4AUIA

Structure and function of the porb porin from disseminating n. gonorrhoeae
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
308
structure length
308
Chain Sequence
DVTLYGTIKAGVETSRSVAHHGAQADRVKTATEIADLGSKIGFKGQEDLGNGLKAIWQLEQKAYVSGTDTGWGNRQSFIGLKGGFGKVRVGRLNNILKDTGNFNPWEGKSYYSGLSNIAQPEERHVSVRYDSPEFAGFSGSVQYVPNDNSGKNRSESYHAGFNYKNDGFFVQYAGSYKRHNYTTEKHQVHRLVGGYDHDALYASVAVQQQDAKLTWRDDNSHNSQTEVATTVAYRFGNVTPRVSYAHGFKGSVYDADHDNTYDQVVVGAEYDFSKRTSALVSAGWLQKGKGAEKFVATVGGVGLRHKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the Porb Porin from Disseminating Neisseria Gonorrhoeae.
pubmed doi rcsb
molecule tags Membrane protein
molecule keywords PORIN (PORB)
total genus 62
structure length 308
sequence length 308
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4auiA00
3POQA 3VY8X 3O0EA 5DL6A 2PORA 4FRXA 2Y0KA 3EMNX 4GCSA 2ZLDA 1H6S1 1OSMA 3VY9X 2J4UP 2XG6A 3HW9A 4KR8A 1BT9A 1GFNA 3HWBA 4LSFA 1HXUA 8PRNA 4FMSA 6PRNA 1GFMA 3FYXA 5DL7A 2XE2A 4LSIA 1HXXA 4LSHA 3UU2A 3T20A 5JDPA 4GCPA 4FSOA 2Y0LA 2Y2XA 4C69X 3VZUX 3UPGA 2OMFA 4KR4A 4D65A 1BH3A 2XE5A 4RJWA 3SYSA 3SZDA 2QTKA 1MPFA 2PRNA 2K4TA 3JTYA 4FT6A 1OPFA 1GFQA 5FVNA 3PORA 2XE1A 7PRNA 3SZVA 4FSPA 4D5UA 3WI4A 1PRNA 3T0SA 1GFOA 3K19A 3WI5A 4KRAA 4LSEA 3POUA 1HXTA 2ZFGA 3VZTX 3POXA 4GCQA 3NSGA 1PHOA 3SYBA 4D64A 2J1NA 3SY9A 4AUIA 4FOZA 1GFPA 3T24A 4JFBA 1E54A 4BUMX 4RJXA 3SY7A 2ODJA 4FRTA 2FGQX 5PRNA 5DL8A 2FGRA 2O4VA 3VZWX 3A2SX 2XE3A 2Y0HA 3PRNA 5DL5A
chains in the Genus database with same CATH superfamily
1ZHXA 1BXWA 3LK2A 3POQA 1P4TA 3VY8X 3A0BO 2R4OA 3O0EA 5G26A 2XMXA 3WU2O 5GV0A 2WJRA 4IL6O 2IWVA 5DL6A 1T1LA 2PORA 3A0HO 3DWNA 4N58A 2Y7SA 4FRXA 2Y0KA 4O4XA 3EMNX 3AA6A 4UB8O 4AYNA 4N75A 2XTQA 4GCSA 3DA3A 5G38A 5TISO 4RL9A 4AYDC 2KC0A 2ZLDA 4QQ1A 2YNKA 5G39A 4AZLA 1H6S1 5GTIO 1OSMA 3VY9X 4E1SA 3SZVA 2XG6A 1ZHWA 2J4UP 1Q9GA 3HW9A 4KR8A 5B66O 2X9KA 2X27X 4AKMA 1QJ9A 1BT9A 3LK41 2JMMA 1GFNA 2LFUA 1ZHYA 1YS5A 3HWBA 4K3CA 4LSFA 1HXUA 3LK3B 4PR7A 8PRNA 5ADXK 2KXPB 2KZ7B 4FMSA 6PRNA 3PQUA 1GFMA 2KXPA 2KZ7A 3FYXA 2XE2A 5DL7A 4FZMA 4LSIA 4FZNA 3LK3A 4GF4A 3UAQA 2AXTO 3JCUO 1HXXA 4PJ0O 4LSHA 3UU2A 3HOLA 3KVDD 3T20A 5JDPA 4B61A 2R4LA 3AAEA 4GCPA 4XNLA 3DZMA 2R89A 4CTDA 4FSOA 2Y0LA 2R8AA 3GP6A 3QRAA 4FZLA 5E79O 2F1VA 3AA7B 4E1TA 2Y2XA 1ZHZA 4C69X 2KDYA 4N74A 3VZUX 3AA7A 5AFUL 2OMFA 3PQSA 3UPGA 3BRZA 5KAIO 1MM4A 4C4VB 3PGRA 4O3ZA 2W81C 4KR4A 4D65A 1BH3A 2XE5A 1Q9FA 4AYMC 4RJWA 3SYSA 1ZHTA 2QTKA 5D5DA 3SZDA 1MPFA 3AA0B 2PRNA 4G76A 3AAAA 5ADXL 1G90A 2K4TA 3JTYA 4RLCA 3VE2A 4FT6A 4AFKA 1OPFA 2W80C 3PF1A 2M07A 3RBHA 3LK2B 1GFQA 5FVNA 2ERVA 3PORA 4U9CA 2XE1A 5H2FO 4O3YA 7PRNA 1S5LO 4FESA 1THQA 2LHFA 3AA1A 3AA6B 1IZNA 2GE4A 1QJPA 3AA0A 4FSPA 4GHBA 3AAAB 3WI4A 2JQYA 4D5UA 1PRNA 4JCHA 3T0SA 5AFUK 3AAEB 3HOEA 1GFOA 3K19A 4O3WA 3WI5A 4Z3TA 4O49A 2F1TA 4KRAA 4LSEA 4XNKA 4AKRA 4F4BA 3LK42 3POUA 5EE2A 1HXTA 2ZFGA 3QRCA 2WJQA 3VZTX 4AKRB 5B5EO 5GTHO 3AA1B 3POXA 3C5OA 4GCQA 3NJTA 3PGUA 4K3BA 3NSGA 1QJ8A 2MNHA 3DWOX 4RLBA 4UB6O 4AYID 4FQEA 2N2MA 3DA4A 3KZIO 1PHOA 3SYBA 3TZGA 4D64A 2R88A 2J1NA 2K0LA 3SY9A 3BS0A 5KAFO 4AUIA 1MM5A 2WVPA 4FOZA 2IWWA 1GFPA 3T24A 2N2LA 3G7GA 4JFBA 4C00A 4O3XB 1E54A 4BUMX 4O4UA 2YPVA 3BRYA 4N59A 4RJXA 3SY7A 2F1CX 2ODJA 4FRTA 2FGQX 2MHLA 3PGSA 2R4NA 5PRNA 4C4VA 3V8UA 2R4PA 5DL8A 4AYEC 2FGRA 5G3AA 2O4VA 4PUXA 1IZNB 1T16A 3A2SX 3VZWX 2XE3A 2Y0HA 5IYUA 2M06A 5T5FA 4G75A 1ORMA 3PRNA 4FUVA 2XTRA 5DL5A 3VE1A
chains in the Genus database with same CATH topology
1ZHXA 1BXWA 3LK2A 3POQA 1P4TA 3VY8X 3O0EA 5G26A 2XMXA 5GV0A 5DL6A 2PORA 4N58A 2Y7SA 4FRXA 2Y0KA 4O4XA 3EMNX 3AA6A 4AYNA 2XTQA 4GCSA 3DA3A 4RL9A 4AYDC 2KC0A 2ZLDA 4QQ1A 2YNKA 4AZLA 1H6S1 1OSMA 3VY9X 4E1SA 3SZVA 2XG6A 1ZHWA 2J4UP 1Q9GA 3HW9A 4KR8A 2X27X 4AKMA 1QJ9A 1BT9A 3LK41 2JMMA 1GFNA 2LFUA 1ZHYA 1YS5A 3HWBA 4LSFA 1HXUA 3LK3B 8PRNA 5ADXK 2KXPB 2KZ7B 4FMSA 6PRNA 3PQUA 1GFMA 2KXPA 2KZ7A 3FYXA 2XE2A 5DL7A 4FZMA 4LSIA 4FZNA 3LK3A 4GF4A 3UAQA 1HXXA 4LSHA 3UU2A 3HOLA 3KVDD 3T20A 5JDPA 4B61A 3AAEA 4GCPA 4XNLA 4FSOA 2Y0LA 3GP6A 3QRAA 4FZLA 4E1TA 2F1VA 3AA7B 2Y2XA 1ZHZA 4C69X 2KDYA 3VZUX 3UPGA 3AA7A 5AFUL 2OMFA 3PQSA 1MM4A 4O3ZA 2W81C 4KR4A 4D65A 1BH3A 2XE5A 1Q9FA 4RJWA 3SYSA 1ZHTA 2QTKA 5D5DA 3SZDA 1MPFA 3AA0B 2PRNA 4G76A 3AAAA 5ADXL 1G90A 2K4TA 3JTYA 4RLCA 3VE2A 4FT6A 4AFKA 1OPFA 2W80C 3RBHA 2M07A 3LK2B 1GFQA 5FVNA 2ERVA 3PORA 4U9CA 2XE1A 4O3YA 7PRNA 4FESA 1THQA 2LHFA 3AA1A 3AA6B 1IZNA 2GE4A 1QJPA 3AA0A 4FSPA 4GHBA 3AAAB 3WI4A 4AYMC 4D5UA 1PRNA 4JCHA 3T0SA 5AFUK 3AAEB 3HOEA 1GFOA 3K19A 4O3WA 3WI5A 4Z3TA 4O49A 2F1TA 4KRAA 4LSEA 4XNKA 4AKRA 4F4BA 3LK42 3POUA 5EE2A 1HXTA 2ZFGA 3QRCA 3VZTX 4AKRB 3AA1B 3POXA 3C5OA 4GCQA 4AYID 4RLBA 3NSGA 1QJ8A 2MNHA 2N2MA 3DA4A 1PHOA 3SYBA 3TZGA 4D64A 2J1NA 2K0LA 3SY9A 4AUIA 1MM5A 4FOZA 1GFPA 3T24A 2N2LA 3G7GA 4JFBA 4O3XB 1E54A 4BUMX 4O4UA 2YPVA 4N59A 4RJXA 3SY7A 2ODJA 4FRTA 2FGQX 2MHLA 5PRNA 3V8UA 5DL8A 4AYEC 2FGRA 2O4VA 4PUXA 1IZNB 3VZWX 3A2SX 2XE3A 2Y0HA 5IYUA 2M06A 5T5FA 4G75A 1ORMA 3PRNA 4FUVA 2XTRA 5DL5A 3VE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3POQ A;  3VY8 X;  3O0E A;  5DL6 A;  2POR A;  4FRX A;  2Y0K A;  3EMN X;  4GCS A;  2ZLD A;  1H6S 1;  1OSM A;  3VY9 X;  2J4U P;  2XG6 A;  3HW9 A;  4KR8 A;  1BT9 A;  1GFN A;  3HWB A;  4LSF A;  1HXU A;  8PRN A;  4FMS A;  6PRN A;  1GFM A;  3FYX A;  5DL7 A;  2XE2 A;  4LSI A;  1HXX A;  4LSH A;  3UU2 A;  3T20 A;  5JDP A;  4GCP A;  4FSO A;  2Y0L A;  2Y2X A;  4C69 X;  3VZU X;  3UPG A;  2OMF A;  4KR4 A;  4D65 A;  1BH3 A;  2XE5 A;  4RJW A;  3SYS A;  3SZD A;  2QTK A;  1MPF A;  2PRN A;  2K4T A;  3JTY A;  4FT6 A;  1OPF A;  1GFQ A;  5FVN A;  3POR A;  2XE1 A;  7PRN A;  3SZV A;  4FSP A;  4D5U A;  3WI4 A;  1PRN A;  3T0S A;  1GFO A;  3K19 A;  3WI5 A;  4KRA A;  4LSE A;  3POU A;  1HXT A;  2ZFG A;  3VZT X;  3POX A;  4GCQ A;  3NSG A;  1PHO A;  3SYB A;  4D64 A;  2J1N A;  3SY9 A;  4AUI A;  4FOZ A;  1GFP A;  3T24 A;  4JFB A;  1E54 A;  4BUM X;  4RJX A;  3SY7 A;  2ODJ A;  4FRT A;  2FGQ X;  5PRN A;  5DL8 A;  2FGR A;  2O4V A;  3VZW X;  3A2S X;  2XE3 A;  2Y0H A;  3PRN A;  5DL5 A; 
#chains in the Genus database with same CATH topology
 1ZHX A;  1BXW A;  3LK2 A;  3POQ A;  1P4T A;  3VY8 X;  3A0B O;  2R4O A;  3O0E A;  5G26 A;  2XMX A;  3WU2 O;  5GV0 A;  2WJR A;  4IL6 O;  2IWV A;  5DL6 A;  1T1L A;  2POR A;  3A0H O;  3DWN A;  4N58 A;  2Y7S A;  4FRX A;  2Y0K A;  4O4X A;  3EMN X;  3AA6 A;  4UB8 O;  4AYN A;  4N75 A;  2XTQ A;  4GCS A;  3DA3 A;  5G38 A;  5TIS O;  4RL9 A;  4AYD C;  2KC0 A;  2ZLD A;  4QQ1 A;  2YNK A;  5G39 A;  4AZL A;  1H6S 1;  5GTI O;  1OSM A;  3VY9 X;  4E1S A;  3SZV A;  2XG6 A;  1ZHW A;  2J4U P;  1Q9G A;  3HW9 A;  4KR8 A;  5B66 O;  2X9K A;  2X27 X;  4AKM A;  1QJ9 A;  1BT9 A;  3LK4 1;  2JMM A;  1GFN A;  2LFU A;  1ZHY A;  1YS5 A;  3HWB A;  4K3C A;  4LSF A;  1HXU A;  3LK3 B;  4PR7 A;  8PRN A;  5ADX K;  2KXP B;  2KZ7 B;  4FMS A;  6PRN A;  3PQU A;  1GFM A;  2KXP A;  2KZ7 A;  3FYX A;  2XE2 A;  5DL7 A;  4FZM A;  4LSI A;  4FZN A;  3LK3 A;  4GF4 A;  3UAQ A;  2AXT O;  3JCU O;  1HXX A;  4PJ0 O;  4LSH A;  3UU2 A;  3HOL A;  3KVD D;  3T20 A;  5JDP A;  4B61 A;  2R4L A;  3AAE A;  4GCP A;  4XNL A;  3DZM A;  2R89 A;  4CTD A;  4FSO A;  2Y0L A;  2R8A A;  3GP6 A;  3QRA A;  4FZL A;  5E79 O;  2F1V A;  3AA7 B;  4E1T A;  2Y2X A;  1ZHZ A;  4C69 X;  2KDY A;  4N74 A;  3VZU X;  3AA7 A;  5AFU L;  2OMF A;  3PQS A;  3UPG A;  3BRZ A;  5KAI O;  1MM4 A;  4C4V B;  3PGR A;  4O3Z A;  2W81 C;  4KR4 A;  4D65 A;  1BH3 A;  2XE5 A;  1Q9F A;  4AYM C;  4RJW A;  3SYS A;  1ZHT A;  2QTK A;  5D5D A;  3SZD A;  1MPF A;  3AA0 B;  2PRN A;  4G76 A;  3AAA A;  5ADX L;  1G90 A;  2K4T A;  3JTY A;  4RLC A;  3VE2 A;  4FT6 A;  4AFK A;  1OPF A;  2W80 C;  3PF1 A;  2M07 A;  3RBH A;  3LK2 B;  1GFQ A;  5FVN A;  2ERV A;  3POR A;  4U9C A;  2XE1 A;  5H2F O;  4O3Y A;  7PRN A;  1S5L O;  4FES A;  1THQ A;  2LHF A;  3AA1 A;  3AA6 B;  1IZN A;  2GE4 A;  1QJP A;  3AA0 A;  4FSP A;  4GHB A;  3AAA B;  3WI4 A;  2JQY A;  4D5U A;  1PRN A;  4JCH A;  3T0S A;  5AFU K;  3AAE B;  3HOE A;  1GFO A;  3K19 A;  4O3W A;  3WI5 A;  4Z3T A;  4O49 A;  2F1T A;  4KRA A;  4LSE A;  4XNK A;  4AKR A;  4F4B A;  3LK4 2;  3POU A;  5EE2 A;  1HXT A;  2ZFG A;  3QRC A;  2WJQ A;  3VZT X;  4AKR B;  5B5E O;  5GTH O;  3AA1 B;  3POX A;  3C5O A;  4GCQ A;  3NJT A;  3PGU A;  4K3B A;  3NSG A;  1QJ8 A;  2MNH A;  3DWO X;  4RLB A;  4UB6 O;  4AYI D;  4FQE A;  2N2M A;  3DA4 A;  3KZI O;  1PHO A;  3SYB A;  3TZG A;  4D64 A;  2R88 A;  2J1N A;  2K0L A;  3SY9 A;  3BS0 A;  5KAF O;  4AUI A;  1MM5 A;  2WVP A;  4FOZ A;  2IWW A;  1GFP A;  3T24 A;  2N2L A;  3G7G A;  4JFB A;  4C00 A;  4O3X B;  1E54 A;  4BUM X;  4O4U A;  2YPV A;  3BRY A;  4N59 A;  4RJX A;  3SY7 A;  2F1C X;  2ODJ A;  4FRT A;  2FGQ X;  2MHL A;  3PGS A;  2R4N A;  5PRN A;  4C4V A;  3V8U A;  2R4P A;  5DL8 A;  4AYE C;  2FGR A;  5G3A A;  2O4V A;  4PUX A;  1IZN B;  1T16 A;  3A2S X;  3VZW X;  2XE3 A;  2Y0H A;  5IYU A;  2M06 A;  5T5F A;  4G75 A;  1ORM A;  3PRN A;  4FUV A;  2XTR A;  5DL5 A;  3VE1 A; 
#chains in the Genus database with same CATH homology
 1ZHX A;  1BXW A;  3LK2 A;  3POQ A;  1P4T A;  3VY8 X;  3O0E A;  5G26 A;  2XMX A;  5GV0 A;  5DL6 A;  2POR A;  4N58 A;  2Y7S A;  4FRX A;  2Y0K A;  4O4X A;  3EMN X;  3AA6 A;  4AYN A;  2XTQ A;  4GCS A;  3DA3 A;  4RL9 A;  4AYD C;  2KC0 A;  2ZLD A;  4QQ1 A;  2YNK A;  4AZL A;  1H6S 1;  1OSM A;  3VY9 X;  4E1S A;  3SZV A;  2XG6 A;  1ZHW A;  2J4U P;  1Q9G A;  3HW9 A;  4KR8 A;  2X27 X;  4AKM A;  1QJ9 A;  1BT9 A;  3LK4 1;  2JMM A;  1GFN A;  2LFU A;  1ZHY A;  1YS5 A;  3HWB A;  4LSF A;  1HXU A;  3LK3 B;  8PRN A;  5ADX K;  2KXP B;  2KZ7 B;  4FMS A;  6PRN A;  3PQU A;  1GFM A;  2KXP A;  2KZ7 A;  3FYX A;  2XE2 A;  5DL7 A;  4FZM A;  4LSI A;  4FZN A;  3LK3 A;  4GF4 A;  3UAQ A;  1HXX A;  4LSH A;  3UU2 A;  3HOL A;  3KVD D;  3T20 A;  5JDP A;  4B61 A;  3AAE A;  4GCP A;  4XNL A;  4FSO A;  2Y0L A;  3GP6 A;  3QRA A;  4FZL A;  4E1T A;  2F1V A;  3AA7 B;  2Y2X A;  1ZHZ A;  4C69 X;  2KDY A;  3VZU X;  3UPG A;  3AA7 A;  5AFU L;  2OMF A;  3PQS A;  1MM4 A;  4O3Z A;  2W81 C;  4KR4 A;  4D65 A;  1BH3 A;  2XE5 A;  1Q9F A;  4RJW A;  3SYS A;  1ZHT A;  2QTK A;  5D5D A;  3SZD A;  1MPF A;  3AA0 B;  2PRN A;  4G76 A;  3AAA A;  5ADX L;  1G90 A;  2K4T A;  3JTY A;  4RLC A;  3VE2 A;  4FT6 A;  4AFK A;  1OPF A;  2W80 C;  3RBH A;  2M07 A;  3LK2 B;  1GFQ A;  5FVN A;  2ERV A;  3POR A;  4U9C A;  2XE1 A;  4O3Y A;  7PRN A;  4FES A;  1THQ A;  2LHF A;  3AA1 A;  3AA6 B;  1IZN A;  2GE4 A;  1QJP A;  3AA0 A;  4FSP A;  4GHB A;  3AAA B;  3WI4 A;  4AYM C;  4D5U A;  1PRN A;  4JCH A;  3T0S A;  5AFU K;  3AAE B;  3HOE A;  1GFO A;  3K19 A;  4O3W A;  3WI5 A;  4Z3T A;  4O49 A;  2F1T A;  4KRA A;  4LSE A;  4XNK A;  4AKR A;  4F4B A;  3LK4 2;  3POU A;  5EE2 A;  1HXT A;  2ZFG A;  3QRC A;  3VZT X;  4AKR B;  3AA1 B;  3POX A;  3C5O A;  4GCQ A;  4AYI D;  4RLB A;  3NSG A;  1QJ8 A;  2MNH A;  2N2M A;  3DA4 A;  1PHO A;  3SYB A;  3TZG A;  4D64 A;  2J1N A;  2K0L A;  3SY9 A;  4AUI A;  1MM5 A;  4FOZ A;  1GFP A;  3T24 A;  2N2L A;  3G7G A;  4JFB A;  4O3X B;  1E54 A;  4BUM X;  4O4U A;  2YPV A;  4N59 A;  4RJX A;  3SY7 A;  2ODJ A;  4FRT A;  2FGQ X;  2MHL A;  5PRN A;  3V8U A;  5DL8 A;  4AYE C;  2FGR A;  2O4V A;  4PUX A;  1IZN B;  3VZW X;  3A2S X;  2XE3 A;  2Y0H A;  5IYU A;  2M06 A;  5T5F A;  4G75 A;  1ORM A;  3PRN A;  4FUV A;  2XTR A;  5DL5 A;  3VE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...