4AVFA

Crystal structure of pseudomonas aeruginosa inosine 5'-monophosphate dehydrogenase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
467
structure length
314
Chain Sequence
MLRISQEALTFDDVLLIPGYSEVLPKDVSLKTRLTRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMGIEQQAAEVRKVKKHETYPLASKDEQGRLRVGAAVGTGADTGERVAALVAAGVDVVVVDTAHGHSKGVIERVRWVKQTFPDVQVIGGNIATAEAAKALAEAGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAAALEGTGVPLIADGGIRFSGDLAKAMVAGAYCVMMGSMFAGTEEAPGEIELFQGRSYKSVPYKGALSAIVHQLMGGLRAAMGYTGSADIQQMRTQPQFVRITGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Aeropath Project Targeting Pseudomonas Aeruginosa: Crystallographic Studies for Assessment of Potential Targets in Early-Stage Drug Discovery
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
total genus 98
structure length 314
sequence length 467
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4avfA00
4EIVA 1XXXA 2QCLA 4PC8A 3PWAA 2WNQA 4O4VA 1ALDA 4FNTA 3OIXA 4O1AA 3EWBX 1H50A 2RHGA 3V75A 1F76A 3BW4A 4WY0A 3HG2A 3O6DA 1QPQA 3LCGA 2WQPA 4UFMA 4JIPA 5K7JA 2OCZA 3A22A 5AYYA 3ZWTA 4DBDA 5FF2A 1RQEA 3QPZA 2DZWA 3MI6A 3W74A 3W07A 3GYEA 1BKSA 5L6UA 5D33A 3QW4B 1AW1A 3L0NA 2NX1A 4N9EA 4JEQA 3LRKA 4QJ1A 3FFSA 1NF7A 4N4PA 3EKZA 3LHWA 3S1VA 1WBHA 4GRSA 3W76A 3BO9A 1L9WA 3M5ZA 5FF7A 5FF0A 1VCGA 5D32A 5H91A 4ZZ9A 4XTIA 3T40A 5C2XA 4HSOA 4O10A 1GWJA 1VGAA 1DBTA 1EP1A 2GJLA 1TPFA 3NNTA 1AW2A 1W3IA 4HIBA 4EF8A 1VRDA 4HSNA 4UTKA 2CLHA 1JUBA 4GUIA 4IXHA 4IXXA 3W83A 5LNRA 2HS6A 5LNUA 1RPXA 3BW3A 5TIMA 2C6QA 3W7GA 1FCVA 4DEFA 1UASA 1QPRA 2EF9A 4UTUA 1W3TA 3NPVA 2ISWA 1GVOA 4FB7A 2H8XA 4GUFA 2ZRZA 4LTSA 4WXZA 4EOUA 1OFOA 3GDKA 3NEVA 5FEWA 1OF6A 5CZ0A 3FKRA 2ZTJA 3DENA 3U2OA 3P7YA 4YLWA 4LV4A 5BW6A 3CT7A 3LHTA 2ZA3A 4QNWA 5FEXA 2Y89A 1WA3A 1LTDA 4O54A 1G4EA 1ZNNA 2J24A 4UTTC 3STGA 1PL9A 1THFD 3LHVA 3RK8A 4O57A 1R47A 3W7NA 2B7PA 2CW6A 3NPWA 1FXPA 3BG9A 3EX3A 3DBPA 3VE9A 1R2TA 1GVQA 3QSRA 5F1VA 1SO6A 5FESA 2QKFA 3FA5A 3INPA 3DHDA 3C2VA 3UWVA 2VFFA 1EWEA 3FJ6A 1XUZA 1TRDA 3A5FA 3OBKA 1JCMP 2Z6IA 1SW3A 3Q58A 2Z1BA 4MLRA 2JK2A 1H1ZA 3VE7A 2WSRA 1H60A 3GLCA 5F2IA 4YCPA 3M16A 1ME9A 4JIQA 5AOUA 3L5LA 4JTIA 2CLKA 3W9ZA 3HB9A 3UD6A 3PBVA 1FWNA 3NM1A 2VFGA 3DFQA 3HO8A 5G5IA 2XN2A 5FF4A 5K9DA 1XL9A 5LZLA 3S1WA 3UZJA 1YXYA 1J2WA 1KLZA 4PH6A 4N4QA 2P1FA 1ICPA 1ZJIA 1JJKA 3PAJA 1EA0A 1S3HA 2Y85A 2VFHA 4QISA 3BGJA 1DV7A 2C19A 1HTIA 1W56A 4GUJA 2A7RA 1H7XA 4QITA 1KTNA 3RLVA 5BOOA 2Y62A 3UY7A 5J5RA 1OFQA 4PCFA 4POCA 1KW1A 4C1LA 5DBTA 3TW6A 5CGQA 2DP3A 2QAPA 4XKYA 5KTLA 2BX7A 1XDMA 1DQWA 4AVFA 4AEOA 2ABAA 4LRTA 4O28A 1UJPA 3ZWSA 2RDTA 4JTEA 1JCNA 5AN7A 2V81A 1Z41A 2E6FA 1DQXA 4PTNA 1TQXA 3W7JA 4RZ5A 3N73A 2QCGA 2R8WA 3P5YA 3WK0A 1YDNA 4AWSA 3UNDA 2X16A 1J5TA 3CIXA 3S5OA 3N2MA 4NT0A 5DXYA 1SQ7A 4NNCA 3WJZA 1LYXA 4MZ1A 5D02A 3TX9A 1W5OA 2WKJA 1UUMA 1JVNA 3RMJA 1LCOA 3TU9A 1FX6A 5EPDA 3UZ5A 1SZEA 2Q8LA 2WPBA 4ONVA 4IMFA 4MYAA 4NJHA 1OK4A 2NUWA 4UMAA 4LVBA 3WK1A 1JQXA 5H2ZA 4R7JA 3LHYA 4LW7A 2NWRA 1VCVA 2GJNA 3NM3A 1TTJA 3MUXA 4IMEA 1LOQA 3DKJA 3DKLA 1FXQA 3LCXA 1IXNA 3NL5A 4JYEA 3TFCA 1I2RA 2CZ5A 3DFTA 3SFKA 3A23A 3EX2A 4IMGA 4O11A 1KBIA 1LROA 5K4ZA 1LBFA 3DFPA 4B5NA 1YTEA 3L66A 3PG9A 1TPDA 2VC6A 2A5HA 3B0UX 1VHCA 1QOPA 3EXSA 1J4EA 5BNKA 1UBSA 4A2RA 4AAJA 2JKEA 2CU0A 1P1XA 5DCBA 3FYPA 3E02A 3LXAA 4L4LA 1KLYA 2J9YA 5G2HA 3QMRA 1IXPA 1H62A 2FB3A 1SSDA 1Z44A 3NQAA 3D0CA 3LTYA 4MZYA 2E5BA 3C4UA 4OQVA 3QH2A 3FLUA 5AYZA 4R33A 3WK3A 1M7OA 1VLIA 4FX8A 4LT9A 2VFDA 2VEMA 4MY8A 5DLCA 4MFDA 3UWZA 4LUJA 4NUWA 2YSWA 1TB3A 2E1DA 3NDOA 1G4PA 3G24A 4LWWA 4KWVA 4QQ3A 5LNWA 3MMTA 1KV8A 3FKKA 3H55A 4NJJA 4O18A 4S2BA 3NQGA 1GEQA 4FO4A 1KBJA 5BRBA 3LI1A 1HUVA 1W0MA 5AC6A 1EUAA 1ZCOA 2YGYA 2QDHA 2CLFA 1F74A 1OFRA 4G1KA 3I7SA 2GQ9A 2Q3OA 2FQIA 2FTPA 1TREA 6ALDA 3KVLA 3GXPA 5EYWA 1L6WA 1AMKA 3P61A 4CLMA 2FIQA 1WYIA 1EEPA 3ELFA 2E09A 2F7FA 5HUPA 4WY0B 1A5CA 1VYPX 4CCCA 4L4MA 1DOSA 2R91A 1W5NA 3L67A 2TSYA 4Q32A 4Y6GA 1RD5A 1H7OA 2C1HA 1TMHA 3PC0A 2Y7FA 4ALDA 4NZFA 5EA9A 1VYRA 1IF2A 3S6DA 4OE7A 3V1PA 4KKXA 3EEGA 1B3OA 2RDUA 3FS2A 4RR4A 1ZENA 4X22A 1MO0A 4JNMA 1YXDA 4YMZA 3R2GA 2WNNA 4XBKA 2A4AA 3G22A 2CZFA 3OVRA 4M6PA 4DELA 5DN1A 2QCDA 1K02A 3M5XA 4C1KA 3BK0A 1ZALA 4YCOA 3GR7A 2Y70A 3W87A 2EKCA 4UTLA 3L65A 3C2FA 3KAOA 3S42A 2ZRWA 5AYXA 3MJYA 1JCXA 2AQWA 3NQEA 4JY9A 2C15A 3E49A 1I8JA 2JGQA 4HNNA 3MYPA 3E9AA 1NAL1 2YW4A 4BR1A 3LM7A 3W7MA 1KFJA 4LS0A 2O7SA 1XBYA 3W2LA 3NZRA 3G1HA 3QQ1A 3S0CA 4NNBA 3GKFA 2ISVA 3RFAA 1D3HA 3NQVA 5TBOA 2WOQA 1SW0A 2EGZA 1LBMA 2R94A 2BSLA 4O8RA 2DZUA 3W3OA 1I45A 1K8ZA 1MEIA 3MWAA 3W1XA 4JTTA 3FOKA 3TQ0A 3QW3A 2IQTA 3LBMA 3KRZA 3THAA 1TPH1 4K8EA 3LDVA 1WV2A 4JTHA 1NSJA 4DO6A 2FFCA 3VNDA 3W7PA 5K9XA 1Q45A 4YL2A 1QO2A 4OGZA 1RQBA 4MYXA 2NUYA 4HN4A 4UUIA 4PODA 3TNOA 1FWWA 3N2XA 4IMDA 5G4EA 3G3MA 5HMSA 5DCDA 1KTBA 1VR6A 2OZ0A 3NVTA 1KM2A 1SFLA 2X1TA 3TE9A 1FCUA 4IPJA 1QNVA 1ICSA 2Y7EA 4QSHA 5CPOA 3IGSA 3TIMA 4WOZA 3LCIA 1JCJA 3W70A 1O5KA 2WV8A 1XI3A 4Z0JA 4OV4A 2X2GA 3C61A 3MO7A 2FB2A 3GIYA 2C0AA 4KFNA 1OX5A 3GX9A 2W6RA 1YDOA 3TH6A 1CW2A 3HGOA 1W5PA 1NVMA 3S5YA 2DJLA 4GBUA 3SGZA 5D2XA 1MXSA 1TTPA 4ORMA 4K38A 1XC4A 4Q4KA 1TPC1 2BXVA 3PULA 4IOTA 4UTHA 1JR1A 2Y63A 1H1YA 1KFEA 5HWMA 3BLEA 1T99A 2DZXA 1IXQA 2BWGA 2YFOA 3LHZA 1R30A 2V5LA 3IVTA 2TPSA 1JUEA 4NX0A 3DI0A 1KM4A 1T0OA 5EY5A 3G1SA 4LUIA 2WO5A 1XBZA 3MBDA 2V0TA 2YZRA 4RX0A 2B4GA 3SW6A 3O05A 1Q6OA 2V5BA 4UMBA 3SECA 1U83A 5C54A 3Q2DA 4IJBA 5KZEA 2G97A 3S5NA 4AB4A 3SI9A 1QR7A 5KSWA 2ZZ2A 5DXXA 2V82A 1H51A 1PVNA 3ATYA 3BG3A 2CLOA 4JTGA 4DQWA 5CSSA 3W1QA 3S1XA 4AHPA 2I14A 4MIMA 5C6MA 1F6PA 1TO3A 1GPWA 3LLDA 3QRHA 4K36A 1WOBA 4XTDA 4TIMA 3KVMA 4RJEA 1AL8A 1JULA 2H8ZA 1PHQA 4O16A 3GAKA 5E1QA 2I9EA 2P0OA 1L6SA 1AK5A 3P8JA 4UFIA 3LCLA 3GNDA 3LI0A 2A6LA 3HGRA 3DFOA 3TSBA 3N14A 2C13A 4Z1AA 4O1CA 1VH7A 3STFA 5DELA 1IIHA 1OFPA 4IX2A 1X6UA 3MI3A 4FNRA 1P0KA 1VS1A 3CLMA 4RXFA 1Q6LA 1O95A 3C56A 4QIUA 5FEPA 3WJXA 4A2SA 3H54A 2JKAA 4UTWC 1TPB1 1X1OA 1X8FA 3F4WA 4KWWA 1NFBA 5J5DA 3M44A 2B0MA 2PURA 1I2QA 3C2OA 4MY9A 2R14A 5TQLA 1QWGA 1WX0A 3NQDA 5D09A 3EKLA 3O15A 1ZHAA 3TSDA 4O53A 2ZTKA 2AAMA 3RU6A 4AF0B 3IRDA 2A2IA 5A8GA 2NWSA 4PL2A 5EBUA 1PE1A 3M43A 3M7WA 3NL3A 2DZSA 4E38A 3BPWA 2QCDB 3DH7A 1ZY9A 2WSQA 3CM4A 3P62A 2ALDA 1RQHA 3W23A 4X9SA 3LERA 4AWUA 1TJPA 3TROA 3A5VA 4O4WA 3RNDA 1WOAA 3O16A 3B04A 3DHFA 5U7SA 3IVSA 2YX0A 2FPTA 3NPUA 4WQ6A 1GOXA 1VZWA 1YLVA 5LHEA 2Q8ZA 4XBSA 3UWYA 4MUZA 2Y7DA 2G5WA 4MOZA 3T7VA 1Q6RA 3O1NA 4DXVA 3N9SA 4O15A 2J9ZA 1YXCA 1LP6A 5K9CA 2ZZ6A 3HGJA 2C3ZA 1Q3NA 2I1OA 1LRNA 3ANYA 4IGHA 1KM5A 4JTSA 2JGYA 1K3UA 2CLIA 3EXRA 3A21A 1TPEA 5HJLA 3M47A 1W37A 1MSSA 3BW2A 3PBUA 3PSVA 3MP4A 3R12A 5CPMA 2GVLA 1K7FA 4NJGA 3DU0A 4E2DA 3W7LA 5ABTA 1OFDA 5HNRA 3CQ0A 4JYDA 2ZZ7A 4HHPA 3G0UA 3QM3A 5CZTA 4UTMA 3CC1A 1G7VA 1B57A 2OT0A 4OBTA 3O8AA 4R34A 2E68A 1TV7A 3G8RA 5AB3A 4UR8A 2YFNA 3NL6A 2H3DA 2DZVA 2NXIA 5LHFA 1OABA 3PY2A 3TJXA 1OJXA 2E5CA 4XWUA 3OEXA 2PRMA 5I3HA 3RLUA 2BLEA 1OF8A 1O4UA 2PC4A 3B03A 4DF0A 5I3JA 4P2VA 3HQ1A 3QFEA 2HTMA 4JTUA 5CZJA 4FIQA 1FY6A 1R46A 3STCA 4UNKA 1ME7A 2FPVA 1EX5A 5AHFA 4FHAA 3TDFA 1WBJA 4O1BA 3N34A 8TIMA 2ZZ5A 4ZQPA 4LRSA 4K39A 3R8RA 4O50A 3BARA 1DJQA 3P60A 4ZVJA 3MBFA 1TTIA 2QUUA 3PUOA 1C9DA 2Z0IA 2WSYA 4MJZA 1SW7A 3N9RA 3G1AA 5G1YA 2FLIA 3FJLA 2QJIA 4WXYA 3W86A 3MI2A 5D2TA 2C14A 1DORA 3DI1A 1T96A 3PBWA 3N3MA 4QNEA 5DY3A 5A5WA 3B0PA 3UWWA 2OT1A 4TU1A 4RK8A 2O7QA 1OX4B 2FDSA 1L2UA 4I7VA 1H7WA 3BLIA 3M5YA 2QCNA 2V2HA 4UTTA 2QCEA 2ZDRA 3MW7A 3W84A 5GVJA 2FPYA 2NLIA 3NXFA 3CHVA 3CB8A 3PVFA 3SJ3A 1QOQA 1OFAA 1EB3A 1UUOA 3PG8A 3EWZA 4BFAA 5F4XA 3GK0A 1W5QA 4K37A 2E6YA 4U28A 2X1SA 2ABBA 4OV9A 1M6JA 3LCFA 4JY8A 3R5EA 3G0SA 2J27A 1CI1A 2A1YA 1M7PA 3ABSA 2GUUA 3PBYA 4LV9A 3SGUA 3M9YA 4A3UA 1GTHA 4AHOA 1XBVA 3G0XA 3TC7A 3MHGA 1XFBA 3LCWA 4LNYA 2RFGA 1QPNA 3W88A 4M7SA 3CU2A 4E2BA 2NZLA 3W7HA 3W2UA 2NXHA 1YADA 4Z0SA 5HUOA 3NR0A 5D38A 1TQJA 1OVDA 4ADSA 3VKJA 1N55A 3KVJA 3BV4A 3PUDA 1I2PA 3NQ2A 2VOMA 2VXNA 4LC8A 4KFPA 4MLJA 1TTQA 2Y6ZA 3EB2A 3TCEA 3PR2A 4I7WA 5I3FA 1RV8A 4NZJA 3E12A 5KZMA 1H63A 4LVAA 4JTJA 4UMCA 4I7UA 3G3DA 4NVTA 1H7RA 3HJZA 3JS3A 1VC4A 5I3GA 2GVGA 4Y9AA 1SO5A 1GVRA 4QAIA 4AF0A 4LC6A 1XCFA 1FBAA 1F7BA 4RXGA 2ZA1A 3HPXA 3LX9A 3TAOA 4HPJA 2V2DA 4K7VA 3KHJA 2H6RA 3NL2A 1XM3A 1LOLA 4GUGA 1JUKA 4LVGA 4LS2A 5C55A 1KM1A 4WOQA 4XZ9A 4N6EA 3ATZA 3C52A 3IGUA 3A24A 4BI7A 2UV8G 4UFLA 5AHIA 5LKYA 4IQLA 1PCWA 4IX0A 2CFFA 3ZR4A 3SIZA 4O19A 1F5ZA 1KM6A 2QJGA 4JDBA 4WX2A 3W85A 3L9CA 2NUXA 3EWXA 3QYQA 3Q37A 1BWKA 4N9DA 4IWWA 1FQ0A 2Y61A 4Z08A 3KVKA 3IIVA 2DZPA 2DJXA 1TPVA 1LLWA 3M41A 3W7DA 1MEHA 3RF9A 3EWUA 3NGJA 1KTCA 3L21A 3P81A 4LVFA 1TJRA 4J9JA 3EX1A 3QZEA 4HKPA 1W1ZA 3GB6A 3BVJA 1KV5A 3HPZA 2E6AA 1PCKA 3M5VA 4W9TA 1K03A 3UWUA 3LRLA 4Q33A 3TSMA 1I4NA 2ZRXA 3OVPA 3TJLA 3W2JA 3CEPA 4CNNA 1TSIA 1VJIA 1QFEA 5K4XA 4A22A 3GDTA 1OFBA 3C2EA 4LU0A 4DF2A 1R2RA 4HNVA 3PUEA 3G1FA 4N2YA 3P67A 3A9IA 3S9YA 4MJMA 3AJXA 2QCHA 3VFLA 3R13A 1IXOA 4NJKA 4UNLA 1RZMA 2X1RA 1FCQA 2CWNA 3LV6A 3LBCA 4JDYA 3JR2A 1PS9A 2QUTA 3DXIA 5CPNA 3QMSA 1EP2A 4JN6A 4JX6A 3TXVA 2TRSA 4H6KA 1C29A 3TAKA 4CCEA 3O07A 2ZRVA 5CPLA 5EMUA 4O1DA 4AHQA 3W7OA 1I2OA 5F4WA 2G95A 1H7PA 5F2LA 1JCLA 3IIOA 3B05A 4PFMA 2Y7GA 4JYFA 4I9AA 4OHQA 4FXRA 4UTJA 3SR7A 4O0ZA 4CQ9A 3W7QA 1QO5A 1KM0A 4ZL1A 1H7NA 3USBA 1W8SA 3IIZA 1OYBA 3VI2A 5LNVA 4UFKA 1VLWA 1PHWA 4R53A 4NNAA 4FX7A 3NG3A 5BMWA 5DCEA 2A7NA 5KMYA 2QF7A 1V5XA 4UCGA 2GQ8A 4U4MA 3UWQA 1P4CA 3T4CA 1N8FA 2NV2A 3OG3A 4S2CA 5HR6A 4WUIA 4OT7A 5HULA 4WJEA 1U5JA 1WAUA 2ZRYA 3O6YX 3ZS4A 3WFAA 1SFJA 4JX5A 3C0JA 3PF3A 3TXZA 1KFLA 3G1VA 1EP3A 2QCMA 3DFNA 4HT3A 1B9BA 1BEUA 3PB0A 1ZFJA 3IIPA 3E0IA 3U6WA 3CTLA 1KFBA 1G4TA 3L0GA 1A53A 3G8EA 3GDLA 3EWWA 2YYTA 1UB3A 1BTMA 1S5TA 4LOCA 5F2GA 1SZFA 1GT8A 3I6RA 3P8IA 5FEZA 4FEZA 3LHUA 1QAPA 4FNQA 2GQAA 4YXGA 1LRQA 1R2SA 1GTEA 4E0CA 4CQ8A 1W5MA 2KZHA 2ZZ3A 2XFWA 4MY1A 4P61A 1K8YA 1KFCA 3DGRA 2J88A 3W7IA 2VENA 3CWOX 1DKWA 5G2IA 3TW7A 1ZAIA 3GXTA 3I68A 2BZNA 1GG1A 2X1UA 1YPIA 5D37A 3MYOA 1F2JA 1A50A 3NYZA 2CZEA 1ML1A 2JBMA 3KXQA 1Q6QA 4DO4A 1B4EA 4WZHA 2V30A 4Z1BA 2HMCA 1OG0A 3TC6A 3QEZA 2OJPA 2E6DA 1SO4A 3ZFHA 1MZHA 3W71A 3QF0A 1NEYA 3GR8A 3W1AA 3QSTA 3W22A 2OX1A 4O52A 1GVFA 3W6YA 2LLEA 1EUNA 2ISSA 4FXSA 4S1FA 1DJNA 5E93A 1XBXA 3ABRA 3F4NA 1GG0A 3GDRA 1OFEA 4FNSA 1ONRA 3LCHA 2WJZA 2ZZ1A 6TIMA 2CZDA 2TMDA 3QC3A 2YR1A 5U4NA 1KM3A 5HQEA 2D73A 5K3VA 2PE4A 1LLZA 4JXCA 4O12A 1YPFA 1FWSA 1A5BA 1C8VA 1QDSA 1Z42A 2GPTA 1EPXA 3R89A 3IEBA 3W2KA 1TPUA 4WY0F 1GZGA 3WJWA 3GVGA 3NQ7A 4H4IA 3LXBA 5AFDA 1JRBA 5MHBA 3I65A 3MP5A 2PRHA 5D2WA 3KX6A 4DF1A 5LGZA 5AHEA 2NXGA 4MVAA 1RR2A 3NOEA 3C2RA 3HF3A 1O60A 3C8FA 4HNTA 2TYSA 1W54A 1TIMA 3EX4A 1VCFA 3L68A 5KINA 4BK9A 1GYNA 2ZZ4A 4XQ6A 3L5AA 1VPXA 2YYUA 3EWYA 1LRTA 3OHIA 3M6YA 1TPWA 2ZQ0A 4TX9A 4RLIA 3I7QA 4CNOA 1UCWA 3HPSA 2ZCGA 1B4KA 2NX3A 3NQFA 4LS1A 2HSAA 4NU7A 4O13A 2QJHA 4AH7A 5CSRA 3IV3A 4CNPA 4GWEA 1D3GA 1H61A 1H5YA 3U8GA 3P82A 4PA8A 4JD4A 1OYCA 1AG1O 3W7CA 3H53A 4BWLC 4K6AA 1LORA 4AMAA 3CIWA 4FX6M 5AHLA 4ZQCA 3G1DA 1W3NA 3N19B 1DHPA 3LGEA 3E96A 4X3ZA 4RV8A 2VKZG 5G4WA 3NO5A 5G1TA 2FJKA 1G69A 5HINA 3C3NA 4RCXA 2Z6JA 3B8DA 3TQKA 3ABQA 3MHUA 3B0VC 1CX9A 1LDCA 3SY5A 2NX9A 4JS3A 3NZ1A 3PM6A 1LOSA 3BGGA 3CEUA 3W7KA 2W0UA 2CLMA 1DL3A 2QR6A 3HBLA 1VHNA 4ORIA 5L9FA 2ZRUA 3STEA 4EVZA 3NA8A 1FDZA 1FUYA 3VCRA 5EKYA 2QEZA 3SZ8A 3AO0A 3F03K 4GJ1A 3TUUA 1EIXA 1KA9F 1TCDA 4LVDA 4UTWA 5C5YA 3NPXA 4IMCA 2H3BA 3LV5A 1F73A 3KOFA 4NX5A 2YDAA 1SUXA 4D2JA 4IUOA 2PRLA 2ZFAA 1E51A 1MEWA 3W7EA 2RDWA 3KRSA 4ZQMA 2GVJA 3C6CA 3TKFA 1A5SA 3FIGA 1FDJA 2QDGA 3HOJA 4H3DA 3DAQA 3K30A 1NF0A 1ME8A 4UTIA 3W73A 4EWND 3PSWA 2CLEA 5IBXC 3W2NA 4M7TA 4FF7A 3S8HA 3GAYA 2P10A 1YTDA 2Y88A 3QMTA 2DU2A 4FNUA 1BWLA 1OHLA 1V7YA 2YPIA 3PB2A 3UXAA 2JKPA 1W31A 5D2YA 4JICA 2HS8A 2WNZA 2QAFA 5F1UA 1L6YA 1Z48A 3NQCA 1OYAA 3ABOA 5K2ZA 5I3IA 5F2MA 3W1UA 4NXKA 3TA6A 3LTPA 2YXGA 3NQ6A 4TR9A 4O17A 1HL2A 4X2RA 4JGDA 1D9EA 3HIJA 4NQ1A 1A5AA 4RZ6A 3GXNA 2XN1A 3DFSA 4GUHA 1FDYA 4TO8A 3T44A 1S5VA 1HO4A 1LM1A 2YCEA 4JR5A 1OK6A 3CPRA 3W1TA 1OX4A 3P84A 4OWGA 2C18A 2VEIA 1LBLA 3LTSA 4MPQA 3P5ZA 3UY8A 1PV8A 4M6QA 2VFEA 4N6FA 1I2NA 3QQ0A 3BLFA 3W75A 4ICNA 5AC8A 3Q94A 3L2IA 4IPIA 4QM1A 5CKSA 4MFEA 1TV5A 1RVGA 2Q3RA 1ICQA 1JCYA 2ZA2A 3TFXA 3KRUA 3G1YA 5D04C 4XUGA 1TV8A 3W1MA 5HR7A 4KFOA 4NXSA 5T26A 2A85A 2V8ZA 1HG3A 4O14A 1WDWA 2YW3A 1GVSA 4JX4A 4ZQOA 5SWUA 5LGXA 2PCQA 3TMLA 4BF9A 1GJPA 2AGKA 2QUVA 5F4SA 4N02A 2B7NA 1FWTA 3BG5A 2VEPA 4JTLA 2QCFA 2CLLA 1AL7A 1Y0EA 2Z2UA 4FIRA 2ZYFA 1ADOA 1SU5A 4GFSA 3LLFA 3P80A 2V9DA 3FEMA 1XKYA 3TK7A 3O63A 5EL1A 2W79A 3IGXA 3P74A 4JTFA 2EHHA 4A29A 3L0KA 3L5MA 4PEKA 2B7OA 4GE8A 4PL1A 4WD0A 1EWDA 3G1XA 4BI5A 3NAVA 1GQNA 5IBXA 4DBEA 3F1QA 2BTMA 5AHMA 1YYAA 1M5WA 3TQVA 3TV8A 3YPIA 1X7FA 4TMBA 5D2VA 1VYSX 1TYGA 1LZOA 4AWTA 1WQ5A 1VQTA 5D03A 3O06A 1KFKA 2E77A 3QPYA 3W1RA 4NJIA 3FYOA 1O94A 1SSGA 1SO3A 1O5XA 2GOUA 1QCWA 4UC5A 4Z1CA 2EAWA 1G67A 4A21A 1X1ZA 4UIOA 4JTKA 3GKAA 5G2WA 5FF3A 3NQ8A 1SR9A 2B7QA 2G96A 1PIIA 2OMAA 3IVUA 3HGSA 1FWRA 4RZ4A 5D05A 4O0KA 1P0NA 3HG5A 3IIXA 2VELA 4ADUA 4K8HA 4OU1A 7TIMA 3T55A 2J6XA 1F6KA 2DORA 3M1ZA 1G6CA 3SSJA 4N9BA 3TMQA 4Y90A 1G7UA 2A0NA 5BMXA 3OA3A 3G18A 1JRCA 3LB0A 4UR7A 2C16A 1HO1A 5KITA 3HG4A 3LRMA 4CQAA 4FNPA 2A7PA 5DY2A 4Y96A 4TMCA 3W2MA 3UPBA 3THQA 1QMLA 2F84A 2J9XA 2ATMA 5I3KA 3GDMA 3S5ZA 4DO5A 1OX6A 3WJYA 5D30A 4DPPA 4YWIA 4ZMGA 1IGSA 1ZAHA 1S5WA 2NV1A 5FI8A 1K8XA 2A21A 2DZTA 3CWNA 3KFTA 3T78A 5AHNA 4DPQA 1K7EA 4GC4A 3W1NA 2E5DA 4ADTA 3UPWA 4Y8FA 3DZ1A 5AC7A 3LOTA 3UXDA 5KZDA 3OVQA 3WK2A 4GXMA 4MKNA 4GNJA 1T8XA 1WXJA 1TRIA 3GZ3A 3B4UA 4K7YA 1GYLA 1SPQA 2QCCA 3W7RA 4HNUA 3GNNA 1SZNA 4AXKA 2V2CA 1P5BA 2EPHA 3MP3A 4CCDA 5CG7A 3NQMA 2X30A 3QJAA 1N7KA 4M6VA 1XUUA 1XDLA 2VFIA 1SZGA 4M19A 3W1PA 1YTKA 3O6CA 3I7RA 3TR2A 2ATSA 3S1UA 4ML9A 4BI6A 1AW5A 2RKXA 4MZ8A 3EXTA 4ZQRA 3MHFA 3B06A 1JQVA 1FCBA 1YDVA 5HWNA 3LXCA 4N9CA 1QPOA 4XKYB 3HMJG 4LY8A 5LNSA 2VEKA 2A6NA 1DVJA 4UFHA 3WJSA 5IM51 4UXDA 5E0KA 4ZQNA 1G4SA 3HG3A 3M0ZA 2H90A 4M5PA 4RKAA 3W1LA 1HFBA 1F05A 1IIGA 4BWLA 5DBUA 1K7XA 4HPXA 4EF9A 3JRKA 2ZBTA 1ZAJA 2RH9A 4Z1DA 5LSMA 5CZSA 3PS7A 5HWJA 4UFJA 3UQNA 2XN0A 3EX6A 3UYCA 3W72A
chains in the Genus database with same CATH superfamily
3UG4A 2QCLA 4AYGA 2AGTA 1E3ZA 4O4VA 1ALDA 4HYRA 4FNTA 4O1AA 3EWBX 3KL3A 1GW9A 1H50A 2RHGA 2WHLA 2XVGA 3BW4A 1B5TA 1QPQA 4B5TA 2NQZA 4UFMA 1WP6A 3T05A 4LXFA 1W6TA 3GYEA 1BKSA 5D33A 1J79A 1O1HA 2ZE3A 1XLFA 1A47A 4J3XA 2AMGA 4WSJA 5JUVA 1Q85A 1WZAA 2ZXDA 4QJ1A 1NF7A 3EKZA 3ES8A 3VABA 3N29A 3VM5A 5FF0A 5D32A 4J3TA 1EF3A 5H91A 3T40A 5JBDA 4O10A 1E9YB 4RV3A 4WDXA 1FH7A 4KS0A 1TZ9A 1W3IA 1WDSA 4EF8A 1VRDA 4Q3MA 4HSNA 5DRCA 3GTFA 4IXHA 3W83A 5TIMA 4DEFA 1MW0A 3MUIA 2Z7GA 2EJ1A 2EF9A 1R9YA 3ONBA 1IR1A 2H8XA 4LTSA 2OX4A 3LY0A 3VOJA 3FKRA 4I5XA 2ZTJA 4L6HA 4Q8TA 1UKSA 4LV4A 4YJ5A 2ZUVA 1J96A 3WQVA 5FEXA 1JD7A 1ODZA 4CUCA 3OPSA 2WMIB 5CG0A 3STGA 1THFD 3LHVA 3RK8A 3BSMA 2XJ7A 2ASHA 3NPWA 4C6JA 1UWIA 4W93A 4HZ8A 3NDYA 3ZOAA 3VAVA 1EZ2A 4JFVA 3VIKA 1W9DM 3II1A 4Q8PA 3DHDA 3C2VA 1W1TA 1TRDA 5D9MA 2QPXA 4DLMA 3C5QA 4NYYA 3VMPA 3VE7A 1ZBWA 4GCXA 4CEUC 1E5JA 4Q7BA 4YCPA 2ACQA 2XHYA 3M0IA 4WJ8A 5AOUA 4ZEPA 4GYKA 2QVHA 2O4MA 1WXZA 2VFGA 3DFQA 3QBUA 5FF4A 1RJQA 1XL9A 1AZ2A 1J2WA 1KLZA 4CQCA 4PH6A 3RR1A 4IJRA 3V18A 4W85A 4N4QA 1V77A 3MJMA 2O92A 3QHMA 2VFHA 4GQBA 3WMLA 2CKSA 2WM1A 1POKA 3SUWA 2C19A 1HTIA 1W56A 3URAA 3RYSA 4GZJA 4D8LA 2FGZA 2E8ZA 1BAGA 1KW1A 4C1LA 1WO2A 4IZGA 1V03A 2QAPA 2BX7A 1HNYA 2P0IA 1XDMA 4AEOA 3EMCA 4ZXOA 2V3EA 1C8QA 2OEKA 4LBSA 4ZB0A 1R8LA 5AN7A 4D8AA 3U2ZA 2V81A 2GGIA 1Z41A 2E6FA 1DQXA 4ZB2A 3N73A 3QY6A 1EJUC 5FJRA 1XRTA 4AWSA 3UNDA 5I00A 4NNCA 3WJZA 1TV4A 4O1FA 1AD1A 1M7JA 3TX9A 1YQ2A 5FJUA 4BQ5A 4DJDD 1HVQA 3VX0A 3H2EA 4IFKA 2WPBA 1CXEA 1QXLA 1Z6KA 1VAHA 2WC7A 5DQPA 5E5CA 3UXLA 3VIJA 3MMWA 3URQA 3M07A 3DHPA 4M81A 4HHHA 1QW7A 2E4TA 1RD6A 1UA7A 5GNZA 1VCVA 2GJNA 3DN5A 3FX4A 3DKLA 1T41A 5C9UA 3CJPA 4JYEA 2CZ5A 4BF7A 1QI4A 3DFTA 2WKGA 4IMGA 1KBIA 2YA2A 3DFPA 4NG3A 2VC6A 3B0UX 3FA3A 4XD3A 1UBSA 4A2RA 3GUWA 2WBGA 4G5DA 4P8UA 2PGRA 1X96A 2QJNA 4TV5A 2PP3A 4OIFA 2J9YA 2NQ9A 3QMRA 1H62A 4AW7A 3B3DA 2JE8A 1SSDA 3D0CA 1QHPA 1UZDA 1GJWA 1R3SA 3C4UA 4B3ZA 2PWDA 3WK3A 1M7OA 2VGIA 3VGBA 3NURA 1VLIA 4FX8A 4LT9A 2VEMA 5DLCA 2QYGA 1XD1A 4QE1A 2YSWA 2E1DA 3NO3A 1SFSA 3WZ0E 1QU4A 3GHUA 3SUUA 4QQ3A 1IT0A 4S2BA 1B31A 5BRBA 2DPEA 3LI1A 1EUAA 5CAHA 2QDHA 2CLFA 3ZSSA 1F74A 2YCIX 2Q3OA 3WEOA 3OJGA 4UZSA 6ALDA 3KTCA 1L6WA 3P61A 2FIQA 3F4DA 2E09A 3KUMA 2VWSA 1VJZA 3GG8A 1A49A 2XSXA 3QOKA 1VYPX 3A4WA 4CCCA 4KRTA 3NGFA 5LA0A 1W5NA 3L67A 4Q32A 1ITQA 3LNMA 4J28A 4NZFA 3MANA 8XIAA 4L6OA 4IGSA 3QR3A 3I10A 3S6DA 2D3LA 4KKXA 4Q8VA 3FS2A 1ZENA 4X22A 3WDHA 3JZUA 4JNMA 1CPUA 4DY1A 2ZUNA 2G37A 2NW0A 4Q4SA 4DJFA 1K02A 3M5XA 5JQ9A 4PEEA 3BK0A 4W5UA 1PUDA 2Y70A 2Z7KA 4JTRA 3W87A 2EKCA 5BOFA 1TELA 4HK6A 2ZRWA 2VL4A 3MJYA 1V6WA 1JCXA 2AQWA 3UGVA 3BL3A 1I8JA 4O8AA 1YX1A 3E9AA 1DIDA 1NAL1 2YW4A 2CIPA 3LM7A 3W7MA 3H8AA 2WMGA 2C7FA 3GHSA 3SCUA 3TNBA 3KCJA 3NQVA 5TBOA 1X97A 5A6LA 1W9BM 1XYBA 1ZBKA 1I45A 4PTMA 3DGBA 1P0EA 3OQ8A 4PE8A 3UR7A 2OOGA 1TPH1 2GL5A 4D6EA 1WV2A 2FH8A 5FJTA 4DO6A 3U5YA 4D6IA 5GJPA 4N42A 3VNDA 5K9XA 3OP2A 4OGZA 3LD5A 4PODA 3WDPP 4IMDA 2VM8A 4HGXA 3FVMA 3GUGA 5BZAA 2D0FA 2FTYA 1KTBA 2ZX9A 4WVXA 2XZ9A 2VC9A 4X2PA 3VO0A 3O3RA 2X1TA 1A5OC 3WF2A 1WDQA 3IGSA 1YW1A 4J4KA 1EX1A 3ITOA 1JCJA 3LCIA 1JYNA 1GOQA 3W70A 4OV4A 4KIRA 2X2GA 3MO7A 3U2EA 3NIYA 2FB2A 4YVVA 3ZVHA 2VC5A 2GSEA 2RGLA 5H1WA 2V6AA 2PUZA 3GX9A 1EC7A 1NVMA 3OU8A 4V2XA 4GBUA 4ACYA 4DHGA 4REQB 3WD4A 1ZSXA 1XC4A 3VIMA 2GUYA 5DEZA 1KFEA 2DZXA 1DIKA 2BWGA 3D46A 3LHZA 2QULA 1R30A 4MJ4A 3IVTA 1JUEA 3DI0A 5H6HA 1KM4A 2W66A 2WVTA 3WQ6A 3FGCA 3MBDA 2V0TA 4RX0A 4GIAA 2EEXA 3O05A 3VFCA 3SECA 2ZC8A 1IWAA 3PNZA 4IIDA 2G97A 5CGTA 1QR7A 1VBJA 4FS9A 2A3LA 5LIWX 2QT3A 3HA1A 2PF8A 2F38A 1BKHA 2W4XA 3WNPA 3VILA 1US2A 5FJJA 3HJEA 3W1QA 4KIEA 7XIMA 4BHYA 3SO7A 2OR2A 1TO3A 3AHYA 1GPWA 2PP0A 3LLDA 4MTVA 4RJEA 1AL8A 2OXNA 4HK7A 1JULA 4MNKA 3UA3A 1PHQA 3GAKA 3IJ7A 2I9EA 1L6SA 3P8JA 2XGIA 1DWGM 4UFIA 3QOMA 5M17A 1W1YA 1FTXA 3K8MA 1F8MA 3DFOA 1H2JA 2C13A 4PMJA 1VEOA 1VH7A 3VDBA 1XYCA 5DELA 1CXFA 1IIHA 1CGXA 1OFPA 2PD9A 4F0LA 1E56A 3H54A 1JZ8A 5HAOA 1EL3A 4QS5A 2TAAA 2GJXB 5J5DA 2B0MA 2JIWA 2R14A 4AD2A 5D09A 3EKLA 1ZHAA 3B9EA 2J7DA 2VMFA 3VIHA 4JL1A 1H1NA 1AQ0A 1Q65A 1V6VA 4AU0A 2P8BA 2NWSA 2D20A 3M43A 2XVLA 3NL3A 4ZB5A 1R3YA 5FL0A 3BPWA 4GQ0A 3P62A 3QTPA 2YCLA 4DUWA 3A5VA 4U2ZA 1WOAA 3BMXA 3NPUA 3U7BA 3R8HA 3CYJA 1UROA 2GDQA 2QQ6A 3TN3A 5E9XA 1E0UA 2GSHA 4R5EA 3V4BA 1XH2A 5K9CA 3R0KA 1P6CA 1QI2A 3CHCA 2VOTA 3WLSA 4IGHA 1ONXA 4JTCA 2ZDSA 3UG5A 3B40A 4UQCA 3KBNA 1UR8A 3NEHA 1MSSA 3OYZA 2GVLA 3SCOA 3VC6A 1K7FA 3UJRA 3W7LA 2MANA 2WVSA 4OVXA 4RW5A 2UZ9A 3CQ0A 2ZZ7A 4JYDA 2XGZA 3MO4A 1JIBA 2PDJA 4B4FA 2WWCA 5CZTA 1EJVC 2YL5A 4UTMA 3CC1A 4OBTA 3O8AA 1OZMA 1A5LC 3G8RA 4CVWA 2YFNA 2QIWA 2H3DA 2NXIA 5LHFA 3TJXA 2NLYA 2OWCA 5CC6A 3V3WA 3AUOA 2BLEA 2YCJA 3E2SA 3MKKA 2YZ5A 1XIEA 2INZA 4JTUA 5CZJA 3STCA 2FPVA 3B9OA 3H2OA 4FHAA 3TDFA 1WBJA 3MUY1 1LQ2A 1JDCA 4RE4A 4U5IA 2WNWA 3ORWA 1J93A 1RLCL 5G1MA 1D8WA 1XYAA 2YA1A 3MBFA 1NWRA 1MQPA 2BY1A 3N9RA 1I1XA 5G1YA 3NXLA 3FJLA 3TQPA 5D2TA 2C14A 4KRZA 3PZTA 1UKPA 1M65A 4QNEA 5LIKX 3ID7A 4V27A 4JCMA 5DY3A 3UWWA 3MZNA 4RK8A 4LUSA 2QHAA 2J7CA 2V2HA 4G8TA 3DYMA 2HRWA 2NLIA 3NXFA 4XSMA 3SJ3A 1QOQA 4W5ZA 2BP1A 4GQRA 2PLCA 4XBJA 2ZVIA 2X1SA 2ABBA 2DH3A 1M6JA 3CUGA 2YDRA 3IK4A 3G0SA 2J27A 3R5EA 4CKQA 1CI1A 1ZLPA 1P7TB 3M9YA 2AQOA 1GTHA 2IQ0A 2QLYA 4U2YA 3LCWA 3IJ9A 3W88A 3S5SA 2X8RA 4IQDA 3I4EA 3NR0A 1X39A 2DSVA 1JL8A 1E4IA 4H83A 1DJYA 3F2DA 3GTNA 4IIBA 3FJ4A 5TAOA 4TXEA 4MLJA 3TCEA 3I4KA 3PR2A 4S3BA 2X7VA 4FXFA 4UMCA 2UBPC 3VDHA 3G3DA 4JQAA 2QPUA 3W00A 1H7RA 2OQHA 4EXQA 5I3GA 4OZOA 4Y9AA 3ITYA 3SY1A 1GVRA 1HF6A 4ZCWA 4QAIA 2WQDA 4LC6A 4GCAA 3S3GA 4WSKA 3NOYA 4E4UA 3KCLA 6REQB 1RHCA 3GBDA 1E55A 4DZAA 4BEQA 1UR1A 4K7VA 1MW3A 3P0XA 1N8IA 2KAUC 2VRQA 3M64A 2DDXA 5HNTA 3RPDA 5C55A 3IGUA 2V5KA 3A24A 4BI7A 4NHVA 4PUUA 3SCRA 4AG0A 4YPJA 1QW9A 4AFYA 3AYRA 4IX0A 1EZWA 2WBKA 4WKAA 4D9PA 2ALRA 1JPIA 4O19A 4OOUA 3TN5A 3UP8A 3L9CA 2NUXA 3QYQA 1K4GA 1UH2A 3BTNA 3BQ5A 4N9DA 1FQ0A 2Y61A 4Z08A 1I9CB 3KVKA 1A0CA 3JVAA 3GWQA 9CGTA 4NSBA 1TVLA 1NU5A 1LLWA 3W7DA 3RF9A 3H24A 3THDA 3NGJA 2VNCA 1TJRA 4QCFA 4QHRA 3GB6A 2DSUA 1XGDA 2E6AA 1E15A 2F2HA 1QUMA 3CQHA 1Q8JA 4R9OA 1I6NA 3M0HA 3UZWA 1K03A 2PSNA 1HL9A 3WLMA 4NF7A 1HZYA 4LYRA 3TJLA 2XH7A 3W2JA 4MDPA 3QHOA 2REQA 2W27A 2QGHA 2VJXA 3C2EA 4LU0A 3IJDA 1D2KA 3PFMA 3G1FA 1A5UA 3H2NA 3OLDA 3BGAA 4Y8EA 4JNYA 4GOAA 4ZOAA 4PTWA 3VFLA 3WUBA 5C9ZA 3PWGA 3UXIA 1FCQA 2BB0A 2VEGA 4EKJA 2QUTA 4S3KA 2TRSA 4AHQA 3W7OA 1I2OA 5F4WA 5F2LA 4KGJA 4AZGA 2Y7GA 4UQDA 1ISZA 4FXRA 3SR7A 3W7QA 4PUJA 4ZL1A 1H7NA 3USBA 4A8IA 3IIZA 2FHBA 5LNVA 5XINA 4NAFB 2OU4A 4L65A 1VLWA 3SEPA 2JF7A 1Q66A 3UG3A 5DCEA 2J13A 2A7NA 4RDZA 1JPDX 2GQ8A 2V69A 5E9AA 4AZ7A 3UWQA 2AAAA 4GY0A 3CHFA 3BLLA 1PTDA 4LH8A 3T6CA 4Z1YA 3A64A 1H3GA 1OBAA 2XTKA 3WFAA 1E43A 4JX5A 4IF2A 2X40A 2PD5A 3PNUA 4FXJA 1B9BA 3UWEA 4KMQA 3TYDA 3WY1A 3IIPA 4GX8A 1YDYA 4GA8A 3U6WA 1KRBC 4JFSA 3UR8A 4QEEA 1S5TA 5ENLA 3IPWA 5F2GA 1XG4A 1SZFA 1GT8A 4PMOA 3LSCA 4J3ZA 4UQEA 3AYTA 3LHUA 1QAPA 2GQAA 1R2SA 4HVXA 4E0CA 5M2FX 4CQ8A 1E9LA 4E8CA 1J0ZA 1VB9A 1XIJA 1XIGA 2XFWA 2VC7A 4MY1A 4QG9A 1U1HA 1B3VA 2VR5A 4DB7A 1DJZA 2OSXA 4S39A 4L5ZA 3L12A 4DXXA 4NRRA 3N17A 3T0CA 4M6UA 3RMEA 2FZMA 4RNJA 1E4NA 1DQUA 1FP8A 1ML1A 2CZEA 2JBMA 4AVOA 2V68A 4L1GA 1B4EA 2J62A 1KRCC 1S1PA 1F3EA 1R6WA 2WVUA 3BAIA 3F2CA 4WK9A 2B81A 3KZSA 5BXTA 2GGGA 3GR8A 2OX1A 2YBVA 2ISSA 5E93A 1DJXA 3F4NA 1M7XA 4FNSA 3LCHA 2YOCA 4JN7A 4PGLA 1XISA 2IQDA 1MYRA 1I0BA 3QR0A 3GM8A 1NH6A 1KM3A 5HQEA 5K3VA 1TFVA 4AXNA 3G6MA 2DGAA 4O12A 4H7CA 2D2JA 4DI8A 4IGNA 4XZLX 3K4AA 1C8VA 1Q5MA 1Z42A 1EPXA 3HMCA 3SCWA 2A3EA 4P7RA 3HN3A 3R89A 3W2KA 4D6JA 1TPUA 1QK0A 4DM1A 5MHBA 1G5AA 2PRHA 4NP7A 2A3HA 4DF1A 3JZEA 1ITCA 3WQ4A 4FLRA 3T8QA 2XSAA 4Y2WA 1RR2A 1O60A 3SURA 5M1TA 3L68A 4BK9A 4ZBCA 4W7UA 2CEQA 4KCTA 1VPXA 1KCLA 1LG2A 3OHIA 1TPWA 4F0HA 4RLIA 3I7QA 3NSXA 4CNOA 4NL1A 3HPSA 2X09A 2D2GA 3N4FA 4UOQA 1P43A 2NX3A 2HK0A 3OZMA 1ZL1A 2D2HA 4O13A 5CSRA 1YPXA 3WNOA 2D0HA 1D3GA 1CCWB 4PA8A 1TA3A 3SN1A 3H12A 4MB1A 4JD4A 4BKNA 3H53A 4BWLC 1LORA 3G1DA 1UH3A 4ZODA 1WDRA 2WZHA 3FDGA 3VOIA 3LGEA 4RV8A 5CXPA 4NRSA 1UR2A 1G69A 4RCXA 3B8DA 5HPCA 4D6CA 1JNDA 2X0HA 1CX9A 2VX4A 3MWCA 1H11A 3GNOA 4JS3A 4EACA 3W7KA 4BQ3A 1DL3A 1J18A 1CLVA 2IKGA 2IW0A 2QR6A 1J01A 3NA8A 3MSDA 1FDZA 2VD9A 4UQAA 3SZ8A 3AO0A 1FH9A 1EO7A 3TUUA 1EIXA 4Q22A 1XQLA 5D8WA 1QVBA 1WUFA 4IMCA 1J0HA 2H3BA 3S2NA 2CESA 1JYWA 1F73A 3KOFA 3C0SA 1QOXA 4NX5A 2J47A 4WEVX 2CCRA 4GVIA 2AL2A 3W7EA 2RDWA 4ZQMA 3WF3A 1JXJA 2QDGA 3HOJA 2Z1SA 3DAQA 3LMYA 1GK8A 3K30A 3W73A 1PKMA 2CBIA 3GXDA 3T08A 1Z9AA 3W2NA 4FF7A 5CZKA 2G41A 2JF6A 3QMTA 1R3WA 1OHLA 3UXAA 4LUSB 3RRAA 1RY8A 5F1UA 3S4TA 1M53A 4GI4A 3AYSA 3WLNA 1LT7A 3ABOA 3L4VA 5I3IA 4B5SA 4ATWA 5F2MA 4NXKA 2QUNA 1MDLA 1HL2A 4X2RA 3FNDA 1D9EA 4NQ1A 3GXNA 1UR0A 4GJJA 3DFSA 1SYTA 4TO8A 4XK2A 4QDPA 3CPRA 1P7TA 1OX4A 4G56A 2IS7A 3LTSA 1C8YA 1PV8A 4M6QA 5ECVA 4JZ5A 5BOEA 2QGYA 3AS2A 4M0XA 3Q94A 3L2IA 4QM1A 4JHZA 3WUFA 3KRUA 5FKYA 3G1YA 4XUGA 1IEVA 4XZBA 4F8XA 2A85A 1U5HA 4O14A 1DTNA 2A3AA 3RHGA 4JX4A 4ZQOA 1R3VA 4I6KA 3TMLA 5EFDA 3V16A 1E1CA 2OVLA 2VEPA 3MSRA 2QCFA 4WCJA 1GHRA 3LN3A 5BU9A 2CLLA 1AL7A 1BVZA 4FIRA 4DUXA 2HPMA 3KRBA 1SU5A 3LLFA 3AMDA 3U4AA 3FEMA 3VTRA 1PKLA 3IJQA 1ZJHA 4QP0A 4A29A 2YCKX 4K8GA 4ZGYA 1S46A 3H7VA 2E67A 1P1MA 5JVLA 2O9TA 4DBEA 3F1QA 2BTMA 1M5WA 3TQVA 1PX3A 3YPIA 3SCVA 5D2VA 2BVTA 1VYSX 1TR1A 1WQ5A 4HZ7A 1W1VA 5D03A 5T9BG 3RG6A 3QPYA 1A3XA 1V0MA 3FYOA 4W89A 3QTGA 2W9MA 3MC5A 4UC5A 1FWJC 3OYXA 5I06A 3HQPA 1JXKA 4Q7NA 4UIOA 3GKAA 5G2WA 4F0SA 3B0YA 4U31A 1A3WA 2VEFA 3D6NA 3LMZA 4LF2A 1US0A 1R9ZA 3JW7A 3FA4A 1VFLA 4REQA 5KZ6A 4DUVA 2R24A 1DYSA 1Y65A 4Q8MA 2HBVA 3RX3A 2C91A 1FWRA 4O0KA 3E5PA 3H2AA 3WLOA 3UT0A 3URBA 2VELA 4J3UA 4K8HA 1FWDC 5BU6A 1BVWA 1F6KA 2DORA 2ZWZA 2J77A 3M1ZA 5C9WA 3IJLA 2WJFA 4N9BA 4F9DA 4Y90A 1UP0A 3WLLA 5BMXA 4ZTYA 3CBWA 1JRCA 1NELA 4P7LA 2BXZA 2ZX8A 2C16A 3EOLA 5KITA 1V4YA 3HG4A 3P2VA 4DWSD 4FNPA 1V6UA 3W2MA 2F2KA 3AIVA 4Q4QA 3THQA 2F84A 4HA4A 3S5ZA 3GDMA 3Q45A 4KBXA 3WLPA 1OX6A 4FOUA 4G7EA 3WIJA 5D30A 4WKHA 1J9YA 2DT3A 5B7ZA 2D1ZA 3N1AA 5FI8A 2BV9A 3CWNA 4J27A 3T78A 3GG0A 1GW1A 5DT7A 1UOZA 4UQ9A 3DZ1A 1BFNA 1H5VA 1ZTVA 3OVQA 1YRRA 2YL6A 3RITA 3QV6A 5MKGB 4DJFD 3GZ3A 4US6A 4YVPA 1SPQA 3MSGA 2X42A 2WMJA 1SZNA 4AXKA 2V2CA 1P5BA 3FDKA 1TWIA 3MP3A 3FEQA 3R94A 3UETA 5LXEA 2O0TA 3QJAA 2O4QA 1XUUA 3N2BA 2GJXA 1YTKA 3O6CA 4UOJA 1XLDA 2X0YA 2INFA 3H21A 3TR2A 1E1EA 2RKXA 3B06A 1TZZA 1YDVA 3Q65A 1QPOA 4KERA 3VD3A 1NDYA 4HB7A 3OLEA 3AISA 4Q7IA 4FI4A 4MF4A 4ICMA 3M0ZA 3W1LA 3BH4A 2ISFA 2CHRA 3AMKA 1WKYA 3GU9A 1V3MA 2ZBTA 1ZAJA 1BRLA 4GGBA 1B3WA 1UWAA 2OZTA 2QV5A 2IXVA 3N12A 4HCDA 4DJEA 3UQNA 2FGBA 1NDWA 4UBPC 3W72A 1X6NA 4AY7A 4EIVA 2J4GA 1XLEA 3OIXA 4DJFC 2BOGX 1S1RA 1UKTA 3CMJA 3O6DA 1NFPA 5IXEA 3LCGA 4DUOA 4W7VA 5K7JA 2OCZA 5FSDC 1A3HA 4DBDA 4C7FA 3CUHA 3W07A 3AXHA 3QW4B 1AW1A 4EPBC 2NX1A 1Q7QA 2VZTA 3FSTA 4I5RA 2NT1A 3RM4A 3LHWA 1S5MA 3S1VA 4GRSA 3M5ZA 5FF7A 5JU6A 4WGHA 4YHEA 4ZZ9A 4FLSA 3GC4A 3L2LA 1KBBA 4XZIA 1VGAA 1TKKA 1DBTA 1EP1A 2XFRA 4AC1X 1E3XA 4WJXA 3M0MA 1W32A 3ARZA 3BJFA 4DWSA 3DHUA 8XIMA 4QDMA 3LZ5A 2CLHA 3ONCA 3ABXA 4GUIA 4IXXA 1D7KA 2HS6A 5LNUA 1HW6A 1UASA 4HK5A 4HYVA 1EJTC 4UTUA 4GINA 5A95A 3O7UA 1XKJA 2ZOXA 1L8PA 3B8VA 4EOUA 4A3YA 2FVMA 2ON3A 3HPAA 3NEVA 1OF6A 1P48A 2VX7A 1LQ0A 1H0IA 4HQVA 1XYFA 4MJ2A 3OBAA 4O54A 1ZNNA 1XDJA 4AEEA 4U3AA 3T2QA 3UCCA 3ECQA 5I7GA 1N8WA 4CNUA 5FESA 1E5NA 4AZCA 2Z1KA 1EOMA 3MKCA 4PTVA 3UWVA 3AIWA 3KS6A 3FJ6A 3H4WA 4Z2HA 2Z6IA 3REQB 1SW3A 3WF1A 4B3LA 1H60A 3GLCA 3M16A 1FHUA 2CLKA 3HB9A 3WD3A 3PBVA 1FWNA 3NM1A 3WD2A 3VNLA 2D3NA 1CGWA 2JIEA 2ZUWA 5LZLA 3JUGA 3UZJA 3S1WA 3EOOA 1YXYA 4LBUA 3SFWA 4YHGA 5D9OA 4MNMA 1JJKA 1S3HA 2VGBA 3ZJ7A 2DT1A 1DWIM 2UY2A 4FLOA 3BANA 3UZYA 1TVNA 4CNTA 4HP5A 4YYCA 4ZFMA 3WSUA 2YBTA 1QBBA 1EC9A 5J5RA 4POCA 1XYLA 3CV1A 3LYEA 4B15A 3TW6A 4AISA 3BOXA 1GOWA 3DOPA 4DN1A 4P8XA 1DQWA 4PMRA 4LRTA 3E0VA 1UC4A 2P3ZA 4O28A 3RXZA 1ISYA 3ZWSA 5M3WA 3E6EA 1Y7VA 2PTXA 3CYVA 3FN9A 3NDZA 4PTNA 2QCGA 5XIAA 5C9RA 1IV8A 5I79A 4W8BA 1LL7A 4B9YA 3S5OA 2PDBA 2PGWA 1SQ7A 1LYXA 4LB4A 1XH1A 1Q6DA 1K70A 5D02A 2WKJA 3S2CA 4KRUA 1E6ZA 1JVNA 1XFCA 1Z69A 3CB3A 2VDGA 1ZU8A 1UWUA 2PLKA 1KWKA 1JZ5A 5GNXA 4ONVA 4IMFA 1EHAA 4MYAA 1CNVA 1NM9A 3BLKA 1PEZA 4UMAA 4LVBA 4C60A 1SJDA 1FHVA 1RALA 1RLDA 3VGGA 1TTJA 1R38A 3MUXA 4IMEA 1LOQA 3DKJA 1FXQA 5TNVA 2VD8A 4PTDA 3LCXA 3ISIX 1JFHA 1ZJAA 3HTWA 3BAJA 2RJHA 5CC7A 3A23A 4O11A 2NVDA 4L1WA 4MDOA 2YDSA 4C1NA 3PG9A 1J0IA 1J4EA 2W67A 4KQNA 3AYVA 4AAJA 4P8WA 4XO6A 4GO8A 4MKSA 3G1RA 2JKEA 1CXKA 4WIWA 3MSYA 1FA2A 5G2HA 4PMDA 3S46A 3TZFA 1C7SA 4MZYA 2E5BA 4OQVA 5AKQA 5A8NA 1CENA 1NFGA 1V3IA 1D7FA 3GVWA 4MFDA 4LUJA 4GY1A 4NUWA 4XAGA 2E0PA 4AD4A 3L4UA 4LWWA 4KWVA 5LNWA 3MMTA 1EJRC 4NJJA 1K6AA 4LUTA 3NQGA 4FO4A 2DUAA 4ZO9A 5H8MA 1XCXA 1ZCOA 1WE5A 1Q6CA 3I7SA 3WBEA 4G9PA 4PCNA 1KB3A 4CLMA 4A8NA 1AUSL 1WYIA 4PMVA 1T8QA 1EEPA 1M03A 4E4PA 1DIOA 3AROA 3KHDA 5H8PA 4RPQA 5HUPA 5HXMA 2PDHA 4L4MA 3EWDA 3KOYA 4LAZA 4NAFA 2FMOA 1H7OA 2NVAA 3M0KA 5EA9A 5JXQA 4FA3A 4TX8A 1FWEC 2YCLB 3KM8A 3E2VA 1Q8AA 1MO0A 3MV11 1YXDA 4YMZA 2WSPA 4IISA 2A4AA 3RCMA 3G22A 2WPGA 4DELA 2QCDA 4UCFA 2PC8A 1ZALA 4YCOA 3GR7A 2W61A 1A5NC 3ANVA 3C2FA 4J35A 3AHVA 3S42A 5AYXA 3FCPA 2OYMA 3NQEA 1QASA 1XHGA 3FVDA 4JY9A 1RPKA 4HNNA 3AZTA 3GD6A 3SJNA 4L9YA 2O7SA 1TE6A 3B4YA 1SMDA 3S0CA 4NNBA 3GKFA 2ISVA 4LAMA 3VUPA 1CGTA 2J7GA 5I78A 1TJ0A 4IP7A 3TYBA 1AH3A 1SW0A 2EGZA 2VZOA 4C7DA 3B8UA 2BNJA 1K8ZA 3MWAA 4DJEC 3IJIA 4RDVA 1OM0A 4W7WA 2W3ZA 3KRZA 5C8BB 2GGEA 1O7AA 2CNCA 1Q45A 1YHTA 1QO2A 4EAYA 1MXGA 4GBDA 5IDIA 2PLMA 2GQ3A 4UUIA 2DH2A 3N2XA 1ZBCA 3A9BA 5A8OA 5DCDA 4DBWA 1QRQA 1FCUA 1QNVA 2O55A 4QSHA 3N2CA 4AIBA 5BWAA 1Q2SA 1O5KA 3W01A 2NSOA 3VKDA 4KH2A 4WDWA 3C61A 1XYMA 4R9XA 2C0AA 3ES7A 4KFNA 3WQ8A 1G94A 2OEJA 2W6RA 1YDOA 1NP0A 3TH6A 2JALA 3WD1A 1NDZA 5D2XA 4F2TA 4PUNA 1TTPA 1AZ1A 4ORMA 1V0KA 4Q4KA 1BXBA 2EG7A 7ENLA 2BXVA 1E9ZB 1QHOA 5HWMA 4XZHA 1T99A 4Y7EA 1XICA 1UD4A 2E40A 3R0DA 2EBNA 3M0LA 2XH0A 3G1SA 3H2CA 3VNMA 1XBZA 2B4GA 3SW6A 1Q6OA 2GSJA 1E4LA 2ZXBA 2HBXA 2DW7A 1Z89A 4QR6A 4WR3A 1XV8A 1CXLA 3SI9A 5C70A 1JZ4A 4TVCA 1AH0A 3EOUA 3NVDA 2V82A 3H7RA 1Q4WA 3ATYA 3D3AA 3AIBA 2I14A 3L2MA 1GJUA 4MIMA 3S6TA 1SR0A 3BJSA 2IXUA 3OODA 2NQHA 3QRHA 3WD0A 1V6TA 3M46A 4DIAA 4E8DA 2H8ZA 1MI3A 2I56A 4O16A 1CLKA 3PTMA 4QRNA 1ITXA 3GH7A 4H8UA 3LCLA 2X1IA 2X7WA 3GNDA 4EANA 3PTKA 5E09A 4R7WA 3NTYA 3PZOA 1KNWA 4EX4A 1AA1B 1VJSA 2WYSA 4M82A 1FWIC 3ARSA 3HURA 3KP1A 3OQEA 1KGWA 1VS1A 1O95A 2GFTA 2ACRA 2JKAA 1TPB1 1X8FA 4IQJA 3VINA 3RLGA 3EDDA 5IFPA 1UQYA 4GH3A 4ZXLA 3C2OA 2XVPA 1QWGA 3CLWA 4KCVA 4MNJA 1S5NA 2PDWA 4UQBA 1KD0A 3EA2A 3TSDA 1BGGA 4O53A 2F6XA 1R5YA 3GTXA 1EPVA 1HKIA 3IRDA 4EWJA 1GVEA 4JQ2A 4F4RA 3NZQA 2DFAA 3M7WA 5A8MA 2QCDB 2WSQA 3CM4A 2ALDA 4XO7A 3W23A 4I9MA 3LERA 1TJPA 4O4WA 2VYOA 2PU1A 5TF0A 1A0DA 1XD0A 5U7SA 3IVSA 3ITGA 4BCEA 4WQ6A 3OGRA 1YLVA 4XBSA 1KXHA 4MUZA 3T7VA 3VDGA 3UEQA 1GQJA 4S3JA 4ACZA 5ECUA 3N9SA 4WF7A 4QBXA 4O15A 2J9ZA 3ENLA 3HGJA 2VZSA 1UMLA 1AQFA 2I1OA 9XIAA 3RCYA 3ANYA 1KM5A 2ACUA 1K3UA 2VGFA 1B0IA 3CO8A 3PBUA 3PSVA 5CPMA 2EPKX 3FV9A 2HK1A 3LQLA 1U22A 3IRSA 1R3RA 4GI6A 1OFDA 3ITLA 4HHPA 3G77A 1UWRA 1ZGDA 2CHNA 3G0UA 3B8IA 1NWSA 1LL4A 1S2VA 1TV7A 3EGJA 1L2QA 3TR9A 2DZVA 5HJXA 1OABA 5I3DA 2VI0A 2OO6A 3OEXA 4X61A 3TYUA 3OLIA 1X8CA 1O4UA 4JIEA 1EH9A 3KBJA 1DIEA 1L0PA 1CDGA 3PTDA 1FY6A 5BYWA 1ME7A 1EX5A 2FZBA 3N9KA 3K5XA 3N34A 4I5UA 4ZQPA 2UY3A 1EHNA 2Y8KA 4NY2A 1NQKA 1M41A 4K39A 3R8RA 4HOXA 1DJQA 3P60A 4ZVJA 4NZCA 3TTOA 1V08A 3RN6A 1TTIA 3UFYA 3PUOA 2I57A 1SW7A 2VR4A 5CPTA 2FLIA 3SRHA 1E72M 3W86A 3CPGA 3MI2A 1GQIA 1T96A 3N3MA 2POTA 1EDQA 3LA4A 4HTBA 5A5WA 3B0PA 2OT1A 4TQTA 4D71A 2NSXA 2O7QA 1R7AA 1H7WA 1UA3A 3M5YA 1IEIA 3W0KA 3N6JA 4UTTA 1W9XA 4IICA 4NILA 3CWHA 3CHVA 3PVFA 1OFAA 3EWZA 2J7BA 5F4XA 1W5QA 2QDEA 3D3FA 4U28A 2PLJA 4MB4A 4GC3A 2A1YA 2PDXA 1BRLB 3SGUA 3PBYA 4KEMA 3MT1A 2AQVA 5E70A 4A3UA 4AHOA 1XLIA 2BY0A 3S1GA 1XFBA 3MDUA 4E8GA 1UWSA 2PTZA 5A6BA 5E6ZA 2X41A 3W2UA 4DLFA 3U7VA 4DYEA 1DJWA 2P8CA 1W3KA 1L6FA 1XLLA 4ADSA 1N55A 3BV4A 1ODUA 4A4AA 2VOMA 4Q8UA 1E6RA 4KFPA 2E9LA 1MUCA 3V0SA 3WDQA 3H6OA 2Y6ZA 2L5HA 3RO8A 4I7WA 2VRJA 1RV8A 5KZMA 3APGA 3AWNA 3ZLFA 4A3QA 5LIUX 3GDBA 2G0WA 3AAMA 4NVTA 4WGXA 1CGYA 3XISA 2KX9A 2CHOA 2X2YA 2Q71A 3AXXA 4R3UA 1V6XA 1S39A 3QC0A 1B90A 5HK4A 4US5D 1XIBA 5FOOA 3S9IA 5I07A 3HPXA 3KOZA 3LX9A 2BXYA 3CV2A 2V2DA 4I90A 4UOZA 1M01A 3KHJA 3WG6A 3NL2A 4KF1A 3M4HA 1HGWA 1LOLA 2VDIA 4HN8A 1KM1A 4XZ9A 2SFPA 2UV8G 5LKYA 3E74A 3WMCA 4LALA 4IQLA 1BYAA 5DMLA 3BZGA 1G1YA 3GFZA 1HL8A 3O0KA 1U30A 2PDGA 3DC0A 1ONWA 3EWXA 2DIKA 3ARYA 3Q37A 2WMKA 3M6DA 5HA7A 3GG1A 1UKQA 3NJ3A 4LAUA 2FZ8A 2CXGA 2DW6A 1MEHA 2DSWA 3RM9A 3APYA 3GU2A 3SADA 7PTDA 2IPJA 3EX1A 3WN6A 1X1NA 3BVJA 2GJPA 1KV5A 4HCLA 3S9ZA 3GVVA 2EPLX 1UD5A 2OELA 1LG1A 1PCKA 1TWDA 3M5VA 3UWUA 2WMHA 1NOUA 1TX0A 2REQB 3OVPA 4F3HA 4CNNA 4F0KA 3LGGA 1TMLA 5K4XA 1HIZA 1W3LA 2CC0A 3LGDA 1OFBA 3TN4A 2R9RA 3MY9A 3WQWA 1XLHA 3P67A 3A9IA 3S9YA 1BSIA 2BOEX 3UZZA 3AJXA 3CZLA 2QCHA 1IXOA 4UNLA 5D9PA 5MF5A 1RZMA 3NZPA 2CWNA 3LV6A 4JDYA 3NYDA 3JR2A 3BSGA 4QFUA 1GYMA 1PS9A 4XD6A 1EQCA 3QMSA 1WZMA 1C29A 3TAKA 4CCEA 5CPLA 2ZRVA 4O1DA 1I0DA 2I16A 5PTDA 1YKWA 4ICCX 3ZJ6A 1JCLA 1LQAA 4JYFA 2CWXA 1LUCB 3A4XA 4S3CA 1E71M 1P0DA 1I60A 5C2GA 3R6IA 3SSZA 1QO5A 4XAPA 4CU6A 4JHOA 2IPGA 1OYBA 3VI2A 2XFYA 1IZJA 1PHWA 3PJUA 5BMWA 4PCSA 4CEXC 2PTWA 3WLKX 4BJHA 3B9DA 2QF7A 5REQA 3QXBA 1P4CA 5M03A 1N8FA 4GNKB 2E25A 4WUIA 4JIHA 2WAGA 1Q13A 3KBMA 4CD8A 3LEPA 4PB4A 1B2YA 4D8ZA 3ZLHA 2VWTA 2WB5A 1VBUA 1X7IA 1W3JA 3PF3A 1RXOB 1YEYA 2QCMA 3DFNA 3BLOA 1VBGA 1ZFJA 1EA9C 1WB0A 3CTLA 1F3XA 3L0GA 4AD3A 1A53A 3SN4A 3GDLA 3EWWA 2BHYA 4L56A 1OCNA 1NOWA 3P8IA 1D8CA 1UWQA 4FNQA 3KDNA 3RJXA 3TYZA 1GTEA 4QJ3B 1VF8A 1EEXA 1W5MA 2KZHA 4HU0A 3EEZA 4PZVA 1K8YA 3FSUA 2Y0FA 4YNGA 2J88A 2XIIA 2VENA 1DKWA 3TW7A 1F3WA 2PODA 1ZAIA 3WX7A 2WCGA 2ZC1A 1GG1A 2X1UA 1F2JA 2HV5A 2VDHA 1PZ1A 3NYZA 2OWWA 1AFSA 8A3HA 3ZJKA 4YTQA 3CV7A 1EBGA 1FWHC 1X6LA 2V30A 1BPLB 3CZ8A 3S47A 1A4MA 3QEZA 1REQA 2E6DA 1SO4A 3LZ3A 3ZFHA 1NEYA 2IUZA 3QSTA 1A5MC 4O52A 3VNZA 2LLEA 3WLTA 3ZMRA 1PKNA 2BS9A 3ABRA 2WMIA 4GJIA 3GDRA 2Y8VA 1BF2A 6TIMA 4MWAC 2CZDA 2TMDA 4KW2A 2HE5A 4KT2A 3D47A 1XJBA 3SCSA 2OLSA 4RW3A 1E1CB 2XDFA 1MUMA 3EA3A 4Z2LA 1RH9A 1IEXA 4LFYA 4JXCA 1UOKA 4H01A 2Z00A 4WDUA 1KCZA 1YPFA 1QDSA 4JIIX 4DJDC 1W9PA 1K4HA 4JAWA 4CD6A 2WHJA 3WJWA 4QDWA 4LGXA 2X05A 3GH5A 3E1F1 3NQ7A 5HDRA 5AFDA 3VYLA 3I65A 4DAFA 4XV0A 3P93A 1T5AA 2NXGA 4K2SA 2PDCA 3NO1A 2TYSA 1XLCA 4A8RA 2V38A 3V36A 2NQJA 3EX4A 3PBMA 5KINA 4D1JA 2Z26A 3TP4A 3QHNA 2W91A 1REQB 1LRTA 1POJA 2MUCA 3M7SA 2ZQ0A 3N2TA 2BDQA 1V3HA 4MNLA 4F0MA 4LUYA 1U5VA 6REQA 2OSWA 4DWSB 4AH7A 5H8UA 5MKGA 2F6KA 1H5YA 2OTDA 3AU2A 3VNIA 1KGUA 1QHZA 1CXIA 4IT1A 3W7CA 1C8XA 3CIWA 3BLPX 1XG3A 1SJAA 3UG8A 1DHPA 2VKZG 1F4AA 4LX4A 2DUZA 3FJNA 5G4WA 3NO5A 5G1TA 1XRVA 4XG1A 1XRFA 1TIWA 2NX9A 4DAIA 3ZO9A 3W29A 3NZ1A 1HQTA 1UJQA 4H2CA 4XZNX 5DO8A 3HBLA 1VHNA 3PPCA 5L9FA 4EVZA 1ZP4A 2AKZA 2QEZA 3F03K 3NZGA 1KA9F 3L4ZA 5AZ1A 4S3GA 1TCDA 1EC8A 3F7JA 4GKTA 4L1XA 3RX4A 3V0TA 2YDAA 2C1GA 4D2JA 2ZFAA 3KRSA 3FIGA 1FDJA 1GORA 3KZPA 3MDWA 3BWWA 1MUWA 3KTXA 3R0UA 4EWND 4RDWA 1UZ1A 5AVNA 4CGTA 4LSBA 4H7ZA 2PB1A 3S8HA 2Z1VA 1YTDA 3IAQA 3WCZA 1V7YA 3FK4A 3PB2A 2JKPA 1W31A 1DXIA 4U5KA 3J7HA 2V3FA 3NCOA 4C1NB 1L6YA 2QZRA 3UF9A 3FHAA 2PDPA 3KEHA 3N3TA 1SVDA 3CUXA 1EJWC 4NZ1A 3NQ6A 4YIWA 1O66A 4TR9A 4JGDA 4DWDA 1A5AA 3KWSA 1GZJA 7ODCA 5HQLA 2Z24A 3T44A 2ZUSA 4H8NA 1S5VA 1HO4A 1LM1A 1OGBA 4JR5A 1OK6A 3W1TA 7A3HA 3FXGA 4F79A 3W02A 3WDRA 2WZEA 4MPQA 3UY8A 2J7HA 4OJYA 1JAKA 4N6FA 1F8IA 4AD0A 3KWXA 1CIUA 1HP5A 1XLJA 1DWJM 4MFEA 4HBKA 3STPA 2Q3RA 2V5DA 1JCYA 2ZA2A 3K4WA 3W1MA 1VKFA 3EB4A 3H2FA 1XF0A 4US5A 1RA0A 4QCEA 1YNQA 1RUSA 1R3QA 1ADDA 3I3DA 2YW3A 2PCQA 5EMKA 4BF9A 4HA1A 1BHGA 2E8YA 5F4SA 1R0MA 3UJEA 3ZM8A 2B7NA 2DV0A 1Y5WA 1E0XA 4JTLA 4XD4A 4DBUA 3KL0A 1EO5A 3BMWA 3RGTA 2Z2UA 3PPGA 3TONA 2ESCA 3DFHA 3GS6A 5AYBA 1VFTA 1TG7A 1VFMA 4PL1A 2VT0A 4ZA0A 5IBXA 4BEUA 3ARWA 5AHMA 4V15A 5HPOA 4IGMA 2WJEA 2VR2A 1GQLA 4TMBA 2UWFA 1BG9A 4MSSA 2CBUA 1UD2A 1ZUAX 1W8GA 3APTA 4TOQA 3T9PA 1XH0A 1SO3A 4NYUA 3THCA 3GBEA 2EAWA 1G67A 4A21A 3DFYA 1W9VA 1UC5A 1X1ZA 2R1NA 3AQUA 4JTKA 1ZCCA 5B7YA 1S2AA 4C6MA 3NQ8A 3GG7A 3OBEA 2B7QA 4H9ZA 2G96A 3ARPA 2OMAA 3IVUA 3HGSA 4RZ4A 2Z27A 5IHSA 1ISVA 1W1A1 4QS6A 3IIXA 2FVLA 1R7OA 4ADUA 2HNHA 4OU1A 7TIMA 4BS0A 4TTGA 1C7TA 3PP7A 3SSJA 3BURA 4XSLA 3UCQA 3OA3A 5JH2A 3TJ4A 4CQAA 2HWGA 1XIDA 4Y96A 2ODOA 1QMLA 3MCOA 3PPHA 6ENLA 4H8HA 4L4OA 1DXEA 2ATMA 5I3KA 3GZAA 1PX8A 4DPPA 4GZEA 4ZMGA 4FR6A 3BUVA 3UERA 4IJCA 1VFSA 5E0FA 2BY3A 5AHNA 4LCQA 4DPQA 4GC4A 2E5DA 4ADTA 1Q7MA 4E5TA 3ICJA 4AVNA 4U10A 2RDXA 4CN4A 3W53A 2F61A 4GXMA 1PKYA 3T2OA 1GNXA 4GNJA 1WXJA 3K8KA 4MM1A 3DEQA 3G5EA 1F07A 2BGSA 1OSEA 4XB3A 4JN8A 2QCCA 3TJIA 4HNUA 2EPHA 1WDDA 4CCDA 4IFOA 1O5QA 1HXJA 2X30A 3AIUA 2QUMA 2XIJA 3KOXA 4S23A 3DYOA 4AX6A 3IUDA 4NAEB 1SJBA 3N4AA 3QV8A 3R58A 4M19A 3W1PA 3HQOA 4MGGA 2CKRA 4ML9A 2OYKA 4BI6A 3QY7A 3EXTA 3WBWA 3MHFA 1JQVA 1E0WA 4G6CA 1V02A 4RL3A 3JU2A 4XKYB 3HMJG 3EPOA 4ZO6A 5LNSA 1E9IA 9XIMA 4UXDA 3TWAA 3ARQA 5JBEA 4ZQNA 1RK6A 3ZVHB 4HZMA 4AZIA 4M5PA 3GSMA 2ZX6A 4PSPA 1E70M 4TV6A 4BWLA 3CGTA 4CU8A 1PO9A 4NZ4A 2VQUA 1QPKA 1PYFA 2CERA 4ROQA 3UNTA 3T0AA 2XN0A 4R88A 1AJ0A 2RUSA 3ERPA 1XXXA 4AC7C 3CV6A 2HJPA 1CGUA 1PDZA 5HANA 4HU8A 3V75A 1F76A 3U3HA 4WY0A 3HG2A 1L6GA 1UP3A 5EBAA 3A22A 5EU9A 3T0DA 1RQEA 4OFCA 3WH7A 3QPZA 3IV8A 3PHAA 4MAZA 5LYRA 3W74A 5L6UA 1WZKA 3L0NA 4N9EA 4JEQA 4LJ3A 4ZR8A 2Y8UA 5CSUA 5IFTA 1J8VA 4Q8WA 1WBHA 3W76A 3BO9A 1L9WA 2WMFA 3C3UA 4H9MA 4HSOA 4M56A 1B3ZA 3VGFA 4JTQA 2GJLA 3CUZA 3G2GA 4JIRA 1ITUA 2I5GA 3QQWA 3QLLA 2YLAA 5LIYX 1WKDA 3SN0A 2HISA 5LNRA 2ZXQA 2ZE0A 1R9XA 1RPXA 3BW3A 3W7GA 2C6QA 1FCVA 5BXRA 1QPRA 1I75A 1W3TA 3ITCA 5EGRA 3NPVA 4HJWA 2HEJA 4KWUA 2ZRZA 4WXZA 2FFIA 4YLWA 2OOFA 3QGKC 2VHLA 3LHTA 3THUA 5I5RA 4RE0A 1OG6A 4B4HA 3IJ6A 4KEZA 2J24A 4UTTC 3T2PA 4OUIA 1TJ2A 1K9EA 4LY4A 1R47A 2B7PA 2CW6A 5I6SA 4NIRA 3EX3A 5I02A 4L64A 1QI0A 1JF5A 5T9CE 4GG9A 3WQ5A 5F1VA 1BXCA 4EK7A 1B3XA 4U33A 3VM7A 2VFFA 2WCSA 1EWEA 1E4MM 2G3JA 2VX5A 3OBKA 1S38A 3U0HA 3Q58A 2Z1BA 3F5KA 2VCAA 2JK2A 1H1ZA 1XC6A 4GISA 3PZQA 4LAOA 3CQIA 3HQNA 3GNPA 1BYCA 4C6CA 1GVYA 4JTIA 3GH4A 4W4QA 3W9ZA 5D9NA 3UD6A 4AIUA 5G5IA 3HO8A 2XN2A 1VP5A 4GQQA 4ERIA 4D6FA 2P1FA 3PAJA 1EA0A 1V3JA 2Y85A 2BASA 3EDFA 4YYFA 4C5YA 4QISA 5I24A 1JYVA 4GUJA 3DDMA 2A7RA 4PTXA 1JPMA 1KR0A 1CEOA 4QITA 2OO0A 2QVNA 3EMQA 3RLVA 2XZ7A 5BOOA 5HJYA 4ACZB 3UY7A 4PCFA 4AD5A 4CD4A 1DJGA 4W87A 1HJXA 5DBTA 1R86A 2DP3A 4XKYA 2DZAA 3MUZ1 5BWFA 1IEQA 4AVFA 2ABAA 1DTUA 4QQUA 2RDTA 4JTEA 4PFHA 7TAAA 3N13A 3W7JA 1TQXA 3OZPA 2R8WA 3P5YA 4FSAA 3USZA 1XSKA 3B9AA 3WK0A 5C71A 3WQPA 3W4RA 1YDNA 2OZ8A 2X16A 3CIXA 5DXYA 1C90A 2G3FA 5GQBA 1PSCA 3GYCA 5CBIA 3RMJA 1LCOA 1RJRA 1EYWA 2I7GA 1XP3A 3GC2A 2Q8LA 1MMFA 4NJHA 1O6IA 3WK1A 1JQXA 5H2ZA 3LHYA 1QW8A 2NWRA 1L8NA 3NM3A 4HJFA 2FMNA 1S2UA 4HNOA 1LUCA 3NL5A 1AD4A 3GNXA 3TFCA 1I2RA 1GOIA 1VPQA 3HV9A 3BDKA 5K4ZA 3G6LA 1LBFA 4UWMA 1CT5A 1YTEA 3L66A 3R11A 3VGEA 1TPDA 4F40A 1VHCA 3EXSA 1MW1A 2BBFA 3GNRA 2PGFA 3AIRA 2PFHA 5DCBA 1P1XA 1OCBA 3FYPA 3H22A 1IEWA 2ZX5A 1GGOA 4L4LA 1KLYA 2W63A 4P5UA 3NQAA 3AMGA 3BXWA 2PBOA 1Q4NX 4H9UA 5A6JA 4Q4OA 1JFXA 2FZDA 1DWFM 4R33A 4QAWA 3SCQA 2R1MA 2BGQA 1RA5A 3B8TA 2VP8A 4MY8A 4ECLA 2D22A 3WFLA 1K9FA 1TB3A 1QNRA 1G4PA 5FCZA 5LIXX 4DJED 3H55A 2GYIA 4PCPA 4O18A 1QNQA 3T1GA 1GEQA 1K6WA 4GABA 1W0MA 5AC6A 4LUTB 2YGYA 2D69A 3WF4A 3H4XA 3TZNA 1OFRA 4G1KA 1CGVA 2GQ9A 3QGAC 1CZ1A 5JIPA 2FQIA 2FYMA 2PWUA 5EYWA 3WDJA 1JDEA 2P76A 4F66A 1A5CA 2CETA 1KRMA 3HM7A 2ADAA 3AMCA 2R91A 3L23A 2TSYA 1RD5A 1VRXA 1V02E 2C1HA 1TMHA 1W1B1 5CH9A 3PC0A 2Y7FA 4IIFA 3TCSA 4GX9A 4O0QA 3D5HA 4OE7A 4BY3A 2FHFA 4MWAE 3EEGA 1B3OA 2RDUA 3CK5A 4GIRA 3O6AA 3T81A 3SUVA 3R2GA 3OZOA 2WNNA 4PMXA 4XBKA 4JOMA 4E3VA 1W91A 1TUFA 1GZ1A 3AZSA 3V5FA 3GHTA 3M0JA 3LK6A 2CPUA 1HJVA 1T40A 4MPKA 2JGQA 4Z17A 1KFJA 4W86A 4LS0A 3RO6A 5C0QA 3W2LA 1PWLA 4DNMA 3RFAA 3ZYZA 1LBMA 1FWBC 2BSLA 2PWGA 4JHMA 1MEIA 1ZP3A 4AEFA 3QW3A 4AUBA 5HMDA 3GTHA 4D6GA 2XGBA 3LDVA 2PMQA 3ANUA 4B3KA 2ZVRA 5HOSA 1NJJA 3CZEA 2FFCA 1ZZMA 1H49A 2Y2WA 3VVGA 4YL2A 4GVFA 2P3EA 4QG6A 4MYXA 2D24A 3EBVA 2NUYA 4HN4A 2OQYA 1PXGA 1SFTA 2PZNA 3DIPA 5G4EA 3G3MA 4ROPA 3F4CA 1VR6A 3NVTA 1KM2A 5HNNA 4Q4MA 1PX4A 3TE9A 2PDUA 4IPJA 3BCDA 1XINA 1TV2A 2Y5EA 1ICSA 5CPOA 3TIMA 1BF6A 4J2PA 1MQQA 2WV8A 5CC5A 1W9UA 4Z0JA 4YTSA 4MADA 1Y5VA 4YN5A 1KC7A 3MV01 3GR4A 2CXEA 1EIBA 3CAQA 2PDNA 1JF6A 4PUDA 4EPKA 1UD8A 1TWWA 3VMNA 2DJLA 3SGZA 3U4FA 4RUBA 1MXSA 1TPC1 2NQLA 4QE5A 1RCXB 3PULA 3BLEA 4MG4A 2ZADA 1IXQA 4PRWA 3UJSA 4IG2A 4IPNB 2TPSA 4JKKA 4NX0A 3TA9A 4GACA 1OADA 2Q8XA 2YZRA 1UD6A 4A6GA 3IANA 2V5BA 4UMBA 4BZYA 4IMAA 4DO7A 5HQMA 3BAXA 1V3KA 1U83A 7REQA 5C54A 3WQFA 5I03A 3E0WA 5KZEA 1BD0A 3S5NA 2XSBA 4AB4A 1PIFA 4PRRA 5KSWA 2ZZ2A 1PVNA 3BG3A 1VFOA 1UQZA 5BXPA 2QS8A 5CSSA 1VIZA 4C6EA 3PK7A 5AYIA 1I1WA 3OW1A 1GCYA 1F6PA 3VXGA 2DZBA 4YTUA 3N18A 4TIMA 2DT0A 3LPOA 5DT5A 4WKFA 5E1QA 2E9MA 2BMBA 3E0LA 1AK5A 4LF1A 1TMQA 3LI0A 4IH3A 4H8VA 5FJIA 3URNA 4DVOA 1YNYA 5CPSA 4Z1AA 4PULA 1EF2A 4O1CA 3OIHA 3STFA 2G8ZA 3K2GA 3MI3A 1JZ7A 3CLMA 3LPPA 4RXFA 1Q6LA 5FEPA 3WJXA 5CEWA 4IG2B 4UTWC 1JPKA 1GHSA 5J8LA 1X1OA 3WUEA 1PAMA 3M44A 4ZSTA 1I2QA 4A3HA 4MY9A 4WHBA 5TQLA 3W25A 4XVEA 3TTYA 1WX0A 3NQDA 5ABFA 5FJPA 3O15A 2XUCA 4EPDC 3LM3A 3WQOA 1NP2A 3CL6A 2ZTKA 5HNUA 3AIEA 1VENA 4AF0B 5A8GA 3IACA 3ME3A 1UPPA 4PL2A 5EBUA 1PE1A 5CBBA 1OT1A 1R87A 4RDYA 2DZSA 3DG3A 1ZY9A 4X9SA 2P5NA 1RCOB 3O16A 3B04A 5A2AA 1XSJA 2YX0A 5AZ0A 3EPNA 5IOBA 3BSHA 1VZWA 3E0FA 3VCNA 3UWYA 2Y7DA 4AYSA 5I2UA 1Q6RA 1JGMA 2WJDA 3CTTA 3O1NA 4DXVA 2GZXA 3CAKA 4MB3A 1YXCA 3NWRA 2C3ZA 1Q3NA 3OOQA 2QW5A 4JQ1A 5EMJA 2ONEA 1U33A 2NQ5A 3MA8A 2DT2A 3A21A 1TPEA 5HJLA 3L7RA 4ZE4A 4W8AA 1W37A 3CIVA 3R12A 4E2DA 4X0VA 5ABTA 2WWDA 3DUGA 4P7OA 5HNRA 3U5UA 4XAFA 2GGJA 3VDCA 1G7VA 1B57A 2IPFA 2E68A 1QWKA 3ARRA 4UR8A 1W1IE 3NL6A 1GKQA 1LWJA 3PY2A 3W6MA 2J8GA 5A94A 3CUFA 4XWUA 5I3HA 1UR9A 1OGSA 3RLUA 3V5OA 3SRFA 1OF8A 3B03A 4DF0A 5I3JA 1V51A 2DQWA 4P2VA 3EMZA 2QJMA 4XIMA 5AHFA 4O1BA 1JI2A 8TIMA 2ZZ5A 3N2OA 2DIEA 2OODA 4GVGA 4O50A 3BARA 2NV9A 4PYSA 2I5IA 1TJ1A 1C9WA 1C9DA 1CLXA 2WSYA 4R27A 1Q7ZA 4FLQA 3G1AA 2QJIA 4WXYA 1XPGA 1K9TA 3SRKA 2WZIA 3A3XA 4PUWA 3KE0A 3DBNA 4GKLA 4CQBA