4ATBA

Crystal structure of the nf90-nf45 dimerisation domain complex with ctp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
334
structure length
334
Chain Sequence
SHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN ENHANCER-BINDING FACTOR 2
publication title NF45 Dimerizes with NF90, Zfr and Spnr Via a Conserved Domain that Has a Nucleotidyltransferase Fold.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 104
structure length 334
sequence length 334
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07528 DZF DZF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4atbA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4atbA02
2PXIA 4MF8A 4I29A 1WOTA 2ID1A 3C66A 7ICTA 5HC9A 1F5AA 1PX5A 4K9BA 8ICFA 4O5KA 4DO9A 4JWMA 4I2CA 4LZGA 4KLJA 8ICUA 3JPNA 8ICWA 4XQ8A 4M9JA 4UB2A 5J2AA 5DDYA 4UAWA 5HRGA 4DOCA 1R89A 3V7JA 4PHPA 9ICBA 5IIIA 4X4OA 4NXVA 4PPXA 3RJKA 4IQWA 4WC1A 4M9LA 4K4HA 5J2BA 4F5QA 4LEWA 4PH5A 1BPDA 3NYBA 9ICLA 2IHMA 4YMNA 7ICGA 4QZ9A 9ICGA 4M47A 1ZQRA 4LEVA 4RWOA 4XRHA 1YLQA 4WOYA 5J0YA 4QZDA 1ZQXA 5BOMA 4K98A 1ZQMA 2BCVA 4X4NA 4PHAA 4FHVA 7ICSA 7ICEA 4JLXA 8ICZA 4KLSA 7ICVA 1BPBA 1KEJA 1ZQVA 2ISOA 4M04A 3AU6A 3RJHA 4X0BA 4E7XA 5IIOA 4TUPA 4PGXA 4RQ7A 4I28A 4UAYA 2BE3A 4FO6A 5DECA 2BCRA 1ZQAA 4TUSA 4O68A 2NRKA 4X4PA 4UD5A 4YMOA 4X4TA 2ZH1A 2PFPA 3HJ1A 4O67A 9ICWA 4JWNA 4RWQA 4LEYA 1ZQHA 1ZQTA 3C2MA 2GWSA 4AT9A 3PMLA 4GXKA 5DDMA 4DOAA 4WC4A 4YD1A 5J0PA 4IQTA 1TV9A 4RQ2A 3PMNA 4MFAA 4I2DA 1BPYA 1TFYA 5HRIA 5J2HA 4FHWA 3TFRA 2PFNA 3HWTA 4KLOA 2BCUA 4FHXA 5J2DA 4RQ3A 4FHYA 5HRBA 3JPSA 1ZQKA 2I9GA 8ICLA 3LK9A 4MFCA 4YMMA 5HRFA 1NOMA 1ZQIA 7ICMA 1ZQUA 2BCSA 4F5PA 1JQRA 2VANA 8ICJA 7ICFA 3HIYA 4I2JA 1HUOA 1BPEA 4WCWA 3PNCA 4NY8A 4AT8B 1UEUA 5J0TA 4MF2A 4PGQA 4K97A 4NLKA 4K4GA 3H39A 1NO5A 4RWPA 8ICVA 4F5OA 3UPSA 8ICSA 7ICJA 4KLEA 9ICHA 2M2VA 4QZBA 2ZH8A 5EOZA 5DBCA 2ZH5A 4Z6EA 4NXZA 4OAGA 3JPPA 4RQ6A 4R66A 4X4UA 7ICKA 4IG8A 3JPQA 3V7LA 3MDAA 4KLDA 3TFSA 4PGYA 4O5CA 5D46A 3JPRA 3C18A 3L9DA 5J2EA 2DR5A 4DOBA 3MGHA 2DVIA 4QZCA 4QZEA 4KM5A 2DRBA 3WFQE 2ZH3A 4FH5A 2Q66A 4KLLA 3RJIA 1ZQZA 4UB4A 4ATBB 2W9MA 5CWRA 5IIMA 4RQ4A 4GXJA 4I2BA 3C5GA 9ICXA 4TUQA 4WC0A 3MBYA 5J2JA 4WBYA 5DB9A 5J29A 3V7KA 8ICIA 4LT6A 9ICTA 4RWNA 4FH3A 5DEDA 1Q79A 4X5VA 3AU2A 3RH6A 1KDHA 1RZTA 4WBZA 8ICMA 5HRHA 3HW8A 3ISCA 3V72A 8ICQA 4XA5A 9ICNA 3HJ4A 1ZQSA 9ICEA 1UEVA 5IIKA 4KLGA 1R8BA 4RPYA 4M5DA 7ICOA 2ZHAA 8ICOA 4QZAA 1ZJNA 4KLQA 1ZQPA 8ICRA 5TZVA 1MIVA 8ICYA 4P4OA 4UB5A 2ZH7A 4I27A 4KLFA 3RH5A 4AT9B 1BPXA 1ZQBA 4O5EA 4P4MA 5CB1A 4WC3A 4UBCA 8ICKA 4TURA 3WFRE 1KNYA 3RJJA 4M9GA 2BPCA 4AT7A 4RQ5A 4GXIA 3AQNA 9ICUA 4UB3A 1ZQOA 3OUYA 4EBJA 3UXNA 4K4IA 7ICNA 5J2KA 4P2HA 8ICTA 4YN4A 4KLMA 4NKUA 4LZDA 3HX0A 5IINA 4M0AA 3C5FA 1ZQJA 8ICXA 2PFOA 1XSLA 4K99A 1TVAA 4KLHA 1MIYA 4NLZA 3GDXA 8ICBA 7ICQA 5J0UA 4EP7A 4WC6A 3UXPA 2ZH2A 5J0XA 1ZQGA 4XUSA 3C2KA 5D4BA 1JAJA 3WFSC 1Q78A 1R8AA 4EBKA 4KLTA 5J0RA 4X0AA 4QZHA 3C2LA 2ZH6A 4PHDA 2O5AA 8ICHA 3AQLA 1BPZA 3LQCB 4NXTA 4AT8A 1VFGA 4M9HA 4O6AA 9ICIA 2M2TA 5IIJA 4WC7A 1OU5A 3K75D 2PBEA 4E8FA 3OVBA 5J2FA 4RT2A 3JPOA 4FHPA 1ZQQA 3RJGA 4RQ8A 1ZQLA 2M2UA 4E80A 2ISPA 1XSNA 4X4VA 4NXWA 3JYYA 4NM2A 4JLZA 4NXXA 3WFPA 2DR9A 9ICKA 7ICRA 4IQUA 9ICSA 4OAIZ 2BCQA 3AUOA 5DB6A 5J0OA 4I2HA 2BPGA 3JZ0A 5HRDA 4M2YA 3MGIA 9ICCA 2DR8A 4YD2A 4WC5A 5J0WA 4UAZA 9ICMA 9ICQA 8ICCA 5F2VO 5BOLA 3AQMA 4I2FA 7ICUA 4XQ7A 1JN3A 1ZQEA 5J2CA 1MQ2A 3OVSA 2FMQA 4NKTA 4WC2A 1ZQWA 2DR7A 3H37A 4RPXA 1MIWA 2ZHBA 2ZH4A 4ATBA 4KB6A 4K96A 4NXUA 4K9AA 9ICFA 4O9MA 4NM1A 4RQ1A 2FMSA 8ICEA 4M9NA 1RPLA 2RFFA 3UPQA 1ZJMA 4R63A 1ZQFA 3H3AA 3RH4A 1UETA 5CP2A 4I2IA 4KLIA 4F5RA 4KLUA 2HHPA 2P66A 1ZQDA 1ZQYA 1TFWA 5HRKA 9ICRA 3UXOA 3RJEA 9ICPA 3RJFA 8ICAA 4IQVA 1VJ7A 3H38A 1ZQNA 4F5NA 4LVSA 2M2WA 2BPFA 1V4AA 7ICHA 4P4PA 4LEZA 1JMSA 4RQ0A 8ICNA 4Z6CA 8ICGA 4MFFA 5IILA 7ICIA 9ICVA 9ICOA 5CJ7A 4OAHA 4AT7B 5CA7A 3B0YA 5HREA 5CHGA 3AQKA 5DB7A 5HRLA 1XSPA 2DRAA 5CR0A 3OUYB 3OGUA 4OAFA 4Z6DA 2FMPA 4UD4A 3JPTA 3MDCA 1HUZA 5DBBA 4RT3A 4X4SA 4QZFA 4X4RA 4UB1A 4S3NA 1FA0A 4QZIA 3B0XA 4RPZA 5J0SA 4I2EA 5DKWA 4PHEA 4UBBA 4I2AA 1R8CA 1ZQCA 3ISBA 4MKPA 9ICJA 4R65A 5HR9A 5J2IA 5D49A 5BPCA 5HHIA 4K8VA 5DBAA 3UQ2A 9ICAA 7ICLA 7ICPA 4QZ8A 4YCXA 3OVAA 4Z6FA 5J2GA 4O69A 4NLNA 4X4QA 1MQ3A 2O1PA 3ISDA 5J0QA 5HHHA 8ICPA 5DB8A 4QZGA 2ZH9A 3UQ0A 4R64A 2PFQA 4I2GA 3OV7A 3WFOA
chains in the Genus database with same CATH superfamily
2PXIA 4MF8A 4I29A 1WOTA 2ID1A 3C66A 7ICTA 5HC9A 1F5AA 1PX5A 4K9BA 8ICFA 4O5KA 4DO9A 4JWMA 4I2CA 4LZGA 4KLJA 8ICUA 3JPNA 8ICWA 3NVOA 4XQ8A 4M9JA 4UB2A 2EWRA 5J2AA 4WH5A 5DDYA 4UAWA 5HRGA 4DOCA 1R89A 3V7JA 4PHPA 9ICBA 5D63A 5IIIA 4X4OA 4NXVA 4PPXA 3RJKA 4IQWA 4WC1A 5JTGA 4M9LA 4K4HA 5J2BA 4F5QA 4LEWA 4PH5A 1BPDA 3NYBA 9ICLA 3ER9B 2IHMA 4YMNA 7ICGA 4QZ9A 9ICGA 4M47A 1ZQRA 2GAFD 5CHEA 4LEVA 4RWOA 4XRHA 1YLQA 4WOYA 5J0YA 4QZDA 4XJEA 1ZQXA 5BOMA 4K98A 1ZQMA 4X4NA 2BCVA 4PHAA 4FHVA 7ICSA 7ICEA 4JLXA 8ICZA 4KLSA 5CFUA 7ICVA 1BPBA 1KEJA 1ZQVA 2ISOA 4M04A 3AU6A 3RJHA 4X0BA 4E7XA 5IIOA 4TUPA 4PGXA 4RQ7A 3JCFA 4I28A 4I0UA 3K7DA 4UAYA 2BE3A 4FO6A 5DECA 2BCRA 2IUBA 1ZQAA 4TUSA 4O68A 2NRKA 4X4PA 4UD5A 4YMOA 4X4TA 2ZH1A 2PFPA 3HJ1A 4O67A 9ICWA 4JWNA 4RWQA 4LEYA 1ZQHA 1ZQTA 3C2MA 2GWSA 4AT9A 2B56A 3PMLA 4GXKA 5DDMA 4DOAA 4WC4A 3MCRA 4YD1A 5J0PA 4IQTA 1TV9A 4RQ2A 3PMNA 5B3QA 4MFAA 4I2DA 1BPYA 1TFYA 5HRIA 5J2HA 4FHWA 3TFRA 2PFNA 3HWTA 4KLOA 2BCUA 4FHXA 2BBJA 5J2DA 4RQ3A 4FHYA 5HRBA 3JPSA 1ZQKA 2I9GA 8ICLA 3LK9A 4MFCA 2B4VA 4YMMA 5HRFA 1NOMA 1ZQIA 7ICMA 1ZQUA 2BCSA 4F5PA 2HN1A 1JQRA 2VANA 8ICJA 7ICFA 3HIYA 4I2JA 1HUOA 1BPEA 4WCWA 3PNCA 4NY8A 4AT8B 1UEUA 5J0TA 4MF2A 4PGQA 4K97A 4NLKA 4K4GA 3H39A 1NO5A 4RWPA 8ICVA 4F5OA 3UPSA 8ICSA 7ICJA 4KLEA 9ICHA 2M2VA 4QZBA 2ZH8A 5EOZA 2IHOA 5DBCA 2ZH5A 4Z6EA 4NXZA 4OAGA 3CK6A 3JPPA 4RQ6A 4R66A 4X4UA 7ICKA 4IG8A 3JPQA 3V7LA 3MDAA 4KLDA 3TFSA 4PGYA 3ER8C 4O5CA 5D46A 3JPRA 3C18A 3L9DA 2DR5A 5J2EA 4DOBA 3MGHA 2DVIA 4QZCA 4QZEA 4KM5A 2DRBA 3WFQE 2ZH3A 4FH5A 2Q66A 4KLLA 2FCLA 3RJIA 1ZQZA 4UB4A 4ATBB 2W9MA 5CWRA 5IIMA 4RQ4A 4GXJA 4I2BA 3NKUA 3C5GA 9ICXA 4TUQA 4WC0A 3MBYA 5J2JA 4WBYA 5DB9A 5J29A 3V7KA 8ICIA 4LT6A 9ICTA 4RWNA 4FH3A 5DEDA 1Q79A 4X5VA 1GPJA 3AU2A 3RH6A 1KDHA 2GA9D 1RZTA 3ERCC 4WBZA 8ICMA 5HRHA 3HW8A 3ISCA 3V72A 8ICQA 4XA5A 9ICNA 3HJ4A 1ZQSA 9ICEA 1UEVA 5IIKA 4KLGA 1R8BA 4RPYA 4M5DA 7ICOA 2ZHAA 8ICOA 4QZAA 1ZJNA 4KLQA 1ZQPA 8ICRA 5TZVA 1MIVA 4N7RA 8ICYA 4P4OA 4UB5A 2ZH7A 4I27A 4KLFA 3RH5A 4AT9B 1BPXA 1ZQBA 4O5EA 4P4MA 5CB1A 4WC3A 4UBCA 8ICKA 4TURA 3WFRE 4WQKA 1KNYA 3RJJA 4M9GA 2BPCA 4AT7A 4RQ5A 4GXIA 3AQNA 9ICUA 4UB3A 1ZQOA 3OUYA 4EBJA 3UXNA 4K4IA 7ICNA 5J2KA 4P2HA 8ICTA 4YN4A 4NKUA 4KLMA 4LZDA 3HX0A 5IINA 4M0AA 3C5FA 1ZQJA 8ICXA 2PFOA 1XSLA 4K99A 1TVAA 4KLHA 1MIYA 4NLZA 3GDXA 8ICBA 7ICQA 5J0UA 4EP7A 4WC6A 3UXPA 2ZH2A 5J0XA 1ZQGA 3NWIA 4XUSA 3C2KA 3PHZA 5D4BA 1JAJA 3WFSC 1Q78A 1R8AA 4EBKA 4KLTA 5J0RA 4X0AA 4QZHA 3C2LA 2ZH6A 4PHDA 2O5AA 8ICHA 3AQLA 1BPZA 3LQCB 4NXTA 4AT8A 1VFGA 4M9HA 4O6AA 9ICIA 2M2TA 5IIJA 4WC7A 1OU5A 3K75D 3OVBA 4E8FA 2PBEA 5J2FA 4RT2A 3JPOA 4FHPA 1ZQQA 3RJGA 4RQ8A 1ZQLA 2M2UA 4E80A 2ISPA 1XSNA 4X4VA 4EGWA 3WFPA 4NXWA 2DR9A 4JLZA 4NXXA 3JYYA 4NM2A 9ICKA 7ICRA 4IQUA 9ICSA 5D61A 4OAIZ 5CFSA 2BCQA 3AUOA 5DB6A 5J0OA 4I2HA 2BPGA 3JZ0A 5HRDA 4M2YA 3MGIA 9ICCA 2DR8A 4EEBA 4YD2A 4WC5A 3EF2A 5J0WA 4UAZA 5B3PA 9ICMA 9ICQA 8ICCA 5F2VO 5BOLA 3AQMA 4I2FA 7ICUA 4XQ7A 1JN3A 1ZQEA 5J2CA 1MQ2A 3OVSA 2FMQA 4NKTA 2DR7A 1ZQWA 4WC2A 2ZHBA 3H37A 2ZH4A 1MIWA 4RPXA 4ATBA 4KB6A 4K96A 4NXUA 4K9AA 9ICFA 4O9MA 4NM1A 4RQ1A 2FMSA 8ICEA 4M9NA 1RPLA 2RFFA 3UPQA 1ZJMA 4R63A 1ZQFA 3H3AA 3RH4A 1UETA 5CP2A 4I2IA 4KLIA 4F5RA 4KLUA 2HHPA 4EV6A 2P66A 1TFWA 1ZQYA 1ZQDA 5HRKA 9ICRA 3UXOA 3RJEA 9ICPA 4EEDA 3RJFA 8ICAA 4IQVA 1VJ7A 3H38A 1ZQNA 4F5NA 4LVSA 2M2WA 2BPFA 1V4AA 7ICHA 4P4PA 4LEZA 1JMSA 4RQ0A 8ICNA 4Z6CA 8ICGA 4MFFA 5IILA 5CFTA 7ICIA 9ICVA 2B51A 9ICOA 2BBHA 5CJ7A 4OAHA 4AT7B 5CA7A 3B0YA 5HREA 5DB7A 5CHGA 2DRAA 3AQKA 4HX0A 5HRLA 5CR0A 1XSPA 3OUYB 3OGUA 4OAFA 4Z6DA 2FMPA 4UD4A 3JPTA 3MDCA 1HUZA 5DBBA 4RT3A 4X4SA 4X4RA 4QZFA 4UB1A 4S3NA 1FA0A 4WQLA 4QZIA 3B0XA 4RPZA 5J0SA 4I2EA 5DKWA 4PHEA 4UBBA 4I2AA 1R8CA 1ZQCA 3ISBA 4MKPA 9ICJA 4R65A 5HR9A 5J2IA 5D49A 5HHIA 5DBAA 4K8VA 5BPCA 3UQ2A 9ICAA 3OWGA 7ICLA 2HN2A 7ICPA 4QZ8A 4YCXA 3OVAA 4Z6FA 5J2GA 4O69A 4NLNA 4X4QA 1MQ3A 2O1PA 5D62A 3ISDA 5J0QA 5HHHA 8ICPA 5DB8A 4FO1A 2ZH9A 4QZGA 3UQ0A 4R64A 2PFQA 4I2GA 3OV7A 3WFOA
chains in the Genus database with same CATH topology
2PXIA 4MF8A 4I29A 1WOTA 2ID1A 3C66A 7ICTA 5HC9A 1F5AA 1PX5A 4K9BA 8ICFA 4O5KA 4DO9A 4JWMA 4I2CA 4LZGA 4KLJA 8ICUA 3JPNA 8ICWA 4XQ8A 4M9JA 4UB2A 5J2AA 5DDYA 4UAWA 5HRGA 4DOCA 1R89A 3V7JA 4PHPA 9ICBA 5IIIA 4X4OA 4NXVA 4PPXA 3RJKA 4IQWA 4WC1A 4M9LA 4K4HA 5J2BA 4F5QA 4LEWA 4PH5A 1BPDA 3NYBA 9ICLA 2IHMA 4YMNA 7ICGA 4QZ9A 9ICGA 4M47A 1ZQRA 4LEVA 4RWOA 4XRHA 1YLQA 4WOYA 5J0YA 4QZDA 1ZQXA 5BOMA 4K98A 1ZQMA 4X4NA 2BCVA 4PHAA 4FHVA 7ICSA 7ICEA 4JLXA 8ICZA 4KLSA 7ICVA 1BPBA 1KEJA 1ZQVA 2ISOA 4M04A 3AU6A 3RJHA 4X0BA 4E7XA 5IIOA 4TUPA 4PGXA 4RQ7A 4I28A 4UAYA 2BE3A 4FO6A 5DECA 2BCRA 1ZQAA 4TUSA 4O68A 2NRKA 4X4PA 4UD5A 4YMOA 4X4TA 2ZH1A 2PFPA 3HJ1A 4O67A 9ICWA 4JWNA 4RWQA 4LEYA 1ZQHA 1ZQTA 3C2MA 2GWSA 4AT9A 2B56A 3PMLA 4GXKA 5DDMA 4DOAA 4WC4A 4YD1A 5J0PA 4IQTA 1TV9A 4RQ2A 3PMNA 4MFAA 4I2DA 1BPYA 1TFYA 5HRIA 5J2HA 4FHWA 3TFRA 2PFNA 3HWTA 4KLOA 2BCUA 4FHXA 5J2DA 4RQ3A 4FHYA 5HRBA 3JPSA 1ZQKA 2I9GA 8ICLA 3LK9A 4MFCA 2B4VA 4YMMA 5HRFA 1NOMA 1ZQIA 7ICMA 1ZQUA 2BCSA 4F5PA 1JQRA 2VANA 8ICJA 7ICFA 3HIYA 4I2JA 1HUOA 1BPEA 4WCWA 3PNCA 4NY8A 4AT8B 1UEUA 5J0TA 4MF2A 4PGQA 4K97A 4NLKA 4K4GA 3H39A 1NO5A 4RWPA 8ICVA 4F5OA 3UPSA 8ICSA 7ICJA 4KLEA 9ICHA 2M2VA 4QZBA 2ZH8A 5EOZA 5DBCA 2ZH5A 4Z6EA 4NXZA 4OAGA 3JPPA 4RQ6A 4R66A 4X4UA 7ICKA 4IG8A 3JPQA 3V7LA 3MDAA 4KLDA 3TFSA 4PGYA 4O5CA 5D46A 3JPRA 3C18A 3L9DA 5J2EA 2DR5A 4DOBA 3MGHA 2DVIA 4QZCA 4QZEA 4KM5A 2DRBA 3WFQE 2ZH3A 4FH5A 2Q66A 4KLLA 3RJIA 1ZQZA 4UB4A 4ATBB 2W9MA 5CWRA 5IIMA 4RQ4A 4GXJA 4I2BA 3C5GA 9ICXA 4TUQA 4WC0A 3MBYA 5J2JA 4WBYA 5DB9A 5J29A 3V7KA 8ICIA 4LT6A 9ICTA 4RWNA 4FH3A 5DEDA 1Q79A 4X5VA 3AU2A 3RH6A 1KDHA 1RZTA 4WBZA 8ICMA 5HRHA 3HW8A 3ISCA 3V72A 8ICQA 4XA5A 9ICNA 3HJ4A 1ZQSA 9ICEA 1UEVA 5IIKA 4KLGA 1R8BA 4RPYA 4M5DA 7ICOA 2ZHAA 8ICOA 4QZAA 1ZJNA 4KLQA 1ZQPA 8ICRA 5TZVA 1MIVA 8ICYA 4P4OA 4UB5A 2ZH7A 4I27A 4KLFA 3RH5A 4AT9B 1BPXA 1ZQBA 4O5EA 4P4MA 5CB1A 4WC3A 4UBCA 8ICKA 4TURA 3WFRE 1KNYA 3RJJA 4M9GA 2BPCA 4AT7A 4RQ5A 4GXIA 3AQNA 9ICUA 4UB3A 1ZQOA 3OUYA 4EBJA 3UXNA 4K4IA 7ICNA 5J2KA 4P2HA 8ICTA 4YN4A 4NKUA 4KLMA 4LZDA 3HX0A 5IINA 4M0AA 3C5FA 1ZQJA 8ICXA 2PFOA 1XSLA 4K99A 1TVAA 4KLHA 1MIYA 4NLZA 3GDXA 8ICBA 7ICQA 5J0UA 4EP7A 4WC6A 3UXPA 2ZH2A 5J0XA 1ZQGA 4XUSA 3C2KA 5D4BA 1JAJA 3WFSC 1R8AA 1Q78A 4EBKA 4KLTA 5J0RA 4X0AA 4QZHA 3C2LA 2ZH6A 4PHDA 2O5AA 8ICHA 3AQLA 1BPZA 3LQCB 4NXTA 4AT8A 1VFGA 4M9HA 4O6AA 9ICIA 2M2TA 5IIJA 4WC7A 1OU5A 3K75D 3OVBA 4E8FA 2PBEA 5J2FA 4RT2A 3JPOA 4FHPA 1ZQQA 3RJGA 4RQ8A 1ZQLA 2M2UA 4E80A 2ISPA 1XSNA 4X4VA 4NXWA 2DR9A 3JYYA 4JLZA 4NXXA 4NM2A 3WFPA 9ICKA 7ICRA 4IQUA 9ICSA 4OAIZ 2BCQA 3AUOA 5DB6A 5J0OA 4I2HA 2BPGA 3JZ0A 5HRDA 4M2YA 3MGIA 9ICCA 2DR8A 4YD2A 4WC5A 5J0WA 4UAZA 9ICMA 9ICQA 8ICCA 5F2VO 5BOLA 3AQMA 4I2FA 7ICUA 4XQ7A 1JN3A 1ZQEA 5J2CA 1MQ2A 3OVSA 2FMQA 4NKTA 2DR7A 1ZQWA 4WC2A 2ZHBA 3H37A 2ZH4A 1MIWA 4RPXA 4ATBA 4KB6A 4K96A 4NXUA 4K9AA 9ICFA 4O9MA 4NM1A 4RQ1A 2FMSA 8ICEA 4M9NA 1RPLA 2RFFA 3UPQA 1ZJMA 4R63A 1ZQFA 3H3AA 3RH4A 1UETA 5CP2A 4I2IA 4KLIA 4F5RA 4KLUA 2HHPA 2P66A 1TFWA 1ZQYA 1ZQDA 5HRKA 9ICRA 3UXOA 3RJEA 9ICPA 3RJFA 8ICAA 4IQVA 1VJ7A 3H38A 1ZQNA 4F5NA 4LVSA 2M2WA 2BPFA 1V4AA 7ICHA 4P4PA 4LEZA 1JMSA 4RQ0A 8ICNA 4Z6CA 8ICGA 4MFFA 5IILA 7ICIA 9ICVA 2B51A 9ICOA 5CJ7A 4OAHA 4AT7B 5CA7A 3B0YA 5HREA 5CHGA 2DRAA 3AQKA 5HRLA 5DB7A 1XSPA 5CR0A 3OUYB 3OGUA 4OAFA 4Z6DA 2FMPA 4UD4A 3JPTA 3MDCA 1HUZA 5DBBA 4RT3A 4X4SA 4X4RA 4QZFA 4UB1A 4S3NA 1FA0A 4QZIA 3B0XA 4RPZA 5J0SA 4I2EA 5DKWA 4PHEA 4UBBA 4I2AA 1R8CA 1ZQCA 3ISBA 4MKPA 9ICJA 4R65A 5HR9A 5J2IA 5D49A 5BPCA 5DBAA 5HHIA 4K8VA 3UQ2A 9ICAA 7ICLA 7ICPA 4QZ8A 4YCXA 3OVAA 4Z6FA 5J2GA 4O69A 4NLNA 4X4QA 1MQ3A 2O1PA 3ISDA 5J0QA 5HHHA 8ICPA 5DB8A 4QZGA 2ZH9A 3UQ0A 4R64A 2PFQA 4I2GA 3OV7A 3WFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PXI A;  4MF8 A;  4I29 A;  1WOT A;  2ID1 A;  3C66 A;  7ICT A;  5HC9 A;  1F5A A;  1PX5 A;  4K9B A;  8ICF A;  4O5K A;  4DO9 A;  4JWM A;  4I2C A;  4LZG A;  4KLJ A;  8ICU A;  3JPN A;  8ICW A;  4XQ8 A;  4M9J A;  4UB2 A;  5J2A A;  5DDY A;  4UAW A;  5HRG A;  4DOC A;  1R89 A;  3V7J A;  4PHP A;  9ICB A;  5III A;  4X4O A;  4NXV A;  4PPX A;  3RJK A;  4IQW A;  4WC1 A;  4M9L A;  4K4H A;  5J2B A;  4F5Q A;  4LEW A;  4PH5 A;  1BPD A;  3NYB A;  9ICL A;  2IHM A;  4YMN A;  7ICG A;  4QZ9 A;  9ICG A;  4M47 A;  1ZQR A;  4LEV A;  4RWO A;  4XRH A;  1YLQ A;  4WOY A;  5J0Y A;  4QZD A;  1ZQX A;  5BOM A;  4K98 A;  1ZQM A;  2BCV A;  4X4N A;  4PHA A;  4FHV A;  7ICS A;  7ICE A;  4JLX A;  8ICZ A;  4KLS A;  7ICV A;  1BPB A;  1KEJ A;  1ZQV A;  2ISO A;  4M04 A;  3AU6 A;  3RJH A;  4X0B A;  4E7X A;  5IIO A;  4TUP A;  4PGX A;  4RQ7 A;  4I28 A;  4UAY A;  2BE3 A;  4FO6 A;  5DEC A;  2BCR A;  1ZQA A;  4TUS A;  4O68 A;  2NRK A;  4X4P A;  4UD5 A;  4YMO A;  4X4T A;  2ZH1 A;  2PFP A;  3HJ1 A;  4O67 A;  9ICW A;  4JWN A;  4RWQ A;  4LEY A;  1ZQH A;  1ZQT A;  3C2M A;  2GWS A;  4AT9 A;  3PML A;  4GXK A;  5DDM A;  4DOA A;  4WC4 A;  4YD1 A;  5J0P A;  4IQT A;  1TV9 A;  4RQ2 A;  3PMN A;  4MFA A;  4I2D A;  1BPY A;  1TFY A;  5HRI A;  5J2H A;  4FHW A;  3TFR A;  2PFN A;  3HWT A;  4KLO A;  2BCU A;  4FHX A;  5J2D A;  4RQ3 A;  4FHY A;  5HRB A;  3JPS A;  1ZQK A;  2I9G A;  8ICL A;  3LK9 A;  4MFC A;  4YMM A;  5HRF A;  1NOM A;  1ZQI A;  7ICM A;  1ZQU A;  2BCS A;  4F5P A;  1JQR A;  2VAN A;  8ICJ A;  7ICF A;  3HIY A;  4I2J A;  1HUO A;  1BPE A;  4WCW A;  3PNC A;  4NY8 A;  4AT8 B;  1UEU A;  5J0T A;  4MF2 A;  4PGQ A;  4K97 A;  4NLK A;  4K4G A;  3H39 A;  1NO5 A;  4RWP A;  8ICV A;  4F5O A;  3UPS A;  8ICS A;  7ICJ A;  4KLE A;  9ICH A;  2M2V A;  4QZB A;  2ZH8 A;  5EOZ A;  5DBC A;  2ZH5 A;  4Z6E A;  4NXZ A;  4OAG A;  3JPP A;  4RQ6 A;  4R66 A;  4X4U A;  7ICK A;  4IG8 A;  3JPQ A;  3V7L A;  3MDA A;  4KLD A;  3TFS A;  4PGY A;  4O5C A;  5D46 A;  3JPR A;  3C18 A;  3L9D A;  5J2E A;  2DR5 A;  4DOB A;  3MGH A;  2DVI A;  4QZC A;  4QZE A;  4KM5 A;  2DRB A;  3WFQ E;  2ZH3 A;  4FH5 A;  2Q66 A;  4KLL A;  3RJI A;  1ZQZ A;  4UB4 A;  4ATB B;  2W9M A;  5CWR A;  5IIM A;  4RQ4 A;  4GXJ A;  4I2B A;  3C5G A;  9ICX A;  4TUQ A;  4WC0 A;  3MBY A;  5J2J A;  4WBY A;  5DB9 A;  5J29 A;  3V7K A;  8ICI A;  4LT6 A;  9ICT A;  4RWN A;  4FH3 A;  5DED A;  1Q79 A;  4X5V A;  3AU2 A;  3RH6 A;  1KDH A;  1RZT A;  4WBZ A;  8ICM A;  5HRH A;  3HW8 A;  3ISC A;  3V72 A;  8ICQ A;  4XA5 A;  9ICN A;  3HJ4 A;  1ZQS A;  9ICE A;  1UEV A;  5IIK A;  4KLG A;  1R8B A;  4RPY A;  4M5D A;  7ICO A;  2ZHA A;  8ICO A;  4QZA A;  1ZJN A;  4KLQ A;  1ZQP A;  8ICR A;  5TZV A;  1MIV A;  8ICY A;  4P4O A;  4UB5 A;  2ZH7 A;  4I27 A;  4KLF A;  3RH5 A;  4AT9 B;  1BPX A;  1ZQB A;  4O5E A;  4P4M A;  5CB1 A;  4WC3 A;  4UBC A;  8ICK A;  4TUR A;  3WFR E;  1KNY A;  3RJJ A;  4M9G A;  2BPC A;  4AT7 A;  4RQ5 A;  4GXI A;  3AQN A;  9ICU A;  4UB3 A;  1ZQO A;  3OUY A;  4EBJ A;  3UXN A;  4K4I A;  7ICN A;  5J2K A;  4P2H A;  8ICT A;  4YN4 A;  4KLM A;  4NKU A;  4LZD A;  3HX0 A;  5IIN A;  4M0A A;  3C5F A;  1ZQJ A;  8ICX A;  2PFO A;  1XSL A;  4K99 A;  1TVA A;  4KLH A;  1MIY A;  4NLZ A;  3GDX A;  8ICB A;  7ICQ A;  5J0U A;  4EP7 A;  4WC6 A;  3UXP A;  2ZH2 A;  5J0X A;  1ZQG A;  4XUS A;  3C2K A;  5D4B A;  1JAJ A;  3WFS C;  1Q78 A;  1R8A A;  4EBK A;  4KLT A;  5J0R A;  4X0A A;  4QZH A;  3C2L A;  2ZH6 A;  4PHD A;  2O5A A;  8ICH A;  3AQL A;  1BPZ A;  3LQC B;  4NXT A;  4AT8 A;  1VFG A;  4M9H A;  4O6A A;  9ICI A;  2M2T A;  5IIJ A;  4WC7 A;  1OU5 A;  3K75 D;  2PBE A;  4E8F A;  3OVB A;  5J2F A;  4RT2 A;  3JPO A;  4FHP A;  1ZQQ A;  3RJG A;  4RQ8 A;  1ZQL A;  2M2U A;  4E80 A;  2ISP A;  1XSN A;  4X4V A;  4NXW A;  3JYY A;  4NM2 A;  4JLZ A;  4NXX A;  3WFP A;  2DR9 A;  9ICK A;  7ICR A;  4IQU A;  9ICS A;  4OAI Z;  2BCQ A;  3AUO A;  5DB6 A;  5J0O A;  4I2H A;  2BPG A;  3JZ0 A;  5HRD A;  4M2Y A;  3MGI A;  9ICC A;  2DR8 A;  4YD2 A;  4WC5 A;  5J0W A;  4UAZ A;  9ICM A;  9ICQ A;  8ICC A;  5F2V O;  5BOL A;  3AQM A;  4I2F A;  7ICU A;  4XQ7 A;  1JN3 A;  1ZQE A;  5J2C A;  1MQ2 A;  3OVS A;  2FMQ A;  4NKT A;  4WC2 A;  1ZQW A;  2DR7 A;  3H37 A;  4RPX A;  1MIW A;  2ZHB A;  2ZH4 A;  4ATB A;  4KB6 A;  4K96 A;  4NXU A;  4K9A A;  9ICF A;  4O9M A;  4NM1 A;  4RQ1 A;  2FMS A;  8ICE A;  4M9N A;  1RPL A;  2RFF A;  3UPQ A;  1ZJM A;  4R63 A;  1ZQF A;  3H3A A;  3RH4 A;  1UET A;  5CP2 A;  4I2I A;  4KLI A;  4F5R A;  4KLU A;  2HHP A;  2P66 A;  1ZQD A;  1ZQY A;  1TFW A;  5HRK A;  9ICR A;  3UXO A;  3RJE A;  9ICP A;  3RJF A;  8ICA A;  4IQV A;  1VJ7 A;  3H38 A;  1ZQN A;  4F5N A;  4LVS A;  2M2W A;  2BPF A;  1V4A A;  7ICH A;  4P4P A;  4LEZ A;  1JMS A;  4RQ0 A;  8ICN A;  4Z6C A;  8ICG A;  4MFF A;  5IIL A;  7ICI A;  9ICV A;  9ICO A;  5CJ7 A;  4OAH A;  4AT7 B;  5CA7 A;  3B0Y A;  5HRE A;  5CHG A;  3AQK A;  5DB7 A;  5HRL A;  1XSP A;  2DRA A;  5CR0 A;  3OUY B;  3OGU A;  4OAF A;  4Z6D A;  2FMP A;  4UD4 A;  3JPT A;  3MDC A;  1HUZ A;  5DBB A;  4RT3 A;  4X4S A;  4QZF A;  4X4R A;  4UB1 A;  4S3N A;  1FA0 A;  4QZI A;  3B0X A;  4RPZ A;  5J0S A;  4I2E A;  5DKW A;  4PHE A;  4UBB A;  4I2A A;  1R8C A;  1ZQC A;  3ISB A;  4MKP A;  9ICJ A;  4R65 A;  5HR9 A;  5J2I A;  5D49 A;  5BPC A;  5HHI A;  4K8V A;  5DBA A;  3UQ2 A;  9ICA A;  7ICL A;  7ICP A;  4QZ8 A;  4YCX A;  3OVA A;  4Z6F A;  5J2G A;  4O69 A;  4NLN A;  4X4Q A;  1MQ3 A;  2O1P A;  3ISD A;  5J0Q A;  5HHH A;  8ICP A;  5DB8 A;  4QZG A;  2ZH9 A;  3UQ0 A;  4R64 A;  2PFQ A;  4I2G A;  3OV7 A;  3WFO A; 
#chains in the Genus database with same CATH topology
 2PXI A;  4MF8 A;  4I29 A;  1WOT A;  2ID1 A;  3C66 A;  7ICT A;  5HC9 A;  1F5A A;  1PX5 A;  4K9B A;  8ICF A;  4O5K A;  4DO9 A;  4JWM A;  4I2C A;  4LZG A;  4KLJ A;  8ICU A;  3JPN A;  8ICW A;  3NVO A;  4XQ8 A;  4M9J A;  4UB2 A;  2EWR A;  5J2A A;  4WH5 A;  5DDY A;  4UAW A;  5HRG A;  4DOC A;  1R89 A;  3V7J A;  4PHP A;  9ICB A;  5D63 A;  5III A;  4X4O A;  4NXV A;  4PPX A;  3RJK A;  4IQW A;  4WC1 A;  5JTG A;  4M9L A;  4K4H A;  5J2B A;  4F5Q A;  4LEW A;  4PH5 A;  1BPD A;  3NYB A;  9ICL A;  3ER9 B;  2IHM A;  4YMN A;  7ICG A;  4QZ9 A;  9ICG A;  4M47 A;  1ZQR A;  2GAF D;  5CHE A;  4LEV A;  4RWO A;  4XRH A;  1YLQ A;  4WOY A;  5J0Y A;  4QZD A;  4XJE A;  1ZQX A;  5BOM A;  4K98 A;  1ZQM A;  4X4N A;  2BCV A;  4PHA A;  4FHV A;  7ICS A;  7ICE A;  4JLX A;  8ICZ A;  4KLS A;  5CFU A;  7ICV A;  1BPB A;  1KEJ A;  1ZQV A;  2ISO A;  4M04 A;  3AU6 A;  3RJH A;  4X0B A;  4E7X A;  5IIO A;  4TUP A;  4PGX A;  4RQ7 A;  3JCF A;  4I28 A;  4I0U A;  3K7D A;  4UAY A;  2BE3 A;  4FO6 A;  5DEC A;  2BCR A;  2IUB A;  1ZQA A;  4TUS A;  4O68 A;  2NRK A;  4X4P A;  4UD5 A;  4YMO A;  4X4T A;  2ZH1 A;  2PFP A;  3HJ1 A;  4O67 A;  9ICW A;  4JWN A;  4RWQ A;  4LEY A;  1ZQH A;  1ZQT A;  3C2M A;  2GWS A;  4AT9 A;  2B56 A;  3PML A;  4GXK A;  5DDM A;  4DOA A;  4WC4 A;  3MCR A;  4YD1 A;  5J0P A;  4IQT A;  1TV9 A;  4RQ2 A;  3PMN A;  5B3Q A;  4MFA A;  4I2D A;  1BPY A;  1TFY A;  5HRI A;  5J2H A;  4FHW A;  3TFR A;  2PFN A;  3HWT A;  4KLO A;  2BCU A;  4FHX A;  2BBJ A;  5J2D A;  4RQ3 A;  4FHY A;  5HRB A;  3JPS A;  1ZQK A;  2I9G A;  8ICL A;  3LK9 A;  4MFC A;  2B4V A;  4YMM A;  5HRF A;  1NOM A;  1ZQI A;  7ICM A;  1ZQU A;  2BCS A;  4F5P A;  2HN1 A;  1JQR A;  2VAN A;  8ICJ A;  7ICF A;  3HIY A;  4I2J A;  1HUO A;  1BPE A;  4WCW A;  3PNC A;  4NY8 A;  4AT8 B;  1UEU A;  5J0T A;  4MF2 A;  4PGQ A;  4K97 A;  4NLK A;  4K4G A;  3H39 A;  1NO5 A;  4RWP A;  8ICV A;  4F5O A;  3UPS A;  8ICS A;  7ICJ A;  4KLE A;  9ICH A;  2M2V A;  4QZB A;  2ZH8 A;  5EOZ A;  2IHO A;  5DBC A;  2ZH5 A;  4Z6E A;  4NXZ A;  4OAG A;  3CK6 A;  3JPP A;  4RQ6 A;  4R66 A;  4X4U A;  7ICK A;  4IG8 A;  3JPQ A;  3V7L A;  3MDA A;  4KLD A;  3TFS A;  4PGY A;  3ER8 C;  4O5C A;  5D46 A;  3JPR A;  3C18 A;  3L9D A;  2DR5 A;  5J2E A;  4DOB A;  3MGH A;  2DVI A;  4QZC A;  4QZE A;  4KM5 A;  2DRB A;  3WFQ E;  2ZH3 A;  4FH5 A;  2Q66 A;  4KLL A;  2FCL A;  3RJI A;  1ZQZ A;  4UB4 A;  4ATB B;  2W9M A;  5CWR A;  5IIM A;  4RQ4 A;  4GXJ A;  4I2B A;  3NKU A;  3C5G A;  9ICX A;  4TUQ A;  4WC0 A;  3MBY A;  5J2J A;  4WBY A;  5DB9 A;  5J29 A;  3V7K A;  8ICI A;  4LT6 A;  9ICT A;  4RWN A;  4FH3 A;  5DED A;  1Q79 A;  4X5V A;  1GPJ A;  3AU2 A;  3RH6 A;  1KDH A;  2GA9 D;  1RZT A;  3ERC C;  4WBZ A;  8ICM A;  5HRH A;  3HW8 A;  3ISC A;  3V72 A;  8ICQ A;  4XA5 A;  9ICN A;  3HJ4 A;  1ZQS A;  9ICE A;  1UEV A;  5IIK A;  4KLG A;  1R8B A;  4RPY A;  4M5D A;  7ICO A;  2ZHA A;  8ICO A;  4QZA A;  1ZJN A;  4KLQ A;  1ZQP A;  8ICR A;  5TZV A;  1MIV A;  4N7R A;  8ICY A;  4P4O A;  4UB5 A;  2ZH7 A;  4I27 A;  4KLF A;  3RH5 A;  4AT9 B;  1BPX A;  1ZQB A;  4O5E A;  4P4M A;  5CB1 A;  4WC3 A;  4UBC A;  8ICK A;  4TUR A;  3WFR E;  4WQK A;  1KNY A;  3RJJ A;  4M9G A;  2BPC A;  4AT7 A;  4RQ5 A;  4GXI A;  3AQN A;  9ICU A;  4UB3 A;  1ZQO A;  3OUY A;  4EBJ A;  3UXN A;  4K4I A;  7ICN A;  5J2K A;  4P2H A;  8ICT A;  4YN4 A;  4NKU A;  4KLM A;  4LZD A;  3HX0 A;  5IIN A;  4M0A A;  3C5F A;  1ZQJ A;  8ICX A;  2PFO A;  1XSL A;  4K99 A;  1TVA A;  4KLH A;  1MIY A;  4NLZ A;  3GDX A;  8ICB A;  7ICQ A;  5J0U A;  4EP7 A;  4WC6 A;  3UXP A;  2ZH2 A;  5J0X A;  1ZQG A;  3NWI A;  4XUS A;  3C2K A;  3PHZ A;  5D4B A;  1JAJ A;  3WFS C;  1Q78 A;  1R8A A;  4EBK A;  4KLT A;  5J0R A;  4X0A A;  4QZH A;  3C2L A;  2ZH6 A;  4PHD A;  2O5A A;  8ICH A;  3AQL A;  1BPZ A;  3LQC B;  4NXT A;  4AT8 A;  1VFG A;  4M9H A;  4O6A A;  9ICI A;  2M2T A;  5IIJ A;  4WC7 A;  1OU5 A;  3K75 D;  3OVB A;  4E8F A;  2PBE A;  5J2F A;  4RT2 A;  3JPO A;  4FHP A;  1ZQQ A;  3RJG A;  4RQ8 A;  1ZQL A;  2M2U A;  4E80 A;  2ISP A;  1XSN A;  4X4V A;  4EGW A;  3WFP A;  4NXW A;  2DR9 A;  4JLZ A;  4NXX A;  3JYY A;  4NM2 A;  9ICK A;  7ICR A;  4IQU A;  9ICS A;  5D61 A;  4OAI Z;  5CFS A;  2BCQ A;  3AUO A;  5DB6 A;  5J0O A;  4I2H A;  2BPG A;  3JZ0 A;  5HRD A;  4M2Y A;  3MGI A;  9ICC A;  2DR8 A;  4EEB A;  4YD2 A;  4WC5 A;  3EF2 A;  5J0W A;  4UAZ A;  5B3P A;  9ICM A;  9ICQ A;  8ICC A;  5F2V O;  5BOL A;  3AQM A;  4I2F A;  7ICU A;  4XQ7 A;  1JN3 A;  1ZQE A;  5J2C A;  1MQ2 A;  3OVS A;  2FMQ A;  4NKT A;  2DR7 A;  1ZQW A;  4WC2 A;  2ZHB A;  3H37 A;  2ZH4 A;  1MIW A;  4RPX A;  4ATB A;  4KB6 A;  4K96 A;  4NXU A;  4K9A A;  9ICF A;  4O9M A;  4NM1 A;  4RQ1 A;  2FMS A;  8ICE A;  4M9N A;  1RPL A;  2RFF A;  3UPQ A;  1ZJM A;  4R63 A;  1ZQF A;  3H3A A;  3RH4 A;  1UET A;  5CP2 A;  4I2I A;  4KLI A;  4F5R A;  4KLU A;  2HHP A;  4EV6 A;  2P66 A;  1TFW A;  1ZQY A;  1ZQD A;  5HRK A;  9ICR A;  3UXO A;  3RJE A;  9ICP A;  4EED A;  3RJF A;  8ICA A;  4IQV A;  1VJ7 A;  3H38 A;  1ZQN A;  4F5N A;  4LVS A;  2M2W A;  2BPF A;  1V4A A;  7ICH A;  4P4P A;  4LEZ A;  1JMS A;  4RQ0 A;  8ICN A;  4Z6C A;  8ICG A;  4MFF A;  5IIL A;  5CFT A;  7ICI A;  9ICV A;  2B51 A;  9ICO A;  2BBH A;  5CJ7 A;  4OAH A;  4AT7 B;  5CA7 A;  3B0Y A;  5HRE A;  5DB7 A;  5CHG A;  2DRA A;  3AQK A;  4HX0 A;  5HRL A;  5CR0 A;  1XSP A;  3OUY B;  3OGU A;  4OAF A;  4Z6D A;  2FMP A;  4UD4 A;  3JPT A;  3MDC A;  1HUZ A;  5DBB A;  4RT3 A;  4X4S A;  4X4R A;  4QZF A;  4UB1 A;  4S3N A;  1FA0 A;  4WQL A;  4QZI A;  3B0X A;  4RPZ A;  5J0S A;  4I2E A;  5DKW A;  4PHE A;  4UBB A;  4I2A A;  1R8C A;  1ZQC A;  3ISB A;  4MKP A;  9ICJ A;  4R65 A;  5HR9 A;  5J2I A;  5D49 A;  5HHI A;  5DBA A;  4K8V A;  5BPC A;  3UQ2 A;  9ICA A;  3OWG A;  7ICL A;  2HN2 A;  7ICP A;  4QZ8 A;  4YCX A;  3OVA A;  4Z6F A;  5J2G A;  4O69 A;  4NLN A;  4X4Q A;  1MQ3 A;  2O1P A;  5D62 A;  3ISD A;  5J0Q A;  5HHH A;  8ICP A;  5DB8 A;  4FO1 A;  2ZH9 A;  4QZG A;  3UQ0 A;  4R64 A;  2PFQ A;  4I2G A;  3OV7 A;  3WFO A; 
#chains in the Genus database with same CATH homology
 2PXI A;  4MF8 A;  4I29 A;  1WOT A;  2ID1 A;  3C66 A;  7ICT A;  5HC9 A;  1F5A A;  1PX5 A;  4K9B A;  8ICF A;  4O5K A;  4DO9 A;  4JWM A;  4I2C A;  4LZG A;  4KLJ A;  8ICU A;  3JPN A;  8ICW A;  4XQ8 A;  4M9J A;  4UB2 A;  5J2A A;  5DDY A;  4UAW A;  5HRG A;  4DOC A;  1R89 A;  3V7J A;  4PHP A;  9ICB A;  5III A;  4X4O A;  4NXV A;  4PPX A;  3RJK A;  4IQW A;  4WC1 A;  4M9L A;  4K4H A;  5J2B A;  4F5Q A;  4LEW A;  4PH5 A;  1BPD A;  3NYB A;  9ICL A;  2IHM A;  4YMN A;  7ICG A;  4QZ9 A;  9ICG A;  4M47 A;  1ZQR A;  4LEV A;  4RWO A;  4XRH A;  1YLQ A;  4WOY A;  5J0Y A;  4QZD A;  1ZQX A;  5BOM A;  4K98 A;  1ZQM A;  4X4N A;  2BCV A;  4PHA A;  4FHV A;  7ICS A;  7ICE A;  4JLX A;  8ICZ A;  4KLS A;  7ICV A;  1BPB A;  1KEJ A;  1ZQV A;  2ISO A;  4M04 A;  3AU6 A;  3RJH A;  4X0B A;  4E7X A;  5IIO A;  4TUP A;  4PGX A;  4RQ7 A;  4I28 A;  4UAY A;  2BE3 A;  4FO6 A;  5DEC A;  2BCR A;  1ZQA A;  4TUS A;  4O68 A;  2NRK A;  4X4P A;  4UD5 A;  4YMO A;  4X4T A;  2ZH1 A;  2PFP A;  3HJ1 A;  4O67 A;  9ICW A;  4JWN A;  4RWQ A;  4LEY A;  1ZQH A;  1ZQT A;  3C2M A;  2GWS A;  4AT9 A;  2B56 A;  3PML A;  4GXK A;  5DDM A;  4DOA A;  4WC4 A;  4YD1 A;  5J0P A;  4IQT A;  1TV9 A;  4RQ2 A;  3PMN A;  4MFA A;  4I2D A;  1BPY A;  1TFY A;  5HRI A;  5J2H A;  4FHW A;  3TFR A;  2PFN A;  3HWT A;  4KLO A;  2BCU A;  4FHX A;  5J2D A;  4RQ3 A;  4FHY A;  5HRB A;  3JPS A;  1ZQK A;  2I9G A;  8ICL A;  3LK9 A;  4MFC A;  2B4V A;  4YMM A;  5HRF A;  1NOM A;  1ZQI A;  7ICM A;  1ZQU A;  2BCS A;  4F5P A;  1JQR A;  2VAN A;  8ICJ A;  7ICF A;  3HIY A;  4I2J A;  1HUO A;  1BPE A;  4WCW A;  3PNC A;  4NY8 A;  4AT8 B;  1UEU A;  5J0T A;  4MF2 A;  4PGQ A;  4K97 A;  4NLK A;  4K4G A;  3H39 A;  1NO5 A;  4RWP A;  8ICV A;  4F5O A;  3UPS A;  8ICS A;  7ICJ A;  4KLE A;  9ICH A;  2M2V A;  4QZB A;  2ZH8 A;  5EOZ A;  5DBC A;  2ZH5 A;  4Z6E A;  4NXZ A;  4OAG A;  3JPP A;  4RQ6 A;  4R66 A;  4X4U A;  7ICK A;  4IG8 A;  3JPQ A;  3V7L A;  3MDA A;  4KLD A;  3TFS A;  4PGY A;  4O5C A;  5D46 A;  3JPR A;  3C18 A;  3L9D A;  5J2E A;  2DR5 A;  4DOB A;  3MGH A;  2DVI A;  4QZC A;  4QZE A;  4KM5 A;  2DRB A;  3WFQ E;  2ZH3 A;  4FH5 A;  2Q66 A;  4KLL A;  3RJI A;  1ZQZ A;  4UB4 A;  4ATB B;  2W9M A;  5CWR A;  5IIM A;  4RQ4 A;  4GXJ A;  4I2B A;  3C5G A;  9ICX A;  4TUQ A;  4WC0 A;  3MBY A;  5J2J A;  4WBY A;  5DB9 A;  5J29 A;  3V7K A;  8ICI A;  4LT6 A;  9ICT A;  4RWN A;  4FH3 A;  5DED A;  1Q79 A;  4X5V A;  3AU2 A;  3RH6 A;  1KDH A;  1RZT A;  4WBZ A;  8ICM A;  5HRH A;  3HW8 A;  3ISC A;  3V72 A;  8ICQ A;  4XA5 A;  9ICN A;  3HJ4 A;  1ZQS A;  9ICE A;  1UEV A;  5IIK A;  4KLG A;  1R8B A;  4RPY A;  4M5D A;  7ICO A;  2ZHA A;  8ICO A;  4QZA A;  1ZJN A;  4KLQ A;  1ZQP A;  8ICR A;  5TZV A;  1MIV A;  8ICY A;  4P4O A;  4UB5 A;  2ZH7 A;  4I27 A;  4KLF A;  3RH5 A;  4AT9 B;  1BPX A;  1ZQB A;  4O5E A;  4P4M A;  5CB1 A;  4WC3 A;  4UBC A;  8ICK A;  4TUR A;  3WFR E;  1KNY A;  3RJJ A;  4M9G A;  2BPC A;  4AT7 A;  4RQ5 A;  4GXI A;  3AQN A;  9ICU A;  4UB3 A;  1ZQO A;  3OUY A;  4EBJ A;  3UXN A;  4K4I A;  7ICN A;  5J2K A;  4P2H A;  8ICT A;  4YN4 A;  4NKU A;  4KLM A;  4LZD A;  3HX0 A;  5IIN A;  4M0A A;  3C5F A;  1ZQJ A;  8ICX A;  2PFO A;  1XSL A;  4K99 A;  1TVA A;  4KLH A;  1MIY A;  4NLZ A;  3GDX A;  8ICB A;  7ICQ A;  5J0U A;  4EP7 A;  4WC6 A;  3UXP A;  2ZH2 A;  5J0X A;  1ZQG A;  4XUS A;  3C2K A;  5D4B A;  1JAJ A;  3WFS C;  1R8A A;  1Q78 A;  4EBK A;  4KLT A;  5J0R A;  4X0A A;  4QZH A;  3C2L A;  2ZH6 A;  4PHD A;  2O5A A;  8ICH A;  3AQL A;  1BPZ A;  3LQC B;  4NXT A;  4AT8 A;  1VFG A;  4M9H A;  4O6A A;  9ICI A;  2M2T A;  5IIJ A;  4WC7 A;  1OU5 A;  3K75 D;  3OVB A;  4E8F A;  2PBE A;  5J2F A;  4RT2 A;  3JPO A;  4FHP A;  1ZQQ A;  3RJG A;  4RQ8 A;  1ZQL A;  2M2U A;  4E80 A;  2ISP A;  1XSN A;  4X4V A;  4NXW A;  2DR9 A;  3JYY A;  4JLZ A;  4NXX A;  4NM2 A;  3WFP A;  9ICK A;  7ICR A;  4IQU A;  9ICS A;  4OAI Z;  2BCQ A;  3AUO A;  5DB6 A;  5J0O A;  4I2H A;  2BPG A;  3JZ0 A;  5HRD A;  4M2Y A;  3MGI A;  9ICC A;  2DR8 A;  4YD2 A;  4WC5 A;  5J0W A;  4UAZ A;  9ICM A;  9ICQ A;  8ICC A;  5F2V O;  5BOL A;  3AQM A;  4I2F A;  7ICU A;  4XQ7 A;  1JN3 A;  1ZQE A;  5J2C A;  1MQ2 A;  3OVS A;  2FMQ A;  4NKT A;  2DR7 A;  1ZQW A;  4WC2 A;  2ZHB A;  3H37 A;  2ZH4 A;  1MIW A;  4RPX A;  4ATB A;  4KB6 A;  4K96 A;  4NXU A;  4K9A A;  9ICF A;  4O9M A;  4NM1 A;  4RQ1 A;  2FMS A;  8ICE A;  4M9N A;  1RPL A;  2RFF A;  3UPQ A;  1ZJM A;  4R63 A;  1ZQF A;  3H3A A;  3RH4 A;  1UET A;  5CP2 A;  4I2I A;  4KLI A;  4F5R A;  4KLU A;  2HHP A;  2P66 A;  1TFW A;  1ZQY A;  1ZQD A;  5HRK A;  9ICR A;  3UXO A;  3RJE A;  9ICP A;  3RJF A;  8ICA A;  4IQV A;  1VJ7 A;  3H38 A;  1ZQN A;  4F5N A;  4LVS A;  2M2W A;  2BPF A;  1V4A A;  7ICH A;  4P4P A;  4LEZ A;  1JMS A;  4RQ0 A;  8ICN A;  4Z6C A;  8ICG A;  4MFF A;  5IIL A;  7ICI A;  9ICV A;  2B51 A;  9ICO A;  5CJ7 A;  4OAH A;  4AT7 B;  5CA7 A;  3B0Y A;  5HRE A;  5CHG A;  2DRA A;  3AQK A;  5HRL A;  5DB7 A;  1XSP A;  5CR0 A;  3OUY B;  3OGU A;  4OAF A;  4Z6D A;  2FMP A;  4UD4 A;  3JPT A;  3MDC A;  1HUZ A;  5DBB A;  4RT3 A;  4X4S A;  4X4R A;  4QZF A;  4UB1 A;  4S3N A;  1FA0 A;  4QZI A;  3B0X A;  4RPZ A;  5J0S A;  4I2E A;  5DKW A;  4PHE A;  4UBB A;  4I2A A;  1R8C A;  1ZQC A;  3ISB A;  4MKP A;  9ICJ A;  4R65 A;  5HR9 A;  5J2I A;  5D49 A;  5BPC A;  5DBA A;  5HHI A;  4K8V A;  3UQ2 A;  9ICA A;  7ICL A;  7ICP A;  4QZ8 A;  4YCX A;  3OVA A;  4Z6F A;  5J2G A;  4O69 A;  4NLN A;  4X4Q A;  1MQ3 A;  2O1P A;  3ISD A;  5J0Q A;  5HHH A;  8ICP A;  5DB8 A;  4QZG A;  2ZH9 A;  3UQ0 A;  4R64 A;  2PFQ A;  4I2G A;  3OV7 A;  3WFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...