4AUIA

Structure and function of the porb porin from disseminating n. gonorrhoeae
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
308
structure length
308
Chain Sequence
b'DVTLYGTIKAGVETSRSVAHHGAQADRVKTATEIADLGSKIGFKGQEDLGNGLKAIWQLEQKAYVSGTDTGWGNRQSFIGLKGGFGKVRVGRLNNILKDTGNFNPWEGKSYYSGLSNIAQPEERHVSVRYDSPEFAGFSGSVQYVPNDNSGKNRSESYHAGFNYKNDGFFVQYAGSYKRHNYTTEKHQVHRLVGGYDHDALYASVAVQQQDAKLTWRDDNSHNSQTEVATTVAYRFGNVTPRVSYAHGFKGSVYDADHDNTYDQVVVGAEYDFSKRTSALVSAGWLQKGKGAEKFVATVGGVGLRHKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORIN (PORB)
publication title Structure and Function of the Porb Porin from Disseminating Neisseria Gonorrhoeae.
pubmed doi rcsb
molecule tags Membrane protein
total genus 62
structure length 308
sequence length 308
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4auiA00
2ZLDA 1HXXA 4BUMX 2PRNA 1BH3A 4GCSA 3SZDA 3UU2A 3PRNA 7PRNA 3NSGA 3O0EA 3SYBA 2Y0LA 1HXTA 3POUA 2O4VA 3VZUX 3WI5A 3VZTX 4KRAA 3SYSA 4D64A 5PRNA 1HXUA 4JFBA 1GFPA 2XE5A 5FVNA 2XE2A 4GCQA 4D5UA 1MPFA 3T0SA 3HW9A 4RJWA 1OSMA 8PRNA 4LSFA 4FT6A 5JDPA 3A2SX 3VY8X 3POQA 4RJXA 1GFQA 2QTKA 1GFNA 4LSEA 2XG6A 4C69X 4KR4A 2OMFA 2J4UP 2FGQX 5DL7A 3FYXA 2ODJA 3WI4A 3EMNX 4FRXA 3SY7A 2Y0HA 3K19A 1OPFA 3PORA 4KR8A 4LSHA 4GCPA 3SY9A 2K4TA 3SZVA 2Y0KA 2J1NA 4D65A 4LSIA 3VY9X 2Y2XA 5DL8A 1PHOA 4FSPA 1H6S1 4FRTA 1BT9A 1GFMA 5DL5A 3VZWX 4FMSA 4FSOA 3POXA 1PRNA 3T24A 2ZFGA 5DL6A 4FOZA 1GFOA 2FGRA 6PRNA 3JTYA 3UPGA 2PORA 4AUIA 3HWBA 2XE3A 1E54A 2XE1A 3T20A
chains in the Genus database with same CATH superfamily
2ZLDA 1HXXA 1ZHTA 3VE2A 4BUMX 3BRYA 3PF1A 2PRNA 3PGUA 2YNKA 3PQUA 4GHBA 1BH3A 1ZHYA 1Q9GA 4F4BA 4GCSA 3SZDA 4AYID 4IL6O 3AA0B 3UU2A 4U9CA 4O4UA 2KDYA 3DA4A 3LK2A 3PRNA 3QRAA 7PRNA 3LK3A 1QJ9A 3KZIO 3NSGA 3O0EA 3DWOX 4AYNA 3SYBA 2Y0LA 4UB6O 2ERVA 1HXTA 3AA6A 3POUA 2O4VA 4N75A 4FZLA 3VZUX 3WI5A 3VZTX 2IWVA 4KRAA 3SYSA 5KAIO 4D64A 3PGRA 5PRNA 1G90A 5E79O 1HXUA 2K0LA 4JFBA 3LK3B 4O3YA 1GFPA 3AAAB 4O3WA 2XE5A 5FVNA 5H2FO 2XE2A 4GCQA 4D5UA 3AA6B 3RBHA 3TZGA 5G38A 1MPFA 4N74A 3T0SA 1QJPA 4O3ZA 1T16A 2M06A 4XNKA 3HW9A 4C4VB 2R89A 3PGSA 3BS0A 1MM5A 1OSMA 4RJWA 8PRNA 4AKMA 1S5LO 2W81C 4LSFA 4FT6A 5JDPA 3A2SX 3AA1A 2JMMA 5D5DA 3VY8X 3VE1A 4E1SA 3POQA 1MM4A 2GE4A 3A0BO 3DWNA 1QJ8A 3AAAA 1GFQA 4FUVA 4RJXA 5G39A 2QTKA 2R88A 1GFNA 4PJ0O 3HOLA 4AYMC 1YS5A 4LSEA 5GV0A 2LFUA 2WJRA 3DZMA 4C00A 4Z3TA 5G3AA 2XG6A 5B66O 3V8UA 4KR4A 2F1TA 2OMFA 3AA1B 4RL9A 2FGQX 3LK42 4C69X 2J4UP 4C4VA 5DL7A 4AYEC 1ZHZA 4GF4A 4E1TA 5T5FA 3FYXA 5TISO 5IYUA 5AFUK 2ODJA 1Q9FA 5ADXK 3WI4A 4AKRB 2XTRA 3EMNX 5AFUL 3BRZA 4FRXA 3SY7A 2IWWA 2Y0HA 5KAFO 5GTHO 4CTDA 5B5EO 1THQA 3K19A 2R8AA 1OPFA 4B61A 2AXTO 2XMXA 3PORA 4KR8A 2XTQA 4LSHA 4GCPA 3SY9A 2LHFA 4PUXA 1ORMA 2K4TA 3A0HO 3SZVA 4FZNA 4K3CA 4XNLA 3WU2O 2Y0KA 1ZHWA 4AYDC 2KC0A 3HOEA 2M07A 2J1NA 4AKRA 4D65A 4LSIA 2X27X 2R4LA 3VY9X 4G76A 2Y2XA 2JQYA 1ZHXA 5EE2A 3G7GA 5DL8A 1IZNA 1PHOA 4FSPA 1H6S1 3AAEA 1BT9A 4FRTA 3C5OA 5ADXL 1GFMA 3AA7A 2KZ7B 5DL5A 4N59A 4FMSA 3VZWX 3DA3A 4FSOA 2F1CX 4N58A 4AZLA 4QQ1A 3NJTA 2R4NA 1PRNA 3POXA 3T24A 1T1LA 4O49A 2ZFGA 4RLBA 3LK41 4UB8O 1IZNB 2R4OA 3PQSA 5DL6A 2X9KA 2KXPA 2WVPA 2F1VA 3AAEB 4FOZA 4O3XB 2N2MA 4FESA 1GFOA 4RLCA 4AFKA 2FGRA 3KVDD 4G75A 1BXWA 2MHLA 3AA7B 6PRNA 2N2LA 3JCUO 3JTYA 3GP6A 4FZMA 4JCHA 4PR7A 3UPGA 4FQEA 5GTIO 3UAQA 3QRCA 2KZ7A 2PORA 2Y7SA 3LK2B 4AUIA 3HWBA 2KXPB 1P4TA 2R4PA 5G26A 2W80C 2XE3A 1E54A 2WJQA 3AA0A 2MNHA 2YPVA 4O4XA 2XE1A 3T20A 4K3BA
chains in the Genus database with same CATH topology
2ZLDA 1HXXA 1ZHTA 3VE2A 4BUMX 2PRNA 2YNKA 3PQUA 4GHBA 1BH3A 1ZHYA 1Q9GA 4F4BA 4GCSA 3SZDA 4AYID 3AA0B 3UU2A 4U9CA 4O4UA 2KDYA 3DA4A 3LK2A 3PRNA 3QRAA 7PRNA 3LK3A 1QJ9A 3NSGA 3O0EA 4AYNA 3SYBA 2Y0LA 2ERVA 1HXTA 3AA6A 3POUA 2O4VA 4FZLA 3VZUX 3WI5A 3VZTX 4KRAA 3SYSA 4D64A 5PRNA 1G90A 1HXUA 2K0LA 4JFBA 3LK3B 4O3YA 1GFPA 3AAAB 4O3WA 2XE5A 5FVNA 2XE2A 4GCQA 4D5UA 3AA6B 3RBHA 3TZGA 1MPFA 3T0SA 1QJPA 4O3ZA 2M06A 4XNKA 3HW9A 1MM5A 1OSMA 4RJWA 8PRNA 4AKMA 2W81C 4LSFA 4FT6A 5JDPA 3A2SX 3AA1A 2JMMA 5D5DA 3VY8X 3VE1A 4E1SA 3POQA 1MM4A 2GE4A 1QJ8A 3AAAA 1GFQA 4FUVA 4RJXA 2QTKA 1GFNA 4AYMC 3HOLA 1YS5A 4LSEA 5GV0A 2LFUA 4Z3TA 2XG6A 3V8UA 4KR4A 2F1TA 2OMFA 3AA1B 4RL9A 2FGQX 3LK42 4C69X 2J4UP 5DL7A 4AYEC 1ZHZA 4GF4A 4E1TA 5T5FA 3FYXA 5IYUA 5AFUK 2ODJA 1Q9FA 5ADXK 3WI4A 4AKRB 2XTRA 3EMNX 5AFUL 4FRXA 3SY7A 2Y0HA 1THQA 3K19A 1OPFA 4B61A 2XMXA 3PORA 4KR8A 2XTQA 4LSHA 4GCPA 3SY9A 2LHFA 4PUXA 1ORMA 2K4TA 3SZVA 4FZNA 4XNLA 2Y0KA 1ZHWA 4AYDC 2KC0A 3HOEA 2M07A 2J1NA 4AKRA 4D65A 4LSIA 2X27X 3VY9X 4G76A 2Y2XA 1ZHXA 5EE2A 3G7GA 5DL8A 1IZNA 1PHOA 4FSPA 1H6S1 3AAEA 1BT9A 4FRTA 3C5OA 5ADXL 1GFMA 3AA7A 2KZ7B 5DL5A 4N59A 4FMSA 3VZWX 3DA3A 4FSOA 4N58A 4AZLA 4QQ1A 3POXA 1PRNA 3T24A 4O49A 2ZFGA 4RLBA 3LK41 5DL6A 1IZNB 3PQSA 2KXPA 2F1VA 3AAEB 4FOZA 2N2MA 4FESA 1GFOA 4RLCA 4AFKA 2FGRA 3KVDD 4G75A 1BXWA 2MHLA 3AA7B 6PRNA 2N2LA 3JTYA 3GP6A 4FZMA 4JCHA 3UPGA 3UAQA 3QRCA 2KZ7A 2PORA 2Y7SA 3LK2B 4AUIA 3HWBA 2KXPB 1P4TA 5G26A 2W80C 2XE3A 1E54A 3AA0A 2MNHA 2YPVA 4O4XA 2XE1A 3T20A 4O3XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZLD A;  1HXX A;  4BUM X;  2PRN A;  1BH3 A;  4GCS A;  3SZD A;  3UU2 A;  3PRN A;  7PRN A;  3NSG A;  3O0E A;  3SYB A;  2Y0L A;  1HXT A;  3POU A;  2O4V A;  3VZU X;  3WI5 A;  3VZT X;  4KRA A;  3SYS A;  4D64 A;  5PRN A;  1HXU A;  4JFB A;  1GFP A;  2XE5 A;  5FVN A;  2XE2 A;  4GCQ A;  4D5U A;  1MPF A;  3T0S A;  3HW9 A;  4RJW A;  1OSM A;  8PRN A;  4LSF A;  4FT6 A;  5JDP A;  3A2S X;  3VY8 X;  3POQ A;  4RJX A;  1GFQ A;  2QTK A;  1GFN A;  4LSE A;  2XG6 A;  4C69 X;  4KR4 A;  2OMF A;  2J4U P;  2FGQ X;  5DL7 A;  3FYX A;  2ODJ A;  3WI4 A;  3EMN X;  4FRX A;  3SY7 A;  2Y0H A;  3K19 A;  1OPF A;  3POR A;  4KR8 A;  4LSH A;  4GCP A;  3SY9 A;  2K4T A;  3SZV A;  2Y0K A;  2J1N A;  4D65 A;  4LSI A;  3VY9 X;  2Y2X A;  5DL8 A;  1PHO A;  4FSP A;  1H6S 1;  4FRT A;  1BT9 A;  1GFM A;  5DL5 A;  3VZW X;  4FMS A;  4FSO A;  3POX A;  1PRN A;  3T24 A;  2ZFG A;  5DL6 A;  4FOZ A;  1GFO A;  2FGR A;  6PRN A;  3JTY A;  3UPG A;  2POR A;  4AUI A;  3HWB A;  2XE3 A;  1E54 A;  2XE1 A;  3T20 A; 
#chains in the Genus database with same CATH topology
 2ZLD A;  1HXX A;  1ZHT A;  3VE2 A;  4BUM X;  3BRY A;  3PF1 A;  2PRN A;  3PGU A;  2YNK A;  3PQU A;  4GHB A;  1BH3 A;  1ZHY A;  1Q9G A;  4F4B A;  4GCS A;  3SZD A;  4AYI D;  4IL6 O;  3AA0 B;  3UU2 A;  4U9C A;  4O4U A;  2KDY A;  3DA4 A;  3LK2 A;  3PRN A;  3QRA A;  7PRN A;  3LK3 A;  1QJ9 A;  3KZI O;  3NSG A;  3O0E A;  3DWO X;  4AYN A;  3SYB A;  2Y0L A;  4UB6 O;  2ERV A;  1HXT A;  3AA6 A;  3POU A;  2O4V A;  4N75 A;  4FZL A;  3VZU X;  3WI5 A;  3VZT X;  2IWV A;  4KRA A;  3SYS A;  5KAI O;  4D64 A;  3PGR A;  5PRN A;  1G90 A;  5E79 O;  1HXU A;  2K0L A;  4JFB A;  3LK3 B;  4O3Y A;  1GFP A;  3AAA B;  4O3W A;  2XE5 A;  5FVN A;  5H2F O;  2XE2 A;  4GCQ A;  4D5U A;  3AA6 B;  3RBH A;  3TZG A;  5G38 A;  1MPF A;  4N74 A;  3T0S A;  1QJP A;  4O3Z A;  1T16 A;  2M06 A;  4XNK A;  3HW9 A;  4C4V B;  2R89 A;  3PGS A;  3BS0 A;  1MM5 A;  1OSM A;  4RJW A;  8PRN A;  4AKM A;  1S5L O;  2W81 C;  4LSF A;  4FT6 A;  5JDP A;  3A2S X;  3AA1 A;  2JMM A;  5D5D A;  3VY8 X;  3VE1 A;  4E1S A;  3POQ A;  1MM4 A;  2GE4 A;  3A0B O;  3DWN A;  1QJ8 A;  3AAA A;  1GFQ A;  4FUV A;  4RJX A;  5G39 A;  2QTK A;  2R88 A;  1GFN A;  4PJ0 O;  3HOL A;  4AYM C;  1YS5 A;  4LSE A;  5GV0 A;  2LFU A;  2WJR A;  3DZM A;  4C00 A;  4Z3T A;  5G3A A;  2XG6 A;  5B66 O;  3V8U A;  4KR4 A;  2F1T A;  2OMF A;  3AA1 B;  4RL9 A;  2FGQ X;  3LK4 2;  4C69 X;  2J4U P;  4C4V A;  5DL7 A;  4AYE C;  1ZHZ A;  4GF4 A;  4E1T A;  5T5F A;  3FYX A;  5TIS O;  5IYU A;  5AFU K;  2ODJ A;  1Q9F A;  5ADX K;  3WI4 A;  4AKR B;  2XTR A;  3EMN X;  5AFU L;  3BRZ A;  4FRX A;  3SY7 A;  2IWW A;  2Y0H A;  5KAF O;  5GTH O;  4CTD A;  5B5E O;  1THQ A;  3K19 A;  2R8A A;  1OPF A;  4B61 A;  2AXT O;  2XMX A;  3POR A;  4KR8 A;  2XTQ A;  4LSH A;  4GCP A;  3SY9 A;  2LHF A;  4PUX A;  1ORM A;  2K4T A;  3A0H O;  3SZV A;  4FZN A;  4K3C A;  4XNL A;  3WU2 O;  2Y0K A;  1ZHW A;  4AYD C;  2KC0 A;  3HOE A;  2M07 A;  2J1N A;  4AKR A;  4D65 A;  4LSI A;  2X27 X;  2R4L A;  3VY9 X;  4G76 A;  2Y2X A;  2JQY A;  1ZHX A;  5EE2 A;  3G7G A;  5DL8 A;  1IZN A;  1PHO A;  4FSP A;  1H6S 1;  3AAE A;  1BT9 A;  4FRT A;  3C5O A;  5ADX L;  1GFM A;  3AA7 A;  2KZ7 B;  5DL5 A;  4N59 A;  4FMS A;  3VZW X;  3DA3 A;  4FSO A;  2F1C X;  4N58 A;  4AZL A;  4QQ1 A;  3NJT A;  2R4N A;  1PRN A;  3POX A;  3T24 A;  1T1L A;  4O49 A;  2ZFG A;  4RLB A;  3LK4 1;  4UB8 O;  1IZN B;  2R4O A;  3PQS A;  5DL6 A;  2X9K A;  2KXP A;  2WVP A;  2F1V A;  3AAE B;  4FOZ A;  4O3X B;  2N2M A;  4FES A;  1GFO A;  4RLC A;  4AFK A;  2FGR A;  3KVD D;  4G75 A;  1BXW A;  2MHL A;  3AA7 B;  6PRN A;  2N2L A;  3JCU O;  3JTY A;  3GP6 A;  4FZM A;  4JCH A;  4PR7 A;  3UPG A;  4FQE A;  5GTI O;  3UAQ A;  3QRC A;  2KZ7 A;  2POR A;  2Y7S A;  3LK2 B;  4AUI A;  3HWB A;  2KXP B;  1P4T A;  2R4P A;  5G26 A;  2W80 C;  2XE3 A;  1E54 A;  2WJQ A;  3AA0 A;  2MNH A;  2YPV A;  4O4X A;  2XE1 A;  3T20 A;  4K3B A; 
#chains in the Genus database with same CATH homology
 2ZLD A;  1HXX A;  1ZHT A;  3VE2 A;  4BUM X;  2PRN A;  2YNK A;  3PQU A;  4GHB A;  1BH3 A;  1ZHY A;  1Q9G A;  4F4B A;  4GCS A;  3SZD A;  4AYI D;  3AA0 B;  3UU2 A;  4U9C A;  4O4U A;  2KDY A;  3DA4 A;  3LK2 A;  3PRN A;  3QRA A;  7PRN A;  3LK3 A;  1QJ9 A;  3NSG A;  3O0E A;  4AYN A;  3SYB A;  2Y0L A;  2ERV A;  1HXT A;  3AA6 A;  3POU A;  2O4V A;  4FZL A;  3VZU X;  3WI5 A;  3VZT X;  4KRA A;  3SYS A;  4D64 A;  5PRN A;  1G90 A;  1HXU A;  2K0L A;  4JFB A;  3LK3 B;  4O3Y A;  1GFP A;  3AAA B;  4O3W A;  2XE5 A;  5FVN A;  2XE2 A;  4GCQ A;  4D5U A;  3AA6 B;  3RBH A;  3TZG A;  1MPF A;  3T0S A;  1QJP A;  4O3Z A;  2M06 A;  4XNK A;  3HW9 A;  1MM5 A;  1OSM A;  4RJW A;  8PRN A;  4AKM A;  2W81 C;  4LSF A;  4FT6 A;  5JDP A;  3A2S X;  3AA1 A;  2JMM A;  5D5D A;  3VY8 X;  3VE1 A;  4E1S A;  3POQ A;  1MM4 A;  2GE4 A;  1QJ8 A;  3AAA A;  1GFQ A;  4FUV A;  4RJX A;  2QTK A;  1GFN A;  4AYM C;  3HOL A;  1YS5 A;  4LSE A;  5GV0 A;  2LFU A;  4Z3T A;  2XG6 A;  3V8U A;  4KR4 A;  2F1T A;  2OMF A;  3AA1 B;  4RL9 A;  2FGQ X;  3LK4 2;  4C69 X;  2J4U P;  5DL7 A;  4AYE C;  1ZHZ A;  4GF4 A;  4E1T A;  5T5F A;  3FYX A;  5IYU A;  5AFU K;  2ODJ A;  1Q9F A;  5ADX K;  3WI4 A;  4AKR B;  2XTR A;  3EMN X;  5AFU L;  4FRX A;  3SY7 A;  2Y0H A;  1THQ A;  3K19 A;  1OPF A;  4B61 A;  2XMX A;  3POR A;  4KR8 A;  2XTQ A;  4LSH A;  4GCP A;  3SY9 A;  2LHF A;  4PUX A;  1ORM A;  2K4T A;  3SZV A;  4FZN A;  4XNL A;  2Y0K A;  1ZHW A;  4AYD C;  2KC0 A;  3HOE A;  2M07 A;  2J1N A;  4AKR A;  4D65 A;  4LSI A;  2X27 X;  3VY9 X;  4G76 A;  2Y2X A;  1ZHX A;  5EE2 A;  3G7G A;  5DL8 A;  1IZN A;  1PHO A;  4FSP A;  1H6S 1;  3AAE A;  1BT9 A;  4FRT A;  3C5O A;  5ADX L;  1GFM A;  3AA7 A;  2KZ7 B;  5DL5 A;  4N59 A;  4FMS A;  3VZW X;  3DA3 A;  4FSO A;  4N58 A;  4AZL A;  4QQ1 A;  3POX A;  1PRN A;  3T24 A;  4O49 A;  2ZFG A;  4RLB A;  3LK4 1;  5DL6 A;  1IZN B;  3PQS A;  2KXP A;  2F1V A;  3AAE B;  4FOZ A;  2N2M A;  4FES A;  1GFO A;  4RLC A;  4AFK A;  2FGR A;  3KVD D;  4G75 A;  1BXW A;  2MHL A;  3AA7 B;  6PRN A;  2N2L A;  3JTY A;  3GP6 A;  4FZM A;  4JCH A;  3UPG A;  3UAQ A;  3QRC A;  2KZ7 A;  2POR A;  2Y7S A;  3LK2 B;  4AUI A;  3HWB A;  2KXP B;  1P4T A;  5G26 A;  2W80 C;  2XE3 A;  1E54 A;  3AA0 A;  2MNH A;  2YPV A;  4O4X A;  2XE1 A;  3T20 A;  4O3X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...