4AVFA

Crystal structure of pseudomonas aeruginosa inosine 5'-monophosphate dehydrogenase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
467
structure length
314
Chain Sequence
MLRISQEALTFDDVLLIPGYSEVLPKDVSLKTRLTRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMGIEQQAAEVRKVKKHETYPLASKDEQGRLRVGAAVGTGADTGERVAALVAAGVDVVVVDTAHGHSKGVIERVRWVKQTFPDVQVIGGNIATAEAAKALAEAGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAAALEGTGVPLIADGGIRFSGDLAKAMVAGAYCVMMGSMFAGTEEAPGEIELFQGRSYKSVPYKGALSAIVHQLMGGLRAAMGYTGSADIQQMRTQPQFVRITGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
publication title The Aeropath Project Targeting Pseudomonas Aeruginosa: Crystallographic Studies for Assessment of Potential Targets in Early-Stage Drug Discovery
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 98
structure length 314
sequence length 467
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4avfA00
4FF7A 1GQNA 3EX1A 1TB3A 2PRHA 4ZL1A 3ZFHA 2YFNA 3EXSA 3B03A 3W2MA 4JY8A 3L5AA 4FX7A 2JGYA 1LCOA 2YFOA 3C0JA 4UFJA 3DKJA 4QSHA 3GDKA 1TQXA 3N14A 2ZDRA 3TNOA 1XL9A 5FEXA 1JRBA 5K7JA 3W73A 3TJXA 3G1SA 3LXCA 3QC3A 3A9IA 3S0CA 3LV6A 3GLCA 1QO5A 4M6VA 4GE8A 4JN6A 4OV4A 5AOUA 4ZMGA 5DXYA 2RFGA 3GAYA 2A6NA 2A2IA 3ZS4A 5HR6A 3M7WA 3KX6A 1FDYA 4BF9A 4O28A 4P2VA 1Z48A 1VJIA 1F2JA 3STFA 2P1FA 1WXJA 3CWOX 3THQA 3NXFA 1SO4A 1PS9A 1R2RA 2C14A 3I7RA 5HJLA 3DFSA 1OF8A 1JCMP 3EX6A 3VCRA 3I7QA 3M16A 4DF0A 1KW1A 2I9EA 3E49A 3P5ZA 4RZ4A 1TPWA 1HO1A 4MFDA 2JKPA 1FWNA 4YLWA 2W0UA 2E77A 2OT0A 3GR8A 2VFGA 1VLIA 2CLHA 3W1PA 2V0TA 4E38A 1W31A 2HTMA 3S42A 1C29A 1SO6A 3B0UX 3NL2A 3W86A 1VRDA 1A5CA 2QUTA 3W76A 2Y7GA 2BWGA 4LWWA 2JK2A 3UWZA 4NX0A 1GWJA 2A85A 5CPMA 4RCXA 2RKXA 2G5WA 2JBMA 5FI8A 3LCIA 2CU0A 3QPYA 3TMLA 3GYEA 1XBZA 2DZXA 3TC7A 1F6PA 2RDTA 4WY0A 5LNRA 1SFLA 3ABOA 3WJYA 4N4PA 4RK8A 3W71A 3TSDA 4H3DA 2F84A 3HGRA 2QUVA 5AYYA 8TIMA 1YLVA 2QCFA 4GC4A 1I45A 4DF1A 4AEOA 1OYAA 1KLYA 1TYGA 3O07A 1RQBA 2A0NA 3JS3A 1TPB1 1TV7A 3CM4A 1H7XA 4E0CA 4UTIA 4NZFA 1ZJIA 4MVAA 2H8XA 2YDAA 2Y62A 5DLCA 3TR2A 3LXAA 5I3IA 1T96A 4MPQA 3O06A 2DJXA 1TCDA 4LW7A 1AL7A 3ZWSA 5CSSA 4AWSA 1H62A 4O54A 3N2XA 4Z1CA 3CC1A 5AC8A 1TSIA 2H3DA 3PUEA 3QSRA 1KM4A 3W7IA 1P5BA 1XBXA 4GNJA 3MYPA 2VOMA 4GUJA 4N9BA 4JR5A 1W5QA 1OFQA 3KXQA 5K9DA 4KWVA 4ZQNA 3LDVA 3Q58A 3S5YA 3W7JA 1GG1A 1M7PA 2VFEA 4UTTA 5EBUA 3BK0A 2A1YA 2ZZ5A 7TIMA 2A21A 4LVGA 3LOTA 3LBMA 1ICSA 2VEKA 5EMUA 4CCDA 2NXGA 4JTFA 3M0ZA 3DKLA 1W5OA 5U7SA 5HWNA 3NGJA 5F4SA 3S5ZA 3P5YA 4OHQA 5C6MA 1V7YA 3CT7A 1O60A 1S5WA 1E51A 2J27A 1W8SA 4PFMA 3I6RA 2CZDA 5EKYA 4CQ8A 2ZRUA 5LGXA 1JCJA 4A3UA 2EPHA 1FWTA 3INPA 3TXZA 2P0OA 3D0CA 1W1ZA 4I7WA 3TSMA 1YXYA 4WOZA 1SUXA 4ZQCA 3IVUA 3V75A 5D2TA 1GVOA 5LNVA 2J24A 5DXXA 5F2MA 5HQEA 3UWQA 4GXMA 2NX9A 1KTBA 2FB3A 2E5DA 3TROA 1TTJA 3E96A 4LV9A 3NDOA 2E6DA 2TSYA 3A5VA 3N19B 2UV8G 3PB2A 3SFKA 1ME9A 1K3UA 3VE9A 4OE7A 5LNSA 3P84A 4HNNA 4UFIA 3L5LA 1R46A 4UTMA 4RR4A 4MUZA 4FNTA 1B4KA 5CZSA 4Z1BA 1LRTA 4CQ9A 4JTUA 4QAIA 3EXRA 1FQ0A 1ZNNA 3IEBA 3QEZA 2C1HA 1MO0A 4R53A 3OBKA 3MI6A 1IF2A 3C2EA 4IOTA 2ZTJA 4JY9A 2Y7FA 4YWIA 3RFAA 1R47A 4LVDA 4UTWA 1TPEA 4RXFA 1CW2A 4GJ1A 3G1HA 4M7SA 5D05A 5TQLA 2CFFA 4MZ1A 4DBDA 4IXXA 2C0AA 3W1LA 4XWUA 3N9SA 3LHWA 1KBIA 3FOKA 4I9AA 5KSWA 3LM7A 1AMKA 1WOBA 4XKYB 1GPWA 2CLMA 2VEMA 3USBA 3MHFA 1LP6A 1QPQA 4AAJA 5IBXA 1MZHA 4K38A 3UZJA 4ZQOA 3MI3A 5AHLA 2NWRA 1IIHA 2Y6ZA 4IMEA 3TFXA 1L2UA 5G2HA 3HJZA 4LUIA 1GEQA 4H4IA 2ZRWA 4LC8A 1WYIA 4B5NA 3IRDA 1QCWA 1Q6RA 2OX1A 4IJBA 2Q8LA 4Y8FA 1OABA 2QCEA 2ZZ1A 3PUDA 1DBTA 3UYCA 4JTKA 5D2XA 3FLUA 3CLMA 1EB3A 1WBJA 2JKEA 4NJGA 3OEXA 4MY1A 1LLWA 3PG9A 4W9TA 3TKFA 3GXTA 2ZRYA 2J9YA 3R12A 1ZAIA 3NM3A 5CZTA 2TMDA 3W1UA 4OV9A 3LRKA 2V30A 1D3GA 1PIIA 3LI0A 4D2JA 3Q2DA 2TPSA 3V1PA 5D2YA 1HO4A 4MLJA 1L6WA 2C19A 2YW4A 4O50A 2FPYA 2CZFA 1K02A 1LLZA 4RKAA 4WUIA 1J5TA 3G1XA 1X7FA 4AWUA 2FQIA 3QRHA 1V5XA 4JEQA 1X6UA 4I7UA 2TRSA 1Z42A 2GVGA 3HOJA 5KZMA 1VC4A 1OYCA 3S1VA 2G97A 3IVTA 1GYNA 4TIMA 1KM6A 3LXBA 3UXDA 1ZAHA 2GQ8A 1MEIA 2R14A 1H7WA 4Z0JA 3IIOA 3PM6A 3FEMA 3QMTA 2WNQA 4X9SA 5CZ0A 1VYSX 1XDLA 2QJIA 2WV8A 1DJQA 1HTIA 1LM1A 3FFSA 4K7VA 4FNRA 2FPVA 3BLIA 4HT3A 3PAJA 1THFD 2X1SA 1ICPA 1F76A 3O16A 3EEGA 1EP3A 3HF3A 1DV7A 4FIRA 4RLIA 4OU1A 3TFCA 2YXGA 1TJPA 4QNEA 3W1RA 1PE1A 2HMCA 3QQ1A 2GUUA 4K8HA 3WK0A 2CLOA 2ZZ4A 2DP3A 4KFNA 4JIPA 4POCA 5I3KA 3WK2A 3ABQA 4IX2A 4OWGA 4AHOA 5LNUA 2DZWA 5GVJA 3W87A 1MEWA 1TRDA 4JXCA 1LYXA 4Z08A 5I3FA 1IXOA 1IXQA 4JTLA 4O4WA 3FIGA 1FCVA 3DENA 2OT1A 4DELA 4N9DA 4UFMA 4ZQMA 1NFBA 5J5DA 2E5CA 5FEZA 3GDLA 3M47A 1IGSA 3IVSA 3NZRA 5D2VA 3TC6A 4RZ6A 3NNTA 1NF7A 3B04A 3P7YA 4JYEA 4RJEA 3CEPA 3CIWA 3QSTA 4O1DA 4DPQA 4XBSA 2VEPA 1VHNA 3DXIA 1R2SA 3JR2A 3LCWA 2CLEA 2FJKA 2Q3RA 5FF2A 1ME8A 5F4XA 1TPUA 4Q33A 3O15A 4JDYA 1A53A 3PBUA 2Z1BA 3Q37A 3W1TA 3NQGA 1Z44A 1MXSA 3LI1A 4FB7A 1SO5A 5HNRA 4X2RA 3C3NA 3LCLA 4JGDA 2E6YA 3PUOA 1FCQA 2WJZA 1LRNA 3PULA 4NX5A 3SECA 3BVJA 5HINA 4UR7A 3BW2A 3DHFA 4IGHA 2F7FA 3AJXA 3GVGA 2VFIA 3EWWA 4UTTC 5G4WA 1ONRA 3MHUA 4O0ZA 1DOSA 1X1OA 4YCOA 2XN2A 3C2FA 1PCWA 1OFEA 2G96A 2LLEA 5I3HA 5AHMA 2QCCA 2B0MA 3LV5A 2ATMA 3M44A 1VCGA 3NAVA 3HGJA 1OK6A 1IXNA 1KLZA 1FDJA 4O1CA 4ZZ9A 1UUOA 3DBPA 3W07A 1I2PA 1RZMA 1H61A 3W7RA 3TU9A 1FXQA 3DFTA 3W1QA 1I2RA 3DU0A 5G1TA 3W74A 4LNYA 2QJHA 1AL8A 1H5YA 1UUMA 4YCPA 4MZ8A 1ADOA 3W22A 2C15A 2VKZG 4PEKA 3VKJA 4Z0SA 4O4VA 2ZZ6A 1I4NA 4O53A 1TTIA 4O1BA 3UWWA 1OYBA 4L4LA 1KV5A 4LUJA 1EIXA 2E09A 1FXPA 5E93A 1W5NA 1XCFA 4JX6A 4IWWA 3HPXA 2WO5A 4K39A 3LHTA 1JVNA 4AWTA 1AK5A 1KFLA 5AC7A 3L68A 2CLLA 5G5IA 3SIZA 4JTHA 3WFAA 1N55A 1L6SA 4XKYA 4MYXA 1K8YA 4LU0A 3W84A 3CB8A 3P82A 2X1UA 4K8EA 2Y63A 3I65A 1TJRA 2Q8ZA 4FIQA 4R7JA 2XN1A 4UTWC 5J5RA 3S1XA 1H7PA 1ZALA 3L2IA 4ADTA 5D33A 1BWKA 2J6XA 4NNBA 3DFPA 1JCNA 3W70A 5U4NA 2VEIA 1WQ5A 1Q6LA 1QR7A 3HG3A 4NJJA 2V8ZA 3S1UA 4LVBA 4O11A 3TMQA 1UBSA 2YGYA 4AXKA 1LORA 2BLEA 2ALDA 2Z2UA 1U5JA 1GJPA 3GNNA 3WK1A 4TO8A 4DPPA 5ABTA 1SZEA 1O5XA 5IBXC 5H2ZA 1G6CA 2J88A 3HG2A 1QPRA 4JDBA 4X22A 4XZ9A 3QM3A 3LLFA 4ZQRA 2FDSA 1LRQA 3TE9A 1F6KA 1Q45A 4IPIA 2GQ9A 4P61A 3IGSA 4JYDA 2I1OA 1SW0A 4TU1A 5D02A 4CNOA 5KZEA 4N6FA 3M5XA 1M6JA 3P81A 2ZTKA 2NUYA 2FFCA 3BGJA 2E5BA 2X1RA 3AO0A 2ISVA 3KAOA 3MP4A 4EWND 4JS3A 1FY6A 3DAQA 1FX6A 3NL5A 3S6DA 2ZRXA 3TAKA 4QISA 2AAMA 5FF4A 1H51A 3LHZA 1DQWA 2FIQA 2RDWA 3WJXA 5HR7A 1TMHA 2VC6A 1WA3A 1SZGA 5F1VA 4DQWA 4K7YA 1VS1A 1H60A 1OK4A 4JX4A 4NJHA 1PCKA 2WSYA 5A5WA 4CCEA 2X16A 2DZUA 2B4GA 4NJKA 5KINA 3VE7A 3W7QA 1XBYA 3IIPA 4FX6M 4PODA 3T44A 1XDMA 5LHEA 3A5FA 1YPIA 4NJIA 1HUVA 1S5VA 4ZVJA 4HSOA 2EHHA 3LGEA 3DFOA 3W1XA 3NL3A 1EEPA 2TYSA 4XUGA 3RU6A 2DU2A 5EYWA 1AG1O 3QZEA 4HIBA 1U83A 3NQ6A 4LTSA 5AYXA 1TPVA 1M5WA 2ZA2A 2ZQ0A 3DFNA 3O6DA 3MI2A 3G3DA 5AHIA 3PB0A 3W9ZA 3G24A 4O16A 2V2CA 3O8AA 2VFHA 2GVLA 4WY0F 3TUUA 4JIQA 2R94A 2Y7DA 3EKZA 3NVTA 4LVAA 4PH6A 1DQXA 2GQAA 2QF7A 1DORA 3MUXA 3NQFA 3KRZA 3PBVA 4N4QA 1DKWA 2ZBTA 1KA9F 4OGZA 5FESA 2GVJA 3ATYA 3B0PA 4UTKA 2NX3A 1FDZA 3NQAA 1SO3A 4GFSA 3N9RA 3GDTA 4HNUA 3FYPA 2YYTA 1OX4B 2BTMA 1GYLA 3EKLA 4O1AA 5K9XA 5DBUA 5FF3A 1TO3A 4UUIA 1NAL1 4XBKA 4LS2A 2ZZ7A 3B8DA 1VLWA 4S2BA 4ORMA 2VFDA 4JTGA 3PSVA 2DJLA 4M5PA 3MBDA 3M5VA 2NLIA 3LRLA 1AW1A 2VELA 4JICA 4UMCA 2DZTA 1TQJA 4UNKA 1BEUA 3W23A 1XUZA 2YPIA 5CGQA 3W2UA 4A29A 4CNPA 2NXHA 3G8RA 2BSLA 4Q4KA 1BTMA 3TQVA 2A7RA 4CQAA 1QO2A 4O0KA 4ICNA 3OA3A 4YXGA 3ATZA 5DBTA 3LERA 4Y90A 3S8HA 3NEVA 3HO8A 2NV2A 2VENA 4N6EA 5D03A 3LHUA 4AH7A 1H7NA 1VPXA 3ZR4A 1P0KA 1W37A 4MFEA 3LCXA 3RNDA 3FA5A 5KITA 4KWWA 3VFLA 1A5AA 3N73A 3P8IA 1F7BA 2VFFA 2WPBA 3MMTA 3LB0A 3MJYA 3NQVA 3U6WA 1F74A 3R13A 4LS1A 3TJLA 3NQ7A 1I8JA 1WX0A 2E6FA 2NV1A 2DORA 2DZVA 1KFEA 4O18A 3W7KA 4UTUA 1QWGA 5AYZA 3IIZA 2ZCGA 1XM3A 1JR1A 3NG3A 2H90A 3EX3A 4BFAA 1NEYA 3EWXA 3UZ5A 1B4EA 1JRCA 4TMBA 4JTSA 3WJZA 4AF0B 1UB3A 3TQ0A 5FF0A 4QNWA 3G1DA 1VQTA 5EPDA 2WQPA 3KHJA 4U4MA 5F4WA 3TDFA 5AHEA 3FKRA 3I68A 5G4EA 1GZGA 4M7TA 1AW5A 2WKJA 1I2NA 2QAPA 2QDHA 2NUXA 4PC8A 4UNLA 3W7NA 3W7DA 3G0XA 1I2QA 1Y0EA 1T99A 2QCMA 4RX0A 2OCZA 3G3MA 4R33A 1JJKA 1JCYA 1PHQA 1KM1A 1MSSA 3W1MA 3G0SA 2CZ5A 3L0KA 4DO6A 2Y7EA 1OFPA 4PL2A 3HPSA 2YCEA 3YPIA 4QITA 1K8XA 3KOFA 3K30A 3PWAA 5DCBA 1C8VA 5BNKA 3SR7A 5K9CA 5CKSA 1LOQA 2PCQA 2C16A 3W75A 4FNPA 1PL9A 2OJPA 4R34A 2ZFAA 3W1NA 2O7QA 2NWSA 3UPWA 1Z41A 5C5YA 1YDOA 3TH6A 1XBVA 1LOLA 3P74A 1DJNA 4LS0A 3NQDA 3DZ1A 3W2KA 1YXCA 1GVSA 3P60A 1SPQA 3NPVA 4ADSA 4ONVA 3UPBA 1LBFA 5G1YA 3ABRA 5KMYA 4NUWA 3LRMA 4EIVA 2BXVA 1F5ZA 3EX2A 3PBYA 3U2OA 3UD6A 5K4XA 3OIXA 4NU7A 4NXKA 4RXGA 4MY8A 5D04C 3LCHA 4JTTA 4Y96A 1VCFA 3SJ3A 1I2OA 1EP2A 2ZA1A 1PVNA 1T8XA 2AQWA 3W7MA 5F2GA 2R91A 1TRIA 1G4SA 2EGZA 3N2MA 3MWAA 4O57A 3BGGA 1JULA 5CZJA 2FB2A 3L0NA 1N7KA 1TPH1 1EWEA 4L4MA 2DZPA 4TX9A 3NPWA 3OVQA 1XC4A 3UY7A 3A21A 1X1ZA 1J2WA 1B57A 3VNDA 3RLUA 5L9FA 2A6LA 1LZOA 1JCLA 3A23A 2CLFA 1XKYA 2V82A 3NPUA 3HQ1A 3QFEA 4KFPA 1DVJA 4WXZA 1VCVA 3ELFA 3STEA 3G1FA 4UTLA 5I3GA 3W1AA 3STCA 3PVFA 1G4TA 2PC4A 3PSWA 1VHCA 2B7NA 2CLKA 3O6CA 3BLFA 2E1DA 3IGXA 2QEZA 2W79A 1BWLA 4LV4A 4UFKA 3KRSA 1ZHAA 3UWUA 5E1QA 3LTPA 2B7QA 4HPJA 1B3OA 5AB3A 1LROA 1OFDA 1NSJA 3DFQA 3EWYA 3LBCA 4O10A 3B0VC 1G4PA 1DL3A 1S3HA 3KRUA 4Z1AA 4J9JA 4GUFA 3A22A 4UC5A 3HBLA 1GVFA 4K6AA 2YX0A 4MJZA 3W6YA 4DF2A 3T55A 3CWNA 2GJNA 1TPC1 1YTDA 1ALDA 4NNCA 4JTEA 1TPDA 2R8WA 4M6PA 3W7PA 5D30A 3IGUA 5K3VA 1JUEA 1XI3A 1Q6QA 3GIYA 1OX4A 1W5PA 1OHLA 3KVMA 5AC6A 4AHPA 2DZSA 4E2BA 3PF3A 5EL1A 1QMLA 4IPJA 3P61A 3QW3A 3NM1A 4UFHA 4UR8A 3IIVA 3TX9A 3WK3A 2Y70A 5BW6A 4HPXA 3CPRA 1W54A 3RMJA 5C2XA 5DY2A 1XXXA 1LOSA 4OBTA 3HG4A 1QOPA 1JQXA 1QOQA 2VXNA 3G1YA 1A5BA 4DO5A 1ME7A 1D9EA 1WV2A 5HULA 5HWJA 1LDCA 4GUIA 1FCBA 5FEWA 3UQNA 3RK8A 3QJAA 2ZRVA 3C4UA 4UXDA 3LHYA 4IX0A 3U8GA 2WSRA 1M7OA 3LLDA 5G2IA 3CQ0A 2RDUA 2X1TA 4O8RA 3GDRA 4WQ6A 3BG9A 1K8ZA 4JTJA 3NL6A 1J4EA 4IQLA 1L6YA 1HG3A 5CSRA 2QJGA 3BV4A 3R5EA 3M5ZA 3BLEA 5DCDA 4DEFA 5DELA 3HPZA 4HKPA 3C56A 1KV8A 3R89A 3B4UA 2Y88A 3GXPA 3S5OA 1N8FA 1CX9A 5L6UA 1F05A 4PTNA 3FYOA 5TBOA 4QIUA 4QM1A 5LNWA 4NQ1A 3W2JA 1NVMA 2EF9A 2NX1A 3NO5A 4O15A 3TW7A 3L0GA 5T26A 2OMAA 3O1NA 1FWSA 3CEUA 2Y85A 1A5SA 3FKKA 1SW7A 5HUPA 3THAA 1QDSA 5H91A 2WSQA 2Y61A 1QPNA 3P8JA 4BR1A 3O6YX 3KFTA 4M6QA 2V5LA 3F03K 1ZENA 5BOOA 2J9ZA 4AF0A 1L9WA 1H1ZA 4FEZA 5D38A 3W2NA 5IM51 3CHVA 4ZQPA 3L9CA 3DGRA 3P80A 4NT0A 4A22A 1T0OA 3MP3A 5DY3A 1RQEA 2ZRZA 4BWLA 3TCEA 3LCFA 1WAUA 1W3IA 3ABSA 2ISWA 1JQVA 4Y9AA 1EP1A 4N02A 3A24A 2WNZA 2FTPA 2A7NA 3G8EA 5AHFA 3M9YA 4GBUA 1B9BA 4HSNA 3G22A 3TAOA 4EVZA 3PY2A 2WOQA 1RD5A 3M41A 1C9DA 4UMAA 3BARA 2QDGA 1O4UA 3HMJG 3NQCA 4K36A 1WDWA 3C52A 4LVFA 4A2RA 3S5NA 2Z6IA 1IIGA 2QAFA 3EX4A 1LBLA 1DHPA 1IXPA 3C2OA 3GXNA 3GK0A 1RV8A 1VH7A 3MP5A 5AFDA 4PCFA 3DHDA 1LTDA 1EWDA 2V9DA 1A50A 1SFJA 1OFBA 1D3HA 3TIMA 2E68A 3FJ6A 4QJ1A 4Z1DA 1W3NA 5LKYA 2PRMA 5K4ZA 1TTPA 3GB6A 1RPXA 3G1AA 1NF0A 2C13A 4ADUA 1X8FA 2B7PA 4H6KA 3TXVA 2O7SA 2QCNA 3UXAA 3F4WA 4IMCA 2CW6A 1K7FA 4WXYA 3ZWTA 3B06A 5D2WA 3S1WA 1RQHA 3L21A 3IIXA 3PS7A 1OX6A 1VYPX 3QH2A 3L67A 2YZRA 4IMFA 4C1KA 3LX9A 2C6QA 1UJPA 4O17A 3M43A 3N34A 4IUOA 3OG3A 1W56A 3NA8A 1SU5A 1YTEA 3LTSA 1EUNA 3M1ZA 1YADA 1EX5A 1KM3A 2GPTA 4JD4A 4UTJA 4WX2A 3S9YA 4K37A 1YYAA 1H50A 1VYRA 4ML9A 1FUYA 2AGKA 3W83A 5F2LA 1YPFA 5FEPA 2A5HA 3PG8A 2XFWA 3R8RA 1KFCA 3FS2A 4XTDA 3QPZA 1SSDA 3NQ2A 4WOQA 3O05A 1JUKA 2W6RA 3PR2A 1OF6A 3F1QA 1OFOA 2B7OA 1QPOA 4JX5A 2BZNA 2PE4A 4OQVA 5EY5A 2NZLA 4FXSA 3R2GA 3UWVA 4C1LA 3EWUA 1G7VA 1TREA 5G2WA 4AMAA 5LHFA 3W7OA 2I14A 3C61A 2QCDB 1K7EA 3NYZA 2V81A 4E2DA 3QYQA 3BG3A 3T40A 2RHGA 1XFBA 2QCGA 4XQ6A 3LCGA 3C2VA 5F2IA 3M5YA 3W7HA 4BI6A 3RF9A 4N9EA 1P4CA 5CPNA 5CG7A 1H7RA 2X30A 4FNUA 1GVRA 2QR6A 2WNNA 3PBWA 1SW3A 1PV8A 4HN4A 4LY8A 1W3TA 1P0NA 1ZY9A 3W7GA 3F4NA 4EF9A 1EA0A 3GKAA 2QCHA 4MY9A 1GTEA 5FF7A 5DN1A 1GG0A 2V2HA 4GUHA 1K03A 2V5BA 1O5KA 1YTKA 2CZEA 3GNDA 4O19A 5KZDA 4PA8A 1VR6A 6TIMA 2J9XA 4G1KA 3IV3A 3H53A 3SI9A 2YYUA 3NOEA 1YDNA 3NZ1A 3NQEA 3TV8A 5CPOA 5D32A 2Z6JA 2HSAA 3H54A 2QUUA 1O95A 3EB2A 2NUWA 4WJEA 3WJWA 1KM5A 3DH7A 1VZWA 2ISSA 3W7LA 4MOZA 4GUGA 4MLRA 4HNVA 1KM0A 2HS6A 5LZLA 1WBHA 1YDVA 3HGSA 5BMXA 2EKCA 3CIXA 1QNVA 4ALDA 5DCEA 1OVDA 4NXSA 2GOUA 4O14A 3GR7A 4O12A 3UNDA 4ORIA 1SZFA 1WOAA 3HIJA 4X3ZA 4Q32A 5HMSA 1KTNA 4CNNA 3E0IA 1KFJA 4RV8A 4WZHA 4GWEA 4LOCA 2P10A 3FJLA 1XUUA 4UIOA 2QKFA 4M19A 1JCXA 3G0UA 3O63A 1SR9A 4JYFA 3B05A 3TQKA 3W2LA 4DBEA 4CCCA 4PL1A 1EPXA 2Z0IA 5CPLA 4EF8A 1ICQA 3L65A 1TV8A 2PRLA 5K2ZA 2IQTA 3GDMA 1S5TA 4YL2A 5KTLA 4WY0B 1W5MA 4DXVA 1CI1A 3SY5A 3LHVA 3T78A 4MKNA 3W3OA 3CU2A 1HFBA 1GVQA 2ZYFA 2JGQA 1RR2A 2H8ZA 3EWBX 2YSWA 3QMRA 2QCLA 3DI0A 2G95A 3BPWA 1SQ7A 1ZAJA 5LSMA 3SGUA 5MHBA 3P67A 3NPXA 4BK9A 1KTCA 3H55A 1P1XA 2BX7A 2FLIA 4AB4A 3C6CA 5SWUA 1FWWA 3DI1A 3KVKA 3E02A 2OZ0A 4MJMA 5AHNA 3GX9A 3KVLA 2CLIA 1O94A 4IMGA 4MYAA 4A21A 5C55A 3T4CA 3W88A 1H7OA 1H1YA 3NR0A 4LRTA 4BI7A 1QAPA 1AW2A 2KZHA 2V2DA 4LT9A 3HG5A 2ZA3A 4NZJA 1PHWA 1QFEA 1W0MA 2FPTA 3SGZA 3GAKA 3G1VA 4FO4A 4FNQA 3W85A 2PURA 2XN0A 3KVJA 3WJSA 1EUAA 4GRSA 1OFAA 4BWLC 4N9CA 1G69A 5I3JA 1OJXA 3MHGA 4LRSA 2ABAA 4S2CA 1G7UA 1K7XA 3SSJA 3SZ8A 1TTQA 1UCWA 2H3BA 3E12A 4YMZA 3Q94A 1YXDA 5AN7A 1F73A 1Q6OA 4UFLA 3TSBA 1H63A 1LBMA 1R30A 3GZ3A 3T7VA 4EOUA 1G4EA 4FX8A 3BO9A 3QF0A 3LTYA 5EA9A 4S1FA 4TR9A 2NXIA 3UWYA 1FBAA 3TA6A 4UMBA 3C8FA 1TV5A 2E6AA 4UTHA 3BW3A 1GTHA 2A4AA 2D73A 2YR1A 1HL2A 3P62A 2GJLA 3CTLA 3QQ0A 2Q3OA 4O13A 3TK7A 3W7CA 5A8GA 3N3MA 1ZCOA 3OVPA 1KBJA 5HWMA 1TPFA 5D37A 5F1UA 1SZNA 5BMWA 3RLVA 1KFBA 4CLMA 1SSGA 2C3ZA 3I7SA 4IMDA 3G18A 1ML1A 1KFKA 3L5MA 3HGOA 1GT8A 4Y6GA 3UY8A 3MW7A 1TIMA 3SW6A 1UASA 3W72A 3W7EA 5E0KA 2ABBA 3PC0A 5HUOA 4O52A 3EXTA 3C2RA 4RZ5A 4MIMA 4MZYA 5BRBA 3E9AA 4BI5A 4OT7A 4KFOA 2X2GA 3M6YA 3TW6A 3HB9A 2ZZ2A 5TIMA 3GKFA 2ATSA 4AHQA 1JUBA 3NQMA 4NVTA 2C18A 2EAWA 1KM2A 3MBFA 2CWNA 1FWRA 5C54A 4FHAA 1BKSA 3OHIA 4WD0A 1MEHA 4NNAA 2H6RA 3MYOA 3OVRA 4QQ3A 4DO4A 4HHPA 1OX5A 3VI2A 3QMSA 1VGAA 3L66A 1ZFJA 4JNMA 2Y89A 6ALDA 1OG0A 4FXRA 3ANYA 4I7VA 4HNTA 4TMCA 2HS8A 4A2SA 3MO7A 2RH9A 1GOXA 4LC6A 3STGA 1FCUA 3QW4B 3JRKA 4U28A 3EWZA 4UCGA 3NQ8A 2YW3A 5LGZA 4AVFA 2QCDA 3BG5A 1OFRA 2JKAA 4XTIA 1G67A 1RVGA 1Q3NA 4JTIA 2A7PA 4KKXA 5D09A 2ZZ3A 4IXHA 3BW4A 4FNSA 1R2TA 4N2YA
chains in the Genus database with same CATH superfamily
1P0EA 3VM5A 2UY3A 3DHPA 2YFNA 3AU6A 1R3TA 3B03A 3CNYA 3L5AA 4GXPA 1WDQA 3C0JA 3CWHA 1WPCA 1YNYA 4UFJA 1EKOA 3AHTA 3GDKA 3ONBA 4IPLA 2G0WA 2YXXA 3I10A 3CZKA 4O1EA 2V67A 3A9IA 3S0CA 5FACA 3GLCA 1CXKA 1CXLA 4BEUA 1QO5A 2ZDSA 4OV4A 5AOUA 2IW0A 4ZMGA 2DUAA 3GXMA 4B5WA 4ENLA 3R43A 3SO7A 1JNEA 4GZ7A 4O28A 3UZZA 1QBBA 1UP3A 3ERPA 3CWOX 4UCFA 1PS9A 2C14A 4YTTA 3I7RA 5HQMA 3BMXA 4HNOA 3CUJA 3A3WA 5HMFA 4JNYA 2I16A 4KGJA 3P5ZA 3WQPA 2XVPA 2JKPA 2X1IA 2WMHA 1FWNA 2G8ZA 2OT0A 2Q71A 4F3HA 4XD4A 4H1ZA 1W31A 1KGWA 2GSEA 4ZOEA 2J75A 1SO6A 3B0UX 4U10A 3W86A 4CNSA 2QUTA 1O6IA 3UWZA 4YN5A 1GWJA 3N12A 3WYZA 2I56A 5EFDA 4JTCA 3N3TA 2Y0FA 4Q4PA 3IGHX 2E67A 1XBZA 2QV5A 1F6PA 1SFLA 5A69A 1KRMA 3MUZ1 1Z9AA 1DJYA 2R1PA 3LMZA 2JF6A 4JQ1A 5AYYA 4HZ7A 4Y2WA 2Z00A 4AEOA 1RQBA 2A0NA 1GZ1A 4NAFA 3LGGA 4AD3A 2NVCA 2FVLA 3UR5A 2YDAA 4RZBA 3WQWA 2TAAA 3TR2A 2REQB 4J27A 5I3IA 4MB5A 3WD3A 2PDHA 1DE5A 2ZX7A 4LW7A 1AL7A 3VDCA 1XLHA 1H62A 1ZPTA 4Z1CA 4DWSB 5AC8A 1TSIA 3AIRA 3LLXA 2VOMA 1K6WA 4GUJA 4N9BA 4JR5A 1K9EA 1OFQA 4KWVA 4IM4A 1YNQA 3C2YA 5HNTA 1BRLB 3S5YA 2GDVA 2Y5SA 3WIJA 1IHIA 1E4IA 3EMCA 4U2ZA 3BANA 4AVOA 4U3AA 3LOTA 4B9YA 1ICSA 1H5VA 4C5ZA 1M7XA 5JVLA 3H2MA 5F4SA 2XYLA 4EWJA 4Z2JA 2Z26A 3KL0A 2QUMA 2OO6A 3P2VA 4PMDA 4PFMA 3ZR6A 2CZDA 5EKYA 1PTGA 5BOFA 4MPKA 1XRSA 2P88A 3NDZA 3D0CA 4Z17A 3TSMA 3L23A 1W3JA 5D2TA 3TWBA 2AMXA 5FJPA 4AG0A 2J24A 3UWQA 1KTBA 5TNVA 3VOIA 2BS9A 1TTJA 2XZ7A 4D6FA 1PKLA 3SUTA 4LV9A 3NDOA 2R1MA 3FV9A 2GUBA 2TSYA 3TYAA 3CL8A 5I02A 4P7NA 3VE9A 2VCBA 3P84A 4D6JA 1KXQA 3FA3A 3NO3A 4REQA 1SFSA 4RR4A 4KWUA 3W6MA 4CQ9A 4BF5A 4QSFA 3M46A 1ZNNA 3QEZA 2RGMA 4GNVA 4CD8A 1UW9A 4R53A 1UD3A 1XWYA 3VGBA 3AIUA 1R3YA 3A3XA 3JZEA 4IOTA 4PMQA 1JPMA 4PB4A 3VNLA 3RFAA 4DUOA 4UTWA 1TPEA 4RXFA 1GVYA 3QLDA 3G1HA 5LA2A 3PZUA 5TQLA 2V3DA 2C0AA 1KC7A 3W1LA 2CXGA 3BZJA 3NZQA 5I2UA 5I5RA 2V3GA 2DEPA 1KBIA 3FOKA 4IIBA 4DYKA 4I9AA 1OCJA 1UR4A 1HKVA 2O0TA 4XKYB 3USBA 3HPAA 3MHFA 1GVEA 1LP6A 4HJFA 2D0FA 5IBXA 3FDKA 4PYSA 2E40A 1SR0A 4K38A 4J2PA 4QJ5B 4Q4QA 3RR4A 1EDQA 2XVNA 3HJZA 3FCPA 2ZRWA 4LC8A 1BVWA 4HU4A 2WXDM 2GGGA 4PCSA 4C7FA 2OX1A 1FHUA 3QHNA 2ZZ1A 3PUDA 5D2XA 3CLMA 1WBJA 3UEQA 5A2CA 3CLWA 4MY1A 3CZGA 4GINA 2YCLA 1VENA 3N2BA 3M0YA 1FKWA 2CIPA 3PZVA 2WMGA 3FVMA 1CBGA 3LRKA 1DIDA 4L64A 5A8MA 1LLZA 3CHCA 3SURA 2XTKA 3N2TA 1V5XA 1X6UA 2TRSA 4NRSA 2O9PA 3PFMA 1V7AA 1Z42A 1C8QA 1VC4A 3S1VA 2G97A 3MCOA 3GW0A 3IVTA 2HVOA 1MRAA 1PWMA 5D9MA 1UR1A 4LANA 4KIEA 4C6CA 3IIOA 1OCBA 1HIZA 4X9SA 5CZ0A 1M53A 4F0RA 5B80A 1VYSX 1XG3A 2E3ZA 2FJUB 2PP3A 1R3VA 3FFSA 4K7VA 4C6BA 1EQCA 3OGVA 3EA1A 4P7RA 3PAJA 2X1SA 3GHUA 3NUKA 1F76A 1KO0A 4OOZA 2WKGA 2IPGA 4FIRA 4HJWA 4OU1A 2FKPA 3R25A 4QNEA 3W1RA 2G4JA 2ZUMA 1GPFA 1XINA 3KBJA 4CKQA 2YL6A 4KFNA 3N4FA 4JIPA 4POCA 3VNZA 1E71M 5I3KA 4IX2A 1XG4A 4D8AA 2DZWA 1MEWA 1HL8A 1TRDA 3F2DA 1LYXA 4Z08A 2JEQA 5CLWA 4XAYA 5C7VA 1XD1A 5I3FA 1L8PA 3FIGA 4E8CA 2AOSA 3VNKA 1FWAC 4RL3A 2R6OA 4MADA 1NFBA 3PTQA 2E5CA 1Q2SA 1IGSA 2Z29A 3NZRA 3NNTA 4RJEA 3QSTA 2YZ5A 1UQZA 4KWSA 3LCWA 4H6QA 1R9XA 3O15A 4JDYA 4AZBA 3USZA 3Q37A 1K1DA 4HOXA 3LI1A 1SO5A 4FF5A 4X2RA 1UMLA 4LUSB 3PUOA 1FCQA 2ZIDA 4IGHA 3DHFA 2HPIA 4U3CA 3AJXA 2XHYA 3UT0A 3VINA 2GWGA 4LSBA 1ONRA 3MHUA 4O0ZA 1PTDA 1EX1A 4FOUA 1WZKA 2G96A 3DFHA 1YHTA 5AHMA 5I3HA 4L1GA 2QGYA 3AIEA 2B0MA 2WCGA 4C6JA 3LV5A 4XZLX 2EPKX 5T9CE 2VRKA 3TYBA 4H41A 2WVVB 2X0SA 1OK6A 1TVPA 3VMNA 3OZYA 1S2CA 1FDJA 4HNLA 4QDPA 3S3GA 3T2QA 1M7JA 3DBPA 7REQB 3TOYA 2PDPA 1NWRA 2G3IA 3H6OA 2OWWA 4IIEA 4IGNA 3W1QA 7PTDA 4HCHA 5G1TA 3W74A 2QJHA 1H5YA 3NQBA 5CG0A 4MZ8A 2D2HA 5J8LA 4Z0SA 4X0VA 3N2OA 4Z1YA 5CLTA 4O4VA 2DPEA 2WM1A 1E5NA 3M0VA 1OYBA 4LUJA 3SCPA 1EIXA 3AS1A 3UCDA 5I77A 1FXPA 4E8GA 1W5NA 1XCFA 4JX6A 1W32A 1MW0A 4IWWA 3WH6A 3L68A 4JTHA 3WFAA 1GOOA 3BTNA 4XD5A 3TTEA 3UXLA 2Y63A 3N13A 1GJUA 1XCXA 3AMLA 3KOWA 1TR9A 1E6RA 3TEVA 1Y5WA 4JKLA 2VGBA 4GABA 3DFPA 3W70A 4Q4RA 2BGNE 2VEIA 3ICJA 4NJJA 2EPMX 4AXKA 1FFRA 2BXZA 4TO8A 1I1XA 3WQEA 2QGHA 2BY3A 2J88A 1KXTA 2CZVA 1QPRA 4LAZA 1S46A 2OSWA 3ARTA 1LRQA 3BH4A 3TE9A 1Q45A 2VYOA 3KBNA 3K2GA 1BGGA 3KOXA 4DJDC 4RE4A 4TU1A 3RIKA 5D02A 5CPTA 3P81A 2ZTKA 3EZ4A 1VFHA 2E5BA 3GBEA 1I75A 2ISVA 2DT0A 2FMNA 3M0JA 3S6DA 1H51A 4XZHA 2FIQA 4TV6A 2XVLA 3NFUA 3C0QA 1SZGA 4X63A 3S9IA 3ECQA 1RAKA 4DZAA 2GQ3A 1R5YA 2PUZA 3B8IA 4LBSA 4HOZA 1PCKA 1HKWA 2WSYA 3KL5A 1KXHA 3EOSA 3KUMA 3MWCA 3VE7A 3W7QA 1I6NA 2XIIA 3VKDA 2INFA 2W63A 2EEXA 4PUDA 5LHEA 2UZ9A 1HUVA 1S5VA 4R7OA 4GCXA 4HSOA 4QDMA 1LWHA 3BC9A 4A6GA 2AL2A 3DIPA 1EEPA 3MMWA 3NL3A 2G37A 5EYWA 1REQA 1N8WA 1UZHA 3NQ6A 2IPJA 3PFRA 1VFOA 3DFNA 2YDQA 3K8LA 3G24A 2WZTA 2V2CA 3GNRA 4JL1A 3O8AA 2BHUA 1OEPA 2PDIA 1IZKA 3B8WA 1CECA 3TUUA 3BLKA 5DEZA 3VGFA 2OODA 2Y7DA 3CHFA 3IAQA 4F8XA 4LVAA 4PH6A 1DQXA 2GQAA 1J0KA 1OBAA 3QOKA 3NQFA 4N4QA 3WBEA 3H70A 1KA9F 4LB3A 2GVJA 5HDRA 4E2OA 2NX3A 3GDTA 3FYPA 1H2JA 2J66A 1OX4B 4J28A 1DIOA 1VBJA 3EKLA 4O1AA 1TO3A 4UUIA 2YL9A 3GC5A 3RM4A 4S2BA 2ZC1A 1PUDA 3PSVA 1E9YB 3LRLA 1QW8A 2VELA 2G3JA 3U3HA 4WIWA 4UNKA 1BEUA 3W23A 2X40A 3WH9A 4QXIA 1NFPA 3UZXA 2BSLA 3Q45A 3ES7A 1WUEA 4Q4KA 1XHGA 3AYVA 4GX9A 3UG4A 5HJXA 4TVUA 3LHUA 5BXSA 4HOWA 3TN6A 3S9ZA 4MFEA 5FOOA 1V6VA 2OGJA 4D1IA 2BGQA 3OPSA 4HA3A 4Q7NA 3N73A 3UXIA 1JYXA 3P8IA 2VFFA 3FGCA 1U30A 2J25A 3P93A 6TAAA 3CUZA 4M29A 3GTXA 1A4MA 2ACRA 2NV1A 1GOWA 2DORA 2DZVA 4XB3A 3IIZA 4H2CA 2H90A 3RU8X 1EC9A 1QUMA 2DH2A 3UZ5A 4D71A 1JRCA 1RCQA 5CXPA 3WJZA 3CBWA 3U0HA 1UB3A 1MDRA 3EOEA 1U1UA 1SJAA 5E6ZA 3AALA 1NM9A 4U4MA 3TDFA 3VMPA 3FKRA 5G4EA 5FJIA 1UROA 4DWSD 3GZAA 2PGEA 4UNLA 1U1HA 2CBUA 4B4HA 4D6EA 2QCMA 1U2YA 4H04A 3HN3A 1S5NA 3W1MA 3TQPA 1XS2A 3L0KA 3HFTA 1E9ZB 4RPQA 3U4AA 3GSMA 3D3AA 4WVXA 4CQDA 5DCBA 2Z1VA 4JQ4A 5LA0A 4FNPA 4J7RA 2ZFAA 2HE5A 4MWAB 1IR2A 2NWSA 2PDJA 1WP6A 1XH2A 1CXEA 1YDOA 3TH6A 1LOLA 4ML4A 3P74A 4LS0A 3BV7A 1H11A 3P60A 5C70A 3B97A 3NPVA 4ADSA 3WLNA 2E28A 3DC8A 3UPBA 4H9UA 3WBWA 1XIGA 4MJ4A 4AUBA 3TN3A 2BHZA 3GC2A 2D20A 1OQFA 3VD4A 1EA9C 5BWAA 1QI2A 1UZDA 1FKXA 1V51A 1A47A 3EX2A 4NU7A 2Y8KA 3BLPX 3H4XA 4ZE5A 3LCHA 2X05A 2W91A 4QBXA 2FTWA 1VCFA 1TV4A 1S1RA 2ZA1A 3Q65A 1A5KC 4GY1A 1WNOA 4C6PA 2P3EA 2J77A 3GVQA 4HZMA 2EGZA 1IEXA 5CZJA 4C65A 4H9MA 4ATDA 4OIFA 4N7QA 3OVQA 3GIPA 4Q8WA 1EOMA 1MQPA 3DN5A 1X1ZA 3R10A 1J2WA 4KPLA 5LYRA 2CLFA 2Z4GA 3R4IA 3NXLA 5IXEA 1NIUA 4KFPA 4JHOA 3UJFA 3WFLA 3PVFA 4L5ZA 4UQCA 2O4QA 1G4TA 2PC4A 3PSWA 2B7NA 2CLKA 1NTHA 3O6CA 2FZMA 4TQTA 1BWLA 2INEA 4LV4A 2FVMA 1OWQA 4AY8A 3UWUA 3TR9A 5E1QA 2B7QA 3S2LA 1OFDA 1G4PA 1VEPA 1S3HA 3R7MA 5JBFA 3KRUA 3QGVA 4J9JA 4GUFA 2NSXA 2WZHA 3FYYA 3HBLA 4K6AA 4MJZA 3W6YA 4C7GA 1E4MM 5CQ1A 4NNCA 2R8WA 4QG9A 1DJWA 1HJUA 4HK5A 3EA2A 3IGUA 5K3VA 1NOWA 1XI3A 1Q6QA 3GIYA 4GQGA 5AC6A 1YX1A 4E2BA 3PF3A 3SCOA 3PWGA 4GYPA 2Y70A 3RMJA 4GH1A 4XZMX 3QTPA 1LOSA 2WHJA 5GQBA 1JQXA 3DGBA 1JIBA 1KWKA 1LG1A 1ME7A 2Z27A 2QZRA 2CHNA 5HWJA 2RAGA 3GIQA 4V15A 5TD4A 2PBGA 3W02A 4IX0A 4WCJA 1XYCA 1C7SA 1M7OA 3DG6A 1ZQ5A 1YE4A 2X1TA 4PMJA 3ZT7A 2DSZA 4E5TA 3GDRA 3U48A 1HKIA 2D22A 1DJGA 3KBMA 2RDXA 3NL6A 4JFSA 1HG3A 5CSRA 3APTA 3BLEA 4IL2A 3C56A 5KZ6A 5BU6A 2Y88A 3GXPA 3R0UA 4XSMA 1TR1A 4EPBC 4IT1A 4PTNA 1GHRA 5TBOA 1Z7AA 2D2OA 4NQ1A 5LNWA 4ZCWA 2V63A 3NZGA 3RR1A 4YS1A 3L0GA 2FGLA 1FWSA 1A5SA 4CCZA 1Q6FA 4RNJA 1ZJHA 1M65A 4IGSA 4IIDA 3M0MA 3O6YX 4GI8A 3KFTA 5E09A 1TE1A 2J9ZA 1EZ2A 3OW1A 1FWHC 1BYAA 2C8NA 4FEZA 3OYZA 4QE5A 3CPGA 3KCLA 2VP8A 4LYQA 3L9CA 5A6JA 4NT0A 2PLCA 4A22A 1T0OA 4AZCB 1WO2A 3B3DA 3MP3A 3LCFA 2J74A 1OC7A 2ISWA 3WUGA 5H1WA 4JPGA 4O8AA 1GQIA 4YHGA 3A24A 2FTPA 4N0RA 4ERAA 3E5PA 2A7NA 4DYJA 4C1NA 4GBUA 3KWSA 1Y5XA 3WF1A 1C9DA 2I5IA 1EGZA 2J47A 3VZZA 1WDWA 4LVFA 4A2RA 1IIGA 4U5IA 4QQUA 2QAFA 1LBLA 4W5ZA 4FZIA 1EJWC 3C2OA 2QW5A 4A05A 4LY4A 3GK0A 1W9XA 1RV8A 3MP5A 5AFDA 3T08A 2D0HA 1NOFA 3WNPA 4HHHA 1KQYA 1OC6A 3CHEA 3KTXA 1XGDA 4HHMA 4XG1A 2ON3A 3GUGA 3PZIA 1CCWB 2Q8XA 2Z1SA 1UKSA 4QJ1A 2PWVA 4Z1DA 2XISA 1W3NA 5LKYA 3WFZA 4Q8TA 1EEXA 4ADUA 1GW9A 4PBEA 3XISA 3WZ0E 1W1A1 1YIXA 4IMCA 1K7FA 4WXYA 4Y9MA 3B06A 4EPKA 3IIXA 1JZ6A 1W3LA 2BBFA 4DJEA 4GISA 5DRIA 3WLOA 5HA7A 2HPMA 4JN8A 1VF8A 3OG3A 3NA8A 3UBPC 1V3JA 1XLBA 1YTEA 3OLDA 4XIMA 3M1ZA 1C8XA 2GPTA 4FMVA 3GH7A 1R86A 2P53A 4ML9A 5GPRA 4D6DA 5REQA 3W83A 5F2LA 4ATLA 2A5HA 3N11A 4FPSA 3AMKA 3E2SA 2BOFX 1X8CA 3F5LA 3NQ2A 4WOQA 3MCNA 4QEHA 4V28A 1OFOA 3TLLA 3AYTA 3O0FA 3U5UA 4GH3A 2QPXA 4MF4A 3TW9A 5CEWA 2J13A 5HNUA 3PNUA 3U7BA 1VBUA 1TREA 1D7KA 3BLDA 4N42A 3REQB 1PDZA 3NYZA 4ACZB 4E2DA 3GG7A 3T40A 4QEEA 1Q85A 2ZUNA 2QCGA 3C2VA 1E1CA 2XH2A 5F2IA 2VD9A 3BLOA 1B3WA 4JTDA 1CNVA 3U9IA 5CPNA 3E3HA 3CJPA 3GRIA 4MKVA 3RLGA 4HN4A 1W3TA 1FWDC 4H9XA 4QS6A 3RAOA 3VMOA 4ZOCA 4DM1A 4DUVA 4DI9A 4QG8A 1K03A 1CWYA 1WE5A 2ODOA 4O19A 5KZDA 4PA8A 2XSXA 1UP0A 4EXBA 4HNCA 2PDKA 1W1TA 4G1KA 3IV3A 3P6LA 3ENLA 3H53A 1E5JA 2Z6JA 2HSAA 3H54A 1DEDA 4Z2KA 1QI0A 2NUWA 1KR1A 1KM5A 4MOZA 5I79A 2HS6A 3E0FA 3WQ5A 1WBHA 1R7OA 2EKCA 3CIXA 4Q8OA 3DUGA 5DCEA 4JQ2A 4NXSA 1R3RA 1R87A 3UNDA 1ISYA 2IKJA 4ORIA 4ZOBA 2WHLA 1KTNA 2FHBA 1P7TA 5AC5A 1JDFA 3ARZA 2BVDA 3VIJA 5F7UA 1DJZA 4M19A 2C7FA 1JCXA 3G0UA 3ZSTA 1OY0A 3ARUA 2OOGA 4JYFA 3WLKX 3TQKA 3T07A 1FA2A 4JAWA 2OYKA 3V18A 1SM9A 3DX5A 3ISIX 3QR3A 4G2DA 5AVHA 5FSDC 1W5MA 1CI1A 3ZIZA 1HF6A 2PP1A 3T78A 3V7PA 2P76A 1QW7A 1U5HA 1HFBA 4OKDA 2ZYFA 4RPPA 3EWBX 3BPWA 4IP7A 1PSCA 2XUCA 3DEQA 3PPFA 3AROA 4H7ZA 3NPXA 3V5FA 3W6LA 4CEXC 1KTCA 3H55A 1P1XA 3AXIA 4FI4A 3H7RA 4ICMA 5A8QA 5BWFA 3GTIA 4U2YA 3KVLA 4NYUA 2GDQA 3KEHA 1K9TA 1W9PA 3HPFA 3NR0A 3VOHA 2KZHA 2V2DA 3HG5A 2ZA3A 3QN3A 1PHWA 1QFEA 3G77A 2RGLA 4FO4A 3ITYA 2PURA 1V6UA 5CSUA 3M0IA 4GRSA 1OFAA 4RUBA 4N9CA 3CUXA 1AFSA 4JL2A 2ZC8A 2YJQA 2ABAA 4S2CA 3SZ8A 3W53A 4XD6A 1C8YA 3KS6A 4YMZA 1YXDA 3TSBA 1H63A 4EOUA 5I07A 5EA9A 2Z1KA 4DVOA 2POZA 4KCTA 3CV7A 4Q8MA 3JW7A 2OQYA 1LT8A 2D73A 1HL2A 4QP0A 4HA1A 2Q3OA 5CPSA 3UR2A 3QV8A 2J8FA 2D1ZA 4QLLA 4WDUA 1AODA 1ZCOA 3CMFA 4ROQA 5F1UA 1OG6A 1Z32X 1AJ2A 1ML1A 1UWRA 3TYZA 3HGOA 1GT8A 4GYFA 4J3UA 3VVGA 3LNPA 2VZVA 5E0KA 3PC0A 3EXTA 4MZYA 5BRBA 4IQDA 1AH0A 4BI5A 2X2GA 3M6YA 3GKFA 1V0NA 2ATSA 2UWFA 4KEVA 4NVTA 1YEYA 3KZSA 5M03A 1CLXA 1BKSA 3CHDA 3OHIA 2EJ1A 1MEHA 4NNAA 4CVUA 2FGZA 4LCRA 2XIOA 3CK5A 3CQJA 4L80A 2HXTA 3L66A 3L12A 2AL1A 5CC5A 3T2PA 2PDLA 1RALA 1XW8A 4AWEA 3NZPA 3BZGA 4DUWA 2HVMA 4FXRA 3PZMA 2CKRA 2RH9A 3IJQA 1FCUA 3QW4B 3JRKA 4WF7A 4JIEA 4KGLA 4DNMA 2YOCA 1GQLA 2QCDA 2IPFA 1Y65A 2J7HA 2JKAA 1UH4A 1ZL1A 3CS2A 2A7PA 4W86A 4J3WA 2DIKA 2ZZ3A 3CGTA 3MQTA 4GI6A 4IXHA 4L4OA 2GDUA 1GQNA 3EX1A 1TB3A 2PRHA 2ZVRA 2OEJA 3W2MA 1RA0A 4FX7A 3WEMA 2JGYA 1OGBA 4G7EB 4C6NA 2ZDRA 3GHTA 1A5OC 1JRBA 1HVXA 3H7UA 3KL3A 3LV6A 3PN8A 3ME3A 4M6VA 5DXYA 2RFGA 3VCNA 4Q8NA 1E0TA 3ZXWA 5HR6A 4KEUA 3A4WA 2QDEA 3ZJKA 4UOZA 1Z48A 1VJIA 1F2JA 3GVWA 1WXJA 1ZRQA 1DJXA 1W9UA 4O1FA 4LUYA 5HJLA 4X2PA 3N1AA 1JCMP 4XZWA 4A3QA 3EX6A 3VCRA 1JZ4A 3H24A 4X9YA 1R7AA 3M16A 3WLRA 4DF0A 3HFYA 2I9EA 4TOQA 2OOFA 4RZ4A 3W27A 4ZFCA 1HO1A 4MFDA 4S3GA 4PSRA 2C91A 2XPKA 3WENA 3ABZA 2FFIA 4YLWA 2PB1A 1EXBA 4PBFA 2XH4A 1ELSA 2CPUA 4XVDA 1QXLA 4ZO7A 5H6HA 5C71A 1IV8A 3UERA 3NL2A 3WNKA 1B0IA 1VRDA 3W76A 2VX4A 2Y7GA 1A5MC 4AD0A 4DI8A 2BWGA 3V5CA 2JK2A 1WB0A 4GCAA 1QI3A 1CXHA 1MXGA 2RKXA 2G5WA 3WY1A 4GVIA 3CUIA 4NZ4A 5FI8A 3LCIA 1B3VA 1O7AA 1W91A 4GO9A 2RDTA 2YCIX 4WY0A 5LNRA 9XIMA 3TSDA 4H3DA 2DQXA 1J6OA 4R85A 5FSEC 1YLVA 2NT0A 4DF1A 1OYAA 4MWAA 1TYGA 3O07A 3A6OA 3KBVA 4EAYA 4AISA 1H7XA 4UTIA 2C79A 4NZFA 1ZJIA 3A4AA 3OLEA 2OZ3A 5DLCA 1EYWA 3LXAA 3O06A 1E56A 4K1WA 4PULA 3ZWSA 3CMGA 3EPNA 2GJXB 3CC1A 1S1PA 3SQSA 3UU0A 1P5BA 1XPYA 1MW3A 1XBXA 3EKGA 3WMSA 1F8MA 1W5QA 5K9DA 3SN1A 1XIHA 1VFSA 3LDVA 2HBXA 3W7JA 1GG1A 2VFEA 4UTTA 3BK0A 2A1YA 4FLQA 3WQGA 3ARVA 4C7DA 4Z2GA 7TIMA 2A21A 4LVGA 4GY7A 1CGTA 3LBMA 3GXDA 5EMUA 4JTFA 3R8GA 3M0ZA 3DKLA 5U7SA 5HWNA 3EPOA 3NGJA 5A3HA 3CYVA 9CGTA 2PGWA 2XM2A 2WC7A 3P5YA 4OHQA 1W1IE 1XH1A 2VR2A 2CCRA 4B5TA 4QLKA 2NVAA 1U1JA 1J93A 4A3RA 3JZUA 1UBPC 3KZPA 4AIOA 2QJJA 5A6BA 5LGXA 3T2OA 2P0OA 1W1ZA 3RYSA 1UD4A 1YXYA 4WOZA 1TE6A 4I3GA 1EJXC 3V75A 2DVUA 4DBUA 4BHYA 5DXXA 5HQEA 3VD5A 2NX9A 3A4XA 3LYEA 2VDGA 2E6DA 2FZBA 4WKAA 3PB2A 3D6NA 5LNSA 4HNNA 3L5LA 3E2QA 3U4FA 1X7IA 5XINA 3MY9A 5C9WA 1IT0A 2QMKA 3KP0A 4FNTA 5C2CA 5C9RA 5CZSA 4Z1BA 3WX7A 3EXRA 1FQ0A 3SADA 4PCPA 3IEBA 1XRFA 4F2BA 3PJTA 1H09A 3C2EA 4JY9A 3PNZA 4LVDA 4FXJA 4GJ1A 4F79A 1RXOB 4LNCA 1YDYA 4IXXA 5A8PA 1DWGM 3AUJA 2WVTA 3E2RA 4L1WA 3GVVA 4GC3A 5M2FX 1AZ1A 3LM7A 3VO0A 3WUBA 3BAYA 1GPWA 4Y9OA 1JL8A 1Y8BA 3EMQA 3OB8A 3RN6A 1N82A 1V02A 1X97A 1SZRA 1UR3M 2VC5A 4JBRA 4OJYA 3UZJA 4ZQOA 1BF2A 3MI3A 3GM8A 1IIHA 1A49A 1L2UA 4UQ9A 1C90A 1GEQA 5A2BA 4M3PA 3BGAA 1Q6RA 3RX3A 2Q8LA 1UYQA 2WQDA 1DBTA 3UYCA 4ZA0A 3ITVA 2OQHA 1KKRA 1EB3A 4RNIA 4GIAA 3OEXA 3ARYA 2DVXA 1LLWA 3PG9A 1GQKA 1V8EA 3R12A 1ZAIA 4YVXA 3NM3A 5CZTA 1Y5VA 3EBVA 1DP0A 4OV9A 1D3GA 3LI0A 1UA3A 3Q2DA 3RXZA 4ASTA 1HO4A 3JUGA 4MLJA 2CZFA 3AYRA 1K02A 4AZHA 1J5TA 1KCLA 2PU0A 5D8ZA 2J7DA 4AXNA 3NSNA 2GYIA 1GYMA 1PZ2A 4IUGA 3HOJA 5KZMA 3GC4A 4Q8VA 1GOQA 1R38A 1J8VA 3T4WA 5AZ1A 5CAKA 1MEIA 2R14A 4AZCA 1CGXA 1EGVA 4Z0JA 3FEMA 1J96A 2QF8A 2PODA 3VD3A 2QJIA 2PTDA 1DJQA 1HTIA 2W62A 1V0LA 2D2GA 2FPVA 4HT3A 1THFD 3VOGA 4TVDA 1EP3A 1PE1A 3QQ1A 2GUUA 1S38A 1YMYA 1WZAA 1JDEA 4W88A 4LX4A 5DMLA 2OPJA 5H8MA 3AU2A 3WK2A 3MJMA 4OWGA 4AHOA 5LNUA 4GK8A 5GVJA 1F3WA 3LN3A 1UHVA 2RJGA 3WEZA 2CC0A 2YIHA 3PAOA 3WNMA 5HK4A 3PJXA 5DRCA 2VJXA 1E15A 1FCVA 1WDSA 2GSJA 2OT1A 3BLLA 4N9DA 2VDIA 5FEZA 5BXPA 4FXFA 3GDLA 6ENLA 4RZ6A 1O12A 1T8QA 3FA4A 1NF7A 4AY7A 1B3ZA 5I09A 4JYEA 3CEPA 4O1DA 2ZE0A 2ZXBA 5LXXA 1R2SA 2CLEA 2Q3RA 3SUVA 2PDBA 5FF2A 4HPHA 1JXKA 4ZEPA 1TPUA 4R9OA 2NQZA 4JCLA 2Z1BA 4YTQA 3NQGA 1Z44A 2CERA 1MXSA 3BXWA 1DIKA 1RY0A 3OZOA 3C3NA 3LCLA 1Q8AA 4JGDA 3R94A 3PULA 2WWDA 3SECA 1QRQA 4IFRA 2ZUWA 1NWSA 1PZ1A 1BQCA 1KGXA 3KE0A 4XSLA 3B8TA 1LUCA 2WZEA 1J0IA 1E43A 4A8NA 5CBIA 1CLVA 3C2FA 2XH0A 3L4WA 1RBLA 2PLJA 2ZX5A 1CDGA 5IFTA 2ATMA 1BWVA 1HGWA 4HCLA 4M6UA 4K68A 1KLZA 1B31A 3QHMA 3BQ5A 3AIQA 3AS2A 4XAZA 1A0EA 2EG8A 1RZMA 3MUCA 3II1A 4G7FA 1AQ0A 4RE3A 1I2RA 3DU0A 1U5VA 3S6TA 4LNYA 1AL8A 4BQ4A 1UUMA 1VKFA 2ZXQA 3CUHA 3W22A 3ZT6A 3KBSA 1VBRA 2ZZ6A 2PU1A 1XGZA 2VCCA 5A1AA 3E0LA 1G01A 3TTSA 4L4PA 1CGVA 3RX4A 2Z2AA 2E4TA 3R1ZA 1NARA 5DT7A 2WO5A 1JVNA 3IJ7A 2PD5A 2F38A 1OZQA 3LM3A 5BCAA 3W84A 1EBGA 1E9IA 4K8EA 4B5SA 1TJRA 4GGHA 4UTWC 3PANA 1ZALA 4ADTA 3UYIA 4UR9A 1WQ5A 3VKKA 5LA1A 1Q6LA 1ITXA 1QR7A 3SN0A 2DT2A 1ISVA 4MB1A 1PX8A 3KRBA 1K77A 2ALDA 2Z2UA 3WK1A 4A3YA 5ABTA 1O5XA 3H21A 5IBXC 3F4CA 3HG2A 4X22A 2VR5A 2VL4A 3U5YA 3BAJA 2FDSA 2ZUTA 1F6KA 4IPIA 1LWJA 4PZVA 4P61A 3IGSA 4KETA 3ZLHA 3SRFA 4CNOA 4N6FA 3N6QA 3T0CA 1T7LA 1IWPA 3BGJA 2X1RA 3AO0A 2XH7A 4UQDA 3KAOA 1KKOA 2WZIA 2F6XA 3DAQA 1E0VA 3OLIA 4QISA 4IISA 4R9XA 5FF4A 1GKQA 1EPVA 3AUOA 2RDWA 4LCQA 3WJXA 5HR7A 2VC6A 1WA3A 1U22A 2PDFA 4DAFA 2XVKA 4I90A 4ZXLA 2ZXDA 4DQWA 2V5KA 4S3EA 3MKCA 2GSHA 5A5WA 1PYMA 5JBDA 3MDUA 2CWXA 1ZBCA 2Y8VA 2DW6A 1DHKA 1XBYA 3IIPA 2CITA 4IFKA 4PODA 4EAMA 1YPIA 5LXEA 3GVRA 2CBIA 3NCOA 3DFOA 3W1XA 4L6HA 2TYSA 3RU6A 3QTGA 2Y4SA 4UOQA 4HIBA 1CB7B 3GU9A 2ZQ0A 3GFYA 3T0AA 3MI2A 3NWRA 3R8HA 3G3DA 3C0LA 4O16A 1YBQB 3PJWA 3PTMA 2OEKA 4LFYA 2XJ7A 2J6VA 1XD0A 4MG4A 2Y5JA 1XGEA 2GVLA 3LD5A 1V4YA 1AH4A 4E4UA 3NVTA 2HROA 2QF7A 1DORA 2DUXA 3CZ8A 3THUA 3PBVA 2VMFA 4NZCA 5FESA 1OD0A 4GQRA 3B0PA 2CLPA 4KRTA 5CJMA 4GFSA 3N9RA 4BF7A 2VC9A 5K9XA 5DFAA 3VIOA 1NAL1 1UPMB 1BXBA 4XBKA 3OLGA 2GJRA 2ZZ7A 3B8DA 3B9EA 6CGTA 1F6YA 1VLWA 5FA5A 3FDGA 4V2XA 3M5VA 3LPOA 3WMCA 4F9DA 4UMCA 2ZXAA 3QY6A 2EO7A 4HYVA 5AKQA 3MMDA 3E2VA 2WNWA 1DTUA 2W4XA 2CETA 2P8CA 3DG3A 3SSZA 3AXHA 2NXHA 4CNPA 3G8RA 1JPKA 4M51A 2PPGA 4CQAA 4O0KA 1R3SA 3GG0A 3ZJ8A 3VIGA 3TZFA 1JYVA 4BJHA 2I5GA 4ICCX 2O4MA 3NEVA 5ECVA 5GJPA 4P5UA 1J6PA 4GIRA 1ITQA 2VENA 4IZGA 4N6EA 4QRNA 1H7NA 3ZR4A 1A4LA 4F40A 4B15A 1DE6A 3RNDA 4KWWA 1EL3A 3TYUA 3VFLA 1AQMA 4MKSA 1J11A 2HE8A 3ALGA 5D4YA 4TX6A 3U6WA 1F74A 2VNCA 3R13A 3R6IA 3NQ7A 5DMYA 1WX0A 2VVNA 5XIMA 3GE7A 5EMYA 1NJJA 5A6KA 4AYGA 3W7KA 4DJDA 4GOAA 4UTUA 1QWGA 2AKZA 2E25A 2ZCGA 3QZ6A 1NEYA 3EWXA 1RVKA 1GOKA 1C91A 5BRQA 4A8IA 1DWFM 1B4EA 3W25A 1H0GA 1GHSA 1XC6A 1TVLA 4AF0B 3APYA 5FF0A 2Q6ZA 1VQTA 3OODA 3AHYA 4H83A 3OQ8A 1SJCA 1FWFC 4P8XA 1J0ZA 3KHJA 5F4WA 5AHEA 1EBHA 1AW5A 1I2NA 2QDHA 4PC8A 4NI8A 4QROA 3W7NA 1JYWA 1I2QA 3ZMRA 3KDNA 3G3MA 4AW7A 3ARPA 1JJKA 1WZLA 3IARA 1MSSA 4DJFD 4K1GA 3MVIA 4DO6A 3M64A 2OGYA 2YCEA 1QI4A 3F5JA 3VOJA 4QITA 2YKKA 1B54A 3V0UA 1UZ4A 3FN9A 3KOFA 3DERA 2Y1HA 1KXVA 1C8VA 4U33A 3Q4DA 3SR7A 5CKSA 2JEPA 3CAVA 1LOQA 3TOPA 3ZM8A 4B3LA 2C16A 3VILA 3W75A 3SCSA 1PL9A 4R34A 3SM0A 2FYMA 3WDHA 3WELA 3UPWA 2ZX9A 1T6MA 3MSDA 1EJRC 4DO7A 1XBVA 1J79A 5LIKX 3TVAA 2DSVA 3MANA 1SPQA 1BVZA 1FOBA 4PMRA 3QY8A 1LLOA 1Z69A 5G1YA 5KMYA 4NUWA 3W0KA 3FSTA 3VIFA 4CQBA 6REQB 1RP8A 1HXJA 2BXVA 3BL3A 1F5ZA 3U2OA 3UD6A 3OIXA 4W8LA 3MSYA 1OZMA 4ZODA 4MY8A 3SRDA 5D04C 1F4HA 1IEQA 5C9XA 4X60A 1Q7ZA 5ENLA 1J2BA 1T8XA 1ODUA 4GBDA 2AQWA 2XFYA 1DXIA 4I8DA 1QHZA 3OP2A 5F2GA 3VGGA 4LF1A 1G4SA 5DMNA 4UQEA 3BGGA 3L0NA 4YJ5A 4D9PA 5FCZA 1EWEA 4L4MA 5CCZA 1UOKA 3LMYA 1O5RA 3PUGA 2DZPA 1QW9A 4TX9A 3NPWA 4IJCA 1BLIA 2F9RA 3L7RA 3W00A 1B57A 4R27A 3RLUA 3UWEA 2X09A 5L9FA 1LZOA 1JCLA 5MKGB 1S5MA 3T09A 2V82A 1EC7A 4IL0A 4AIEA 3FXGA 1VCVA 3ELFA 3NYDA 3G1FA 5I3GA 3W1AA 5HXMA 4FR1A 1Z6KA 3VXGA 4MTVA 3GG1A 3VUPA 5E0CA 3BLFA 3IGXA 3FHAA 2W79A 4ZO6A 1TKKA 1M68A 2WMIA 1LROA 1ONEA 3LBCA 4ROPA 4Z1AA 4XO6A 3SCWA 4DF2A 3WF2A 4GLEA 1YTDA 4JTEA 2ZWZA 3W7PA 4CD6A 2J4GA 3WH5A 2DZSA 2YLLA 3AS3A 3BDKA 3NM1A 4UR8A 3WK3A 4HPXA 4PTXA 4GXWA 1W54A 4IIGA 1I0DA 1JI1A 2PAJA 1K70A 1XXXA 5DY2A 3VIKA 3OIHA 3HG4A 1QOPA 4ZTXA 3G1YA 2OG9A 1GZJA 4BEQA 1D9EA 1V77A 1OM0A 3CL6A 1XCWA 1UWTA 3KP1A 3QPEA 2J62A 1K4GA 4HU8A 3EOOA 3LHYA 5D9PA 1M04A 2BODX 1Q2RA 3VDAA 4H9TA 2RDUA 1TJ2A 4S3AA 3E0VA 3IWPA 4TUFA 3KWXA 5AC4A 2OLAA 4S3DA 4PSPA 3R5EA 3M5ZA 2ZADA 4Y9NA 3WUEA 4L9YA 1O66A 3I4KA 3R89A 3B4UA 5IFPA 3SN4A 1CX9A 1F05A 4H7VA 4XBJA 3FYOA 4P7QA 3W2JA 2EF9A 3NO5A 3L4TA 1IYXA 1X96A 2DIEA 5I24A 3N9KA 1SW7A 5CZKA 1SVDA 5HUPA 3THAA 5H91A 4JIIX 1QPNA 3P8JA 4BR1A 2V5LA 2YBTA 1ZENA 5BOOA 4MUPA 1L9WA 2EJAA 4RW5A 3MUAA 1UQYA 5D38A 2XINA 1R3QA 3DGRA 3VKCA 1NQ6A 1RQEA 3TCEA 3LQGA 1WAUA 2E9MA 2O92A 3IJDA 1EP1A 2Y5EA 2WNZA 2ALRA 1UH3A 4JTRA 1TZZA 1XDJA 3G8EA 5AHFA 4CD7A 3BAKA 1B9BA 3G22A 2WOQA 3M41A 4IHCA 5EBAA 3BARA 3FXYA 2FDMA 4RV3A 3UF9A 2NSOA 3RCNA 3HMJG 3NQCA 4K36A 1Q7QA 3W38A 3S5NA 4I8YA 4FLOA 2ZUSA 1UWAA 1W9DM 1IXPA 5ABFA 1SMAA 4V1XA 3UW6A 4PCFA 3DHDA 1LTDA 1EWDA 1FWCC 1XIJA 1CXFA 2V9DA 2WJEA 3EWCA 3VOCA 3ZOAA 1K9DA 3DC0A 3TTQA 3UXKA 1D3HA 2E68A 4L9ZA 2PRMA 4EANA 1RLDA 2BV9A 1E73M 1AJ0A 2VRJA 2XM1A 4HA0A 1BFNA 5D2WA 4OVXA 3L21A 3C86A 3PS7A 1E6XM 2DZBA 1F61A 4MHBA 2NW0A 5HANA 4M1BA 4OOUA 4M81A 2C6QA 4F4RA 1W56A 1SU5A 1KBBA 3N15A 2VZSA 1YADA 4FLRA 5D8WA 1EX5A 3QY7A 3S9YA 4K37A 1LF1A 1YYAA 3DESA 3S2NA 4D8LA 2XFWA 1KFCA 5FL1A 1M9HA 4A35A 1XLAA 4L1XA 2W6RA 3RGTA 1FH8A 5HAOA 4ZB2A 1S39A 3M7SA 2WMJA 4JX5A 3N04A 3L2LA 1E70M 2PE4A 3VZYA 1R6WA 3B40A 3C0SA 2WC4A 3R2GA 3SFWA 3OJGA 1K7EA 2V81A 4EXAA 3QYQA 3PPHA 4MJ2A 4HGXA 4XQ6A 4M0XA 3I3BA 5BYWA 3OZPA 2YA0A 2ESCA 1QJWA 1UWSA 3HMCA 4LUTA 1GVRA 2QR6A 3E38A 1RP9A 2PDXA 1Q63A 4PMUA 2XWDA 3W7GA 1BTCA 1VIWA 2WSPA 3GKAA 3VU2A 4KCUA 2JQXA 3WUFA 1E55A 3AZSA 5FF7A 1GG0A 1DTNA 4GUHA 4NYYA 2AAAA 3O6AA 3WLPA 2CZEA 3GNDA 4MNLA 1VR6A 3WDJA 6TIMA 1M01A 2ANUA 1I60A 3SI9A 2YYUA 2OSXA 4PUJA 2NQ5A 2QPUA 3NZ1A 3NQEA 1GONA 1CLKA 5CPOA 5D32A 4CQCA 4HD5A 3RRAA 3HV8A 4MLRA 4TXEA 4DBWA 5LZLA 1YDVA 3UG3A 5BMXA 4JFVA 1QNVA 3DYMA 4UTFA 2GOUA 3R58A 3VTRA 1JZ7A 3VDGA 1P0DA 3RPDA 2OTDA 1WOAA 3CO8A 1F07A 3APGA 1UIOA 2G3MA 3HIJA 3TA9A 4X3ZA 4RV8A 3UG8A 4WZHA 3FJLA 4Q8PA 1MUMA 1R0MA 3O63A 4BA0A 4PTMA 1UR2A 5CBBA 4CCCA 3I4EA 4BY3A 3CH9A 3PK7A 3S2JA 1JZ3A 1EPXA 5CPLA 3SCQA 4R3UA 1XRVA 4LB4A 1TV8A 3GDMA 3A47A 3GS6A 3M6DA 3UR8A 4MKNA 1JGIA 3IUIA 3E74A 4YTSA 1US0A 1HJQA 3DI0A 1SQ7A 3IUHA 1CT5A 1KCZA 3SGUA 3G6LA 5DMMA 3SQMA 4H8NA 4BK9A 1OT1A 2FLIA 4AB4A 3LPPA 1KNWA 7XIMA 1FWWA 3DI1A 2CEQA 1V3HA 3QR1A 5AHNA 2BGSA 2C1IA 3ITXA 2PTYA 2YB1A 5CPQA 3WLLA 3ZLGA 3WQDA 1H1YA 2GZXA 5JBEA 2OWCA 2WPGA 1QAPA 3SGZA 4FNQA 4I6VA 5B7YA 3B8VA 4YVPA 2XN0A 4PE8A 1VFLA 2G3NA 5BXRA 3WJSA 1PEZA 1G69A 3KDOA 1OJXA 4Q7BA 1W6TA 3MHGA 2E8ZA 4LRSA 1VFFA 1ITUA 1G7UA 4QCFA 3SSJA 1RBAA 3RDKA 4G1NA 2BY2A 1UCWA 1F73A 3F4VA 1Q6OA 1XF0A 3GZ3A 1G4EA 3BO9A 3QF0A 2J7BA 1MXDA 4TR9A 1UD6A 4I9MA 1CEOA 4ES4A 4NZ3A 2A4AA 2Z2BA 4DY1A 2W61A 2GJLA 3LQLA 3S6OA 4MWAE 1BG4A 3P14A 3BSHA 3EEZA 9XIAA 5D37A 3RLVA 1SZNA 2CYGA 2OZTA 3OGSA 3FJNA 1EJ7L 1XYMA 1FHVA 1J18A 3GU1A 5EMKA 3IK4A 3L5MA 3F7JA 4Y6GA 3AMDA 3TNBA 3FHQA 2F8QA 4L65A 3MW7A 1TIMA 1LG2A 4QLJA 3W72A 2ABBA 3MV11 5HUOA 4O52A 4REQB 3VYLA 2D69A 4PBGA 4JHMA 4ZR8A 4Q7IA 1ENUA 4KFOA 4AC7C 3HB9A 4B3ZA 4C6DA 2X7VA 1JUBA 3NQMA 1V79A 1LL6A 3KLKA 3MBFA 2CWNA 5LIWX 5C54A 4P8UA 4FHAA 4DJEC 1HJXA 1Q4NX 4E4FA 1VFUA 1F9CA 2JALA 4QQ3A 1HJVA 2PFHA 1G9HA 2AQOA 4IICA 4HHPA 1GQJA 3VI2A 3QMSA 2VUYA 1ZFJA 4F9JA 2Y89A 4HNTA 1ZBWA 3MO7A 2G3FA 3QBUA 3EWZA 4UCGA 1EYEA 1T40A 2BP1A 2VGGA 3CTTA 4AVFA 3BG5A 4XTIA 1RVGA 4JTIA 3AZTA 1JPHA 3W01A 2Z7GA 4ATWA 4FNSA 1A5LC 4FF7A 1UOZA 1CGYA 3DHUA 4GGBA 4NSBA 1LCOA 2YFOA 3MCMA 2BB0A 2PI6A 4QSHA 1TQXA 3N14A 2FH8A 1XL9A 2G50A 1GGOA 5K7JA 1M41A 5FIPA 3W73A 3TJXA 5A8NA 3HA1A 4HSHA 3QC3A 2YCLB 4GE8A 2HJPA 3K13A 1Z8AA 3GAYA 1PYFA 2A6NA 3O0KA 4TTUA 1W17A 4F0KA 4DLMA 2HVNA 4BF9A 2HNEA 4P2VA 3ZVIA 1US2A 4TVCA 1K4HA 3THQA 3NXFA 1HX0A 3DFSA 3M0KA 3T6CA 1KRAC 3KOZA 4AVNA 1KW1A 3E49A 5IOBA 3AXXA 2W0UA 1US3A 3D47A 4EE9A 1V02E 2VFGA 1VLIA 2IKGA 2V0TA 1TWSA 3VGHA 1VPYA 2HTMA 2QULA 4UZUA 2D24A 2PTXA 4B2DD 2PDCA 3U2EA 5BU9A 2ZX6A 1QNPA 4LWWA 3OHMB 4IIHA 2ZUUA 2GL5A 4NX0A 1Q6GA 4RCXA 4NI3A 3WD4A 2QLYA 1G0CA 4HZ6A 3NJ3A 2CU0A 3QPYA 2BNJA 3LPGA 2DT1A 2DZXA 2J8GA 3LSCA 4WDTA 1ZCCA 1POJA 4RK8A 3W71A 4PUMA 3HGRA 2QUVA 3BCDA 3ITGA 8TIMA 2BHYA 1QNQA 4GC4A 1I45A 3AC0A 4J3TA 4JIHA 1TV7A 1XISA 4E0CA 2F2KA 5HBFA 4DYEA 4MVAA 3O2LA 1FP8A 4Q6JA 1E0XA 3BSGA 1L6GA 2MUCA 1TCDA 3QC0A 5CSSA 4O54A 3N2XA 4DZHA 1BPLB 1O1ZA 3AMGA 3AYSA 3QSRA 3W7IA 1AUSL 3WNOA 2E9LA 4IF2A 3BAWA 4YTUA 4NIRA 1B2YA 3VC5A 1XYLA 2IUZA 4HU3A 2C0HA 3Q58A 1M7PA 5CC3A 4AX7A 2VGIA 1EJUC 2VEFA 3EDKA 4US5D 2VEKA 4CCDA 4HTBA 2WYSA 3CO4A 1PKNA 3S5ZA 1V7YA 4DIAA 1KWGA 3CT7A 3K1GA 2NQHA 4YHEA 1E51A 5JIPA 4KBXA 3B8SA 1ODZA 3WQFA 3EDJA 1MRQA 4CQ8A 4Z2HA 1HJWA 3D3FA 2EPHA 1FWTA 3TXZA 2BG5A 2IPWA 3PPCA 4I7WA 4ZQCA 3CZJA 3EA3A 4UB9A 1WKDA 4F2UA 2GFTA 1GVOA 1BSIA 1TFVA 5BZAA 3TROA 2WMFA 4KW2A 5FJRA 3M0XA 3A5VA 3CQIA 3IK2A 3SFKA 1ME9A 4OE7A 1B9ZA 3MUIA 3AAMA 1IEIA 2ICSA 4DM2A 4UTMA 1O1HA 2HDJA 4B4FA 4PMZA 1C92A 4QAIA 4IPNB 3MT1A 2C1HA 1MO0A 8A3HA 3OBKA 3MI6A 4DJFC 2OYMA 2GOKA 2ZTJA 2Y7FA 4YWIA 1X6NA 1CW2A 2F61A 3GU2A 5D05A 3SUWA 3WNNA 2CFFA 1PKMA 4W89A 4DBDA 2D2JA 1LQ0A 4XWUA 3N9SA 3LHWA 3VAVA 1XIEA 2JFEX 5KSWA 1LJYA 4C6OA 2CLMA 1PIFA 2VEMA 1QPQA 4RE0A 1D7FA 1BXNA 2GGEA 4ZSUA 4KS0A 5GNYA 3SIMA 3OG2A 5C2GA 2NWRA 2W92A 2J7FA 5A6SA 4H4IA 4B5NA 2EXOA 1V3KA 2QYGA 2QCEA 1UKPA 3WF3A 2JKEA 4NJGA 1VBGA 1A80A 1SYTA 5GNXA 2BXYA 3GXTA 3VNYA 2ZRYA 2HZGA 1TCMA 2J9YA 4C5YA 3H7VA 2DQWA 3W1UA 4IH3A 4INFA 1HN1A 4M82A 2V30A 4GZJA 1PIIA 1D2KA 5D2YA 4DZIA 1MUCA 3E5BA 2C19A 2YW4A 2FVKA 2FPYA 1MQQA 3QV9A 4HZ8A 4GZIA 3T8LA 4WUIA 3G1XA 4H00A 4AWUA 2G41A 2FQIA 1R9ZA 3QRHA 3RPTA 4RNFA 3EDEA 4JEQA 4I7UA 3NSXA 2GVGA 1OYCA 3HURA 3R0KA 1W8GA 2YDSA 3R0DA 1KM6A 4YYCA 1VP5A 4FOJA 3LXBA 4LPCA 3UXDA 2GQ8A 4I5RA 5CJ5A 1H7WA 4YU1A 4IFOA 3UP8A 3OOQA 4YWSA 3CUFA 4HMDA 2WV8A 5HMEA 1LM1A 4FNRA 1NFGA 3BLIA 1UG6A 3FK4A 3O16A 3EEGA 1DV7A 4RLIA 3TFCA 4B5VA 2AL2B 5TF0A 4XAPA 4K8HA 1ZGDA 3WK0A 2CBJA 4PMXA 3VX0A 3W4RA 3OQEA 3LZ5A 4EXQA 1RY8A 2ZZ4A 2DP3A 1BHGA 1E6PA 3ARXA 4GQQA 5I7GA 1A0CA 3W24A 3ABQA 4OBSA 2PD9A 1UA7A 1V6WA 2Q01A 3DECA 3N2CA 4HTYA 4MMWA 3W87A 1KD0A 3ZVHB 4JXCA 4HMEA 4HCDA 1IXOA 4WSJA 1IXQA 4JTLA 4O4WA 1V6XA 1XLIA 3T05A 3BJFA 2REQA 4IQEA 4FSAA 3DENA 4ZQMA 2UY5A 5J5DA 4DWSA 3MV01 3M47A 3TC6A 3B04A 3P7YA 3PZGA 3VOFA 5TAOA 4DPQA 1W3KA 2VEPA 1TZ9A 1VHNA 1FRBA 1ZJAA 5E5CA 4MNJA 4DXXA 5F4XA 2WJFA 1BRLA 4JQAA 2VO5A 3PBUA 1K8CA 2VTFA 1XLGA 3AIWA 4QE4A 3CPUA 1L6FA 3B9NA 1QHPA 4U5KA 4D6HA 2E6YA 2WJZA 4K2SA 4NX5A 1ZU8A 3BVJA 2VGFA 2F7FA 2PSNA 1ESWA 2VFIA 1OD8A 3EWWA 4UTTC 5G4WA 1VFTA 4YVVA 2HQAA 1Y7VA 5A94A 4X0NA 4F0MA 2WZMA 4YCOA 1POKA 2NT1A 3VDBA 4GYJA 2XN2A 1JAKA 1OFEA 2LLEA 4D6IA 5A6LA 3M44A 4ACYA 4WRHA 3CL7A 3IANA 1IXNA 3TJIA 1E3ZA 3FGCB 1AQFA 4ZZ9A 3VNMA 3W07A 1I2PA 3RCYA 4PTVA 3S4TA 3TU9A 4GA8A 1FXQA 1Q6DA 1XLFA 3DFTA 3W81A 1LL7A 5BXTA 2VEGA 1ADOA 1UJQA 2EKGA 1L2QA 3WQOA 1S2TA 2C15A 2PDUA 1M3UA 4GG9A 1LWIA 2DFAA 5JMUA 4HPGA 1I4NA 1TTIA 4TX8A 1JDCA 2VUNA 3S2CA 1XLEA 1X1NA 2E09A 4AU0A 4RE2A 2WMKA 1KBLA 1HQTA 3WSUA 3HPXA 3VX1A 1KFLA 4KT2A 2CLLA 5G5IA 3SIZA 4JTAA 1H1NA 2F2HA 1L6SA 4XKYA 1K8YA 4LU0A 3P82A 2X1UA 3ZO9A 1OIFA 5J5RA 2XN1A 3S1XA 1WKYA 1H7PA 1TWZA 5D33A 4DBSA 2R9RA 2J6XA 3VZXA 4J1OA 4NNBA 2WW5A 5A95A 5A2AA 1B5TA 1E6QM 3V0SA 4W93A 4LVBA 3RX2A 3TMQA 1UBSA 2YGYA 1LORA 1GJPA 3GNNA 2HWGA 1P0BA 4W84A 4MM1A 4OUIA 1XLKA 5H2ZA 1G6CA 4XZ9A 3B8UA 3QM3A 3LLFA 4I5XA 3UCCA 2PDNA 2GQ9A 4S3KA 2BVWA 1DWJM 2I1OA 1V3IA 3UJSA 1SW0A 2I7GA 1S3TC 1B3YA 4HP5A 2FFCA 3QV7A 4FK9A 2V5DA 4EWND 4JS3A 3NL5A 2ZRXA 3OO2A 1PDYA 1ONWA 2XFRA 1DQWA 4Z2IA 3UGVA 4EPEC 1RCOB 1RJQA 1ONXA 3VKAA 1NDZA 5F1VA 1EDGA 4K7YA 1MNSA 1Z3NA 1VS1A 1H60A 1OK4A 3VNJA 2D0GA 3N4AA 2IS7A 4S3CA 1JEZA 1UC5A 1ZJBA 4CCEA 2DZUA 2B4GA 2HK1A 4RDYA 4LYPA 4NJKA 5KINA 3URBA 2DW7A 4FX6M 4A4AA 1XDMA 3A5FA 4NJIA 2BASA 4ZVJA 1RH9A 2IXVA 1BVNP 3QQWA 4BQ3A 1XH0A 3EWDA 3FVDA 2GJPA 2POTA 1TIWA 4LTSA 3PP7A 3P3BA 3GHRA 3O6DA 4PCNA 3SEPA 5AHIA 3W9ZA 1JFXA 1PZ0A 2YBUA 2WCSA 3TC3A 1X39A 2I9UA 3MMUA 4WY0F 4HHLA 4GYKA 2R94A 3LGDA 3EB3A 1CGWA 1CPUA 3HQOA 2WKLA 3MUXA 2VR4A 2Y2WA 4DN1A 1KFWA 3KRZA 2ZBTA 3GNPA 1E3XA 1OCNA 3LUTA 1EO5A 3ATYA 1FDZA 1QASA 3NQAA 1KCKA 1SO3A 2E1WA 4HNUA 1J0HA 2VHLA 1GYLA 1NWTA 4IPPA 3V5OA 1QU4A 5FF3A 4NF7A 3W29A 4LS2A 3K8KA 4ORMA 4JTGA 4M5PA 2DJLA 5M17A 3MBDA 2NLIA 4Q8UA 3VD7A 1MVYA 1PZ3A 1JDAA 2DZTA 2DH3A 1TQJA 4MNKA 1XLMA 1UZ1A 3GNXA 4ZFMA 1XUZA 2YPIA 4UOJA 4LUSA 3W2UA 2DZAA 1V08A 4C6MA 2CNCA 4A29A 2GUYA 1EXPA 1J5SA 3WKZA 3U7VA 2Z7KA 3TQVA 2A7RA 1QO2A 4NASA 2XVGA 3OA3A 3CQHA 4YXGA 3ATZA 5DBTA 3QOMA 3LERA 1FWEC 4OUEA 4Y90A 8XIAA 1UMYA 4U31A 5D03A 3GFXA 1PX4A 1P0KA 4EX4A 3LCXA 1NP2A 1DWAM 2WVVA 1A5AA 1ZB5A 2WPBA 3K1DA 3LB0A 5H8PA