4AUAA

Liganded x-ray crystal structure of cyclin dependent kinase 6 (cdk6)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
291
structure length
256
Chain Sequence
b'QQYECVAEIGEGAGKVFKARDLKNGGRFVALKRSTIREVAVLRHLETFEHPNVVRLFDVCTKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLATLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 6
publication title Fragment-Based Discovery of 7-Azabenzimidazoles as Potent, Highly Selective, and Orally Active CDK4/6 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 256
sequence length 291
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4auaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4auaA01
3UPXA 5BMMA 5A4LA 3OROA 3IW6A 4B7TA 5C4LA 4G3FA 4K0YA 5ETFA 2QG5A 1M7QA 1ZZ2A 2G9XA 1JNKA 1K2PA 3ELJA 4ONAA 3TUDA 1R0EA 2OJJA 4EORA 5E8WA 4ZSGA 2FO0A 2QR8A 2VTTA 3FYKX 2BKZA 3FZSA 4XOYA 4H39A 4FTMA 5IKWA 3MH0A 2V55A 4UMPA 1SVEA 4L43A 5FRIA 3ROCA 3SLSA 3OTUA 4AE6A 4AGUA 3S1HA 5KMJA 2YLEA 4FIFA 5J95A 1BX6A 2QOCA 3F5GA 3NR9A 2QHMA 4GJ3A 4QP4A 4ZTHA 4G6OA 2QOFA 4C35A 2X2LA 4HVGA 3NNUA 4FTIA 5E1EA 3U4UA 4MXZA 4ZTSA 3LFSA 4FTTA 2C3KA 3HMOA 1MRYA 3B8RA 3ZM4A 2XP2A 3NEWA 4RMZA 3Q5IA 5GINE 3KVXA 3IW4A 4H3BA 2BDFA 4R3PA 1GOLA 3FSKA 3E5AA 4JLCA 4UN0C 2UW3A 4BBEA 1ZOGA 3BLRA 5DT0A 1WCCA 5DEYA 5E90A 3F7WA 4MNFA 4PMPA 4EYJA 5IEVA 4OUCA 4I22A 3DOGA 3UE4A 3GI3A 4IAAA 3TZ7A 5HLWA 2FSTX 2YM5A 4KINA 3DKOA 2UZEA 4X2GA 1ZMUA 3CCNA 3QQLA 3DS6A 4O2PA 2GNHA 4YUQA 3BLHA 3PP1A 4CFFA 3FMKA 5CSPA 3PYYA 4RJ7A 1UA2A 5HLPA 4O83A 4D1ZA 2V22A 4DGNA 4PMSA 3O23A 5I9YA 3BGQA 3LOKA 4M12A 4GV1A 1IAHA 4ZK5A 1SVHA 5HTBA 1NVSA 4R78A 3MI9A 3VJOA 1V0PA 3N9XA 5FLFA 3GFEA 4ALUA 4JRNA 1ND4A 3QRTA 3R01A 4QMTA 4H05A 4W8DA 3WF5A 5CU2A 3UTOA 5CASA 1Q61A 1XH9A 4IMYA 2YA9A 2HYYA 2Z7QA 4YBKA 3GCSA 2B9JA 3C0GA 5EW8A 4CFNA 1APME 1FQ1B 3JXWA 4MQ1A 3KCFA 4FKRA 3CPBA 5ACKA 5BVDA 2WMUA 5HG5A 4OTPA 3BYUA 3OXIA 3WZJA 3K5VA 2YWPA 4HGSA 3F2NA 3ZU7A 4E6QA 4L68A 3BYSA 3BYVA 3OWJA 2XA4A 2XIKA 3CTHA 3ERKA 4S34A 5HIBA 2Y6MA 2BIYA 4TYHB 5DPVA 2C3IB 4K6ZA 5HICA 2CDZA 4OTDA 4EH6A 5T68A 5AUWA 4EH9A 4BKYA 3PVUA 3IPHA 4D0WA 3AXWA 3DT1A 2OH4A 2Z7LA 4DGLC 2OF4A 3PY3A 4PQNA 3QLFA 4DEIA 5JEBA 4U81A 3R9HA 1ERKA 3BYMA 3T9TA 3EN6A 3UO4A 3V5LA 3V5WA 4C7TA 4TT7A 4QPMA 4L53A 4M0ZA 2NRYA 2BALA 3M11A 3OY3A 2YM6A 2R3IA 4DEAA 2BRNA 1KV2A 3DB8A 4E1ZA 4O86A 3R2BA 5DI1A 2B9HA 4Y95A 5C8NA 3FBVA 4F7SA 1KOBA 2GTNA 2WFYA 2ZM4A 3L1SA 5FP6A 4J8NA 2R7IA 1E1XA 5DA3A 4F9BA 2XEZA 3OWLA 5J1VA 4ZJIA 3MV5A 4C4JA 2PVRA 3CIKA 4KIPA 2XK8A 3LFQA 4AAAA 4AT4A 3P4KA 3PRIA 4FTLA 4K18A 3FZPA 3DBDA 2PUPA 3EWHA 3HDNA 4BI2A 2ZDUA 3BV3A 4ACMA 3JVSA 5EHLA 5CF6A 1VYWA 4O0YA 4YPSA 3C0IA 5LARA 3UDBA 3DQWA 4RC2A 3A62A 3PXZA 2J9MA 4FZDB 2P55A 3R28A 5L4QA 4J98A 2YZLA 2HELA 3ZDIA 4ZSEA 4D2RA 3UZTA 2W96B 3T8OA 5L2WA 1XO2B 5AP6A 5F20A 4M68A 4KD1A 3FV8A 3RK9A 4XUFA 4Y72A 2WTKC 4OW8A 3AC2A 3SVVA 3QX2A 5CT0A 1PXKA 3GFWA 4FEXA 1J1BA 4MTAA 4O0RA 4X2FA 3NVMB 1NVRA 4E7WA 5AIKA 5CAQA 4DH3A 4O7ZA 2ZAZA 2GS7A 3OMVA 2W5AA 2G2FA 3G6GA 4IAFA 5E8ZA 4WIHA 4JX7A 4EHGA 3FLNC 2OJIA 4GMYA 5LVMA 2R0IA 5A6OA 3Q9WA 4HYHA 4F7NA 4FT5A 4JQEA 4FUXA 3QC4A 4GFGA 4MWHA 3QC9A 4FSNA 3LCKA 5A6NA 4FX3A 3LMIA 1ZOEA 2XB7A 3H9FA 4GT3A 4F1MA 4O96A 4C33A 4X21A 3CC6A 4YC6A 4EL9A 2XK3A 1H26A 2GU8A 2OI4X 5JZNA 4XYFA 1YDRE 2UVYA 3QKLA 2ITTA 4XEYA 3SD0A 3EQIA 1NY3A 5EI8A 3ZO3A 4ERKA 2C30A 3LMHA 4ZMFA 4HPTE 1YXXA 3SG9A 1Q62A 5HBEA 4D5HA 3HA8A 4O21A 4YNOA 3RM7A 3Q4CA 4OAUC 3DQXA 4HVIA 5GIPE 1GY3A 2ITXA 3A7HA 3CGOA 5H8BA 4X2KA 2X4ZA 4UB7A 5JN2A 1VEBA 2XEYA 3ALOA 3W2RA 3PIZA 3CKXA 3CQWA 2JDRA 1ZYJA 3FHIA 4GFOA 4EOOA 1M2RA 3HVCA 4RWIA 4I0RA 3G15A 3I1AA 2R9SA 4FV4A 4F4PA 3NDMA 3U4WA 4A9TA 3P5KA 4D2VA 2R3HA 3HRBA 2PUUA 3UYTA 4CQEA 2VWWA 4CFVA 2W7XA 2VTHA 1PF8A 3PZEA 5ANIA 4R7IA 4EYMA 4F70A 4ANOA 4XG4A 2PZ5A 4X0MA 4AZVA 2XIRA 4QMOA 4QTCA 5AP0A 5KMNA 3FLQA 2XM8A 5D9HA 3QQGA 5DHJA 3VRZA 4J52A 5CTPA 1H1QA 5M06A 3HRFA 1R39A 3ZCLA 2VTLA 3A7GA 3E8EA 2WTVA 3GC0A 4FL3A 1Q8ZA 2HXQA 3FI3A 4BRXA 2QOIA 2A19B 2XNPA 3RNYA 3H0ZA 2QKWB 3LFCA 4A4OA 5LVLA 4N57A 3GCPA 3WZDA 1KE9A 2JEDA 4AGWA 2QLQA 5HIEA 1H1WA 3IDBA 3LAUA 4UALA 4O7WA 3EN4A 3DJ5A 3FZTA 4IDVA 3BBTB 3NX8A 3TTIA 2YCQA 3OCBA 1UU8A 2VX0A 5TO8A 4ZTQA 1MRUA 4D1SA 4YLLA 3VS7A 4PWNA 3PY1A 4G34A 5KUPA 4M8TA 1OMWA 3IGGA 2W0JA 3QQUA 3LVPA 4TZRA 4XBUA 3E3BX 4BCMA 5JRSA 4LGGA 2UZWE 4IAZA 1SMHA 4BDGA 3C5IA 4RT7A 4NKSA 5LQFA 4FT3A 4BKZA 5JFWA 2WB8A 2H8HA 5HKMA 5I9ZA 2W1CA 3AC5A 4FL1A 4AUAA 3GENA 4NKAA 4QYHA 3DBFA 3RMFA 3T3UA 3UNZA 3CY2A 4AOIA 5BX0A 1QMZA 3EL8A 5DRDA 3OBJA 2YAKA 2YIWA 2YISA 3HV7A 3R71A 4FVQA 4YHTA 4HVSA 5I5ZA 3AC3A 4MYGA 3EFLA 2Y4IB 5JGAA 2X4FA 4BDBA 1WMKA 4I5MA 4E6AA 3EHAA 4RZWA 4I24A 3WF9A 4FK3A 1P4OA 3OG7A 2JKKA 3MDYA 4RIXA 5DNRA 5KKRB 3ACKA 5IDNA 2YITA 3A8WA 1BKXA 2C6LA 2WU6A 1OM1A 2JITA 4GK2A 3VUMA 3GCQA 3BHTA 1GAGA 3R04A 4XG9A 3EQHA 4NW5A 4X3FA 3HUCA 4BTJA 3A61A 3RAHA 3EKKA 5JK3A 2C6TA 3COIA 2GNLA 3AGMA 3VF8A 1U54B 3R2YA 4U43A 3UOKA 2GPHA 2PMLX 4YLJA 4NM7A 1OBDA 4WG4A 3AC8A 4BTFA 3V01A 3DZOA 3LCSA 2C6MA 2O0UA 3EIDA 1ZLTA 4H58A 4UY9A 4EC9A 5JMSA 2OKRA 4F7JA 4FVPA 3R7GA 4EWHA 2WMSA 4L7FA 5DIAA 1UWJA 4DINA 3W10A 2WHBA 3UO5A 3RCDA 5EQEA 2PVFA 3FHRA 2YIQA 5CSHA 4JRVA 4MEDA 4BWKA 2WQNA 2C3LA 2YIXA 3BEAA 3P23A 4LFIA 2X81A 4JDIA 2F2UA 4QO9A 3W16A 4AU8A 4UBAA 2IZSA 2C1AA 4HPUE 4ZJJA 2ETKA 3TV7A 4AA4A 3L8XA 5CVHA 3O50A 4IC7A 3RNIA 3W33A 1B38A 4L3PA 3R1NA 4CXAA 3TUCA 4CT2A 3RPSA 3TL8A 2GHLA 4OBQA 5HVYA 5DYJA 1R0PA 2B7AA 3ODZX 3P08A 4IB0A 4UEUA 3RPOA 4EHZA 1P5EA 3DXPA 4OT5A 1V0OA 1YI3A 2XBAA 2P2IA 2GFCA 2JFLA 3PA5A 4GL9A 4IC8A 5GJDA 5IA5A 4BBMA 5D10A 3E7OA 5ETCA 5CEIA 1PXOA 5I0BA 3I81A 4PDSA 4WUNA 5TT7A 4X2JA 4ZLOA 1XBBA 2ERKA 3PPZA 2IVSA 2X1NA 4ITJA 3NUPA 3G9LX 3MJ2A 4GG7A 2BRBA 5M07A 1W7HA 3E8CA 3E8DA 3SHEA 5AV4A 5HHWA 4AZSA 4RG0A 1Y6BA 2IPXA 2WEIA 3UPZA 4RX9A 4A9YA 3MY1A 3RWQA 2KULA 3GC9A 3QA0A 1LR4A 2XUUA 4JIAA 1E1VA 4HCTA 2GNIA 4Z7HA 4L46A 4FV3A 4BY9E 2B4SB 2F57A 5TE0A 1MP8A 4HNFA 1P14A 3LM0A 3PVBA 3CTJA 1UNLA 1M14A 2CGWA 2UZVA 3C5UA 3NAYA 4KBCA 3TNIA 4CRLA 4DLIA 2XK6A 4YSJA 5JH6A 2FVDA 1Q41A 4FV9A 2ZV7A 4DEHA 4CT1A 1KE7A 4BI0A 3FUPA 4CFUA 4R1YA 4GYGA 3L9LA 4AFJA 4MNEB 3R30A 5GHVA 1VR2A 3CE3A 4UZDA 1OKYA 5AUXA 4LUDA 5C8KA 3I60A 1G8AA 4JVGA 2PK9A 2UZLA 4G9RA 4P4CA 4PX6A 2QONA 3PJ2A 4X3JA 5AUZA 5IF1A 5M4CA 5HLNA 2RFNA 2FGIA 2YZAA 3QALE 4Z9LA 3V8WA 4CTBA 4BWPA 1ZMVA 3GU5A 2QG7A 4FA2A 2VWXA 5E7RA 2BUJA 3S0OA 5A4EA 1JKSA 5K0XA 4DAWA 3PE1A 5ANJA 4C3PA 4USDA 4XOZA 3QF9A 1YXVA 3A7JA 2A27A 1UKIA 2UW8A 5HU3A 2CLQA 2JDVA 4YJVA 4S30A 2QR7A 4C2VA 2PVLA 5HIDA 5D7AA 1CKJA 2UVXA 3RPRA 1Y91A 3FLZA 3NNXA 5K4IA 2F7EE 3P1AA 2W5HA 2OICA 4XP3A 3KFAA 1TVOA 1OL5A 2BFYA 4I3ZA 4U3YA 4GVAA 4IB3A 4QP8A 4ZIMA 3MESA 4F6UA 3FMMA 3F5PA 3OZ6A 3F2RA 4QPAA 2IW9A 2YERA 5LMBA 2PE0A 4FVRA 4TKSA 4FBXA 3PUPA 4FV0A 5EYMA 1SNXA 2ZMCA 4E4LA 2YHVA 3LLTA 3M1SA 3ZEPA 1SZMA 4EQCA 4BHNA 2FB8A 4YZBA 1KE8A 3C50A 1UWHA 3UP7A 5HZNA 3DKFA 4IACA 4QMPA 4RJ8A 5J9ZA 4UMQA 5J5SA 4OTQA 4P90A 3BE2A 1W8CA 3COKA 4P7EA 4RX7A 2YLFA 3PP0A 4GH2A 2QVSE 3TNWA 3AC1A 1XH7A 1U54A 3OUNB 4L52A 4TRLA 4X3FC 5EK7A 5C27A 2ZDTA 4BICA 5HTIA 4YJOA 1OBGA 5HBHA 3E62A 3BU5A 3F3VA 2XNMA 4D1XA 3Q3BA 1ZXEA 5AFVA 2UW5A 5IUIA 3D94A 3R83A 3FL5A 4DA5A 2X9EA 3QXPA 2WQBA 3OCTA 2OIDA 3SXSA 5I3RA 2V7AA 2HWPA 2V7OA 1U5RA 4BDFA 4LMUA 1A9UA 3QZGA 4Y73A 2ETMA 3R0TA 3P0MA 2XNEA 2BVAA 5F1ZA 1PXMA 3VS3A 3UNKA 3KXZA 4YHJA 3UVQA 3H4JA 3Q2JA 4A9SA 2XNGA 2OXYA 4QNAA 1FBNA 3E7VA 4KBAA 3TJCA 1FMOE 3FI2A 2XIXA 2XJ0A 2W06A 3D2KA 4KWPA 4N70A 4YPDA 4EZ7A 3BHYA 3ZSGA 2BDWA 3WIKA 5CSWA 2CJMA 3H9OA 4FIHA 4QMSA 4DN5A 3LIJA 4LRMA 1UU7A 3MY0A 3COHA 3D14A 3QD0A 3RVGA 2FSOX 4ZY4A 3F82A 4EOIA 3DBQA 2ONLC 4WKQA 5CX9A 1F5QA 3QU0A 4A9RA 3RZBA 4IANA 4ZEGA 3UC3A 4BZNA 3CP9A 1W83A 2UZBA 1O6LA 2XJ2A 2GQGA 2ESMA 3DPKA 3IS5A 4HYIA 4IWPA 4JOAA 5FEDA 4YTCA 5KCVA 2UZUE 4ZS4A 5LCJA 3I5NA 1MQ4A 4I5HA 3F3WA 3OBGA 3WE4A 1WBOA 4TYGA 2AUHA 4QP9A 3ORPA 3AG9A 5J7HA 4Y8DA 4B9DA 2OFVA 2C3JA 1FVTA 2I6LA 3GQLA 3MFSA 3P86A 5DOSA 3U6HA 1YWRA 2CPKE 4XJ0A 3ZO4A 4C38A 1YI4A 3D5WA 4JAJA 4ACDA 2IVUA 5CQWA 2OBJA 3ALNA 3KXNA 2O3PA 3C51A 3VNTA 2WTJA 4CFXA 3F69A 5L8LA 3DAKA 4ZSJA 5JGDA 2WAJA 2B54A 3Q5ZA 4E5WA 4KS8A 4L3JA 3LXLA 4O6EA 3RZFA 5LVNA 4BDCA 1UU3A 4XG3A 5JZJA 3HMPA 3PDTA 2Z60A 4YC3A 3VHEA 5LJJA 2H34A 1CM8A 3TIZA 4DC2A 4FEQA 4DH5A 5BUJA 3OT8A 5IDPA 5K5NA 1U5QA 4WNOA 1YOLA 5IEXA 5ETAA 2EWAA 3QUEA 2WMTA 2JDTA 4I92A 4IBMA 4BL1A 5AA8A 5IH4A 2OJ9A 5D1JA 3DGKA 4R3CA 4KIKB 4NSTA 5L8KA 3QCXA 4CFMA 3AD6A 2WD1A 1Y6AA 1LPUA 3KK8A 3QXOA 2WMWA 4UXLA 3FC2A 5CSXA 3MVJA 5E8YA 4J95A 3DTCA 2PE2A 4I5PA 4K1BA 5EYKA 1H28A 2C6DA 4MK0A 5E8XA 1QCFA 3KMWA 4EBWA 4ENXA 5IQEA 4MF0A 4RQKA 5HNBA 4HGLA 4AA0A 2XK7A 3ORIA 5AIRA 5GJGA 3W8QA 1DI9A 3WZUA 3A4PA 5IUHA 1YXUA 3HECA 4CD0A 1RQQA 3ZLYA 4OT6A 5IQIA 4ZZNA 3RGFA 2GCDA 3UOHA 4XCUA 4D2SA 3TEIA 2PMNX 3UZPA 1Q97A 3GVUA 2FSLX 1Q5KA 5L2SA 4YJUA 2HWOA 4IB5A 3ZBXA 5KMIA 2Y4IC 3VIDA 3MFUA 4ANLA 1M2QA 3BYOA 1IASA 2BPMA 3KCKA 2RF9A 4JL9A 4WRSA 1QPCA 4U6RA 1F3MC 5J87A 3EN5A 3UVRA 4TYIA 5KKRC 2UZOA 4M7IA 4WNPA 1IEPA 2X7GA 2ZV9A 4D2PA 1XH8A 2VU3A 3DAEA 3QUDA 4CV8A 2QHNA 1OKVA 3BWJA 3TIYA 5JRQA 2IW6A 2WTDA 3FMHA 3NS9A 4QYGA 3QD3A 4IAKA 5EYDA 2EU9A 1ZZLA 3DK3A 4WD5A 4FYOA 4X6RA 3PXQA 4HNIA 1BI8A 4D2TA 3G0EA 3QRUA 5J79A 1VYZA 2BAJA 3I6WA 4RA5A 2EB3A 3NPCA 4CG8A 3LKMA 1Q3WA 2JKOA 3HEGA 1IA8A 3VW6A 1GZKA 4BDAA 4EK3A 3PA3A 4FC0A 4FSYA 4MX9A 1BI7A 3FJQE 4DHFA 4ORKA 4BCGA 1PXJA 3ZM9A 1BUHA 4F0GA 5HVKA 4DH7A 2A4LA 4IZYA 3UOJA 4D0XA 3EJ1A 1UNGA 3NWWA 4LG4A 4RPVA 1JLUE 3Q6WA 3IG7A 4FIJA 5CQUA 3MSSA 5D11A 4FK6A 5BYZA 3SRVA 4U41A 5EDRA 1PXPA 2W1EA 3S95A 4Z3VA 3OFMA 4TN6A 1PRYA 3C13A 4W8EA 5CY3A 3JY9A 1TQIA 3FPQA 3KULA 5CF4A 1F0QA 3VS5A 2VWBA 5IA4A 2ITWA 4IAYA 2W1DA 4G16A 1FVVA 3KEXA 4QPSA 4XV1A 4FSUA 4I1ZA 1OPLA 2C4GA 4AZFA 4WT6A 4QQ5A 4KB8A 2JAVA 4F99A 3KXGA 2JIVA 1Q3DA 3EQPA 2J5EA 2PE1A 3BBWA 4E26A 2W1FA 2WPAA 3IDPA 3BKBA 3QTSA 3NUAA 2F7XE 4ZXTA 1OPJA 3ZLSA 3HV3A 2VWUA 4G2FA 4QMXA 4JR3A 2R0UA 5A9UA 3U9NA 3BRBA 3IGOA 4U3ZA 5DMZA 4BCNA 1IR3A 3ZRMA 2QC6A 2Y6OA 3JUHA 4FKVA 3D5VA 3SGCA 5FGKA 5ANDA 1PW2A 4FZ7A 4G5JA 4ALWA 5ACBC 4FKSA 3TNHA 4NTTA 1EH4A 2Z7SA 4UWYA 4QMUA 3FLSA 3UO6A 4F9WA 3V5TA 4YJPA 2GNGA 4GFMA 1GJOA 1PXLA 4J96A 4IM0A 3V5JA 4HYUA 3O0GA 5AA9A 5KHXA 3F6XA 4LV8A 1PMVA 2F49A 1S9JA 2O2UA 3OUKA 1W0XC 5CVFA 5L6WL 2CNUA 4FSRA 4H1MA 2CGVA 4JXFA 3AT3A 4USEA 4FTQA 1SNUA 3E63A 4PL3A 1Z5MA 2ETRA 2WKMA 2J50A 4TWPA 1PJKA 3HP2A 3VC4A 2F2CB 5HX8A 4EJ7A 4KIKA 5DT4A 4NK9A 3QTWA 1J1CA 3FXZA 3QBNA 5EDPA 3KF7A 4IFCA 2Y7JA 2Q83A 4PPAA 3UGCA 3UMXA 2G2IA 3MFTA 4DH8A 5L6PA 3UOLA 4NJ3A 1TKIA 2DYLA 4FKIA 4U45A 2AC5A 3MA6A 2X7OA 3Q4TA 3O8PA 4YLKA 3NYOA 3UQFA 4G3DA 4GIIA 5AAFA 4AT5A 3KA0A 5M51A 2X8DA 3MTLA 4YHFA 5FEEA 4R7BA 4EOSA 4TW9A 4TTHB 3R63A 2QU6A 3MIAA 3SXFA 3BHVA 1GNGA 4BZDA 2C69A 4W4XA 2J7TA 4WOVA 5AP4A 1TQPA 2BZHB 4JBVA 5TR6A 1B39A 4ANSA 4AW5A 5EKNA 4YBJA 4NUSA 2VWVA 5IQGA 5CYIA 5FP5A 2I7QA 3OF0A 3K5UA 4XP2A 3F3ZA 4ZZOA 4AW1A 1Q4LA 3D15A 3KY2A 2WTCA 2R3RA 3QAME 1DM2A 3L9MA 3ACJA 3LCOA 4JQ7A 5DBXA 4BYJA 3EQBA 3SOCA 4KIOA 2HIWA 3NIZA 3UYSA 3ZSHA 4NCTA 3VUDA 4FYNA 3P7BA 4F64A 4C8BA 4K77A 5HU9A 3HP5A 3VBXA 2GMXA 1CMKE 1RDQE 2J0IA 3I79A 4C57A 3OXZA 2XS0A 2XF0A 4L7SA 4M69A 5M4UA 4E73A 5AR5A 4F9CA 3AD5A 4IADA 4AW2A 3ZH8A 5AADA 4EK4A 3Q60A 3WOWA 3LW0A 4A4XA 2HY81 4YJRA 5F95A 1OPKA 3U87A 4AQCA 2VO6A 3VUKA 3F88A 3Q9YA 4QQCA 2LAVA 4C34A 3A60A 4RIXB 4CYJA 3DU8A 2WNTA 3FAAA 3R8UA 3ZUVA 4UMUA 3B8QA 3C0HA 3LMGA 3IW5A 4U5JA 4BVUA 5HO8A 5M08A 3DDQA 4FG7A 1GZNA 2UZNA 3M2WA 4OAVB 3S00A 4F7LA 3I4BA 4X3FB 4U0IA 2UW9A 4L00A 4PDPA 1ZY5A 3EN9A 4CMUA 3KMUA 4D28A 3CXWA 4FT7A 3SW4A 3GP0A 3IOPA 2UW7A 3G2FA 4LUEA 4FZ6A 3TWJA 2JKMA 4FTNA 3DK7A 5AP2A 2C6EA 4G31A 5AMNA 1H0VA 4LL5A 4R6VA 4ARKA 3D5UA 4G17A 4QT1A 5I3OA 4XG7A 4YJTA 3R8VA 3QHRA 3DLZA 2JIIA 2XVDA 3A4OX 3MVHA 2J4ZA 3MH3A 4TWCA 3LXPA 4RWKA 5CNOA 2QOLA 4NM5A 3LFNA 3TN8A 3EZRA 4FNWA 5AR4A 3W2OA 1H07A 3PWYA 4DG2E 3DFAA 4F6SA 2R64A 3VQUA 4BCJA 5M44A 5HESA 4PUZA 2CKPA 5EM5A 3C4EA 1X8BA 2X8IA 3FQSA 3QYZA 1H00A 3QYWA 4Y85A 3GCUA 3CD8A 3B2TA 4UYNA 5TKDA 2DWBA 5KE0A 5AAGA 2OO8X 1J7IA 3CEKA 5CVGA 3W2QA 2JDSA 5AP3A 4AZTA 4DFZE 2C0OA 3ATSA 3BGZA 3BEGA 3MVMA 3QQFA 4QRCA 5BMSA 3U54A 2UZTA 2XCHA 2C5NA 3TKHA 4DGMA 4EH3A 5H3QA 4O0WA 2RFEA 4KIQA 5HG7A 5CALA 3QZIA 4NFNA 3ET7A 2XM9A 2XZSA 3MTFA 3LQ5A 2LGCA 2PPQA 2VO3A 2YEXA 1GZOA 3PA4A 2VAGA 4LMNA 3ZXTA 1J3HA 1OUKA 4P5QA 3MH2A 2UUEA 3HZTA 3ORMA 1ZYDA 3FMJA 3H9RA 4DLJA 4G3GA 1ZRZA 3QTRA 4I4FA 5FXSA 5EKOA 4APCA 4AZWA 3LZBA 4MBLA 2ZMDA 3NZ0A 5BVOA 4BDKA 3BI6A 2CN8A 3REPA 5CAOA 4GT5A 4DFUA 2FH9A 4GU6A 4KS7A 4V0GA 4I6HA 4GYIA 4KKGA 5AX9A 3IKAA 1ZOHA 4BZOA 4YMJA 3NUYA 4U42A 1W82A 2RFSA 4MWIA 1OECA 5FEQA 2W4JA 3E92A 3EFJA 4AN3A 4ERWA 2W4KA 4YO4A 3LQ8A 3SG8A 5IPJA 2VD5A 5CU4A 5E91A 5B7VA 1Q8YA 2XNNA 3KGAA 1OL2A 3QRIA 3FI4A 1W84A 5AAEA 5DEWA 3TI1A 2BHHA 5DE2A 5DH3A 3E8NA 4A7CA 4IAIA 2X2KA 3NW5A 5EOBA 3W18A 4MCVA 4AGDA 4B8MA 4D58A 5JKGA 3PG3A 4LOQA 3NCGA 4UMRA 2QO7A 4PL5A 3LE6A 4C61A 4MKCA 5IQHA 4QP6A 2BZJA 3DNEA 3F2AA 4ACHA 3OEZA 1ZARA 5EW3A 1WAKA 4YR8A 4DBNA 3I7CA 3MFRA 4B99A 5BPYA 3VQHA 2XKEA 4JNWA 2W9ZB 3QQJA 3UG2A 4M84A 2W1ZA 3L8PA 4XLVA 4NCTC 4O0TA 4RIYA 2JKQA 4FSTA 2VTIA 4EK8A 4N6ZA 3O2MA 1OIRA 5AX3A 2ITOA 3LQ3A 3COMA 1ATPE 4G6LA 2QLUA 3BGPA 2EXMA 5CEPA 4BCIA 5FBOA 2OW3A 3KRXA 1WBPA 4AXAA 2J5FA 2OJFE 4FL2A 2PVKA 4H36A 3GNIB 2UW6A 3BQCA 4O0SA 4MD7E 4C4IA 1LUFA 4XG8A 3H3CA 3BU6A 4QMLA 1JBPE 5AUTA 4G5PA 4UV0A 2YWVA 1XQZA 2FSMX 3BQRA 3PTGA 2H9VA 4L67A 5AR7A 3BWFA 2PULA 3KREA 3OCGA 3VN9A 3AT2A 3EYGA 5GNKA 4RJ3A 4YURA 2XKFA 4XNEA 1PMUA 2G2HA 2YDJA 4I41A 4J1RA 5L2IA 2BRMA 3VBTA 4EZ3A 2A0CX 4C0TA 5CI6A 4RIWA 4O7VA 1YVJA 4R7HA 2BFXA 2I40A 3ULIA 3CY3A 2ZJWA 1V0BA 2HCKA 1RJBA 2ZVAA 2O8YA 3WI6A 3U51A 2ITPA 4FICA 2XK4A 5BQ0A 4RA4A 2CCIA 5FTGA 4FZFB 2IZTA 4IX4A 5HE2A 4IH8A 4AS0A 1HCLA 3QD4A 3VVHA 1ZAOA 4WNMA 3FDNA 2X7FA 1IA9A 4NIFA 3CSVA 4EQMA 5AP1A 2CNQA 3TZMA 4NH1A 3UC4A 3VW8A 3MH1A 4YGAA 4S33A 2OK1A 4RGJA 2J0JA 4S2ZA 4EI4A 4USFA 5AV1A 3O7LD 4H3QA 3A7FA 3R8LA 3KRLA 4LV5A 2PU8A 3I7BA 3IOKA 1H4LA 4O7YA 2QO9A 4FTKA 5CI7A 3GUBA 4FODA 5BNJA 2WIHA 5DR6A 4HZSA 4KKEA 4LQMA 4RQVA 4QOXA 5KHWA 3RK5A 3R9RA 2WMAA 4XHKB 4A07A 1MUOA 3D4QA 4ZP5A 5IQAA 3RAIA 4BB4A 4CSVA 4IQ6A 4P5ZA 4FV1A 5H2UA 5TOZA 2XRUA 3R7EA 4EUTA 2IW8A 3U6JA 5AR3A 2I0HA 4TYJA 5K0KA 3FQHA 4MXOA 4KBKA 4OBPA 3VJNA 2VTNA 1FGIA 2E9UA 3CLYA 4FNYA 3SDJA 3ZONA 4ASZA 4KRDA 4FEWA 3MWUA 2HY0A 4NFMA 3HAVA 3DY7A 4EH7A 1XR1A 2R2PA 3KB7A 1U4DA 4IWDA 5EM8A 4Y83A 4AGCA 4APPA 2XIZA 1H8FA 2P0CA 3WBLA 1YOMA 1BL6A 4FT9A 2B9IA 1Y8GA 4NWMA 4GKIA 4RJ5A 2C5YA 2W17A 3CBLA 1XH6A 4II5A 3LCDA 4FKOA 5IH6A 1WBVA 3FKOA 4EONA 4RX8A 3G5DA 1CKIA 4LOOA 3B2WA 4Z16A 4RBLA 1BYGA 5ANOA 3PJ8A 4PTGA 3ANQA 3U9CA 1JSTA 4E4NA 2J2IB 4PP9A 4EOMA 5E8VA 4JX3A 2VN9A 4ITIA 5A14A 4RWLA 4V05A 2GHMA 3NNVA 2CKOA 4XRLA 2WTWA 1ZY4A 1PY5A 4JS8A 4RRVA 5M09A 2IZUA 4BDIA 3VUTA 3HYHA 3F3UA 1KE5A 4FF8A 5FDXA 2R3NA 4DEBA 2PUNA 2IJMA 2HXLA 5BVNA 3KL8A 4XG6A 2QOOA 2W4OA 2X6DA 3C4WA 4K8AA 4XLIA 3PJ1A 5B2MA 3U55A 5HG8A 2QURA 2O5KA 2YFXA 2F7ZE 2R3PA 1H25A 3BV2A 3R1SA 4S32A 2WQEA 1YOJA 4D9TA 5KNJA 4BF2A 3RK7A 3RTPA 5AV2A 3N4UA 4ZZMA 3G0FA 3TACA 4LOPA 3EKNA 2WMQA 1WBSA 3WYYA 3N51A 5FM2A 3EN7A 3QZHA 4RLKA 2WOUA 4EHVA 5BVWA 2YDKA 3DK6A 3SQQA 2ITYA 1LEWA 5K9IA 4D4YA 3ORLA 3ZS5A 3LFEA 2GQRA 3ZO2A 2NPQA 3MPMA 4JR7A 4OLIA 4RIOA 3V51A 3U8WA 4E3CA 3BHUA 2XK9A 4PRJA 2H6DA 5AM7A 3CTQA 3R7OA 1FVRA 2R3FA 2ZM1A 4Z55A 2UW0A 4CZUA 4D2WA 4BN1A 5A3XA 3NGAA 3QGWA 4M97A 5EG3A 3QWJA 5ANEA 2QU5A 2W1HA 4DGOA 4IHPA 2VZ6A 3D2IA 3EQRA 2R5TA 4O2ZA 2ITNA 3WE8A 4E4XA 3FI8A 2HK5A 3PE2A 2HZ0A 5T6KA 1M2PA 2CGUA 1BMKA 4QTBA 4BDJA 5HQ0A 4M67A 3AD4A 2VTOA 4IDTA 4EHEA 3FQEA 5IUGA 1LEZA 3KU2A 1GIJA 4J71A 4W9WA 4L6QA 3BZ3A 3MS9A 4ZJVA 5CF8A 2HOGA 2EB2A 4FZAB 4AT3A 4FE2A 2VTMA 4EOQA 3AQVA 5JFXA 3TG1A 4TY1A 3CJGA 5E8UA 3PSDA 4MQ2A 4K2RA 2OJGA 4F1TA 1DS5A 4JG8A 3NUXA 4AZEA 1JKKA 2Y9QA 4ASXA 2YACA 1QL6A 2PZYA 2ITQA 3C7QA 4FKJA 4FTUA 4FV2A 4BI1A 4CCUA 5B2KA 4D4VA 4FUYA 2VV9A 2X6EA 4AACA 3Q6UA 3TV4A 4IM2A 4LM5A 4O7RA 3EMGA 3IQ7A 4BCQA 3SRVB 4DGGA 2BRGA 3WARA 1K9AA 3ZMMA 3O17A 4AW0A 3KXMA 4C4GA 2JD5A 3FKNA 5CZHA 2BKKA 5E4HA 3Q52A 5L2QA 4MF1A 5KBQA 4UX9A 4J8MA 3ZDUA 2WXVA 1O6KA 2GHGA 4FI1A 5DN3A 5FG8A 3UQGA 4ANBA 3QCYA 3KULB 2X8EA 2YCRA 4J97A 4KSQA 1Q8WA 2A1AB 5KMLA 3II5A 3BELA 5FUTA 4I6QA 4AE9A 3AMYA 1REJA 2XH5A 4L8MA 1Y57A 2HZ4A 2QCSA 4ASDA 4I5CA 3ZOSA 1O9UA 4AWIA 3UMWA 2XCKA 4DEEA 4LRJA 2UZDA 3PSCA 4I94A 5FXQA 3BIZA 1NT2A 4F09A 4C36A 4FKGA 4QP2A 3HV5A 4U40A 5ICPA 3OS3A 1KSWA 4DT9A 3EOCA 2C68A 2VGPA 3POZA 4DYMA 3V6RA 2YM7A 3SX9A 2QOHA 2BTRA 3BE9A 4RLLA 3THBA 5I4NA 4GIHA 4CFWA 3PLAE 5FTQA 3KMMA 5AUYA 3D7ZA 4ZTMA 2ZV2A 5CANA 3RINA 2C0IA 4EBVA 2HZNA 3UVPA 3BLQA 1J91A 3F7ZA 3RHKA 1BLXA 1IG1A 3OP5A 3GC7A 2YJSA 5HG9A 4ZSAA 1OGUA 4EEVA 2QQ7A 2C5XA 3O71A 3W8LA 5FXRA 3ORKA 4V04A 5HCZA 4FKQA 3UIXA 1YWVA 3VS4A 3RI1A 3LFFA 2VNYA 3ENHA 4O27B 5L8JA 4B0GA 5IA3A 3SXRA 4C4HA 3N4TA 1YHSA 2GDOA 3DAJA 5HD7A 3JVRA 3VULA 1KOAA 5CLPA 3WZKA 4NJDA 5FM3A 3PRFA 3Q2MA 3I0QA 4KA3A 4O7TA 4MXCA 2PZRA 3C9WA 5CT7A 4BC6A 2OFUA 3SAYA 1YXSA 2GFSA 1OIUA 3KRJA 2PVHA 2GNFA 2XBJA 1PKDA 4MD9E 4HGEA 5DRBA 3RALA 4GJ2A 2J51A 5HOAA 3M42A 4GCJA 2WMVA 4N6YA 3SC1A 2CMWA 3JR1A 2GQSA 4FKPA 3HLLA 2YM3A 4ZTLA 3EQFA 3R02A 4RZVA 3G51A 4CCBA 2B1PA 2PMIA 5A4CA 4KKHA 2XNBA 2BMCA 3E88A 4FIGA 4CZTA 3HL7A 1H24A 2CN5A 4C37A 4TXCA 2JBPA 4WRGA 5J8IA 3ZZWA 3D0EA 4HYSA 4C59A 3K3IA 5B2LA 2YDIA 5IZFA 2VO7A 3MB6A 4J53A 5EDQA 4KNBA 2Y8OA 3TXOA 4O22A 3ORNA 2OZAA 1OIQA 4CNHA 2DS1A 4FNZA 3K2LA 3PXRA 4RWJA 4TL0A 3NIEA 3HDMA 4NM3A 5HBJA 2WEVA 3D7TA 1URCA 4IZAA 1QPDA 2XYNA 3RP9A 4FSWA 4RX5A 4ZY6A 3NSZA 2IWIA 4FSQA 3A8XA 5G6VA 1I09A 3NNWA 4ALVA 2OH0E 3LLAA 4YZNA 4F0FA 3NAXA 1KUTA 4RJ6A 3TUBA 4WSYA 3PWDA 4M69B 3P7AA 2WZJA 4AN2A 5C9CA 1YXTA 5IA1A 3TNPC 4AN9A 4CTCA 1Q99A 4GU9A 3HRCA 4IB1A 3R8ZA 2ITUA 5BUIA 3PG1A 4FV5A 4TPTA 5HI2A 3LJ0A 1OUYA 4DFLA 5DT3A 4Q2AA 4E8AA 2B9FA 5JSMA 2IN6A 4HCUA 2BHEA 2W1IA 4CYIA 4PF4A 2OIQA 3MBLA 4GT4A 1XBCA 2P2HA 4AOTA 4PDOA 3HGKA 4CQGA 5DGZA 3FZOA 3OD6X 2WO6A 4IJPA 3O51A 3ZO1A 3HV6A 1M17A 3R9NA 2HENA 4Q9SA 4E20A 3MPAA 1XH5A 1AQ1A 2R3QA 3MW1A 4DITA 5CF5A 4HOKA 4EKKA 5GIOE 4QTEA 4G9CA 3EFKA 1YHVA 4JDHA 4LYNA 5CU0A 5HVJA 4FTOA 4YU2A 3FC1X 1VJYA 2WMRA 4TYEA 2PVNA 2WGJA 4ANQA 4BFMA 4MXYA 4WNKA 5DLSA 4GG5A 1ZYCA 2R7BA 3K54A 3MJ1A 4G3CA 4YZ9A 5HCXA 3WZEA 4FR4A 4JDJA 2X0GA 2KTYA 3FMNA 2WOTA 4YJQA 3POOA 2OIBA 4JAIA 5E8TA 5G1XA 5KMOA 3D83A 1E9HA 4GVJA 4LL0A 4DE4A 3IW7A 3MYGA 2HZIA 4MBJA 3UP2A 3VUIA 4L3LA 4DFYA 3EFWA 1WVYA 2BTSA 3H10A 3OW3A 4GK4A 2VWIA 1JSUA 5EQPA 2WQMA 5K5XA 4CVAA 3HMMA 3I5ZA 4QQJA 4C02A 3WILA 5IQBA 4O1PA 1OKZA 4W4WA 3HAMA 5DVRA 5FTOA 1ZYLA 3R22A 2OU7A 2R3GA 4IX5A 4ACGA 4BCFA 4C3FA 4B8LA 4QMNA 1PYXA 2VUWA 2PVJA 5EHOA 5AR8A 4UWBA 5A54A 3CR0A 2GSFA 3MGYA 4IX6A 4BTMA 2HW7A 4O0UA 5LCKA 4GKHA 4BWXA 5F9EA 5IMXA 1IAJA 1QPJA 3OT3A 4ACCA 3ZLWA 1BL7A 3KRWA 4CV9A 5E1SA 3NW6A 3HX4A 5CS6A 1WBWA 3TDVA 4FIIA 5HNIX 5HO6A 3DKGA 3ATTA 3VS0A 1XKKA 3ZXZA 3PJ3A 3VS2A 4B4LA 4R77A 3Q04A 4J99A 3LJ2A 5E9EA 4BBFA 2C1BA 4EWQA 2JFMA 5CXZA 3FMDA 4FSMA 3GOKA 3GGFA 1NA7A 2O65A 3AMAA 1Z9XA 3BPRA 3WF7A 1DAWA 3ZSIA 3AT4A 3FE3A 1ZMWA 3LXKA 4O38A 4V0GB 1L3RE 2CSNA 4PY1A 5FD2A 3QQKA 4O7NA 2BZKB 4W9XA 2YN8A 2F9GA 2PZPA 2R3JA 4PMMA 4AP7A 4EJNA 3EQDA 3GXLA 4QMYA 3W55A 1XHAA 3FMLA 5EH0A 3GCVA 2QKRA 3C4XA 4FGBA 4LGDA 3PY0A 3VHKA 4I0SA 4JJRA 3TJDA 2XRWA 4F65A 1XBAA 4FKWA 3VO3A 1YHWA 3OOGA 2R3MA 2X9FA 3DCVA 4FKUA 1PHKA 4XBRA 3WF8A 4XV9A 5LVPA 3WIGA 4J7BA 4YJNA 4FTRA 3VBVA 4BHZA 2B0QA 1A06A 2YABA 5HD4A 5M55A 4YTFA 2PMOX 3V8SA 4ANNA 4CKJA 4MH7A 5HGIA 4PDYA 1IRKA 3C4CA 4JBQA 4O0VA 3EQGA 5AR2A 4I23A 3S4QA 3ANRA 5DR2A 1YKRA 2GTMA 2ZB1A 3EZVA 3PXFA 2EXEA 3CJFA 2VGOA 1FOTA 5KMMA 3P7CA 4GRBA 4KRCA 4RIYB 2OXXA 3L9PA 3ITZA 4U97A 4MAOA 3PZHA 2V62A 3IDCA 3RHXA 4JI9A 3HUBA 4YNEA 4D4SA 1GIIA 4XX9A 3TNQB 3LPBA 4X6QC 1U59A 3QQHA 5I9XA 3G6HA 3BHHA 4XMOA 3W32A 1UU9A 4FTJA 4AF3A 4BDEA 5H8EA 1R1WA 4P2KA 4MXXA 3CGFA 4EOPA 3NYVA 1URWA 1OITA 2IVVA 5K3YA 3GQIA 3LXNA 3R1QA 5CEOA 5JFSA 4EK5A 5C26A 3AC4A 4RFYA 2X2MA 4E6CA 2CKEA 3RKBA 2CHLA 4M66A 4JBPA 5HE1A 4W4VA 4FG8A 4I93A 4FEVA 2PWLA 3KKVA 4XG2A 4XV3A 3CQEA 5CEKA 5I9VA 3V8TA 4WO5A 4BCOA 4RSSA 2QODA 2BRHA 5CAPA 4DT8A 2E9NA 5CEMA 3R7VA 3GT8A 4RIWB 2C6KA 3T3VA 3KXHA 1JSVA 4RC3A 5CAUA 2NO3A 2UVZA 4IFGA 4CKRA 2W99B 4O7SA 1NVQA 2BR1A 4QP1A 5JT2A 1QPEA 4IWQA 3PPJA 2C0TA 3F3TA 3OWKA 4OTHA 2B52A 4YO6A 4BCPA 5BVFA 5AJQA 4GUEA 2PUIA 3GU8A 3QTZA 1AD5A 3HMNA 4GK3A 4IVBA 4O0XA 4TWNA 4V01A 1ZWSA 2BAQA 4ZTNA 4ZAUA 4NIFB 3MY5A 4D4RA 5IU2A 2C6OA 1VZOA 1PYEA 5E92A 4HW7A 4U7ZA 3FLYA 3F5XA 5EFQA 5HE0A 3ZHPC 1PMEA 3DBEA 3E93A 4E5BA 2DQ7X 3AMBA 1STCE 1OIYA 3NYNA 4QP7A 1YDTE 3CQUA 4JG7A 1PXNA 4CRSA 1WZYA 5HE3A 4YTHA 2I0VA 4PPCA 4R5SA 4QP3A 4U79A 4EUUA 1FPUA 2QOKA 2E9OA 4ZMEA 4NW6A 3C4ZA 5AWMA 5HX6A 1RW8A 3ULZA 2IO6A 3F66A 4QMMA 4WG3A 5AEPA 3OW4A 3NRMA 3R73A 4QD6A 2EVAA 4YZMA 3BCEA 5C4KA 2R3LA 4PTEA 4YSMA 4Z7GA 4TNBA 4QYYA 3ZC5A 2R3KA 3QA8A 1YW2A 1RE8A 3ZTXA 5J1WA 5L2TA 4QNYA 3HV4A 5KZIA 1J7LA 1JOWB 3DXNA 3DTWA 3R6XA 4BKJA 2C6IA 2E9PA 3LJ1A 3N4VA 3TM0A 4WBBB 1JPAA 4DG3E 2R4BA 4PPBA 4JG6A 1SM2A 3P79A 4IZ5A 4ID7A 4JIKA 3ZYAA 5JGBA 2R3OA 4PP7A 4QYEA 5LVOA 2WMXA 3ZZEA 5EI2A 4MHAA 3W2SA 5M4IA 3R9DA 2G1TA 3KF4A 2WELA 3GBZA 3SW7A 3L9NA 2YCSA 2W1GA 3CD3A 3Q9ZA 4CKIA 4LGHA 2G01A 2C47A 3A99A 3P78A 4IJ9A 3ZFYA 5JQ5A 2QD9A 3OY1A 3PJCA 3RBWA 5M57A 3QGYA 4XV2A 4WSQA 3QHWA 2XMYA 1ZYSA 1B6CB 3RPVA 2E9VA 2J0MB 3RAKA 4EKLA 3QZFA 4M15A 4FV6A 4R8QA 3ZUUA 2JLDA 2PTKA 3ENMA 5M53A 4OR5A 2VTAA 3NCZA 3PXYA 3Q4ZA 2RG6A 5F94A 4Q5EA 1DI8A 4A4LA 4RVMA 5K4JA 3R8PA 1YRPA 5L3AA 3SOAA 3KXXA 1OVEA 5IISA 3ZC6A 4PL4A 1MQBA 1PKGA 2PZIA 2ZYBA 4FKTA 1I44A 4TYHA 5IA2A 2FYSA 2XKCA 3GU4A 4C4FA 3R21A 1JQHA 3ZEWA 3R7YA 3ZBFA 3ORXA 3V6SA 1SYKA 2F4JA 4D5KA 1REKA 4OTIA 2J0LA 2YJRA 3JY0A 3L8VA 3RCJA 3NYXA 1HOWA 4ZLZA 3QKKA 3KVWA 4KABA 3ODYX 3QD2B 2OG8A 1T46A 2REIA 3A2CA 4RFMA 4UWCA 3FXXA 4IE9A 5E8SA 5BVKA 4FSZA 2V0DA 5ANKA 2ZOQA 3FSFA 3IONA 3FZRA 1WVWA 4G1WA 5DFPA 1R78A 2BCJA 2UV2A 4XH6A 2RGPA 5BVEA 2WU7A 4DEDA 1Q24A 1O6YA 3W2PA 5KBRA 5IMEA 4FKLA 4I6BA 3TZ9A 2OZOA 1OB3A 2CCHA 2XYUA 5DWRA 3D5XA 4UZHA 2Q0NA 5BYLA 2OSCA 2JBOA 4EQUA 2ZM3A 5KO1A 2NRUA 3QRJA 4O1OA 4R3RA 4Q5HA 4EK6A 5HTCA 4JT3A 2QOQA 4MD8E 3BU3A 3VF9A 5CXHA 5HORA 2VX3A 1WFCA 4E6DA 1GIHA 4ITHA 3FPMA 5H8GA 3V5PA 2OF2A 4E4MA 3FMEA 1Z57A 2QNJA 4CEGA 4FGRA 2Z8CA 3CPCA 3PVGA 5FQDC 3OC1A 1OZ1A 4DFBA 4M0YA 5A4QA 3FZ1A 2C5OA 4RC4A 4RVKA 5A46A 4L01A 5A4TA 2VX1A 4WG5A 2PYWA 5EOLA 4CLIA 3FY0A 2C5VA 2Q0BA 2YIYA 3NMUF 3VS1A 4YC8A 3LFDA 3ZFXA 4DFNA 5J5TA 2CKQA 5AUUA 5T3QA 3HA6A 3RWPA 1XWSA 3ZLXA 4U80A 2Z02A 2OLCA 2RFDA 4Y5HA 2PSQA 4EH5A 3V5QA 3NW7A 4FV7A 4ANMA 4Q9ZA 3GC8A 4KUJA 4HCVA 3RJCA 3DA6A 1CDKA 2RL5A 2SRCA 3DDPA 3ETAA 4I21A 2WIPA 3FYJX 3VAPA 4N0SA 4HZRA 4BDDA 3UIUA 3Q96A 4EH8A 1WBTA 2VTPA 3E87A 3R7IA 4EH4A 3ID6C 5C1QB 3PXKA 3GU7A 4O84A 3TKIA 2ZV8A 4MBIA 5LMKA 5C8MA 4X7QA 3ZFMA 1UV5A 4DCAA 4BR3A 4RJ4A 2B55A 4M3QA 5IA0A 5AP5A 4YTIA 3UIMA 4PNIA 2UW4A 5KX8A 2XIYA 5GZ8A 5FBNC 2ONLA 5EW9A 2VTQA 4R1VA 1L8TA 3IK3A 2V5QA 3EYHA 4DBXA 3OHTA 4IVDA 1MRVA 4F6WA 4FV8A 4C4EA 3I0OA 1CTPE 3PLSA 4ZTRA 4QQTA 4NZWB 1H1SA 1OL6A 5CENA 2IG7A 3G9NA 2I1MA 3V04A 1JKLA 2CGXA 4ASEA 4O81A 3VS6A 5EM6A 4A06A 4O82A 4I4EA 2XKDA 1A48A 3EQCA 2RKUA 2RG5A 3DB6A 2W05A 3DFCB 4U9AA 2JDOA 1OL1A 3UBDA 2J6MA 1OL7A 4BIDA 4DEGA 3DV3A 4PV0A 2EUFB 4FTCA 4ZY5A 4HGTA 4QMZA 5IG1A 1SVGA 2QO2A 5CNNA 3QTIA 4U44A 5IQCA 3UJGA 3RPYA 3G90X 2BZIB 4YJSA 1YDSE 3FL4A 4QYFA 4WBOA 4HVHA 2YM8A 5LOHA 4DG0E 5CU3A 3GEQA 4F9AA 3CKWA 4YZCA 3UZRA 1JKTA 3MA3A 3NVKI 3HKOA 1PXIA 2Z7RA 4IVCA 3UG1A 5I9WA 4IM3A 3I6UA 2O63A 4LI5A 4B6LA 3AGLA 3DZQA 2YAAA 4ZOGA 2YM4A 2QI8A 3H0YA 5GJFA 5B0XA 1W98A 3FXWA 3D9VA 3ORZA 3OVVA 1CKPA 3LFBA 4GEOA 4F0IA 5LWMA 3RM6A 3DJ6A 4OTFA 2VWZA 3PSBA 3TT0A 5EYCA 3PIXA 3NUUA 3TCPA 2FUMA 4CMTA 3QUPA 3WYXA 2Z2WA 1UNHA 4GSBA 5LMAA 3LM5A 4DTKA 4OTGA 3UQCA 4FNXA 4NM0A 4QTAA 4GS6A 4LRKA 2JIUA 3KN5A 3L8SA 3WF6A 1CSNA 4N4SA 2OZAB 3PIYA 2E2BA 2EXCX 3IECA 4H3PA 4HVDA 5C01A 1UVRA 5EHYA 3EH9A 4M13A 4W4YA 3IO7A 3QX4A 4BGQA 3D7TB 4XP0A 2VO0A 2CNVA 2YIRA 4CLJA 4K9YA 3JS2A 3E3PA 3UNJA 3W2CA 1OI9A 2H96A 3NUNA 4O6LA 4IIRA 2ITVA 1LP4A 1HCKA 3LCTA 4I20A 4IVAA 4L45A 5J7BA 4NTSA 4UYAA 3QTXA 4YP8A 3SV0A 3ZUTA 3R9OA 4DFXE 3DXQA 2PL0A 3TZ8A 3VBYA 1NXKA 1KE6A 5AM6A 2AYPA 4IX3A 5HCYA 1FGKA 2P33A 2BAKA 2PHKA 3A7IA 5LXMA 1M52A 2IVTA 4F08A 3S3IA 4IW0A 4FOCA 4QTDA 3LFAA 3VBWA 5J9YA 2YCFA 4EZ5A 4OGRA 4O91A 5BUEA 1KWPA 1Q8UA 4IWOA 3UODA 2BIKB 3QLGA 2JAMA 2VRXA 3DNDA 3OEFX 3MB7A 4U8ZA 5HO7A 1XH4A 5AV3A 4UMTA 1FMKA 2Y4PA 4JQ8A 4NU1A 5CZIA 2CLXA 3AOXA 4BGGA 5CSVA 3W1FA 5CAVA 4TNDA 2I0YA 3PPKA 5JQ8A 2Y0AA 5EM7A 1JWHA 4UXQA 4RFZA 1GZ8A 2GNJA 5FWKK 1TQMA 1OKWA 5IH5A 3EB0A 2ACXA 4KSPA 3MN3A 4AG8A 2GS6A 1WBNA 3SKCA 4I0TA 5EI6A 3F9NA 2OGVA 5DG5A 3KQ7A 5ITAA 3DLSA 4CGAA 3H30A 2O64A 2RSVA 3ROYA 4EC8A 4WUAA 4PTCA 4NL0A 2ERZE 3QCSA 5HEZA 2JGZA 3KN6A 4C62A 2NP8A 2VTSA 5LMKC 3PVWA 1DAYA 3NUSA 4AOJA 4E5AX 3SA0A 4PNKA 1J7UA 3FY2A 3TV6A 3O8UA 2JC6A 3FEGA 2WTKB 1H08A 3GOPA 3S2PA 4FTAA 3OCSA 2NNWB 5C03A 5AUVA 3TTJA 1JAMA 3O96A 5H9BA 2VNWA 3JYAA 3TDWA 3IW8A 1XJDA 3VBQA 4FMQA 4ZLYA 2ITZA 3PFQA 4Y5QA 1JVPP 3ZRKA 3QCQA 5L6OA 2P3GX 3TKUA 5ETIA 4I6FA 4O7LA 2GS2A 4R5YA 4DTAA 4L42A 4BCKA 2OWBA 1YWNA 2VTJA 3G33A 3RAWA 3QFVA 1K3AA 4AFEA 2J90A 2HW6A 3MVLA 4CMOA 5IEYA 4ZS0A 2B53A 3VUHA 1G5SA 3R7UA 1U46A 3C1XA 5KZ0A 2A2AA 3QTQA 5KMKA 4L9IA 5M56A 4NEUA 1WVXA 4AA5A 4BTKA 1FINA 2WTIA 4MXAA 3QRKA 4QMQA 4TWOA 4WHZA 2W5BA 3V3VA 3VUGA 3VRYA 5CEQA 4GW8A 5IQFA 3DJ7A 4KAOA 4FT0A 2BILB 2IZRA 3ZRLA 4DCEA 3UIBA 4JBOA 2X39A 4DH1A 4ENYA 4FOBA 3HMIA 2WMBA 4BIBA 2I0EA 4X2NA 3R1YA 5JFVA 3OXTA 2VTRA 2W9FB 3O7LB 4MNEA 4S31A 4L44A 3VWAA 1P4FA 5D41A 3MPTA 4IZ7A 4WA9A 4D55A 4DF3A 3GU6A 4RVTA 3R8MA 4K33A 4GUBA 3C4FA 1P2AA 4FEUA 4QMVA 1UKHA 3ORTA 3BX5A 4G6NA 5IQDA 1H27A 2PY3A 4C2WA 4E93A 2OXDA 1S9IA 5CU6A 3CS9A 4OTRA 3QTUA 2HAKA 4MVFA 4D9UA 2RIOA 4IEBA 5CWZA 3F5UA 4BYIA 1YQJA 4FG9A 3O8TA 2QOBA 4H1JA 4AX8A 5GZAA 2DUVA 4EH2A 3P9JA 3QL8A 4F63A 2XJ1A 3MIYA 5J9LA 4QMWA 3LHJA 4G3EA 1V1KA 3FLWA 3R00A 5DR9A 4BCHA 2P4IA 4CZYB 1Y8YA 3U6IA 3DBCA 1H01A 3Q4UA 4HJOA 3Q9XA 1M7NA 4IXPA 4JDKA 5BYYA 3HNGA 3OWPA 2ZB0A 3OTVA 1G8SA 1KV1A 2AC3A 4EOLA 3Q53A 1H1PA 4C58A 4XRJA 5D7VA 4FIEA 4ZSLA 2PVMA 2VWYA 5AV0A 1PMNA 4NYEA 2G15A 4PMTA 1YI6A 2BDJA 2WQOA 3E64A 2BROA 3Q32A 2PVYA 5LWNA 3KC3A 4RVLA 4F1OA 3FKLA 3EL7A 4C3RA 1H1RA 2J0KA 3NLBA 1T45A 3DKCA 1R3CA 4M14A 5F4NA 4F9YA 4BIEA 3T9IA 5I9UA 1Q8TA 4A9UA 4DTBA 4XS2A 4CG9A 1NW1A 5AP7A 5ANGA 5M4FA 2XNOA 3QWKA 1AGWA 4EOKA 1H0WA 3QKMA 4Y46A 4OBOA 5GZ9A 5HNGA 2FA2A 4YZDA 5D12A 3FWQA 5EQYA 4K11A 5TF9A 4EOJA 4BDHA 4OTWA 3GB2A 3K3JA 3KK9A 1G3NA 5FDPA 3KRRA 4NT4A 3F61A 3OOMA 3JPVA 4BGHA
chains in the Genus database with same CATH superfamily
3UPXA 5BMMA 5A4LA 3OROA 3IW6A 4B7TA 5C4LA 4G3FA 4K0YA 5ETFA 2QG5A 1M7QA 1ZZ2A 2G9XA 1JNKA 1K2PA 3ELJA 4ONAA 3TUDA 4BJJA 1R0EA 2OJJA 4EORA 5E8WA 4ZSGA 2FO0A 2QR8A 2VTTA 3FYKX 2BKZA 3FZSA 4XOYA 4H39A 4FTMA 5IKWA 3MH0A 2V55A 4UMPA 1SVEA 4L43A 5FRIA 3ROCA 3SLSA 3OTUA 4AE6A 4AGUA 3S1HA 5KMJA 2YLEA 4FIFA 5J95A 1BX6A 2QOCA 3F5GA 3NR9A 2QHMA 4GJ3A 4QP4A 4ZTHA 4G6OA 2QOFA 4C35A 2X2LA 4HVGA 3NNUA 4FTIA 5E1EA 3U4UA 4MXZA 4ZTSA 3LFSA 4FTTA 2C3KA 3HMOA 1MRYA 3B8RA 3ZM4A 2XP2A 3NEWA 4RMZA 3Q5IA 5GINE 3KVXA 3IW4A 4H3BA 2BDFA 4R3PA 1GOLA 3FSKA 3E5AA 4AAYA 4JLCA 4UN0C 2UW3A 4BBEA 1ZOGA 3BLRA 5DT0A 1WCCA 5DEYA 5E90A 3F7WA 3NFGB 4MNFA 4PMPA 4EYJA 5IEVA 4OUCA 4I22A 3DOGA 3UE4A 3GI3A 4IAAA 3TZ7A 5HLWA 2FSTX 2YM5A 4KINA 3DKOA 2UZEA 4X2GA 1ZMUA 3CCNA 3QQLA 3DS6A 4O2PA 2GNHA 4YUQA 3BLHA 3PP1A 4CFFA 3FMKA 5CSPA 3PYYA 4RJ7A 1UA2A 5HLPA 4O83A 4D1ZA 2V22A 4DGNA 4PMSA 3O23A 5I9YA 3BGQA 3LOKA 4M12A 4GV1A 1IAHA 3NFFB 4ZK5A 1SVHA 5HTBA 1NVSA 4R78A 3MI9A 3VJOA 1V0PA 3N9XA 5FLFA 3GFEA 4ALUA 4JRNA 1ND4A 3QRTA 3R01A 4QMTA 4H05A 4W8DA 3WF5A 5CU2A 3UTOA 5CASA 1Q61A 1XH9A 4IMYA 2YA9A 2HYYA 2Z7QA 4YBKA 3GCSA 2B9JA 3C0GA 4O4DA 5EW8A 4CFNA 1APME 1FQ1B 3JXWA 4MQ1A 3KCFA 4FKRA 3CPBA 5ACKA 5BVDA 2WMUA 5HG5A 4OTPA 3BYUA 3OXIA 3WZJA 3K5VA 2YWPA 4HGSA 3F2NA 3ZU7A 4E6QA 4L68A 3ML1A 3BYSA 3BYVA 3OWJA 2XA4A 2AEGA 2XIKA 3CTHA 3ERKA 4S34A 5HIBA 2Y6MA 2BIYA 4TYHB 5DPVA 2C3IB 4K6ZA 5HICA 2CDZA 4OTDA 4EH6A 5T68A 5AUWA 4EH9A 4BKYA 3PVUA 3IPHA 4D0WA 3AXWA 3DT1A 2OH4A 2Z7LA 4DGLC 2OF4A 3PY3A 4PQNA 3QLFA 4DEIA 5JEBA 4U81A 3R9HA 1ERKA 3BYMA 3T9TA 3EN6A 3UO4A 3V5LA 3V5WA 4C7TA 4TT7A 4QPMA 4L53A 4M0ZA 2NRYA 2BALA 3M11A 2XALA 3OY3A 2YM6A 2R3IA 4DEAA 2BRNA 1KV2A 3DB8A 4E1ZA 4O86A 3R2BA 5DI1A 2B9HA 4Y95A 5C8NA 3FBVA 4F7SA 2WFYA 1KOBA 2GTNA 2ZM4A 3L1SA 5FP6A 4J8NA 2R7IA 1E1XA 5DA3A 4F9BA 2XEZA 3OWLA 5J1VA 4ZJIA 3MV5A 4C4JA 2PVRA 3CIKA 4KIPA 2XK8A 3LFQA 4AAAA 4AT4A 3P4KA 3PRIA 4FTLA 4K18A 3FZPA 3DBDA 2PUPA 3EWHA 3HDNA 4BI2A 2ZDUA 3BV3A 4ACMA 3JVSA 5EHLA 3W0SA 5CF6A 1VYWA 4O0YA 4YPSA 3C0IA 5LARA 3UDBA 3DQWA 4RC2A 3A62A 3PXZA 2J9MA 4FZDB 2P55A 3R28A 5L4QA 4J98A 1XMLA 2HELA 3ZDIA 4ZSEA 4D2RA 3UZTA 2YZLA 2W96B 3T8OA 5L2WA 1XO2B 5AP6A 5F20A 4M68A 4KD1A 3FV8A 3RK9A 4XUFA 4Y72A 2WTKC 4OW8A 3AC2A 3SVVA 3QX2A 5CT0A 1PXKA 3GFWA 4FEXA 1J1BA 4MTAA 4O0RA 4X2FA 3NVMB 1NVRA 4E7WA 5AIKA 5CAQA 4DH3A 4O7ZA 2ZAZA 3W0OA 2GS7A 3OMVA 2W5AA 2G2FA 3G6GA 4IAFA 5E8ZA 4WIHA 4JX7A 4EHGA 3FLNC 2OJIA 4GMYA 5LVMA 2R0IA 5A6OA 3Q9WA 4HYHA 4F7NA 4FT5A 2XAOA 4JQEA 4FUXA 3QC4A 4GFGA 4MWHA 3QC9A 4FRFA 3LCKA 4FSNA 4FX3A 5A6NA 3LMIA 1ZOEA 2XB7A 3H9FA 2A98A 4GT3A 4O4BB 4O96A 4C33A 4X21A 4F1MA 3CC6A 4YC6A 4EL9A 2XK3A 1H26A 2GU8A 2OI4X 5JZNA 4XYFA 1YDRE 3W0QA 2UVYA 3QKLA 2ITTA 4XEYA 3SD0A 3EQIA 1NY3A 5EI8A 3ZO3A 4ERKA 2C30A 3LMHA 4ZMFA 4HPTE 1YXXA 3SG9A 1Q62A 5HBEA 4D5HA 3HA8A 4O21A 4YNOA 3RM7A 3Q4CA 4OAUC 3DQXA 4HVIA 5GIPE 1GY3A 2ITXA 3A7HA 3CGOA 5H8BA 4X2KA 2X4ZA 4UB7A 5JN2A 1VEBA 2XEYA 3ALOA 3W2RA 3PIZA 3CKXA 3CQWA 2JDRA 1ZYJA 3FHIA 4GFOA 4EOOA 1M2RA 3HVCA 4RWIA 4I0RA 3G15A 3I1AA 2R9SA 4FV4A 4F4PA 3NDMA 3U4WA 4A9TA 3P5KA 4D2VA 2R3HA 3HRBA 2PUUA 3UYTA 4CQEA 2VWWA 4CFVA 2W7XA 2VTHA 1PF8A 3PZEA 5ANIA 4R7IA 4EYMA 4F70A 2ZFYA 4ANOA 4XG4A 2PZ5A 4X0MA 4AZVA 1G8KA 2XIRA 4QMOA 4QTCA 5AP0A 5KMNA 3FLQA 2XM8A 5D9HA 3QQGA 5DHJA 3VRZA 4J52A 5CTPA 1H1QA 5M06A 3HRFA 1R39A 3ZCLA 2VTLA 3A7GA 3E8EA 2WTVA 3GC0A 4FL3A 1Q8ZA 2HXQA 3FI3A 4BRXA 2QOIA 2A19B 2XNPA 3RNYA 3H0ZA 2QKWB 3LFCA 4A4OA 5LVLA 3P5JC 4N57A 3GCPA 3WZDA 1KE9A 2JEDA 4AGWA 2QLQA 5HIEA 1H1WA 3IDBA 3LAUA 4UALA 4O7WA 3EN4A 3DJ5A 3FZTA 4IDVA 3BBTB 3NX8A 3TTIA 2YCQA 3OCBA 1UU8A 2VX0A 5TO8A 4ZTQA 1MRUA 4D1SA 3W0RA 4YLLA 3VS7A 4PWNA 3PY1A 4G34A 5KUPA 4M8TA 1OMWA 3IGGA 2W0JA 3QQUA 3LVPA 4TZRA 4XBUA 3E3BX 4BCMA 5JRSA 4LGGA 2UZWE 4IAZA 1SMHA 4BDGA 2NYAA 3C5IA 4RT7A 4NKSA 4AXEA 5LQFA 4FT3A 4BKZA 5JFWA 2WB8A 2H8HA 5HKMA 4MUQA 5I9ZA 2W1CA 3AC5A 4FL1A 4AUAA 3GENA 4NKAA 4QYHA 3DBFA 3RMFA 3T3UA 3UNZA 3CY2A 4AOIA 5BX0A 1QMZA 3EL8A 5DRDA 3OBJA 2YAKA 2YIWA 2YISA 3HV7A 3R71A 4FVQA 4YHTA 4HVSA 5I5ZA 3AC3A 4MYGA 3EFLA 2Y4IB 5JGAA 2X4FA 4BDBA 1WMKA 4I5MA 4E6AA 3EHAA 4RZWA 4I24A 3WF9A 4FK3A 1P4OA 3OG7A 2JKKA 3MDYA 4RIXA 5DNRA 5KKRB 3ACKA 5IDNA 2YITA 3A8WA 1BKXA 2C6LA 2WU6A 1OM1A 2JITA 4QEBA 4GK2A 3VUMA 3GCQA 3BHTA 1GAGA 3R04A 4XG9A 3EQHA 4NW5A 4X3FA 3HUCA 4BTJA 3A61A 3RAHA 3KIOC 3EKKA 5JK3A 2C6TA 3COIA 2GNLA 3AGMA 3VF8A 1U54B 3R2YA 4U43A 3UOKA 2GPHA 2PMLX 4YLJA 4NM7A 1OBDA 4WG4A 3AC8A 4BTFA 3V01A 3DZOA 3LCSA 2C6MA 2O0UA 3EIDA 1ZLTA 4H58A 4UY9A 4EC9A 5JMSA 2OKRA 4F7JA 4FVPA 3R7GA 4EWHA 2WMSA 4L7FA 5DIAA 1UWJA 4DINA 3W10A 2WHBA 3UO5A 3RCDA 5EQEA 2PVFA 3FHRA 2YIQA 5CSHA 4JRVA 3BL9A 4MEDA 4BWKA 2WQNA 2C3LA 2YIXA 3BEAA 3P23A 4LFIA 2X81A 4JDIA 2F2UA 4QO9A 3W16A 4AU8A 4UBAA 3W0MA 2IZSA 2C1AA 4HPUE 4ZJJA 2ETKA 3TV7A 4AA4A 3L8XA 5CVHA 3O50A 4IC7A 3RNIA 3W33A 1B38A 4L3PA 3R1NA 4CXAA 3TUCA 4CT2A 3RPSA 3TL8A 2GHLA 4OBQA 5HVYA 5DYJA 1R0PA 2B7AA 3ODZX 3P08A 4IB0A 4UEUA 3RPOA 4EHZA 1P5EA 3DXPA 4OT5A 1V0OA 1YI3A 2XBAA 2P2IA 2GFCA 2JFLA 3PA5A 4GL9A 4IC8A 5GJDA 5IA5A 4BBMA 5D10A 3E7OA 5ETCA 5CEIA 1PXOA 5I0BA 3I81A 4PDSA 4WUNA 5TT7A 4X2JA 4ZLOA 1XBBA 2ERKA 3PPZA 2IVSA 2X1NA 4ITJA 3NUPA 3G9LX 3MJ2A 4GG7A 2BRBA 4F78A 5M07A 1W7HA 3E8CA 3E8DA 3SHEA 5AV4A 5HHWA 4AZSA 4RG0A 1Y6BA 2IPXA 2WEIA 3UPZA 4RX9A 4A9YA 3MY1A 3RWQA 2KULA 3GC9A 3QA0A 1LR4A 2XUUA 4JIAA 1E1VA 4HCTA 2GNIA 4O4CA 4L46A 4FV3A 4Z7HA 2B4SB 2F57A 5TE0A 1MP8A 4HNFA 1P14A 3LM0A 3PVBA 3CTJA 1UNLA 1M14A 2CGWA 2UZVA 3C5UA 3NAYA 4KBCA 3TNIA 4CRLA 4DLIA 2XK6A 4YSJA 5JH6A 2FVDA 1Q41A 4FV9A 2ZV7A 4DEHA 4CT1A 1KE7A 4BI0A 3FUPA 4CFUA 4R1YA 4GYGA 3L9LA 4AFJA 4MNEB 3R30A 5GHVA 1VR2A 3CE3A 4UZDA 1OKYA 5AUXA 4LUDA 5C8KA 3I60A 1G8AA 3W0NA 4JVGA 2PK9A 2UZLA 4G9RA 1OGYA 4P4CA 4PX6A 2QONA 3PJ2A 4X3JA 5AUZA 5IF1A 5M4CA 5HLNA 2RFNA 2FGIA 2YZAA 3QALE 4Z9LA 3V8WA 4CTBA 4BWPA 1ZMVA 3GU5A 2QG7A 4FA2A 2VWXA 5E7RA 2BUJA 3S0OA 5A4EA 1JKSA 5K0XA 4DAWA 3PE1A 5ANJA 4C3PA 4USDA 4XOZA 3QF9A 1YXVA 3A7JA 2A27A 1UKIA 2UW8A 5HU3A 2CLQA 2JDVA 4YJVA 4S30A 2QR7A 4C2VA 2PVLA 5HIDA 5D7AA 1CKJA 2UVXA 3RPRA 1Y91A 3FLZA 3NNXA 5K4IA 2F7EE 3P1AA 2W5HA 2OICA 4XP3A 3KFAA 1TVOA 1OL5A 2BFYA 4I3ZA 4U3YA 4GVAA 4IB3A 4QP8A 2IF8A 4ZIMA 4F6UA 3FMMA 3F5PA 3OZ6A 3F2RA 3MESA 4QPAA 2IW9A 2YERA 5LMBA 2PE0A 4FVRA 4TKSA 4FBXA 3PUPA 4FV0A 5EYMA 1SNXA 2ZMCA 4E4LA 2YHVA 3LLTA 3M1SA 3ZEPA 1SZMA 4EQCA 4BHNA 2FB8A 4YZBA 1KE8A 3C50A 1UWHA 3UP7A 5HZNA 3DKFA 4IACA 4QMPA 4RJ8A 5J9ZA 4UMQA 5J5SA 4OTQA 4P90A 3BE2A 1W8CA 3COKA 4P7EA 4RX7A 2YLFA 3PP0A 4GH2A 2QVSE 3TNWA 3AC1A 1XH7A 1U54A 3OUNB 4L52A 4TRLA 4X3FC 5EK7A 5C27A 2ZDTA 4BICA 5HTIA 4YJOA 1OBGA 5HBHA 3E62A 3BU5A 3F3VA 2XNMA 4D1XA 3Q3BA 1ZXEA 5AFVA 2UW5A 5IUIA 3D94A 3R83A 3FL5A 4DA5A 2X9EA 3QXPA 2WQBA 3OCTA 2OIDA 3SXSA 5I3RA 2V7AA 2HWPA 2V7OA 1U5RA 4BDFA 4LMUA 1A9UA 3QZGA 4Y73A 2ETMA 3R0TA 3P0MA 2XNEA 2BVAA 5F1ZA 1PXMA 3VS3A 3UNKA 3KXZA 4YHJA 3UVQA 3H4JA 3Q2JA 4A9SA 4BJJB 2XNGA 2OXYA 4QNAA 1FBNA 3E7VA 4KBAA 3TJCA 1FMOE 3FI2A 2XIXA 2XJ0A 2W06A 3D2KA 4KWPA 4N70A 4YPDA 4EZ7A 3BHYA 3ZSGA 2BDWA 3WIKA 5CSWA 3TYKA 2CJMA 3H9OA 4FIHA 4QMSA 4DN5A 3LIJA 4LRMA 1UU7A 3MY0A 3COHA 3D14A 3QD0A 3RVGA 2FSOX 4ZY4A 3F82A 4EOIA 3DBQA 2ONLC 4WKQA 5CX9A 1F5QA 3QU0A 4A9RA 3RZBA 4IANA 4ZEGA 3UC3A 4BZNA 3CP9A 1W83A 2UZBA 1O6LA 2XJ2A 2GQGA 2ESMA 3DPKA 3IS5A 4HYIA 4IWPA 4JOAA 5FEDA 4YTCA 5KCVA 2UZUE 4ZS4A 5LCJA 3I5NA 1MQ4A 4I5HA 3F3WA 3OBGA 3WE4A 1WBOA 4TYGA 2AUHA 1G8JA 4QP9A 3ORPA 3AG9A 5J7HA 4Y8DA 4B9DA 2OFVA 2C3JA 1FVTA 2I6LA 3GQLA 3MFSA 3P86A 5DOSA 3U6HA 1YWRA 2CPKE 4XJ0A 3ZO4A 4C38A 1YI4A 3D5WA 4JAJA 4ACDA 2IVUA 5CQWA 2OBJA 3ALNA 3KXNA 2O3PA 4QDEA 3C51A 3VNTA 2WTJA 4CFXA 3F69A 5L8LA 3DAKA 4ZSJA 5JGDA 2WAJA 2B54A 3Q5ZA 4E5WA 4KS8A 4L3JA 3LXLA 4O6EA 3RZFA 5LVNA 4BDCA 1UU3A 4XG3A 5JZJA 3HMPA 3PDTA 2Z60A 4YC3A 3VHEA 5LJJA 3UDZA 2H34A 1CM8A 3TIZA 4DC2A 4FEQA 4DH5A 5BUJA 3OT8A 5IDPA 5K5NA 1U5QA 4WNOA 1YOLA 5IEXA 5ETAA 2EWAA 3QUEA 2WMTA 2JDTA 4I92A 4IBMA 4BL1A 5AA8A 5IH4A 2OJ9A 5D1JA 3DGKA 4R3CA 4KIKB 4NSTA 5L8KA 3QCXA 4CFMA 3AD6A 2WD1A 1Y6AA 1LPUA 3KK8A 3QXOA 2WMWA 4UXLA 3FC2A 5CSXA 3MVJA 5E8YA 4J95A 4AXDA 3DTCA 3VONA 2PE2A 4I5PA 4K1BA 5EYKA 1H28A 2C6DA 4MK0A 5E8XA 1QCFA 3KMWA 4EBWA 4ENXA 5IQEA 4MF0A 4RQKA 5HNBA 4HGLA 4AA0A 2XK7A 3ORIA 5AIRA 5GJGA 3W8QA 1DI9A 3WZUA 3A4PA 5IUHA 1YXUA 3HECA 4CD0A 1RQQA 3ZLYA 4OT6A 5IQIA 4ZZNA 3RGFA 2GCDA 3UOHA 4XCUA 4D2SA 3TEIA 2PMNX 3UZPA 1Q97A 3GVUA 2FSLX 1Q5KA 5L2SA 4YJUA 2HWOA 4IB5A 3ZBXA 5KMIA 2Y4IC 3VIDA 3MFUA 4ANLA 1M2QA 3BYOA 1IASA 2BPMA 3KCKA 2RF9A 4JL9A 4WRSA 1QPCA 4U6RA 1F3MC 5J87A 3EN5A 3UVRA 4TYIA 5KKRC 2UZOA 4M7IA 4WNPA 1IEPA 2X7GA 2ZV9A 4D2PA 1XH8A 2VU3A 1VLRA 3DAEA 3QUDA 4CV8A 2QHNA 1OKVA 3BWJA 3TIYA 5JRQA 2IW6A 2WTDA 3FMHA 3NS9A 4QYGA 3QD3A 4IAKA 5EYDA 2EU9A 1ZZLA 3DK3A 4WD5A 4FYOA 4X6RA 3PXQA 4HNIA 1BI8A 4D2TA 3G0EA 3QRUA 5J79A 1VYZA 2BAJA 3I6WA 4RA5A 2EB3A 3NPCA 4CG8A 3LKMA 1Q3WA 2JKOA 3HEGA 1IA8A 3VW6A 1GZKA 4BDAA 4EK3A 3PA3A 4FC0A 4FSYA 4MX9A 1BI7A 3FJQE 4DHFA 4ORKA 4BCGA 1PXJA 3ZM9A 1TZDA 1BUHA 4F0GA 5HVKA 4DH7A 2A4LA 4IZYA 3UOJA 4D0XA 3EJ1A 1UNGA 3NWWA 4LG4A 4RPVA 1JLUE 3Q6WA 3IG7A 4FIJA 5CQUA 3MSSA 5D11A 4FK6A 5BYZA 3SRVA 4U41A 5EDRA 1PXPA 2W1EA 3S95A 4Z3VA 3OFMA 4TN6A 1PRYA 3C13A 4W8EA 5CY3A 3JY9A 1TQIA 3FPQA 3KULA 5CF4A 1F0QA 3VS5A 2VWBA 5IA4A 2ITWA 4IAYA 2W1DA 4G16A 3BL7A 1FVVA 3KEXA 4QPSA 4XV1A 4FSUA 4I1ZA 1OPLA 2C4GA 4AZFA 4WT6A 4QQ5A 4KB8A 2JAVA 4F99A 2AQXA 2JIVA 3KXGA 1Q3DA 3EQPA 2J5EA 2PE1A 3BBWA 4E26A 2W1FA 2WPAA 3IDPA 3BKBA 3QTSA 3NUAA 2F7XE 4ZXTA 1OPJA 3ZLSA 3HV3A 2VWUA 4G2FA 4QMXA 4JR3A 2R0UA 5A9UA 3U9NA 3BRBA 3IGOA 4U3ZA 5DMZA 4BCNA 1IR3A 3ZRMA 2QC6A 2Y6OA 3JUHA 4FKVA 3D5VA 3SGCA 5FGKA 5ANDA 1PW2A 4FZ7A 4G5JA 4ALWA 5ACBC 4FKSA 3TNHA 4NTTA 1EH4A 2Z7SA 4UWYA 4QMUA 3FLSA 3UO6A 4F9WA 3V5TA 4YJPA 2GNGA 4GFMA 1GJOA 1PXLA 4J96A 4IM0A 3V5JA 4HYUA 3O0GA 5AA9A 5KHXA 3F6XA 4LV8A 1PMVA 2F49A 1S9JA 2O2UA 3OUKA 1W0XC 5CVFA 5L6WL 2CNUA 4DDIA 4FSRA 4H1MA 2CGVA 4JXFA 3AT3A 4USEA 4FTQA 1SNUA 3E63A 4PL3A 1Z5MA 2ETRA 2WKMA 2J50A 4TWPA 1PJKA 3HP2A 3VC4A 2F2CB 5HX8A 4EJ7A 4KIKA 5DT4A 4NK9A 3QTWA 1J1CA 3FXZA 3QBNA 5EDPA 3KF7A 4IFCA 2Y7JA 2Q83A 4PPAA 3UGCA 3UMXA 2G2IA 3MFTA 4DH8A 5L6PA 3UOLA 4NJ3A 1TKIA 2DYLA 4FKIA 4U45A 2AC5A 3MA6A 2X7OA 3Q4TA 3O8PA 4YLKA 3NYOA 3UQFA 4G3DA 4GIIA 5AAFA 4AT5A 3KA0A 5M51A 2X8DA 3MTLA 4YHFA 5FEEA 4R7BA 4EOSA 4TW9A 4TTHB 3R63A 2QU6A 3MIAA 3SXFA 3BHVA 1GNGA 4BZDA 2C69A 4W4XA 2J7TA 4WOVA 5AP4A 1TQPA 2BZHB 4JBVA 5TR6A 1B39A 4ANSA 4AW5A 5EKNA 4YBJA 4NUSA 2VWVA 5IQGA 5CYIA 5FP5A 2I7QA 3OF0A 3K5UA 4XP2A 3F3ZA 4ZZOA 4AW1A 1Q4LA 3D15A 3KY2A 2WTCA 2R3RA 3QAME 1DM2A 3L9MA 3ACJA 3LCOA 4JQ7A 5DBXA 4BYJA 3EQBA 3SOCA 4KIOA 2HIWA 3NIZA 3UYSA 3ZSHA 4NCTA 3VUDA 4FYNA 3P7BA 4F64A 4C8BA 4K77A 5HU9A 3HP5A 3VBXA 4O4FA 2GMXA 1CMKE 1RDQE 2J0IA 3I79A 4C57A 3OXZA 2XS0A 2XF0A 4L7SA 4M69A 5M4UA 4E73A 5AR5A 4F9CA 3AD5A 4IADA 4AW2A 3ZH8A 5AADA 4EK4A 3Q60A 3WOWA 3LW0A 4A4XA 3UDSA 2HY81 4YJRA 5F95A 1OPKA 3U87A 4AQCA 2VO6A 3VUKA 3F88A 3Q9YA 4QQCA 2LAVA 4C34A 3A60A 4RIXB 4CYJA 4LDTA 3DU8A 2WNTA 3FAAA 3R8UA 3ZUVA 4UMUA 3B8QA 3C0HA 3LMGA 3IW5A 4U5JA 4BVUA 5HO8A 5M08A 3DDQA 4FG7A 1GZNA 2UZNA 3M2WA 4OAVB 3PUFC 3S00A 4F7LA 3I4BA 4X3FB 4U0IA 2UW9A 4L00A 4PDPA 1ZY5A 3EN9A 4CMUA 3KMUA 4D28A 3CXWA 4FT7A 3SW4A 3GP0A 3IOPA 2UW7A 3G2FA 4LUEA 4FZ6A 3TWJA 2JKMA 4FTNA 3DK7A 5AP2A 2C6EA 4G31A 5AMNA 1H0VA 4LL5A 4R6VA 4ARKA 3D5UA 4G17A 4QT1A 5I3OA 4XG7A 4YJTA 3R8VA 3QHRA 3DLZA 2JIIA 2XVDA 3A4OX 3MVHA 2J4ZA 3MH3A 4TWCA 3LXPA 4RWKA 5CNOA 2QOLA 4NM5A 3LFNA 3TN8A 3EZRA 4FNWA 5AR4A 3W2OA 1H07A 3PWYA 4DG2E 3DFAA 4F6SA 2R64A 3VQUA 4BCJA 5M44A 5HESA 4PUZA 2CKPA 5EM5A 3C4EA 1X8BA 2X8IA 3FQSA 3QYZA 1H00A 3QYWA 4Y85A 3GCUA 3CD8A 3B2TA 4UYNA 5TKDA 2DWBA 5KE0A 5AAGA 2OO8X 1J7IA 3CEKA 5CVGA 3W2QA 2JDSA 5AP3A 4AZTA 4DFZE 2C0OA 3ATSA 3BGZA 3BEGA 3MVMA 3QQFA 4QRCA 3AKJA 5BMSA 3U54A 2UZTA 2XCHA 2C5NA 3TKHA 4DGMA 4EH3A 5H3QA 4O0WA 2RFEA 4KIQA 5HG7A 5CALA 3QZIA 4NFNA 3ET7A 4FJVA 2XM9A 2XZSA 3MTFA 3LQ5A 2LGCA 2PPQA 2VO3A 2YEXA 1GZOA 3PA4A 2VAGA 4LMNA 3ZXTA 1J3HA 1OUKA 4P5QA 3MH2A 2UUEA 3HZTA 3ORMA 1ZYDA 3FMJA 3H9RA 4DLJA 4G3GA 1ZRZA 3QTRA 4I4FA 5FXSA 5EKOA 4APCA 4AZWA 3LZBA 4MBLA 2ZMDA 3NZ0A 5BVOA 4BDKA 3BI6A 2CN8A 3REPA 5CAOA 4GT5A 4DFUA 2FH9A 4GU6A 4KS7A 4V0GA 4I6HA 4GYIA 4KKGA 5AX9A 3IKAA 1ZOHA 4BZOA 4YMJA 3NUYA 4U42A 1W82A 2RFSA 4MWIA 1OECA 5FEQA 2W4JA 3E92A 3EFJA 4AN3A 4ERWA 2W4KA 4YO4A 3LQ8A 3SG8A 5IPJA 2VD5A 5CU4A 5E91A 5B7VA 1Q8YA 2XNNA 3KGAA 1OL2A 3QRIA 3FI4A 1W84A 5AAEA 5DEWA 3TI1A 2BHHA 5DE2A 5DH3A 3E8NA 4A7CA 4IAIA 2X2KA 3NW5A 5EOBA 3W18A 4MCVA 4AGDA 4B8MA 4D58A 5JKGA 3PG3A 4LOQA 3NCGA 4UMRA 2QO7A 4PL5A 3LE6A 4C61A 4MKCA 5IQHA 4QP6A 2BZJA 3DNEA 3F2AA 4ACHA 3OEZA 1ZARA 5EW3A 1WAKA 4YR8A 4DBNA 3I7CA 3MFRA 4B99A 5BPYA 3VQHA 2XKEA 4JNWA 2W9ZB 3QQJA 3UG2A 4M84A 2W1ZA 3L8PA 4XLVA 4NCTC 4O0TA 4RIYA 2JKQA 4FSTA 2VTIA 4EK8A 4N6ZA 3O2MA 1OIRA 5AX3A 2ITOA 3LQ3A 3COMA 1ATPE 4G6LA 2QLUA 3BGPA 2EXMA 5CEPA 4BCIA 5FBOA 2OW3A 3KRXA 1WBPA 4AXAA 2J5FA 2OJFE 4FL2A 2PVKA 4H36A 3GNIB 2UW6A 3BQCA 4O0SA 4MD7E 4C4IA 1LUFA 4XG8A 3H3CA 3BU6A 4QMLA 1JBPE 5AUTA 4G5PA 4UV0A 2YWVA 1XQZA 2FSMX 3BQRA 3PTGA 2H9VA 4L67A 5AR7A 3BWFA 2PULA 3KREA 3OCGA 3VN9A 3AT2A 3EYGA 5GNKA 4RJ3A 4YURA 2XKFA 4XNEA 1PMUA 2G2HA 2YDJA 4I41A 4J1RA 5L2IA 2BRMA 3VBTA 4EZ3A 2A0CX 4C0TA 5CI6A 4RIWA 4O7VA 1YVJA 4R7HA 2BFXA 2I40A 3ULIA 3CY3A 2ZJWA 1V0BA 2HCKA 1RJBA 2ZVAA 2O8YA 3WI6A 3U51A 2ITPA 4FICA 2XK4A 5BQ0A 4RA4A 2CCIA 5FTGA 4FZFB 2IZTA 4IX4A 5HE2A 4IH8A 4DHJA 4AS0A 1HCLA 3QD4A 3VVHA 1ZAOA 4WNMA 3FDNA 2X7FA 1IA9A 4NIFA 3CSVA 4EQMA 5AP1A 2CNQA 3TZMA <