4AUIA

Structure and function of the porb porin from disseminating n. gonorrhoeae
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
308
structure length
308
Chain Sequence
DVTLYGTIKAGVETSRSVAHHGAQADRVKTATEIADLGSKIGFKGQEDLGNGLKAIWQLEQKAYVSGTDTGWGNRQSFIGLKGGFGKVRVGRLNNILKDTGNFNPWEGKSYYSGLSNIAQPEERHVSVRYDSPEFAGFSGSVQYVPNDNSGKNRSESYHAGFNYKNDGFFVQYAGSYKRHNYTTEKHQVHRLVGGYDHDALYASVAVQQQDAKLTWRDDNSHNSQTEVATTVAYRFGNVTPRVSYAHGFKGSVYDADHDNTYDQVVVGAEYDFSKRTSALVSAGWLQKGKGAEKFVATVGGVGLRHKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORIN (PORB)
publication title Structure and Function of the Porb Porin from Disseminating Neisseria Gonorrhoeae.
pubmed doi rcsb
molecule tags Membrane protein
total genus 62
structure length 308
sequence length 308
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4auiA00
3SYBA 3HWBA 3WI5A 2J1NA 4JFBA 1GFOA 3SY7A 3SYSA 2Y2XA 4C69X 5JDPA 2QTKA 1GFPA 2ZLDA 3POUA 4FRXA 2XE3A 3T0SA 2XE1A 2XE5A 4GCPA 3POQA 3O0EA 1GFQA 2Y0HA 3SZVA 3HW9A 2PORA 3K19A 5DL8A 2OMFA 4LSIA 2K4TA 4RJWA 1PHOA 2FGQX 3VY8X 3FYXA 1MPFA 4D5UA 1PRNA 4FOZA 1E54A 7PRNA 1BT9A 1GFNA 4FRTA 3T20A 4FT6A 3VY9X 4KR8A 2PRNA 3SY9A 2O4VA 2XE2A 3VZTX 5FVNA 3SZDA 4FSOA 4LSHA 3EMNX 3T24A 6PRNA 5DL5A 2ODJA 4GCQA 4D65A 2ZFGA 5DL7A 4GCSA 4D64A 3JTYA 1BH3A 4LSEA 1HXXA 2Y0LA 1OPFA 4AUIA 3A2SX 2FGRA 4FMSA 1HXUA 1HXTA 4FSPA 3UU2A 3PRNA 8PRNA 4RJXA 5DL6A 1GFMA 2Y0KA 4KR4A 2XG6A 3POXA 4BUMX 1OSMA 3PORA 1H6S1 4KRAA 3NSGA 3UPGA 3WI4A 5PRNA 3VZWX 4LSFA 3VZUX 2J4UP
chains in the Genus database with same CATH superfamily
4UB6O 3AAAB 3BS0A 4C4VB 5D5DA 1Q9GA 3SYBA 3HWBA 1ZHXA 3WI5A 2KC0A 2R89A 2J1NA 5DL6A 2W80C 4N59A 4G76A 4JFBA 1GFOA 5GV0A 3SY7A 1MM5A 5H2FO 3SYSA 2Y2XA 4C69X 4CTDA 2LHFA 5JDPA 2QTKA 2X9KA 5G38A 1GFPA 2ZLDA 2MNHA 3POUA 4FQEA 4RLBA 3PGRA 4C00A 3PGSA 3VE2A 4FRXA 2XE3A 5G3AA 3T0SA 2XE1A 3KZIO 2XE5A 4GCPA 3POQA 1YS5A 2XMXA 3LK3A 1T16A 3O0EA 5IYUA 1GFQA 2Y0HA 2AXTO 4FZLA 3SZVA 2W81C 1G90A 3HW9A 2X27X 2PORA 4RLCA 3K19A 5DL8A 4C4VA 3AAEA 4O4XA 2OMFA 2R88A 4LSIA 4O49A 2K4TA 3AAEB 5KAIO 3DZMA 1P4TA 4RJWA 3C5OA 1PHOA 4O3ZA 4AYMC 4AKRB 4E1TA 2F1VA 2XTQA 4AFKA 1IZNA 1S5LO 2FGQX 3PQUA 3BRYA 4RL9A 1QJ8A 3VY8X 3WU2O 5G39A 3FYXA 1MPFA 1IZNB 4PR7A 4D5UA 2R4NA 2WVPA 3HOEA 1PRNA 4XNLA 3DWOX 3A0HO 4FOZA 4AYNA 2IWVA 1E54A 3LK2A 4AYDC 5AFUL 7PRNA 4IL6O 4O3YA 2IWWA 1BT9A 1GFNA 3LK2B 3PGUA 4FRTA 2KZ7B 3T20A 3PQSA 3BRZA 3A0BO 4FT6A 1ORMA 3AA0B 3VY9X 2PRNA 4KR8A 2N2MA 3SY9A 3AA6A 3G7GA 2M07A 2O4VA 4AYEC 4B61A 4E1SA 3AA6B 4FZNA 2R8AA 2XE2A 3AA7B 4FUVA 4GHBA 5FVNA 3VZTX 3SZDA 5B66O 1ZHWA 4FSOA 5GTIO 5ADXL 5G26A 4AKRA 2JQYA 4LSHA 2R4PA 4QQ1A 4FESA 4K3CA 2KDYA 3EMNX 3T24A 6PRNA 3HOLA 3LK42 3LK41 5DL5A 2ODJA 4GCQA 4D65A 1Q9FA 2ZFGA 1ZHZA 4U9CA 4JCHA 2WJRA 5DL7A 2M06A 3KVDD 5EE2A 4GCSA 1MM4A 3JTYA 4D64A 5B5EO 4AYID 1T1LA 1BH3A 4LSEA 3V8UA 2ERVA 2KZ7A 2K0LA 1HXXA 4Z3TA 2Y0LA 2N2LA 5TISO 1OPFA 3AA0A 5AFUK 1QJ9A 3A2SX 2FGRA 1HXUA 4FMSA 4PJ0O 4N58A 1HXTA 4AUIA 4O3WA 2YNKA 1THQA 4F4BA 3JCUO 4FSPA 2F1TA 3UU2A 3PRNA 3DWNA 4AKMA 3AA7A 8PRNA 4O4UA 5GTHO 3NJTA 4RJXA 4N75A 1ZHTA 2R4OA 1GFMA 2JMMA 2Y0KA 1ZHYA 4KR4A 2XG6A 4N74A 2XTRA 3AA1A 4FZMA 4UB8O 4O3XB 3DA3A 5T5FA 3POXA 2YPVA 4GF4A 3QRCA 4BUMX 3AA1B 2WJQA 1OSMA 3PF1A 1QJPA 3DA4A 2F1CX 1H6S1 3PORA 4KRAA 5ADXK 4AZLA 3RBHA 3NSGA 3UPGA 2R4LA 2GE4A 3TZGA 1BXWA 4K3BA 2MHLA 2KXPA 3WI4A 3GP6A 5PRNA 3UAQA 3VZWX 3LK3B 4LSFA 2KXPB 2J4UP 2Y7SA 4PUXA 3QRAA 4XNKA 5E79O 4G75A 5KAFO 3VE1A 3AAAA 3VZUX 2LFUA
chains in the Genus database with same CATH topology
3AAAB 5D5DA 1Q9GA 3SYBA 3HWBA 1ZHXA 3WI5A 2KC0A 2J1NA 2W80C 4N59A 4G76A 4JFBA 1GFOA 5GV0A 3SY7A 1MM5A 3SYSA 2Y2XA 4C69X 2LHFA 5JDPA 2QTKA 1GFPA 2ZLDA 2MNHA 3POUA 4RLBA 3VE2A 4FRXA 2XE3A 3T0SA 2XE1A 2XE5A 4GCPA 3POQA 1YS5A 2XMXA 3LK3A 3O0EA 5IYUA 1GFQA 2Y0HA 4FZLA 3SZVA 2W81C 1G90A 3HW9A 2X27X 2PORA 4RLCA 3K19A 5DL8A 3AAEA 4O4XA 2OMFA 4LSIA 4O49A 2K4TA 3AAEB 1P4TA 4RJWA 3C5OA 1PHOA 4O3ZA 4AYMC 4AKRB 4E1TA 2F1VA 2XTQA 4AFKA 1IZNA 2FGQX 3PQUA 4RL9A 3VY8X 1QJ8A 3FYXA 1MPFA 1IZNB 4D5UA 3HOEA 1PRNA 4XNLA 4FOZA 4AYNA 5AFUL 1E54A 3LK2A 4AYDC 7PRNA 4O3YA 1BT9A 1GFNA 3LK2B 4FRTA 2KZ7B 3T20A 3PQSA 4FT6A 1ORMA 3AA0B 3VY9X 2PRNA 4KR8A 2N2MA 3SY9A 3AA6A 3G7GA 2M07A 2O4VA 4AYEC 4B61A 4E1SA 3AA6B 4FZNA 2XE2A 3AA7B 4FUVA 4GHBA 5FVNA 3VZTX 3SZDA 5ADXL 1ZHWA 4FSOA 5G26A 4AKRA 4LSHA 4QQ1A 4FESA 2KDYA 3EMNX 3T24A 6PRNA 3HOLA 3LK42 3LK41 5DL5A 2ODJA 4GCQA 4D65A 1Q9FA 2ZFGA 1ZHZA 4U9CA 4JCHA 5DL7A 2M06A 3KVDD 5EE2A 4GCSA 1MM4A 3JTYA 4D64A 4AYID 1BH3A 4LSEA 3V8UA 2ERVA 2KZ7A 2K0LA 1HXXA 4Z3TA 2Y0LA 2N2LA 1OPFA 3AA0A 5AFUK 1QJ9A 3A2SX 2FGRA 1HXUA 4FMSA 4AUIA 4N58A 1HXTA 4F4BA 4O3WA 2YNKA 1THQA 4FSPA 2F1TA 3UU2A 3PRNA 4AKMA 3AA7A 8PRNA 4O4UA 4RJXA 5DL6A 1ZHTA 1GFMA 2JMMA 2Y0KA 1ZHYA 4KR4A 2XG6A 5T5FA 2XTRA 3AA1A 4FZMA 4O3XB 3DA3A 3POXA 2YPVA 4GF4A 3QRCA 4BUMX 3AA1B 1OSMA 1QJPA 3DA4A 3PORA 1H6S1 4KRAA 5ADXK 4AZLA 3RBHA 3NSGA 3UPGA 2GE4A 3TZGA 1BXWA 2MHLA 2KXPA 3WI4A 3GP6A 5PRNA 3UAQA 3VZWX 3LK3B 4LSFA 2KXPB 2J4UP 2Y7SA 4PUXA 3QRAA 4XNKA 4G75A 3VE1A 3AAAA 3VZUX 2LFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYB A;  3HWB A;  3WI5 A;  2J1N A;  4JFB A;  1GFO A;  3SY7 A;  3SYS A;  2Y2X A;  4C69 X;  5JDP A;  2QTK A;  1GFP A;  2ZLD A;  3POU A;  4FRX A;  2XE3 A;  3T0S A;  2XE1 A;  2XE5 A;  4GCP A;  3POQ A;  3O0E A;  1GFQ A;  2Y0H A;  3SZV A;  3HW9 A;  2POR A;  3K19 A;  5DL8 A;  2OMF A;  4LSI A;  2K4T A;  4RJW A;  1PHO A;  2FGQ X;  3VY8 X;  3FYX A;  1MPF A;  4D5U A;  1PRN A;  4FOZ A;  1E54 A;  7PRN A;  1BT9 A;  1GFN A;  4FRT A;  3T20 A;  4FT6 A;  3VY9 X;  4KR8 A;  2PRN A;  3SY9 A;  2O4V A;  2XE2 A;  3VZT X;  5FVN A;  3SZD A;  4FSO A;  4LSH A;  3EMN X;  3T24 A;  6PRN A;  5DL5 A;  2ODJ A;  4GCQ A;  4D65 A;  2ZFG A;  5DL7 A;  4GCS A;  4D64 A;  3JTY A;  1BH3 A;  4LSE A;  1HXX A;  2Y0L A;  1OPF A;  4AUI A;  3A2S X;  2FGR A;  4FMS A;  1HXU A;  1HXT A;  4FSP A;  3UU2 A;  3PRN A;  8PRN A;  4RJX A;  5DL6 A;  1GFM A;  2Y0K A;  4KR4 A;  2XG6 A;  3POX A;  4BUM X;  1OSM A;  3POR A;  1H6S 1;  4KRA A;  3NSG A;  3UPG A;  3WI4 A;  5PRN A;  3VZW X;  4LSF A;  3VZU X;  2J4U P; 
#chains in the Genus database with same CATH topology
 4UB6 O;  3AAA B;  3BS0 A;  4C4V B;  5D5D A;  1Q9G A;  3SYB A;  3HWB A;  1ZHX A;  3WI5 A;  2KC0 A;  2R89 A;  2J1N A;  5DL6 A;  2W80 C;  4N59 A;  4G76 A;  4JFB A;  1GFO A;  5GV0 A;  3SY7 A;  1MM5 A;  5H2F O;  3SYS A;  2Y2X A;  4C69 X;  4CTD A;  2LHF A;  5JDP A;  2QTK A;  2X9K A;  5G38 A;  1GFP A;  2ZLD A;  2MNH A;  3POU A;  4FQE A;  4RLB A;  3PGR A;  4C00 A;  3PGS A;  3VE2 A;  4FRX A;  2XE3 A;  5G3A A;  3T0S A;  2XE1 A;  3KZI O;  2XE5 A;  4GCP A;  3POQ A;  1YS5 A;  2XMX A;  3LK3 A;  1T16 A;  3O0E A;  5IYU A;  1GFQ A;  2Y0H A;  2AXT O;  4FZL A;  3SZV A;  2W81 C;  1G90 A;  3HW9 A;  2X27 X;  2POR A;  4RLC A;  3K19 A;  5DL8 A;  4C4V A;  3AAE A;  4O4X A;  2OMF A;  2R88 A;  4LSI A;  4O49 A;  2K4T A;  3AAE B;  5KAI O;  3DZM A;  1P4T A;  4RJW A;  3C5O A;  1PHO A;  4O3Z A;  4AYM C;  4AKR B;  4E1T A;  2F1V A;  2XTQ A;  4AFK A;  1IZN A;  1S5L O;  2FGQ X;  3PQU A;  3BRY A;  4RL9 A;  1QJ8 A;  3VY8 X;  3WU2 O;  5G39 A;  3FYX A;  1MPF A;  1IZN B;  4PR7 A;  4D5U A;  2R4N A;  2WVP A;  3HOE A;  1PRN A;  4XNL A;  3DWO X;  3A0H O;  4FOZ A;  4AYN A;  2IWV A;  1E54 A;  3LK2 A;  4AYD C;  5AFU L;  7PRN A;  4IL6 O;  4O3Y A;  2IWW A;  1BT9 A;  1GFN A;  3LK2 B;  3PGU A;  4FRT A;  2KZ7 B;  3T20 A;  3PQS A;  3BRZ A;  3A0B O;  4FT6 A;  1ORM A;  3AA0 B;  3VY9 X;  2PRN A;  4KR8 A;  2N2M A;  3SY9 A;  3AA6 A;  3G7G A;  2M07 A;  2O4V A;  4AYE C;  4B61 A;  4E1S A;  3AA6 B;  4FZN A;  2R8A A;  2XE2 A;  3AA7 B;  4FUV A;  4GHB A;  5FVN A;  3VZT X;  3SZD A;  5B66 O;  1ZHW A;  4FSO A;  5GTI O;  5ADX L;  5G26 A;  4AKR A;  2JQY A;  4LSH A;  2R4P A;  4QQ1 A;  4FES A;  4K3C A;  2KDY A;  3EMN X;  3T24 A;  6PRN A;  3HOL A;  3LK4 2;  3LK4 1;  5DL5 A;  2ODJ A;  4GCQ A;  4D65 A;  1Q9F A;  2ZFG A;  1ZHZ A;  4U9C A;  4JCH A;  2WJR A;  5DL7 A;  2M06 A;  3KVD D;  5EE2 A;  4GCS A;  1MM4 A;  3JTY A;  4D64 A;  5B5E O;  4AYI D;  1T1L A;  1BH3 A;  4LSE A;  3V8U A;  2ERV A;  2KZ7 A;  2K0L A;  1HXX A;  4Z3T A;  2Y0L A;  2N2L A;  5TIS O;  1OPF A;  3AA0 A;  5AFU K;  1QJ9 A;  3A2S X;  2FGR A;  1HXU A;  4FMS A;  4PJ0 O;  4N58 A;  1HXT A;  4AUI A;  4O3W A;  2YNK A;  1THQ A;  4F4B A;  3JCU O;  4FSP A;  2F1T A;  3UU2 A;  3PRN A;  3DWN A;  4AKM A;  3AA7 A;  8PRN A;  4O4U A;  5GTH O;  3NJT A;  4RJX A;  4N75 A;  1ZHT A;  2R4O A;  1GFM A;  2JMM A;  2Y0K A;  1ZHY A;  4KR4 A;  2XG6 A;  4N74 A;  2XTR A;  3AA1 A;  4FZM A;  4UB8 O;  4O3X B;  3DA3 A;  5T5F A;  3POX A;  2YPV A;  4GF4 A;  3QRC A;  4BUM X;  3AA1 B;  2WJQ A;  1OSM A;  3PF1 A;  1QJP A;  3DA4 A;  2F1C X;  1H6S 1;  3POR A;  4KRA A;  5ADX K;  4AZL A;  3RBH A;  3NSG A;  3UPG A;  2R4L A;  2GE4 A;  3TZG A;  1BXW A;  4K3B A;  2MHL A;  2KXP A;  3WI4 A;  3GP6 A;  5PRN A;  3UAQ A;  3VZW X;  3LK3 B;  4LSF A;  2KXP B;  2J4U P;  2Y7S A;  4PUX A;  3QRA A;  4XNK A;  5E79 O;  4G75 A;  5KAF O;  3VE1 A;  3AAA A;  3VZU X;  2LFU A; 
#chains in the Genus database with same CATH homology
 3AAA B;  5D5D A;  1Q9G A;  3SYB A;  3HWB A;  1ZHX A;  3WI5 A;  2KC0 A;  2J1N A;  2W80 C;  4N59 A;  4G76 A;  4JFB A;  1GFO A;  5GV0 A;  3SY7 A;  1MM5 A;  3SYS A;  2Y2X A;  4C69 X;  2LHF A;  5JDP A;  2QTK A;  1GFP A;  2ZLD A;  2MNH A;  3POU A;  4RLB A;  3VE2 A;  4FRX A;  2XE3 A;  3T0S A;  2XE1 A;  2XE5 A;  4GCP A;  3POQ A;  1YS5 A;  2XMX A;  3LK3 A;  3O0E A;  5IYU A;  1GFQ A;  2Y0H A;  4FZL A;  3SZV A;  2W81 C;  1G90 A;  3HW9 A;  2X27 X;  2POR A;  4RLC A;  3K19 A;  5DL8 A;  3AAE A;  4O4X A;  2OMF A;  4LSI A;  4O49 A;  2K4T A;  3AAE B;  1P4T A;  4RJW A;  3C5O A;  1PHO A;  4O3Z A;  4AYM C;  4AKR B;  4E1T A;  2F1V A;  2XTQ A;  4AFK A;  1IZN A;  2FGQ X;  3PQU A;  4RL9 A;  3VY8 X;  1QJ8 A;  3FYX A;  1MPF A;  1IZN B;  4D5U A;  3HOE A;  1PRN A;  4XNL A;  4FOZ A;  4AYN A;  5AFU L;  1E54 A;  3LK2 A;  4AYD C;  7PRN A;  4O3Y A;  1BT9 A;  1GFN A;  3LK2 B;  4FRT A;  2KZ7 B;  3T20 A;  3PQS A;  4FT6 A;  1ORM A;  3AA0 B;  3VY9 X;  2PRN A;  4KR8 A;  2N2M A;  3SY9 A;  3AA6 A;  3G7G A;  2M07 A;  2O4V A;  4AYE C;  4B61 A;  4E1S A;  3AA6 B;  4FZN A;  2XE2 A;  3AA7 B;  4FUV A;  4GHB A;  5FVN A;  3VZT X;  3SZD A;  5ADX L;  1ZHW A;  4FSO A;  5G26 A;  4AKR A;  4LSH A;  4QQ1 A;  4FES A;  2KDY A;  3EMN X;  3T24 A;  6PRN A;  3HOL A;  3LK4 2;  3LK4 1;  5DL5 A;  2ODJ A;  4GCQ A;  4D65 A;  1Q9F A;  2ZFG A;  1ZHZ A;  4U9C A;  4JCH A;  5DL7 A;  2M06 A;  3KVD D;  5EE2 A;  4GCS A;  1MM4 A;  3JTY A;  4D64 A;  4AYI D;  1BH3 A;  4LSE A;  3V8U A;  2ERV A;  2KZ7 A;  2K0L A;  1HXX A;  4Z3T A;  2Y0L A;  2N2L A;  1OPF A;  3AA0 A;  5AFU K;  1QJ9 A;  3A2S X;  2FGR A;  1HXU A;  4FMS A;  4AUI A;  4N58 A;  1HXT A;  4F4B A;  4O3W A;  2YNK A;  1THQ A;  4FSP A;  2F1T A;  3UU2 A;  3PRN A;  4AKM A;  3AA7 A;  8PRN A;  4O4U A;  4RJX A;  5DL6 A;  1ZHT A;  1GFM A;  2JMM A;  2Y0K A;  1ZHY A;  4KR4 A;  2XG6 A;  5T5F A;  2XTR A;  3AA1 A;  4FZM A;  4O3X B;  3DA3 A;  3POX A;  2YPV A;  4GF4 A;  3QRC A;  4BUM X;  3AA1 B;  1OSM A;  1QJP A;  3DA4 A;  3POR A;  1H6S 1;  4KRA A;  5ADX K;  4AZL A;  3RBH A;  3NSG A;  3UPG A;  2GE4 A;  3TZG A;  1BXW A;  2MHL A;  2KXP A;  3WI4 A;  3GP6 A;  5PRN A;  3UAQ A;  3VZW X;  3LK3 B;  4LSF A;  2KXP B;  2J4U P;  2Y7S A;  4PUX A;  3QRA A;  4XNK A;  4G75 A;  3VE1 A;  3AAA A;  3VZU X;  2LFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...