4ATBA

Crystal structure of the nf90-nf45 dimerisation domain complex with ctp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
334
structure length
334
Chain Sequence
SHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NF45 Dimerizes with NF90, Zfr and Spnr Via a Conserved Domain that Has a Nucleotidyltransferase Fold.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords INTERLEUKIN ENHANCER-BINDING FACTOR 2
total genus 104
structure length 334
sequence length 334
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07528 DZF DZF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4atbA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4atbA02
4IQTA 4UBCA 3AQLA 2BCSA 4I2BA 3GDXA 4RQ7A 8ICQA 5DBCA 4I2HA 4ATBA 5J2CA 3AUOA 1ZQTA 8ICNA 3LQCB 4JWMA 3JPTA 3JPQA 5EOZA 4RQ1A 5CB1A 7ICHA 9ICTA 8ICTA 3V7JA 2ZH6A 5CJ7A 1Q78A 2Q66A 1R8AA 1MIYA 4UD5A 3UXPA 9ICKA 2FMPA 2I9GA 3RJHA 5IIIA 4M9LA 4KLTA 4QZAA 5J0TA 4GXKA 4X0BA 1KEJA 8ICBA 3C5GA 4GXJA 8ICZA 3OGUA 3MDCA 1R8CA 7ICJA 4R66A 5DB6A 2BCUA 4KLEA 1JMSA 4QZDA 2ISPA 3HW8A 2ISOA 4E7XA 4I27A 4M9GA 3MGHA 3K75D 4AT7B 4I2JA 1ZQUA 1XSNA 1V4AA 5J2DA 3OVBA 4KLSA 4X4VA 4I2CA 4WC2A 2DR8A 4NKTA 4XRHA 9ICIA 3PMLA 4NXXA 7ICLA 4KLFA 4UB3A 1ZQSA 4X4TA 3WFQE 5J0PA 4LEVA 4F5RA 1ZQPA 1ZQKA 4F5OA 4M9HA 5HR9A 3JPRA 4RQ2A 3JPPA 5BPCA 5J0SA 1ZQHA 8ICAA 4O9MA 2P66A 1UETA 5TZVA 5D4BA 4NY8A 1BPXA 4RT2A 1NOMA 4FHWA 7ICOA 2ZH4A 1VFGA 2BPCA 4NXWA 3L9DA 4KLOA 1R8BA 3OVAA 4QZCA 3WFPA 4ATBB 4WC0A 4OAHA 4RWOA 2ZH2A 4WOYA 5DBAA 4MFAA 4UB1A 4X0AA 4DOCA 8ICFA 4NXUA 4M9NA 4WC5A 5CWRA 4NXTA 7ICEA 9ICXA 4X4PA 1F5AA 3UXOA 2DRAA 4E80A 1KDHA 4R64A 2BCVA 4PHPA 8ICPA 5D49A 3OUYB 3V7LA 4M5DA 4P4PA 4E8FA 5DKWA 3H39A 5DB9A 1MQ2A 4NLZA 4UB4A 4XA5A 4MF8A 3H38A 7ICUA 2BCRA 8ICVA 3HX0A 4JLXA 3JYYA 3AU6A 3UQ2A 4KLGA 3B0YA 9ICVA 3HJ4A 1ZQNA 1JN3A 4FHYA 2M2WA 5J2KA 1WOTA 3UXNA 4LZDA 8ICRA 5HRHA 1RZTA 4JLZA 2PFNA 4Z6EA 4O5EA 4R63A 1ZQGA 1ZQDA 4JWNA 5J0XA 3MDAA 8ICKA 4FH5A 1ZQQA 7ICKA 5HRBA 1JAJA 8ICXA 2BPGA 1HUZA 5F2VO 4RT3A 4QZHA 4RQ4A 7ICVA 4UB2A 1TFWA 5J2HA 3HJ1A 4PHEA 4MKPA 1ZJMA 3RJGA 7ICGA 2W9MA 5DB7A 1ZJNA 4KLHA 9ICFA 3AQNA 3C2KA 3TFSA 3AQMA 1MQ3A 4K8VA 7ICPA 1MIWA 1PX5A 2ZH1A 4Z6DA 4K4IA 5HRLA 2ZH8A 2PFOA 4M2YA 4AT9B 4DOAA 5J0YA 1ZQYA 4RQ0A 1BPEA 9ICUA 3PMNA 4WC6A 3UQ0A 4O6AA 5D46A 1ZQZA 1VJ7A 4FH3A 4I29A 2ZH5A 4NM1A 1TFYA 1ZQIA 3RJEA 9ICMA 2ZHBA 1JQRA 4QZBA 2BCQA 4RWPA 3UPSA 4EBKA 4YD2A 4RPYA 5BOLA 3V72A 5HRFA 5HRDA 5DECA 3HIYA 4QZEA 5J0OA 1RPLA 4Z6CA 4WC4A 9ICSA 3RH4A 4I2GA 8ICGA 4X4OA 4RWNA 5CHGA 4P2HA 8ICJA 8ICUA 5DDMA 4WC7A 4K4GA 4O5KA 5DEDA 4TUPA 4YMMA 1ZQCA 8ICYA 5CR0A 1HUOA 8ICHA 4OAIZ 3B0XA 4QZ9A 4I2EA 4PHDA 4NLNA 4QZFA 4OAFA 4XQ8A 4DOBA 4K96A 4PGXA 1R89A 8ICSA 3C2LA 9ICJA 4I2AA 3AU2A 4WCWA 2PFQA 4AT8B 4RQ6A 4MF2A 9ICGA 4S3NA 2FMQA 4I2IA 3RJFA 4RQ8A 4UD4A 5IIOA 4I28A 4O5CA 2M2UA 3RH5A 1BPDA 4NXZA 9ICPA 3RJJA 4WC1A 4UAWA 1ZQMA 4O68A 3LK9A 4YD1A 7ICNA 5IILA 1ZQBA 4YMNA 4K99A 3WFOA 4RQ5A 2DR5A 4KLJA 3C18A 1YLQA 9ICNA 4K97A 4NM2A 7ICIA 4TUSA 4WBYA 4O69A 2ZH3A 4MFFA 4KLQA 2PXIA 9ICRA 3C2MA 4PH5A 5IIJA 4F5QA 2GWSA 5HHIA 4X4UA 4KM5A 4IQUA 3UPQA 4QZGA 4LVSA 2O1PA 2RFFA 3AQKA 4IQVA 2DRBA 4TUQA 4LEYA 4UB5A 2PFPA 4I2DA 3WFSC 5CP2A 4R65A 1ZQWA 4M9JA 4M04A 2VANA 1ZQXA 3JPSA 9ICLA 5J2JA 5DB8A 3RH6A 1BPYA 5J0WA 5J2EA 1ZQJA 1ZQAA 4P4MA 4K98A 4YMOA 3H37A 3OUYA 9ICBA 4WBZA 2ZH7A 5IIKA 1ZQVA 4PPXA 5DBBA 2FMSA 4LZGA 4IG8A 3C5FA 2ZHAA 4P4OA 4FHVA 5J2BA 5J2AA 7ICTA 1MIVA 5J2GA 2ID1A 4M0AA 1UEUA 4X4NA 1ZQFA 4K9BA 2PBEA 4PHAA 5HHHA 5J2IA 4XUSA 1XSPA 3PNCA 4X4RA 5HRKA 1ZQLA 2ZH9A 5BOMA 9ICEA 4NXVA 8ICIA 1OU5A 8ICCA 4XQ7A 4K9AA 4GXIA 2DR7A 5HREA 4KLDA 3JPOA 1ZQOA 4EBJA 1ZQEA 4NLKA 4DO9A 1BPBA 4RWQA 4RPXA 5J0RA 4FHXA 3MBYA 4LT6A 4X4SA 2DVIA 9ICCA 9ICHA 3MGIA 5IINA 4QZ8A 3RJIA 2BE3A 2BPFA 4WC3A 4NKUA 5J29A 4QZIA 1BPZA 3JPNA 4KLIA 1TV9A 2M2VA 3ISDA 5DDYA 4TURA 8ICMA 4UAYA 4K4HA 1ZQRA 5J0UA 2DR9A 9ICWA 9ICQA 5HRIA 4IQWA 1FA0A 3NYBA 5IIMA 9ICAA 4OAGA 4PGYA 4AT7A 7ICQA 4KLLA 4Z6FA 3OV7A 1Q79A 4EP7A 3JZ0A 3C66A 3HWTA 4O67A 5HRGA 4UAZA 4KLUA 4F5PA 4PGQA 4FO6A 4I2FA 4MFCA 9ICOA 4KB6A 1NO5A 8ICOA 7ICFA 8ICWA 3WFRE 4AT9A 4KLMA 3OVSA 4RQ3A 3V7KA 4F5NA 1KNYA 1UEVA 4X5VA 4FHPA 5CA7A 1TVAA 2M2TA 2IHMA 4YN4A 4X4QA 7ICSA 3TFRA 3H3AA 5J2FA 7ICMA 2O5AA 7ICRA 2NRKA 5J0QA 3ISBA 8ICLA 3RJKA 3ISCA 4M47A 4LEWA 4RPZA 5HC9A 4AT8A 2HHPA 8ICEA 4LEZA 4UBBA 1XSLA 4YCXA
chains in the Genus database with same CATH superfamily
4IQTA 4UBCA 3AQLA 2BCSA 4I2BA 3GDXA 4RQ7A 8ICQA 5DBCA 4I2HA 4ATBA 5J2CA 3AUOA 1ZQTA 8ICNA 3LQCB 4JWMA 3JPTA 5EOZA 3JPQA 4RQ1A 5CB1A 7ICHA 9ICTA 2HN2A 8ICTA 3V7JA 2ZH6A 2Q66A 1Q78A 5CJ7A 1R8AA 1MIYA 4UD5A 3UXPA 9ICKA 2FMPA 2I9GA 3RJHA 2HN1A 5IIIA 4M9LA 4KLTA 4QZAA 5J0TA 4GXKA 4X0BA 1KEJA 8ICBA 3C5GA 4GXJA 8ICZA 3OGUA 3MDCA 1R8CA 7ICJA 4R66A 5DB6A 2BCUA 4KLEA 1JMSA 4QZDA 2ISPA 4EGWA 3HW8A 2ISOA 4E7XA 4I27A 4M9GA 3MGHA 2GA9D 3K75D 2B4VA 4AT7B 4I2JA 1ZQUA 1XSNA 1V4AA 3OVBA 4WQKA 5J2DA 4KLSA 4X4VA 5D63A 4I2CA 4XJEA 4WC2A 2DR8A 4NKTA 4N7RA 4XRHA 9ICIA 3PMLA 4NXXA 7ICLA 4KLFA 4UB3A 3NKUA 1ZQSA 4X4TA 3WFQE 5J0PA 4LEVA 4F5RA 1ZQPA 1ZQKA 4F5OA 4M9HA 5HR9A 3JPRA 4RQ2A 3JPPA 3EF2A 5BPCA 5J0SA 1ZQHA 8ICAA 4O9MA 2P66A 1UETA 5TZVA 5D4BA 4NY8A 1BPXA 4RT2A 1NOMA 4FHWA 5CFSA 7ICOA 2ZH4A 1VFGA 2BPCA 4NXWA 3L9DA 4KLOA 1R8BA 3OVAA 4QZCA 3WFPA 4ATBB 4WC0A 4OAHA 4RWOA 2ZH2A 4WOYA 5DBAA 4MFAA 4UB1A 4X0AA 4DOCA 8ICFA 4NXUA 4M9NA 4WC5A 3MCRA 5CWRA 4NXTA 7ICEA 9ICXA 4X4PA 1F5AA 2DRAA 3UXOA 4E80A 1KDHA 4R64A 2BCVA 2B56A 4PHPA 8ICPA 5D49A 3OUYB 3V7LA 4M5DA 4P4PA 4E8FA 5DKWA 3H39A 5DB9A 1MQ2A 4NLZA 4UB4A 4XA5A 4MF8A 2B51A 3H38A 7ICUA 2BCRA 8ICVA 2IHOA 3HX0A 4JLXA 3JYYA 3AU6A 3UQ2A 4KLGA 3B0YA 9ICVA 3HJ4A 1ZQNA 1JN3A 4FHYA 2M2WA 5J2KA 1WOTA 3UXNA 4LZDA 8ICRA 5HRHA 1RZTA 4JLZA 2PFNA 4Z6EA 4O5EA 4R63A 1ZQGA 1ZQDA 4JWNA 5J0XA 3MDAA 8ICKA 4FH5A 1ZQQA 7ICKA 4EEDA 5HRBA 1JAJA 8ICXA 2BPGA 1HUZA 5F2VO 4RT3A 4QZHA 4RQ4A 7ICVA 4UB2A 1TFWA 5J2HA 3HJ1A 4PHEA 4MKPA 1ZJMA 3RJGA 7ICGA 2W9MA 5DB7A 1ZJNA 4KLHA 9ICFA 3AQNA 3C2KA 3TFSA 3AQMA 1MQ3A 4K8VA 7ICPA 1MIWA 1PX5A 2ZH1A 4Z6DA 4K4IA 5HRLA 2ZH8A 2FCLA 2PFOA 4M2YA 4AT9B 4DOAA 5J0YA 1ZQYA 4RQ0A 1BPEA 9ICUA 3PMNA 3ER9B 4WC6A 3UQ0A 2IUBA 4O6AA 5D46A 1ZQZA 3ERCC 1VJ7A 4FH3A 1TFYA 2ZH5A 4I29A 4NM1A 1ZQIA 3RJEA 9ICMA 2ZHBA 1JQRA 4QZBA 2BCQA 4RWPA 3UPSA 4EBKA 4YD2A 5CHEA 4RPYA 5BOLA 3V72A 5HRFA 5HRDA 5DECA 4EEBA 3HIYA 4QZEA 5J0OA 1RPLA 4Z6CA 4WC4A 5B3QA 9ICSA 3RH4A 4I2GA 8ICGA 2BBJA 2EWRA 4X4OA 4RWNA 3CK6A 5CHGA 4P2HA 8ICJA 8ICUA 5DDMA 4WC7A 4K4GA 4O5KA 5DEDA 4TUPA 4YMMA 1ZQCA 8ICYA 5CR0A 1HUOA 8ICHA 4OAIZ 3B0XA 4QZ9A 4I2EA 4PHDA 4NLNA 4QZFA 4OAFA 4XQ8A 4DOBA 4K96A 3OWGA 4PGXA 1R89A 8ICSA 3C2LA 9ICJA 3JCFA 4I2AA 3AU2A 4WCWA 2PFQA 4AT8B 4RQ6A 4MF2A 9ICGA 4S3NA 2FMQA 4I2IA 3RJFA 4RQ8A 4UD4A 5IIOA 4I28A 4O5CA 2M2UA 3RH5A 1BPDA 5B3PA 4NXZA 9ICPA 3RJJA 4WC1A 4UAWA 1ZQMA 4EV6A 4O68A 3LK9A 4YD1A 7ICNA 5IILA 1ZQBA 4YMNA 4K99A 3WFOA 4RQ5A 2DR5A 4KLJA 3C18A 4I0UA 1YLQA 9ICNA 4K97A 4NM2A 7ICIA 4TUSA 2ZH3A 4O69A 4WBYA 4MFFA 4KLQA 2PXIA 9ICRA 3C2MA 4PH5A 5IIJA 4F5QA 2GWSA 5HHIA 4X4UA 4KM5A 4IQUA 3UPQA 4QZGA 4WQLA 4LVSA 2O1PA 2RFFA 3AQKA 2DRBA 4IQVA 4TUQA 4LEYA 4UB5A 2PFPA 4I2DA 3WFSC 5CP2A 4R65A 3NWIA 1ZQWA 4M9JA 4M04A 2VANA 1ZQXA 3JPSA 9ICLA 5J2JA 5D62A 5DB8A 3RH6A 1BPYA 5J0WA 5J2EA 1ZQJA 1ZQAA 4P4MA 4K98A 4YMOA 5JTGA 3H37A 3OUYA 9ICBA 4WBZA 2ZH7A 5IIKA 1ZQVA 4PPXA 5DBBA 2FMSA 4LZGA 4IG8A 3C5FA 2ZHAA 4P4OA 4FHVA 5J2BA 5J2AA 7ICTA 3K7DA 1MIVA 2GAFD 5J2GA 2ID1A 4X4NA 1UEUA 4M0AA 1ZQFA 4K9BA 2PBEA 4PHAA 5HHHA 5J2IA 4XUSA 1XSPA 3PNCA 4X4RA 5HRKA 1ZQLA 2ZH9A 5BOMA 9ICEA 4NXVA 8ICIA 1OU5A 8ICCA 4XQ7A 4K9AA 5CFUA 2DR7A 4FO1A 5HREA 4GXIA 4KLDA 3JPOA 1ZQOA 4EBJA 1ZQEA 4NLKA 4DO9A 1BPBA 4RWQA 4RPXA 5J0RA 4FHXA 3MBYA 4LT6A 4X4SA 2DVIA 9ICCA 9ICHA 3MGIA 5IINA 4QZ8A 3RJIA 2BE3A 2BPFA 4WC3A 4NKUA 5J29A 4QZIA 1BPZA 3JPNA 3NVOA 4HX0A 2M2VA 3ISDA 1TV9A 5DDYA 4KLIA 4TURA 8ICMA 4UAYA 4K4HA 1ZQRA 5J0UA 2DR9A 9ICWA 9ICQA 5HRIA 4IQWA 1FA0A 3NYBA 5IIMA 9ICAA 4OAGA 4PGYA 4AT7A 7ICQA 4KLLA 5CFTA 3OV7A 5D61A 4Z6FA 1Q79A 4EP7A 3JZ0A 3C66A 3HWTA 4O67A 5HRGA 4UAZA 4KLUA 4F5PA 4PGQA 4FO6A 4I2FA 4MFCA 9ICOA 4KB6A 1NO5A 3ER8C 8ICOA 7ICFA 8ICWA 3WFRE 4AT9A 4KLMA 3OVSA 4RQ3A 3V7KA 4F5NA 1KNYA 3PHZA 1UEVA 4X5VA 4FHPA 5CA7A 1TVAA 2M2TA 2IHMA 1GPJA 2BBHA 4YN4A 4X4QA 7ICSA 3TFRA 3H3AA 5J2FA 7ICMA 2O5AA 7ICRA 2NRKA 5J0QA 3ISBA 8ICLA 3RJKA 3ISCA 4M47A 4LEWA 4RPZA 5HC9A 4AT8A 2HHPA 8ICEA 4LEZA 4UBBA 4WH5A 1XSLA 4YCXA
chains in the Genus database with same CATH topology
4IQTA 4UBCA 3AQLA 2BCSA 4I2BA 3GDXA 4RQ7A 8ICQA 5DBCA 4I2HA 4ATBA 5J2CA 3AUOA 1ZQTA 8ICNA 3LQCB 4JWMA 3JPTA 5EOZA 3JPQA 4RQ1A 5CB1A 7ICHA 9ICTA 8ICTA 3V7JA 2ZH6A 2Q66A 1Q78A 5CJ7A 1R8AA 1MIYA 4UD5A 3UXPA 9ICKA 2FMPA 2I9GA 3RJHA 5IIIA 4M9LA 4KLTA 4QZAA 5J0TA 4GXKA 4X0BA 1KEJA 8ICBA 3C5GA 4GXJA 8ICZA 3OGUA 3MDCA 1R8CA 7ICJA 4R66A 5DB6A 2BCUA 4KLEA 1JMSA 4QZDA 2ISPA 3HW8A 2ISOA 4E7XA 4I27A 4M9GA 3MGHA 3K75D 2B4VA 4AT7B 4I2JA 1ZQUA 1XSNA 1V4AA 3OVBA 5J2DA 4KLSA 4X4VA 4I2CA 4WC2A 2DR8A 4NKTA 4XRHA 9ICIA 3PMLA 4NXXA 7ICLA 4KLFA 4UB3A 1ZQSA 4X4TA 3WFQE 5J0PA 4LEVA 4F5RA 1ZQPA 1ZQKA 4F5OA 4M9HA 5HR9A 3JPRA 4RQ2A 3JPPA 5BPCA 5J0SA 1ZQHA 8ICAA 4O9MA 2P66A 1UETA 5TZVA 5D4BA 4NY8A 1BPXA 4RT2A 1NOMA 4FHWA 7ICOA 2ZH4A 1VFGA 2BPCA 4NXWA 3L9DA 4KLOA 1R8BA 3OVAA 4QZCA 3WFPA 4ATBB 4WC0A 4OAHA 4RWOA 2ZH2A 4WOYA 5DBAA 4MFAA 4UB1A 4X0AA 4DOCA 8ICFA 4NXUA 4M9NA 4WC5A 5CWRA 4NXTA 7ICEA 9ICXA 4X4PA 1F5AA 2DRAA 3UXOA 4E80A 1KDHA 4R64A 2BCVA 2B56A 4PHPA 8ICPA 5D49A 3OUYB 3V7LA 4M5DA 4P4PA 4E8FA 5DKWA 3H39A 5DB9A 1MQ2A 4NLZA 4UB4A 4XA5A 4MF8A 2B51A 3H38A 7ICUA 2BCRA 8ICVA 3HX0A 4JLXA 3JYYA 3AU6A 3UQ2A 4KLGA 3B0YA 9ICVA 3HJ4A 1ZQNA 1JN3A 4FHYA 2M2WA 5J2KA 1WOTA 3UXNA 4LZDA 8ICRA 5HRHA 1RZTA 4JLZA 2PFNA 4Z6EA 4O5EA 4R63A 1ZQGA 1ZQDA 4JWNA 5J0XA 3MDAA 8ICKA 4FH5A 1ZQQA 7ICKA 5HRBA 1JAJA 8ICXA 2BPGA 1HUZA 5F2VO 4RT3A 4QZHA 4RQ4A 7ICVA 4UB2A 1TFWA 5J2HA 3HJ1A 4PHEA 4MKPA 1ZJMA 3RJGA 7ICGA 2W9MA 5DB7A 1ZJNA 4KLHA 9ICFA 3AQNA 3C2KA 3TFSA 3AQMA 1MQ3A 4K8VA 7ICPA 1MIWA 1PX5A 2ZH1A 4Z6DA 4K4IA 5HRLA 2ZH8A 2PFOA 4M2YA 4AT9B 4DOAA 5J0YA 1ZQYA 4RQ0A 1BPEA 9ICUA 3PMNA 4WC6A 3UQ0A 4O6AA 5D46A 1ZQZA 1VJ7A 4FH3A 1TFYA 2ZH5A 4I29A 4NM1A 1ZQIA 3RJEA 9ICMA 2ZHBA 1JQRA 4QZBA 2BCQA 4RWPA 3UPSA 4EBKA 4YD2A 4RPYA 5BOLA 3V72A 5HRFA 5HRDA 5DECA 3HIYA 4QZEA 5J0OA 1RPLA 4Z6CA 4WC4A 9ICSA 3RH4A 4I2GA 8ICGA 4X4OA 4RWNA 5CHGA 4P2HA 8ICJA 8ICUA 5DDMA 4WC7A 4K4GA 4O5KA 5DEDA 4TUPA 4YMMA 1ZQCA 8ICYA 5CR0A 1HUOA 8ICHA 4OAIZ 3B0XA 4QZ9A 4I2EA 4PHDA 4NLNA 4QZFA 4OAFA 4XQ8A 4DOBA 4K96A 4PGXA 1R89A 8ICSA 3C2LA 9ICJA 4I2AA 3AU2A 4WCWA 2PFQA 4AT8B 4RQ6A 4MF2A 9ICGA 4S3NA 2FMQA 4I2IA 3RJFA 4RQ8A 4UD4A 5IIOA 4I28A 4O5CA 2M2UA 3RH5A 1BPDA 4NXZA 9ICPA 3RJJA 4WC1A 4UAWA 1ZQMA 4O68A 3LK9A 4YD1A 7ICNA 5IILA 1ZQBA 4YMNA 4K99A 3WFOA 4RQ5A 2DR5A 4KLJA 3C18A 1YLQA 9ICNA 4K97A 4NM2A 7ICIA 4TUSA 2ZH3A 4O69A 4WBYA 4MFFA 4KLQA 2PXIA 9ICRA 3C2MA 4PH5A 5IIJA 4F5QA 2GWSA 5HHIA 4X4UA 4KM5A 4IQUA 3UPQA 4QZGA 4LVSA 2O1PA 2RFFA 3AQKA 2DRBA 4IQVA 4TUQA 4LEYA 4UB5A 2PFPA 4I2DA 3WFSC 5CP2A 4R65A 1ZQWA 4M9JA 4M04A 2VANA 1ZQXA 3JPSA 9ICLA 5J2JA 5DB8A 3RH6A 1BPYA 5J0WA 5J2EA 1ZQJA 1ZQAA 4P4MA 4K98A 4YMOA 3H37A 3OUYA 9ICBA 4WBZA 2ZH7A 5IIKA 1ZQVA 4PPXA 5DBBA 2FMSA 4LZGA 4IG8A 3C5FA 2ZHAA 4P4OA 4FHVA 5J2BA 5J2AA 7ICTA 1MIVA 5J2GA 2ID1A 4X4NA 1UEUA 4M0AA 1ZQFA 4K9BA 2PBEA 4PHAA 5HHHA 5J2IA 4XUSA 1XSPA 3PNCA 4X4RA 5HRKA 1ZQLA 2ZH9A 5BOMA 9ICEA 4NXVA 8ICIA 1OU5A 8ICCA 4XQ7A 4K9AA 2DR7A 4GXIA 5HREA 4KLDA 3JPOA 1ZQOA 4EBJA 1ZQEA 4NLKA 4DO9A 1BPBA 4RWQA 4RPXA 5J0RA 4FHXA 3MBYA 4LT6A 4X4SA 2DVIA 9ICCA 9ICHA 3MGIA 5IINA 4QZ8A 3RJIA 2BE3A 2BPFA 4WC3A 4NKUA 5J29A 4QZIA 1BPZA 3JPNA 4KLIA 1TV9A 2M2VA 3ISDA 5DDYA 4TURA 8ICMA 4UAYA 4K4HA 1ZQRA 5J0UA 2DR9A 9ICWA 9ICQA 5HRIA 4IQWA 1FA0A 3NYBA 5IIMA 9ICAA 4OAGA 4PGYA 4AT7A 7ICQA 4KLLA 3OV7A 4Z6FA 1Q79A 4EP7A 3JZ0A 3C66A 3HWTA 4O67A 5HRGA 4UAZA 4KLUA 4F5PA 4PGQA 4FO6A 4I2FA 4MFCA 9ICOA 4KB6A 1NO5A 8ICOA 7ICFA 8ICWA 3WFRE 4AT9A 4KLMA 3OVSA 4RQ3A 3V7KA 4F5NA 1KNYA 1UEVA 4X5VA 4FHPA 5CA7A 1TVAA 2M2TA 2IHMA 4YN4A 4X4QA 7ICSA 3TFRA 3H3AA 5J2FA 7ICMA 2O5AA 7ICRA 2NRKA 5J0QA 3ISBA 8ICLA 3RJKA 3ISCA 4M47A 4LEWA 4RPZA 5HC9A 4AT8A 2HHPA 8ICEA 4LEZA 4UBBA 1XSLA 4YCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQT A;  4UBC A;  3AQL A;  2BCS A;  4I2B A;  3GDX A;  4RQ7 A;  8ICQ A;  5DBC A;  4I2H A;  4ATB A;  5J2C A;  3AUO A;  1ZQT A;  8ICN A;  3LQC B;  4JWM A;  3JPT A;  3JPQ A;  5EOZ A;  4RQ1 A;  5CB1 A;  7ICH A;  9ICT A;  8ICT A;  3V7J A;  2ZH6 A;  5CJ7 A;  1Q78 A;  2Q66 A;  1R8A A;  1MIY A;  4UD5 A;  3UXP A;  9ICK A;  2FMP A;  2I9G A;  3RJH A;  5III A;  4M9L A;  4KLT A;  4QZA A;  5J0T A;  4GXK A;  4X0B A;  1KEJ A;  8ICB A;  3C5G A;  4GXJ A;  8ICZ A;  3OGU A;  3MDC A;  1R8C A;  7ICJ A;  4R66 A;  5DB6 A;  2BCU A;  4KLE A;  1JMS A;  4QZD A;  2ISP A;  3HW8 A;  2ISO A;  4E7X A;  4I27 A;  4M9G A;  3MGH A;  3K75 D;  4AT7 B;  4I2J A;  1ZQU A;  1XSN A;  1V4A A;  5J2D A;  3OVB A;  4KLS A;  4X4V A;  4I2C A;  4WC2 A;  2DR8 A;  4NKT A;  4XRH A;  9ICI A;  3PML A;  4NXX A;  7ICL A;  4KLF A;  4UB3 A;  1ZQS A;  4X4T A;  3WFQ E;  5J0P A;  4LEV A;  4F5R A;  1ZQP A;  1ZQK A;  4F5O A;  4M9H A;  5HR9 A;  3JPR A;  4RQ2 A;  3JPP A;  5BPC A;  5J0S A;  1ZQH A;  8ICA A;  4O9M A;  2P66 A;  1UET A;  5TZV A;  5D4B A;  4NY8 A;  1BPX A;  4RT2 A;  1NOM A;  4FHW A;  7ICO A;  2ZH4 A;  1VFG A;  2BPC A;  4NXW A;  3L9D A;  4KLO A;  1R8B A;  3OVA A;  4QZC A;  3WFP A;  4ATB B;  4WC0 A;  4OAH A;  4RWO A;  2ZH2 A;  4WOY A;  5DBA A;  4MFA A;  4UB1 A;  4X0A A;  4DOC A;  8ICF A;  4NXU A;  4M9N A;  4WC5 A;  5CWR A;  4NXT A;  7ICE A;  9ICX A;  4X4P A;  1F5A A;  3UXO A;  2DRA A;  4E80 A;  1KDH A;  4R64 A;  2BCV A;  4PHP A;  8ICP A;  5D49 A;  3OUY B;  3V7L A;  4M5D A;  4P4P A;  4E8F A;  5DKW A;  3H39 A;  5DB9 A;  1MQ2 A;  4NLZ A;  4UB4 A;  4XA5 A;  4MF8 A;  3H38 A;  7ICU A;  2BCR A;  8ICV A;  3HX0 A;  4JLX A;  3JYY A;  3AU6 A;  3UQ2 A;  4KLG A;  3B0Y A;  9ICV A;  3HJ4 A;  1ZQN A;  1JN3 A;  4FHY A;  2M2W A;  5J2K A;  1WOT A;  3UXN A;  4LZD A;  8ICR A;  5HRH A;  1RZT A;  4JLZ A;  2PFN A;  4Z6E A;  4O5E A;  4R63 A;  1ZQG A;  1ZQD A;  4JWN A;  5J0X A;  3MDA A;  8ICK A;  4FH5 A;  1ZQQ A;  7ICK A;  5HRB A;  1JAJ A;  8ICX A;  2BPG A;  1HUZ A;  5F2V O;  4RT3 A;  4QZH A;  4RQ4 A;  7ICV A;  4UB2 A;  1TFW A;  5J2H A;  3HJ1 A;  4PHE A;  4MKP A;  1ZJM A;  3RJG A;  7ICG A;  2W9M A;  5DB7 A;  1ZJN A;  4KLH A;  9ICF A;  3AQN A;  3C2K A;  3TFS A;  3AQM A;  1MQ3 A;  4K8V A;  7ICP A;  1MIW A;  1PX5 A;  2ZH1 A;  4Z6D A;  4K4I A;  5HRL A;  2ZH8 A;  2PFO A;  4M2Y A;  4AT9 B;  4DOA A;  5J0Y A;  1ZQY A;  4RQ0 A;  1BPE A;  9ICU A;  3PMN A;  4WC6 A;  3UQ0 A;  4O6A A;  5D46 A;  1ZQZ A;  1VJ7 A;  4FH3 A;  4I29 A;  2ZH5 A;  4NM1 A;  1TFY A;  1ZQI A;  3RJE A;  9ICM A;  2ZHB A;  1JQR A;  4QZB A;  2BCQ A;  4RWP A;  3UPS A;  4EBK A;  4YD2 A;  4RPY A;  5BOL A;  3V72 A;  5HRF A;  5HRD A;  5DEC A;  3HIY A;  4QZE A;  5J0O A;  1RPL A;  4Z6C A;  4WC4 A;  9ICS A;  3RH4 A;  4I2G A;  8ICG A;  4X4O A;  4RWN A;  5CHG A;  4P2H A;  8ICJ A;  8ICU A;  5DDM A;  4WC7 A;  4K4G A;  4O5K A;  5DED A;  4TUP A;  4YMM A;  1ZQC A;  8ICY A;  5CR0 A;  1HUO A;  8ICH A;  4OAI Z;  3B0X A;  4QZ9 A;  4I2E A;  4PHD A;  4NLN A;  4QZF A;  4OAF A;  4XQ8 A;  4DOB A;  4K96 A;  4PGX A;  1R89 A;  8ICS A;  3C2L A;  9ICJ A;  4I2A A;  3AU2 A;  4WCW A;  2PFQ A;  4AT8 B;  4RQ6 A;  4MF2 A;  9ICG A;  4S3N A;  2FMQ A;  4I2I A;  3RJF A;  4RQ8 A;  4UD4 A;  5IIO A;  4I28 A;  4O5C A;  2M2U A;  3RH5 A;  1BPD A;  4NXZ A;  9ICP A;  3RJJ A;  4WC1 A;  4UAW A;  1ZQM A;  4O68 A;  3LK9 A;  4YD1 A;  7ICN A;  5IIL A;  1ZQB A;  4YMN A;  4K99 A;  3WFO A;  4RQ5 A;  2DR5 A;  4KLJ A;  3C18 A;  1YLQ A;  9ICN A;  4K97 A;  4NM2 A;  7ICI A;  4TUS A;  4WBY A;  4O69 A;  2ZH3 A;  4MFF A;  4KLQ A;  2PXI A;  9ICR A;  3C2M A;  4PH5 A;  5IIJ A;  4F5Q A;  2GWS A;  5HHI A;  4X4U A;  4KM5 A;  4IQU A;  3UPQ A;  4QZG A;  4LVS A;  2O1P A;  2RFF A;  3AQK A;  4IQV A;  2DRB A;  4TUQ A;  4LEY A;  4UB5 A;  2PFP A;  4I2D A;  3WFS C;  5CP2 A;  4R65 A;  1ZQW A;  4M9J A;  4M04 A;  2VAN A;  1ZQX A;  3JPS A;  9ICL A;  5J2J A;  5DB8 A;  3RH6 A;  1BPY A;  5J0W A;  5J2E A;  1ZQJ A;  1ZQA A;  4P4M A;  4K98 A;  4YMO A;  3H37 A;  3OUY A;  9ICB A;  4WBZ A;  2ZH7 A;  5IIK A;  1ZQV A;  4PPX A;  5DBB A;  2FMS A;  4LZG A;  4IG8 A;  3C5F A;  2ZHA A;  4P4O A;  4FHV A;  5J2B A;  5J2A A;  7ICT A;  1MIV A;  5J2G A;  2ID1 A;  4M0A A;  1UEU A;  4X4N A;  1ZQF A;  4K9B A;  2PBE A;  4PHA A;  5HHH A;  5J2I A;  4XUS A;  1XSP A;  3PNC A;  4X4R A;  5HRK A;  1ZQL A;  2ZH9 A;  5BOM A;  9ICE A;  4NXV A;  8ICI A;  1OU5 A;  8ICC A;  4XQ7 A;  4K9A A;  4GXI A;  2DR7 A;  5HRE A;  4KLD A;  3JPO A;  1ZQO A;  4EBJ A;  1ZQE A;  4NLK A;  4DO9 A;  1BPB A;  4RWQ A;  4RPX A;  5J0R A;  4FHX A;  3MBY A;  4LT6 A;  4X4S A;  2DVI A;  9ICC A;  9ICH A;  3MGI A;  5IIN A;  4QZ8 A;  3RJI A;  2BE3 A;  2BPF A;  4WC3 A;  4NKU A;  5J29 A;  4QZI A;  1BPZ A;  3JPN A;  4KLI A;  1TV9 A;  2M2V A;  3ISD A;  5DDY A;  4TUR A;  8ICM A;  4UAY A;  4K4H A;  1ZQR A;  5J0U A;  2DR9 A;  9ICW A;  9ICQ A;  5HRI A;  4IQW A;  1FA0 A;  3NYB A;  5IIM A;  9ICA A;  4OAG A;  4PGY A;  4AT7 A;  7ICQ A;  4KLL A;  4Z6F A;  3OV7 A;  1Q79 A;  4EP7 A;  3JZ0 A;  3C66 A;  3HWT A;  4O67 A;  5HRG A;  4UAZ A;  4KLU A;  4F5P A;  4PGQ A;  4FO6 A;  4I2F A;  4MFC A;  9ICO A;  4KB6 A;  1NO5 A;  8ICO A;  7ICF A;  8ICW A;  3WFR E;  4AT9 A;  4KLM A;  3OVS A;  4RQ3 A;  3V7K A;  4F5N A;  1KNY A;  1UEV A;  4X5V A;  4FHP A;  5CA7 A;  1TVA A;  2M2T A;  2IHM A;  4YN4 A;  4X4Q A;  7ICS A;  3TFR A;  3H3A A;  5J2F A;  7ICM A;  2O5A A;  7ICR A;  2NRK A;  5J0Q A;  3ISB A;  8ICL A;  3RJK A;  3ISC A;  4M47 A;  4LEW A;  4RPZ A;  5HC9 A;  4AT8 A;  2HHP A;  8ICE A;  4LEZ A;  4UBB A;  1XSL A;  4YCX A; 
#chains in the Genus database with same CATH topology
 4IQT A;  4UBC A;  3AQL A;  2BCS A;  4I2B A;  3GDX A;  4RQ7 A;  8ICQ A;  5DBC A;  4I2H A;  4ATB A;  5J2C A;  3AUO A;  1ZQT A;  8ICN A;  3LQC B;  4JWM A;  3JPT A;  5EOZ A;  3JPQ A;  4RQ1 A;  5CB1 A;  7ICH A;  9ICT A;  2HN2 A;  8ICT A;  3V7J A;  2ZH6 A;  2Q66 A;  1Q78 A;  5CJ7 A;  1R8A A;  1MIY A;  4UD5 A;  3UXP A;  9ICK A;  2FMP A;  2I9G A;  3RJH A;  2HN1 A;  5III A;  4M9L A;  4KLT A;  4QZA A;  5J0T A;  4GXK A;  4X0B A;  1KEJ A;  8ICB A;  3C5G A;  4GXJ A;  8ICZ A;  3OGU A;  3MDC A;  1R8C A;  7ICJ A;  4R66 A;  5DB6 A;  2BCU A;  4KLE A;  1JMS A;  4QZD A;  2ISP A;  4EGW A;  3HW8 A;  2ISO A;  4E7X A;  4I27 A;  4M9G A;  3MGH A;  2GA9 D;  3K75 D;  2B4V A;  4AT7 B;  4I2J A;  1ZQU A;  1XSN A;  1V4A A;  3OVB A;  4WQK A;  5J2D A;  4KLS A;  4X4V A;  5D63 A;  4I2C A;  4XJE A;  4WC2 A;  2DR8 A;  4NKT A;  4N7R A;  4XRH A;  9ICI A;  3PML A;  4NXX A;  7ICL A;  4KLF A;  4UB3 A;  3NKU A;  1ZQS A;  4X4T A;  3WFQ E;  5J0P A;  4LEV A;  4F5R A;  1ZQP A;  1ZQK A;  4F5O A;  4M9H A;  5HR9 A;  3JPR A;  4RQ2 A;  3JPP A;  3EF2 A;  5BPC A;  5J0S A;  1ZQH A;  8ICA A;  4O9M A;  2P66 A;  1UET A;  5TZV A;  5D4B A;  4NY8 A;  1BPX A;  4RT2 A;  1NOM A;  4FHW A;  5CFS A;  7ICO A;  2ZH4 A;  1VFG A;  2BPC A;  4NXW A;  3L9D A;  4KLO A;  1R8B A;  3OVA A;  4QZC A;  3WFP A;  4ATB B;  4WC0 A;  4OAH A;  4RWO A;  2ZH2 A;  4WOY A;  5DBA A;  4MFA A;  4UB1 A;  4X0A A;  4DOC A;  8ICF A;  4NXU A;  4M9N A;  4WC5 A;  3MCR A;  5CWR A;  4NXT A;  7ICE A;  9ICX A;  4X4P A;  1F5A A;  2DRA A;  3UXO A;  4E80 A;  1KDH A;  4R64 A;  2BCV A;  2B56 A;  4PHP A;  8ICP A;  5D49 A;  3OUY B;  3V7L A;  4M5D A;  4P4P A;  4E8F A;  5DKW A;  3H39 A;  5DB9 A;  1MQ2 A;  4NLZ A;  4UB4 A;  4XA5 A;  4MF8 A;  2B51 A;  3H38 A;  7ICU A;  2BCR A;  8ICV A;  2IHO A;  3HX0 A;  4JLX A;  3JYY A;  3AU6 A;  3UQ2 A;  4KLG A;  3B0Y A;  9ICV A;  3HJ4 A;  1ZQN A;  1JN3 A;  4FHY A;  2M2W A;  5J2K A;  1WOT A;  3UXN A;  4LZD A;  8ICR A;  5HRH A;  1RZT A;  4JLZ A;  2PFN A;  4Z6E A;  4O5E A;  4R63 A;  1ZQG A;  1ZQD A;  4JWN A;  5J0X A;  3MDA A;  8ICK A;  4FH5 A;  1ZQQ A;  7ICK A;  4EED A;  5HRB A;  1JAJ A;  8ICX A;  2BPG A;  1HUZ A;  5F2V O;  4RT3 A;  4QZH A;  4RQ4 A;  7ICV A;  4UB2 A;  1TFW A;  5J2H A;  3HJ1 A;  4PHE A;  4MKP A;  1ZJM A;  3RJG A;  7ICG A;  2W9M A;  5DB7 A;  1ZJN A;  4KLH A;  9ICF A;  3AQN A;  3C2K A;  3TFS A;  3AQM A;  1MQ3 A;  4K8V A;  7ICP A;  1MIW A;  1PX5 A;  2ZH1 A;  4Z6D A;  4K4I A;  5HRL A;  2ZH8 A;  2FCL A;  2PFO A;  4M2Y A;  4AT9 B;  4DOA A;  5J0Y A;  1ZQY A;  4RQ0 A;  1BPE A;  9ICU A;  3PMN A;  3ER9 B;  4WC6 A;  3UQ0 A;  2IUB A;  4O6A A;  5D46 A;  1ZQZ A;  3ERC C;  1VJ7 A;  4FH3 A;  1TFY A;  2ZH5 A;  4I29 A;  4NM1 A;  1ZQI A;  3RJE A;  9ICM A;  2ZHB A;  1JQR A;  4QZB A;  2BCQ A;  4RWP A;  3UPS A;  4EBK A;  4YD2 A;  5CHE A;  4RPY A;  5BOL A;  3V72 A;  5HRF A;  5HRD A;  5DEC A;  4EEB A;  3HIY A;  4QZE A;  5J0O A;  1RPL A;  4Z6C A;  4WC4 A;  5B3Q A;  9ICS A;  3RH4 A;  4I2G A;  8ICG A;  2BBJ A;  2EWR A;  4X4O A;  4RWN A;  3CK6 A;  5CHG A;  4P2H A;  8ICJ A;  8ICU A;  5DDM A;  4WC7 A;  4K4G A;  4O5K A;  5DED A;  4TUP A;  4YMM A;  1ZQC A;  8ICY A;  5CR0 A;  1HUO A;  8ICH A;  4OAI Z;  3B0X A;  4QZ9 A;  4I2E A;  4PHD A;  4NLN A;  4QZF A;  4OAF A;  4XQ8 A;  4DOB A;  4K96 A;  3OWG A;  4PGX A;  1R89 A;  8ICS A;  3C2L A;  9ICJ A;  3JCF A;  4I2A A;  3AU2 A;  4WCW A;  2PFQ A;  4AT8 B;  4RQ6 A;  4MF2 A;  9ICG A;  4S3N A;  2FMQ A;  4I2I A;  3RJF A;  4RQ8 A;  4UD4 A;  5IIO A;  4I28 A;  4O5C A;  2M2U A;  3RH5 A;  1BPD A;  5B3P A;  4NXZ A;  9ICP A;  3RJJ A;  4WC1 A;  4UAW A;  1ZQM A;  4EV6 A;  4O68 A;  3LK9 A;  4YD1 A;  7ICN A;  5IIL A;  1ZQB A;  4YMN A;  4K99 A;  3WFO A;  4RQ5 A;  2DR5 A;  4KLJ A;  3C18 A;  4I0U A;  1YLQ A;  9ICN A;  4K97 A;  4NM2 A;  7ICI A;  4TUS A;  2ZH3 A;  4O69 A;  4WBY A;  4MFF A;  4KLQ A;  2PXI A;  9ICR A;  3C2M A;  4PH5 A;  5IIJ A;  4F5Q A;  2GWS A;  5HHI A;  4X4U A;  4KM5 A;  4IQU A;  3UPQ A;  4QZG A;  4WQL A;  4LVS A;  2O1P A;  2RFF A;  3AQK A;  2DRB A;  4IQV A;  4TUQ A;  4LEY A;  4UB5 A;  2PFP A;  4I2D A;  3WFS C;  5CP2 A;  4R65 A;  3NWI A;  1ZQW A;  4M9J A;  4M04 A;  2VAN A;  1ZQX A;  3JPS A;  9ICL A;  5J2J A;  5D62 A;  5DB8 A;  3RH6 A;  1BPY A;  5J0W A;  5J2E A;  1ZQJ A;  1ZQA A;  4P4M A;  4K98 A;  4YMO A;  5JTG A;  3H37 A;  3OUY A;  9ICB A;  4WBZ A;  2ZH7 A;  5IIK A;  1ZQV A;  4PPX A;  5DBB A;  2FMS A;  4LZG A;  4IG8 A;  3C5F A;  2ZHA A;  4P4O A;  4FHV A;  5J2B A;  5J2A A;  7ICT A;  3K7D A;  1MIV A;  2GAF D;  5J2G A;  2ID1 A;  4X4N A;  1UEU A;  4M0A A;  1ZQF A;  4K9B A;  2PBE A;  4PHA A;  5HHH A;  5J2I A;  4XUS A;  1XSP A;  3PNC A;  4X4R A;  5HRK A;  1ZQL A;  2ZH9 A;  5BOM A;  9ICE A;  4NXV A;  8ICI A;  1OU5 A;  8ICC A;  4XQ7 A;  4K9A A;  5CFU A;  2DR7 A;  4FO1 A;  5HRE A;  4GXI A;  4KLD A;  3JPO A;  1ZQO A;  4EBJ A;  1ZQE A;  4NLK A;  4DO9 A;  1BPB A;  4RWQ A;  4RPX A;  5J0R A;  4FHX A;  3MBY A;  4LT6 A;  4X4S A;  2DVI A;  9ICC A;  9ICH A;  3MGI A;  5IIN A;  4QZ8 A;  3RJI A;  2BE3 A;  2BPF A;  4WC3 A;  4NKU A;  5J29 A;  4QZI A;  1BPZ A;  3JPN A;  3NVO A;  4HX0 A;  2M2V A;  3ISD A;  1TV9 A;  5DDY A;  4KLI A;  4TUR A;  8ICM A;  4UAY A;  4K4H A;  1ZQR A;  5J0U A;  2DR9 A;  9ICW A;  9ICQ A;  5HRI A;  4IQW A;  1FA0 A;  3NYB A;  5IIM A;  9ICA A;  4OAG A;  4PGY A;  4AT7 A;  7ICQ A;  4KLL A;  5CFT A;  3OV7 A;  5D61 A;  4Z6F A;  1Q79 A;  4EP7 A;  3JZ0 A;  3C66 A;  3HWT A;  4O67 A;  5HRG A;  4UAZ A;  4KLU A;  4F5P A;  4PGQ A;  4FO6 A;  4I2F A;  4MFC A;  9ICO A;  4KB6 A;  1NO5 A;  3ER8 C;  8ICO A;  7ICF A;  8ICW A;  3WFR E;  4AT9 A;  4KLM A;  3OVS A;  4RQ3 A;  3V7K A;  4F5N A;  1KNY A;  3PHZ A;  1UEV A;  4X5V A;  4FHP A;  5CA7 A;  1TVA A;  2M2T A;  2IHM A;  1GPJ A;  2BBH A;  4YN4 A;  4X4Q A;  7ICS A;  3TFR A;  3H3A A;  5J2F A;  7ICM A;  2O5A A;  7ICR A;  2NRK A;  5J0Q A;  3ISB A;  8ICL A;  3RJK A;  3ISC A;  4M47 A;  4LEW A;  4RPZ A;  5HC9 A;  4AT8 A;  2HHP A;  8ICE A;  4LEZ A;  4UBB A;  4WH5 A;  1XSL A;  4YCX A; 
#chains in the Genus database with same CATH homology
 4IQT A;  4UBC A;  3AQL A;  2BCS A;  4I2B A;  3GDX A;  4RQ7 A;  8ICQ A;  5DBC A;  4I2H A;  4ATB A;  5J2C A;  3AUO A;  1ZQT A;  8ICN A;  3LQC B;  4JWM A;  3JPT A;  5EOZ A;  3JPQ A;  4RQ1 A;  5CB1 A;  7ICH A;  9ICT A;  8ICT A;  3V7J A;  2ZH6 A;  2Q66 A;  1Q78 A;  5CJ7 A;  1R8A A;  1MIY A;  4UD5 A;  3UXP A;  9ICK A;  2FMP A;  2I9G A;  3RJH A;  5III A;  4M9L A;  4KLT A;  4QZA A;  5J0T A;  4GXK A;  4X0B A;  1KEJ A;  8ICB A;  3C5G A;  4GXJ A;  8ICZ A;  3OGU A;  3MDC A;  1R8C A;  7ICJ A;  4R66 A;  5DB6 A;  2BCU A;  4KLE A;  1JMS A;  4QZD A;  2ISP A;  3HW8 A;  2ISO A;  4E7X A;  4I27 A;  4M9G A;  3MGH A;  3K75 D;  2B4V A;  4AT7 B;  4I2J A;  1ZQU A;  1XSN A;  1V4A A;  3OVB A;  5J2D A;  4KLS A;  4X4V A;  4I2C A;  4WC2 A;  2DR8 A;  4NKT A;  4XRH A;  9ICI A;  3PML A;  4NXX A;  7ICL A;  4KLF A;  4UB3 A;  1ZQS A;  4X4T A;  3WFQ E;  5J0P A;  4LEV A;  4F5R A;  1ZQP A;  1ZQK A;  4F5O A;  4M9H A;  5HR9 A;  3JPR A;  4RQ2 A;  3JPP A;  5BPC A;  5J0S A;  1ZQH A;  8ICA A;  4O9M A;  2P66 A;  1UET A;  5TZV A;  5D4B A;  4NY8 A;  1BPX A;  4RT2 A;  1NOM A;  4FHW A;  7ICO A;  2ZH4 A;  1VFG A;  2BPC A;  4NXW A;  3L9D A;  4KLO A;  1R8B A;  3OVA A;  4QZC A;  3WFP A;  4ATB B;  4WC0 A;  4OAH A;  4RWO A;  2ZH2 A;  4WOY A;  5DBA A;  4MFA A;  4UB1 A;  4X0A A;  4DOC A;  8ICF A;  4NXU A;  4M9N A;  4WC5 A;  5CWR A;  4NXT A;  7ICE A;  9ICX A;  4X4P A;  1F5A A;  2DRA A;  3UXO A;  4E80 A;  1KDH A;  4R64 A;  2BCV A;  2B56 A;  4PHP A;  8ICP A;  5D49 A;  3OUY B;  3V7L A;  4M5D A;  4P4P A;  4E8F A;  5DKW A;  3H39 A;  5DB9 A;  1MQ2 A;  4NLZ A;  4UB4 A;  4XA5 A;  4MF8 A;  2B51 A;  3H38 A;  7ICU A;  2BCR A;  8ICV A;  3HX0 A;  4JLX A;  3JYY A;  3AU6 A;  3UQ2 A;  4KLG A;  3B0Y A;  9ICV A;  3HJ4 A;  1ZQN A;  1JN3 A;  4FHY A;  2M2W A;  5J2K A;  1WOT A;  3UXN A;  4LZD A;  8ICR A;  5HRH A;  1RZT A;  4JLZ A;  2PFN A;  4Z6E A;  4O5E A;  4R63 A;  1ZQG A;  1ZQD A;  4JWN A;  5J0X A;  3MDA A;  8ICK A;  4FH5 A;  1ZQQ A;  7ICK A;  5HRB A;  1JAJ A;  8ICX A;  2BPG A;  1HUZ A;  5F2V O;  4RT3 A;  4QZH A;  4RQ4 A;  7ICV A;  4UB2 A;  1TFW A;  5J2H A;  3HJ1 A;  4PHE A;  4MKP A;  1ZJM A;  3RJG A;  7ICG A;  2W9M A;  5DB7 A;  1ZJN A;  4KLH A;  9ICF A;  3AQN A;  3C2K A;  3TFS A;  3AQM A;  1MQ3 A;  4K8V A;  7ICP A;  1MIW A;  1PX5 A;  2ZH1 A;  4Z6D A;  4K4I A;  5HRL A;  2ZH8 A;  2PFO A;  4M2Y A;  4AT9 B;  4DOA A;  5J0Y A;  1ZQY A;  4RQ0 A;  1BPE A;  9ICU A;  3PMN A;  4WC6 A;  3UQ0 A;  4O6A A;  5D46 A;  1ZQZ A;  1VJ7 A;  4FH3 A;  1TFY A;  2ZH5 A;  4I29 A;  4NM1 A;  1ZQI A;  3RJE A;  9ICM A;  2ZHB A;  1JQR A;  4QZB A;  2BCQ A;  4RWP A;  3UPS A;  4EBK A;  4YD2 A;  4RPY A;  5BOL A;  3V72 A;  5HRF A;  5HRD A;  5DEC A;  3HIY A;  4QZE A;  5J0O A;  1RPL A;  4Z6C A;  4WC4 A;  9ICS A;  3RH4 A;  4I2G A;  8ICG A;  4X4O A;  4RWN A;  5CHG A;  4P2H A;  8ICJ A;  8ICU A;  5DDM A;  4WC7 A;  4K4G A;  4O5K A;  5DED A;  4TUP A;  4YMM A;  1ZQC A;  8ICY A;  5CR0 A;  1HUO A;  8ICH A;  4OAI Z;  3B0X A;  4QZ9 A;  4I2E A;  4PHD A;  4NLN A;  4QZF A;  4OAF A;  4XQ8 A;  4DOB A;  4K96 A;  4PGX A;  1R89 A;  8ICS A;  3C2L A;  9ICJ A;  4I2A A;  3AU2 A;  4WCW A;  2PFQ A;  4AT8 B;  4RQ6 A;  4MF2 A;  9ICG A;  4S3N A;  2FMQ A;  4I2I A;  3RJF A;  4RQ8 A;  4UD4 A;  5IIO A;  4I28 A;  4O5C A;  2M2U A;  3RH5 A;  1BPD A;  4NXZ A;  9ICP A;  3RJJ A;  4WC1 A;  4UAW A;  1ZQM A;  4O68 A;  3LK9 A;  4YD1 A;  7ICN A;  5IIL A;  1ZQB A;  4YMN A;  4K99 A;  3WFO A;  4RQ5 A;  2DR5 A;  4KLJ A;  3C18 A;  1YLQ A;  9ICN A;  4K97 A;  4NM2 A;  7ICI A;  4TUS A;  2ZH3 A;  4O69 A;  4WBY A;  4MFF A;  4KLQ A;  2PXI A;  9ICR A;  3C2M A;  4PH5 A;  5IIJ A;  4F5Q A;  2GWS A;  5HHI A;  4X4U A;  4KM5 A;  4IQU A;  3UPQ A;  4QZG A;  4LVS A;  2O1P A;  2RFF A;  3AQK A;  2DRB A;  4IQV A;  4TUQ A;  4LEY A;  4UB5 A;  2PFP A;  4I2D A;  3WFS C;  5CP2 A;  4R65 A;  1ZQW A;  4M9J A;  4M04 A;  2VAN A;  1ZQX A;  3JPS A;  9ICL A;  5J2J A;  5DB8 A;  3RH6 A;  1BPY A;  5J0W A;  5J2E A;  1ZQJ A;  1ZQA A;  4P4M A;  4K98 A;  4YMO A;  3H37 A;  3OUY A;  9ICB A;  4WBZ A;  2ZH7 A;  5IIK A;  1ZQV A;  4PPX A;  5DBB A;  2FMS A;  4LZG A;  4IG8 A;  3C5F A;  2ZHA A;  4P4O A;  4FHV A;  5J2B A;  5J2A A;  7ICT A;  1MIV A;  5J2G A;  2ID1 A;  4X4N A;  1UEU A;  4M0A A;  1ZQF A;  4K9B A;  2PBE A;  4PHA A;  5HHH A;  5J2I A;  4XUS A;  1XSP A;  3PNC A;  4X4R A;  5HRK A;  1ZQL A;  2ZH9 A;  5BOM A;  9ICE A;  4NXV A;  8ICI A;  1OU5 A;  8ICC A;  4XQ7 A;  4K9A A;  2DR7 A;  4GXI A;  5HRE A;  4KLD A;  3JPO A;  1ZQO A;  4EBJ A;  1ZQE A;  4NLK A;  4DO9 A;  1BPB A;  4RWQ A;  4RPX A;  5J0R A;  4FHX A;  3MBY A;  4LT6 A;  4X4S A;  2DVI A;  9ICC A;  9ICH A;  3MGI A;  5IIN A;  4QZ8 A;  3RJI A;  2BE3 A;  2BPF A;  4WC3 A;  4NKU A;  5J29 A;  4QZI A;  1BPZ A;  3JPN A;  4KLI A;  1TV9 A;  2M2V A;  3ISD A;  5DDY A;  4TUR A;  8ICM A;  4UAY A;  4K4H A;  1ZQR A;  5J0U A;  2DR9 A;  9ICW A;  9ICQ A;  5HRI A;  4IQW A;  1FA0 A;  3NYB A;  5IIM A;  9ICA A;  4OAG A;  4PGY A;  4AT7 A;  7ICQ A;  4KLL A;  3OV7 A;  4Z6F A;  1Q79 A;  4EP7 A;  3JZ0 A;  3C66 A;  3HWT A;  4O67 A;  5HRG A;  4UAZ A;  4KLU A;  4F5P A;  4PGQ A;  4FO6 A;  4I2F A;  4MFC A;  9ICO A;  4KB6 A;  1NO5 A;  8ICO A;  7ICF A;  8ICW A;  3WFR E;  4AT9 A;  4KLM A;  3OVS A;  4RQ3 A;  3V7K A;  4F5N A;  1KNY A;  1UEV A;  4X5V A;  4FHP A;  5CA7 A;  1TVA A;  2M2T A;  2IHM A;  4YN4 A;  4X4Q A;  7ICS A;  3TFR A;  3H3A A;  5J2F A;  7ICM A;  2O5A A;  7ICR A;  2NRK A;  5J0Q A;  3ISB A;  8ICL A;  3RJK A;  3ISC A;  4M47 A;  4LEW A;  4RPZ A;  5HC9 A;  4AT8 A;  2HHP A;  8ICE A;  4LEZ A;  4UBB A;  1XSL A;  4YCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...