4AUIA

Structure and function of the porb porin from disseminating n. gonorrhoeae
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
308
structure length
308
Chain Sequence
DVTLYGTIKAGVETSRSVAHHGAQADRVKTATEIADLGSKIGFKGQEDLGNGLKAIWQLEQKAYVSGTDTGWGNRQSFIGLKGGFGKVRVGRLNNILKDTGNFNPWEGKSYYSGLSNIAQPEERHVSVRYDSPEFAGFSGSVQYVPNDNSGKNRSESYHAGFNYKNDGFFVQYAGSYKRHNYTTEKHQVHRLVGGYDHDALYASVAVQQQDAKLTWRDDNSHNSQTEVATTVAYRFGNVTPRVSYAHGFKGSVYDADHDNTYDQVVVGAEYDFSKRTSALVSAGWLQKGKGAEKFVATVGGVGLRHKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the Porb Porin from Disseminating Neisseria Gonorrhoeae.
pubmed doi rcsb
molecule tags Membrane protein
molecule keywords PORIN (PORB)
total genus 62
structure length 308
sequence length 308
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4auiA00
3JTYA 3VY8X 4BUMX 5DL7A 3T20A 2FGQX 1OSMA 1HXXA 4AUIA 6PRNA 1MPFA 1HXTA 2K4TA 5DL6A 3VZUX 3VZWX 2J4UP 3O0EA 1GFOA 4KR4A 4LSEA 4KR8A 3SY9A 4FMSA 3SYSA 2PRNA 5FVNA 4FRXA 4GCPA 2O4VA 7PRNA 4LSIA 3NSGA 1E54A 2XE3A 2XE5A 3VY9X 2ZFGA 3POUA 4FT6A 2XE2A 3SZDA 3HW9A 3EMNX 3T24A 1GFMA 4RJWA 2Y0LA 1HXUA 1PRNA 4GCSA 4LSFA 4D65A 2XG6A 2FGRA 4KRAA 2ODJA 3UU2A 2Y0KA 5DL8A 4FRTA 2OMFA 5DL5A 2J1NA 1GFPA 1GFNA 4LSHA 4RJXA 4FOZA 3PRNA 4D5UA 3POQA 4FSPA 3UPGA 4FSOA 3SZVA 2Y2XA 3FYXA 3POXA 4JFBA 3WI5A 8PRNA 2PORA 4D64A 1OPFA 1GFQA 1BH3A 3K19A 1H6S1 3PORA 5JDPA 4C69X 3A2SX 1PHOA 2ZLDA 3HWBA 3SY7A 1BT9A 2Y0HA 2QTKA 3T0SA 5PRNA 3SYBA 3WI4A 3VZTX 4GCQA 2XE1A
chains in the Genus database with same CATH superfamily
3JTYA 3VY8X 3AA6B 4JCHA 4AFKA 2IWVA 4RLBA 2F1VA 2Y7SA 4BUMX 4C00A 1THQA 4AYNA 3QRAA 5IYUA 3JCUO 3WU2O 5DL7A 5H2FO 1P4TA 3V8UA 2W81C 4C4VA 3T20A 1QJ9A 2FGQX 5B66O 1OSMA 1HXXA 2AXTO 4FQEA 4PUXA 4E1SA 2KZ7B 3LK2B 5KAFO 4AUIA 4E1TA 2F1CX 2WJRA 4FZMA 2KC0A 6PRNA 2W80C 1MPFA 2N2MA 1HXTA 2K4TA 3PGUA 5DL6A 3VZUX 3VZWX 3AAEB 1BXWA 1MM5A 2N2LA 2YPVA 3AAEA 2J4UP 1QJPA 3G7GA 2WVPA 3O0EA 4N59A 5G39A 1GFOA 4O4UA 4KR4A 1T1LA 5G26A 4G75A 3LK42 4KR8A 4LSEA 4K3BA 4O3ZA 2JQYA 3BRZA 3LK3A 3SY9A 4FMSA 1ZHYA 3SYSA 3TZGA 2KZ7A 4K3CA 4O3XB 2PRNA 2LFUA 5GTIO 4AYID 3PGRA 2KXPA 4AYDC 5FVNA 2R89A 1IZNA 1ZHWA 3AA0A 4FRXA 3PGSA 4GCPA 4F4BA 2O4VA 1ZHTA 3AA0B 3LK3B 2R4PA 4RL9A 7PRNA 5ADXK 4LSIA 4GCQA 3UAQA 3DA4A 3NSGA 2KXPB 3RBHA 1E54A 2XE3A 3PQSA 2XE5A 3VY9X 2ZFGA 3POUA 2F1TA 4G76A 4FZNA 3DZMA 4O49A 5AFUL 4FT6A 2XE2A 3SZDA 3HW9A 3AAAB 1ZHZA 2ERVA 2R4NA 4FESA 3EMNX 4CTDA 3AAAA 3T24A 5G38A 1GFMA 1S5LO 4RJWA 2Y0LA 3A0HO 2M07A 3C5OA 1HXUA 1PRNA 3LK2A 3BS0A 4GCSA 4LSFA 4D65A 5GV0A 4GHBA 5KAIO 5ADXL 1YS5A 3HOLA 2XG6A 2FGRA 4AZLA 4XNKA 4KRAA 3NJTA 4N74A 2ODJA 1MM4A 4IL6O 3DWNA 4N75A 4N58A 5AFUK 2X9KA 2X27X 3UU2A 2Y0KA 3GP6A 4FRTA 4FZLA 5DL8A 2OMFA 5DL5A 1ORMA 2J1NA 4QQ1A 1GFPA 1GFNA 5E79O 4LSHA 2YNKA 4RJXA 2LHFA 4FOZA 2R4OA 3PRNA 2K0LA 4O4XA 4B61A 3KVDD 2M06A 5D5DA 4AKMA 2XTRA 4D5UA 1Q9FA 3DA3A 2MNHA 3DWOX 5G3AA 4Z3TA 4C4VB 4O3WA 3POQA 2MHLA 4FSPA 5T5FA 3UPGA 4FSOA 4AYMC 3PQUA 1IZNB 1Q9GA 2GE4A 3BRYA 2XTQA 2R4LA 4U9CA 1T16A 2R8AA 3KZIO 5B5EO 3SZVA 2Y2XA 3AA1A 3FYXA 3POXA 4UB8O 3AA7B 3PF1A 2XMXA 4JFBA 3VE2A 2R88A 3WI5A 4AKRA 8PRNA 2PORA 3AA1B 2IWWA 5TISO 3LK41 3AA7A 4AKRB 2WJQA 4D64A 1OPFA 1GFQA 3HOEA 1BH3A 3QRCA 4AYEC 3K19A 1H6S1 1ZHXA 1QJ8A 4GF4A 3PORA 5JDPA 4RLCA 4C69X 5GTHO 1G90A 3VE1A 3A2SX 4O3YA 1PHOA 5EE2A 2ZLDA 3A0BO 2KDYA 4PJ0O 3HWBA 4UB6O 3SY7A 1BT9A 2Y0HA 2QTKA 4XNLA 3T0SA 5PRNA 4PR7A 3SYBA 3WI4A 4FUVA 3VZTX 2JMMA 3AA6A 2XE1A
chains in the Genus database with same CATH topology
3JTYA 3VY8X 3AA6B 4JCHA 4AFKA 4RLBA 2F1VA 2Y7SA 4BUMX 1THQA 4AYNA 3QRAA 5IYUA 5DL7A 1P4TA 3V8UA 2W81C 3T20A 1QJ9A 2FGQX 1OSMA 1HXXA 4E1SA 4PUXA 2KZ7B 3LK2B 4AUIA 4E1TA 4FZMA 2KC0A 6PRNA 2W80C 1MPFA 2N2MA 1HXTA 2K4TA 5DL6A 3VZUX 3VZWX 3AAEB 1BXWA 1MM5A 2N2LA 2YPVA 3AAEA 2J4UP 1QJPA 3G7GA 3O0EA 4N59A 1GFOA 4O4UA 4KR4A 5G26A 3TZGA 4G75A 3LK42 4KR8A 4LSEA 4O3ZA 3LK3A 3SY9A 4FMSA 1ZHYA 3SYSA 2KZ7A 4O3XB 2PRNA 2LFUA 4AYID 2KXPA 4AYDC 5FVNA 1IZNA 1ZHWA 3AA0A 4FRXA 4GCPA 4F4BA 2O4VA 1ZHTA 3AA0B 3LK3B 4RL9A 7PRNA 5ADXK 4LSIA 4GCQA 3UAQA 3DA4A 3NSGA 2KXPB 3RBHA 1E54A 2XE3A 3PQSA 2XE5A 3VY9X 2ZFGA 3POUA 2F1TA 4G76A 4FZNA 4O49A 5AFUL 4FT6A 2XE2A 3SZDA 3HW9A 3AAAB 1ZHZA 2ERVA 4FESA 3EMNX 3AAAA 3T24A 1GFMA 4RJWA 2Y0LA 3LK2A 2M07A 3C5OA 1HXUA 1PRNA 4GCSA 4LSFA 4D65A 5GV0A 4GHBA 5ADXL 1YS5A 3HOLA 2XG6A 2FGRA 4AZLA 4XNKA 4KRAA 2ODJA 1MM4A 4N58A 5AFUK 2X27X 3UU2A 2Y0KA 3GP6A 4FRTA 4FZLA 5DL8A 2OMFA 5DL5A 1ORMA 2J1NA 4QQ1A 1GFPA 1GFNA 4LSHA 2YNKA 4RJXA 2LHFA 4FOZA 3PRNA 2K0LA 4O4XA 4B61A 3KVDD 2M06A 5D5DA 4AKMA 2XTRA 4D5UA 1Q9FA 3DA3A 2MNHA 4Z3TA 4O3WA 3POQA 2MHLA 4FSPA 5T5FA 3UPGA 4FSOA 4AYMC 3PQUA 1IZNB 1Q9GA 2GE4A 2XTQA 4U9CA 3SZVA 2Y2XA 3AA1A 3FYXA 3POXA 3AA7B 4JFBA 2XMXA 3VE2A 3WI5A 4AKRA 8PRNA 2PORA 3AA1B 3LK41 3AA7A 4AKRB 4D64A 1OPFA 1GFQA 3HOEA 1BH3A 3QRCA 4AYEC 3K19A 1H6S1 1ZHXA 1QJ8A 4GF4A 3PORA 5JDPA 4RLCA 4C69X 1G90A 3VE1A 3A2SX 4O3YA 1PHOA 5EE2A 2ZLDA 2KDYA 3HWBA 3SY7A 1BT9A 2Y0HA 2QTKA 4XNLA 3T0SA 5PRNA 3SYBA 3WI4A 4FUVA 3VZTX 2JMMA 3AA6A 2XE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTY A;  3VY8 X;  4BUM X;  5DL7 A;  3T20 A;  2FGQ X;  1OSM A;  1HXX A;  4AUI A;  6PRN A;  1MPF A;  1HXT A;  2K4T A;  5DL6 A;  3VZU X;  3VZW X;  2J4U P;  3O0E A;  1GFO A;  4KR4 A;  4LSE A;  4KR8 A;  3SY9 A;  4FMS A;  3SYS A;  2PRN A;  5FVN A;  4FRX A;  4GCP A;  2O4V A;  7PRN A;  4LSI A;  3NSG A;  1E54 A;  2XE3 A;  2XE5 A;  3VY9 X;  2ZFG A;  3POU A;  4FT6 A;  2XE2 A;  3SZD A;  3HW9 A;  3EMN X;  3T24 A;  1GFM A;  4RJW A;  2Y0L A;  1HXU A;  1PRN A;  4GCS A;  4LSF A;  4D65 A;  2XG6 A;  2FGR A;  4KRA A;  2ODJ A;  3UU2 A;  2Y0K A;  5DL8 A;  4FRT A;  2OMF A;  5DL5 A;  2J1N A;  1GFP A;  1GFN A;  4LSH A;  4RJX A;  4FOZ A;  3PRN A;  4D5U A;  3POQ A;  4FSP A;  3UPG A;  4FSO A;  3SZV A;  2Y2X A;  3FYX A;  3POX A;  4JFB A;  3WI5 A;  8PRN A;  2POR A;  4D64 A;  1OPF A;  1GFQ A;  1BH3 A;  3K19 A;  1H6S 1;  3POR A;  5JDP A;  4C69 X;  3A2S X;  1PHO A;  2ZLD A;  3HWB A;  3SY7 A;  1BT9 A;  2Y0H A;  2QTK A;  3T0S A;  5PRN A;  3SYB A;  3WI4 A;  3VZT X;  4GCQ A;  2XE1 A; 
#chains in the Genus database with same CATH topology
 3JTY A;  3VY8 X;  3AA6 B;  4JCH A;  4AFK A;  2IWV A;  4RLB A;  2F1V A;  2Y7S A;  4BUM X;  4C00 A;  1THQ A;  4AYN A;  3QRA A;  5IYU A;  3JCU O;  3WU2 O;  5DL7 A;  5H2F O;  1P4T A;  3V8U A;  2W81 C;  4C4V A;  3T20 A;  1QJ9 A;  2FGQ X;  5B66 O;  1OSM A;  1HXX A;  2AXT O;  4FQE A;  4PUX A;  4E1S A;  2KZ7 B;  3LK2 B;  5KAF O;  4AUI A;  4E1T A;  2F1C X;  2WJR A;  4FZM A;  2KC0 A;  6PRN A;  2W80 C;  1MPF A;  2N2M A;  1HXT A;  2K4T A;  3PGU A;  5DL6 A;  3VZU X;  3VZW X;  3AAE B;  1BXW A;  1MM5 A;  2N2L A;  2YPV A;  3AAE A;  2J4U P;  1QJP A;  3G7G A;  2WVP A;  3O0E A;  4N59 A;  5G39 A;  1GFO A;  4O4U A;  4KR4 A;  1T1L A;  5G26 A;  4G75 A;  3LK4 2;  4KR8 A;  4LSE A;  4K3B A;  4O3Z A;  2JQY A;  3BRZ A;  3LK3 A;  3SY9 A;  4FMS A;  1ZHY A;  3SYS A;  3TZG A;  2KZ7 A;  4K3C A;  4O3X B;  2PRN A;  2LFU A;  5GTI O;  4AYI D;  3PGR A;  2KXP A;  4AYD C;  5FVN A;  2R89 A;  1IZN A;  1ZHW A;  3AA0 A;  4FRX A;  3PGS A;  4GCP A;  4F4B A;  2O4V A;  1ZHT A;  3AA0 B;  3LK3 B;  2R4P A;  4RL9 A;  7PRN A;  5ADX K;  4LSI A;  4GCQ A;  3UAQ A;  3DA4 A;  3NSG A;  2KXP B;  3RBH A;  1E54 A;  2XE3 A;  3PQS A;  2XE5 A;  3VY9 X;  2ZFG A;  3POU A;  2F1T A;  4G76 A;  4FZN A;  3DZM A;  4O49 A;  5AFU L;  4FT6 A;  2XE2 A;  3SZD A;  3HW9 A;  3AAA B;  1ZHZ A;  2ERV A;  2R4N A;  4FES A;  3EMN X;  4CTD A;  3AAA A;  3T24 A;  5G38 A;  1GFM A;  1S5L O;  4RJW A;  2Y0L A;  3A0H O;  2M07 A;  3C5O A;  1HXU A;  1PRN A;  3LK2 A;  3BS0 A;  4GCS A;  4LSF A;  4D65 A;  5GV0 A;  4GHB A;  5KAI O;  5ADX L;  1YS5 A;  3HOL A;  2XG6 A;  2FGR A;  4AZL A;  4XNK A;  4KRA A;  3NJT A;  4N74 A;  2ODJ A;  1MM4 A;  4IL6 O;  3DWN A;  4N75 A;  4N58 A;  5AFU K;  2X9K A;  2X27 X;  3UU2 A;  2Y0K A;  3GP6 A;  4FRT A;  4FZL A;  5DL8 A;  2OMF A;  5DL5 A;  1ORM A;  2J1N A;  4QQ1 A;  1GFP A;  1GFN A;  5E79 O;  4LSH A;  2YNK A;  4RJX A;  2LHF A;  4FOZ A;  2R4O A;  3PRN A;  2K0L A;  4O4X A;  4B61 A;  3KVD D;  2M06 A;  5D5D A;  4AKM A;  2XTR A;  4D5U A;  1Q9F A;  3DA3 A;  2MNH A;  3DWO X;  5G3A A;  4Z3T A;  4C4V B;  4O3W A;  3POQ A;  2MHL A;  4FSP A;  5T5F A;  3UPG A;  4FSO A;  4AYM C;  3PQU A;  1IZN B;  1Q9G A;  2GE4 A;  3BRY A;  2XTQ A;  2R4L A;  4U9C A;  1T16 A;  2R8A A;  3KZI O;  5B5E O;  3SZV A;  2Y2X A;  3AA1 A;  3FYX A;  3POX A;  4UB8 O;  3AA7 B;  3PF1 A;  2XMX A;  4JFB A;  3VE2 A;  2R88 A;  3WI5 A;  4AKR A;  8PRN A;  2POR A;  3AA1 B;  2IWW A;  5TIS O;  3LK4 1;  3AA7 A;  4AKR B;  2WJQ A;  4D64 A;  1OPF A;  1GFQ A;  3HOE A;  1BH3 A;  3QRC A;  4AYE C;  3K19 A;  1H6S 1;  1ZHX A;  1QJ8 A;  4GF4 A;  3POR A;  5JDP A;  4RLC A;  4C69 X;  5GTH O;  1G90 A;  3VE1 A;  3A2S X;  4O3Y A;  1PHO A;  5EE2 A;  2ZLD A;  3A0B O;  2KDY A;  4PJ0 O;  3HWB A;  4UB6 O;  3SY7 A;  1BT9 A;  2Y0H A;  2QTK A;  4XNL A;  3T0S A;  5PRN A;  4PR7 A;  3SYB A;  3WI4 A;  4FUV A;  3VZT X;  2JMM A;  3AA6 A;  2XE1 A; 
#chains in the Genus database with same CATH homology
 3JTY A;  3VY8 X;  3AA6 B;  4JCH A;  4AFK A;  4RLB A;  2F1V A;  2Y7S A;  4BUM X;  1THQ A;  4AYN A;  3QRA A;  5IYU A;  5DL7 A;  1P4T A;  3V8U A;  2W81 C;  3T20 A;  1QJ9 A;  2FGQ X;  1OSM A;  1HXX A;  4E1S A;  4PUX A;  2KZ7 B;  3LK2 B;  4AUI A;  4E1T A;  4FZM A;  2KC0 A;  6PRN A;  2W80 C;  1MPF A;  2N2M A;  1HXT A;  2K4T A;  5DL6 A;  3VZU X;  3VZW X;  3AAE B;  1BXW A;  1MM5 A;  2N2L A;  2YPV A;  3AAE A;  2J4U P;  1QJP A;  3G7G A;  3O0E A;  4N59 A;  1GFO A;  4O4U A;  4KR4 A;  5G26 A;  3TZG A;  4G75 A;  3LK4 2;  4KR8 A;  4LSE A;  4O3Z A;  3LK3 A;  3SY9 A;  4FMS A;  1ZHY A;  3SYS A;  2KZ7 A;  4O3X B;  2PRN A;  2LFU A;  4AYI D;  2KXP A;  4AYD C;  5FVN A;  1IZN A;  1ZHW A;  3AA0 A;  4FRX A;  4GCP A;  4F4B A;  2O4V A;  1ZHT A;  3AA0 B;  3LK3 B;  4RL9 A;  7PRN A;  5ADX K;  4LSI A;  4GCQ A;  3UAQ A;  3DA4 A;  3NSG A;  2KXP B;  3RBH A;  1E54 A;  2XE3 A;  3PQS A;  2XE5 A;  3VY9 X;  2ZFG A;  3POU A;  2F1T A;  4G76 A;  4FZN A;  4O49 A;  5AFU L;  4FT6 A;  2XE2 A;  3SZD A;  3HW9 A;  3AAA B;  1ZHZ A;  2ERV A;  4FES A;  3EMN X;  3AAA A;  3T24 A;  1GFM A;  4RJW A;  2Y0L A;  3LK2 A;  2M07 A;  3C5O A;  1HXU A;  1PRN A;  4GCS A;  4LSF A;  4D65 A;  5GV0 A;  4GHB A;  5ADX L;  1YS5 A;  3HOL A;  2XG6 A;  2FGR A;  4AZL A;  4XNK A;  4KRA A;  2ODJ A;  1MM4 A;  4N58 A;  5AFU K;  2X27 X;  3UU2 A;  2Y0K A;  3GP6 A;  4FRT A;  4FZL A;  5DL8 A;  2OMF A;  5DL5 A;  1ORM A;  2J1N A;  4QQ1 A;  1GFP A;  1GFN A;  4LSH A;  2YNK A;  4RJX A;  2LHF A;  4FOZ A;  3PRN A;  2K0L A;  4O4X A;  4B61 A;  3KVD D;  2M06 A;  5D5D A;  4AKM A;  2XTR A;  4D5U A;  1Q9F A;  3DA3 A;  2MNH A;  4Z3T A;  4O3W A;  3POQ A;  2MHL A;  4FSP A;  5T5F A;  3UPG A;  4FSO A;  4AYM C;  3PQU A;  1IZN B;  1Q9G A;  2GE4 A;  2XTQ A;  4U9C A;  3SZV A;  2Y2X A;  3AA1 A;  3FYX A;  3POX A;  3AA7 B;  4JFB A;  2XMX A;  3VE2 A;  3WI5 A;  4AKR A;  8PRN A;  2POR A;  3AA1 B;  3LK4 1;  3AA7 A;  4AKR B;  4D64 A;  1OPF A;  1GFQ A;  3HOE A;  1BH3 A;  3QRC A;  4AYE C;  3K19 A;  1H6S 1;  1ZHX A;  1QJ8 A;  4GF4 A;  3POR A;  5JDP A;  4RLC A;  4C69 X;  1G90 A;  3VE1 A;  3A2S X;  4O3Y A;  1PHO A;  5EE2 A;  2ZLD A;  2KDY A;  3HWB A;  3SY7 A;  1BT9 A;  2Y0H A;  2QTK A;  4XNL A;  3T0S A;  5PRN A;  3SYB A;  3WI4 A;  4FUV A;  3VZT X;  2JMM A;  3AA6 A;  2XE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...