4AVFA

Crystal structure of pseudomonas aeruginosa inosine 5'-monophosphate dehydrogenase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
467
structure length
314
Chain Sequence
b'MLRISQEALTFDDVLLIPGYSEVLPKDVSLKTRLTRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMGIEQQAAEVRKVKKHETYPLASKDEQGRLRVGAAVGTGADTGERVAALVAAGVDVVVVDTAHGHSKGVIERVRWVKQTFPDVQVIGGNIATAEAAKALAEAGADAVKVGIGPGSICTTRIVAGVGVPQISAIANVAAALEGTGVPLIADGGIRFSGDLAKAMVAGAYCVMMGSMFAGTEEAPGEIELFQGRSYKSVPYKGALSAIVHQLMGGLRAAMGYTGSADIQQMRTQPQFVRITGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
molecule tags Oxidoreductase
source organism Pseudomonas aeruginosa
publication title The Aeropath Project Targeting Pseudomonas Aeruginosa: Crystallographic Studies for Assessment of Potential Targets in Early-Stage Drug Discovery
pubmed doi rcsb
total genus 98
structure length 314
sequence length 467
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.205: IMP dehydrogenase.
pdb deposition date 2012-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00478 IMPDH IMP dehydrogenase / GMP reductase domain
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4avfA00
4JTKA 1JCNA 3VE7A 1EUAA 2V2HA 3JS3A 5HINA 1H60A 3NGJA 4LUJA 2GVGA 2Q3OA 4BK9A 3I7SA 3KRZA 3W2NA 3TMQA 2YR1A 4N4QA 4L4MA 5D2VA 5AOUA 4UTHA 4LTSA 1VYSX 2B7OA 2JBMA 5EY5A 3R2GA 4K39A 2G5WA 5CPNA 2R14A 4M5PA 1QOQA 3LTPA 1L9WA 3U2OA 3G0XA 1I45A 3C2FA 4HNTA 3DKJA 3PBWA 5L9FA 3MHUA 3LDVA 3T78A 2Y62A 3BO9A 4ZQOA 4HPJA 3STGA 2VFHA 4NXKA 1JRCA 1JJKA 2YGYA 2QCCA 2GQ8A 3GR7A 5EYWA 2CLLA 1KV8A 3OBKA 5I3GA 3D0CA 5U7SA 3IVUA 2CLKA 2J9ZA 2XN2A 3IGXA 5F2IA 1RQBA 4IGHA 3E0IA 2UV8G 2QCMA 3NYZA 3DKLA 4MYXA 1O5XA 3LCXA 3ZS4A 3O15A 2E1DA 3HG2A 1O5KA 1ZAIA 4K7VA 4XQ6A 3GAKA 4GXMA 2J9YA 4LV9A 1ML1A 3THAA 1JUEA 2EKCA 2P10A 3GDMA 3N73A 1ME7A 1HFBA 1OHLA 4UIOA 3TNOA 3MP4A 3W22A 1A5CA 1RR2A 2CZEA 3LXBA 1Z44A 1RVGA 3RNDA 1YTEA 2O7QA 4ADUA 3P81A 3W75A 1WBHA 4HHPA 1TTIA 4NU7A 1H7OA 1D3HA 2ZZ4A 3GB6A 1KFLA 4HNNA 1UCWA 1AMKA 4PEKA 3QFEA 2H90A 3T7VA 5BNKA 1O95A 1ZNNA 2VELA 4Z08A 3ZWSA 3DFNA 3BG5A 1SW7A 2I9EA 3NPXA 4LY8A 4DO4A 3ANYA 2ZZ6A 2ZFAA 4AAJA 1RD5A 4M7SA 3NEVA 4IMGA 4JTSA 3W74A 3WK3A 1W1ZA 3TQKA 1JCLA 1OFRA 3LLFA 3PVFA 3M5VA 3C52A 3W1UA 2HMCA 5J5DA 3BG3A 3C56A 3O06A 1AK5A 2WSYA 4NXSA 3O6CA 3HF3A 4IMFA 3DFQA 3L5LA 4IOTA 3ATYA 5D2YA 1WDWA 4OE7A 4UR7A 4XBKA 4G1KA 3FOKA 3LCWA 2LLEA 3NL6A 3LHUA 3NO5A 4BFAA 1SPQA 1MXSA 1KA9F 2OZ0A 5D2WA 3L66A 1ZENA 4JTJA 1XXXA 3KVJA 1G6CA 1SUXA 1W3IA 5BW6A 3WJZA 2WNQA 1SSGA 3P60A 4CNPA 3SFKA 4O17A 1K7EA 4ZZ9A 1LLWA 3KX6A 3NAVA 3SGUA 1KTCA 1JQVA 4C1LA 1XM3A 3QW4B 4DF2A 4A22A 5AHMA 2XN0A 5G2IA 3PS7A 3BW2A 2GVJA 3B0PA 4ONVA 5DLCA 1KM3A 1FXPA 4AWUA 3LRLA 1XFBA 3G1XA 4X2RA 3TQ0A 5DN1A 4MZYA 1SW0A 2JGYA 3QF0A 4R7JA 1SR9A 3GDTA 3GKFA 4TMCA 5DELA 3KHJA 3Q37A 3HG3A 2NXHA 5AC7A 1GYNA 2ZQ0A 4OU1A 4ZQPA 3NQFA 4FHAA 1DQXA 2QJIA 4KWWA 4BR1A 2BXVA 4UFIA 3QQ1A 3W2UA 5BOOA 3W7PA 4JEQA 3GKAA 3UWZA 2H3DA 1EP2A 4GBUA 3UZJA 3Q94A 3W7HA 2X1UA 1VRDA 2GVLA 3PWAA 3PR2A 1UB3A 4NJIA 3B0UX 1MSSA 3SW6A 4RXGA 2GJNA 4HSOA 1T99A 4N9EA 1F2JA 3GDKA 3QMSA 5D09A 3LCLA 3ZR4A 3W76A 2NWSA 1FUYA 4HKPA 4JR5A 3PF3A 1WQ5A 4NNBA 3M9YA 2C1HA 4AWSA 4Y96A 4UFMA 3EX6A 5K9CA 3R5EA 4FO4A 4AMAA 1XUUA 3GDLA 4FNUA 4IMDA 5FEZA 4DQWA 2Y89A 4H3DA 3W1RA 3E9AA 3P80A 1WA3A 3W7KA 1KM2A 1WBJA 2GPTA 4UTUA 3TFCA 4Z1DA 5E0KA 4QQ3A 3BK0A 5AFDA 4FNQA 4GUFA 4O1BA 2EAWA 3W7CA 3W2JA 2CLMA 2H6RA 5D2XA 3P84A 5F2LA 1F5ZA 2TSYA 3YPIA 1FCQA 5FF4A 1YXCA 5FESA 4N02A 3MBDA 1OX6A 3VKJA 2NLIA 1SO6A 3R13A 3CPRA 4PA8A 3M5XA 1TPWA 2WOQA 4UMAA 3MI6A 1VLIA 4GUJA 3PB0A 1F74A 1A50A 1Q6LA 3W7NA 1B57A 2DZPA 4JS3A 5F4SA 3OEXA 1YDNA 5TBOA 2Y6ZA 2VFEA 1T96A 1VCFA 4GC4A 2YW3A 4WOQA 4N4PA 3V75A 5F2MA 5D2TA 1O4UA 1OK4A 1NFBA 1EWEA 1SSDA 2QDGA 4DO6A 1XI3A 4O53A 1R2TA 3EX1A 3L5AA 3ABSA 4JTLA 2VFDA 4FIQA 1ZHAA 1HL2A 4X22A 3O63A 3JR2A 3FKRA 3TW7A 3LB0A 1ZJIA 4EIVA 3CTLA 5L6UA 3L68A 3QSRA 4GJ1A 1VH7A 1WX0A 3T40A 3WFAA 1K8ZA 2G96A 1H50A 2QCDB 4CQAA 3C0JA 2RFGA 4XKYB 1LORA 4O1DA 2IQTA 1WYIA 2AAMA 5HMSA 1A5BA 2C19A 1RV8A 2ZRUA 3LCGA 5LNRA 1I4NA 1TTPA 2ZA1A 3HGOA 4CCDA 3MO7A 4Q33A 4K37A 2BTMA 1U83A 1ICPA 3LBMA 1VC4A 4U4MA 1D3GA 1K7XA 4MVAA 1O60A 2PURA 3M5YA 3QJAA 2ISSA 1UASA 2CLEA 4O8RA 4LUIA 3W87A 4FF7A 3STCA 3S9YA 3OVPA 3EWUA 4XTDA 3IIZA 3TJLA 1YLVA 1C29A 3LHYA 1GTHA 2RH9A 2W6RA 3KVKA 2B7QA 1CI1A 5LNUA 3CU2A 1KLYA 3LRMA 4UFJA 5DBTA 2Y7GA 4K38A 3PBYA 2V9DA 4IXHA 1QPRA 2J6XA 1UBSA 1AW1A 3PUDA 3ZWTA 4XUGA 2W79A 3CWOX 5K4ZA 3W86A 3G22A 3EX3A 5CSSA 1DJNA 1IXNA 2ISWA 3G1VA 4IX2A 4LNYA 2HTMA 3BW3A 3B8DA 2DP3A 1YPFA 5AHNA 4PFMA 1OFPA 4KKXA 3SIZA 2NX3A 1P5BA 3HG4A 4O14A 1TPVA 2C16A 2DZUA 4QITA 3DI1A 3TSBA 5C6MA 4E2BA 1GPWA 3PB2A 4A2SA 4TMBA 3ABQA 4O50A 5AC8A 1VR6A 3PUOA 1NAL1 3WK2A 4IPJA 2FPTA 1LP6A 4QM1A 4JTUA 1CW2A 3ELFA 1PCWA 2V2CA 3NL5A 4MKNA 4FNTA 3MBFA 1VLWA 4WZHA 4MJMA 2VEMA 3HIJA 2FLIA 1PL9A 2QUVA 1H5YA 2X16A 4UMBA 3HBLA 4X9SA 3NQVA 2Z2UA 3DFTA 5GVJA 4LS0A 1H7PA 3NM3A 2ABAA 2CLFA 1GVQA 3EWBX 1ME8A 2VENA 4UFHA 3WJYA 2E6FA 2A0NA 4FX8A 5D04C 3E12A 5D30A 3NL2A 4YWIA 3KVMA 2HS6A 2NX1A 4IUOA 1OFQA 4N6EA 3NQGA 2QUTA 3I68A 1Q45A 5AHLA 3W73A 1ME9A 4UTIA 3A5VA 1A5SA 4ZQRA 2RHGA 2FTPA 5FF2A 1SO3A 3EXRA 1ONRA 1GG0A 1OYAA 1JRBA 5LSMA 1EEPA 3I7RA 1QWGA 4BWLC 3C2VA 3LHTA 5DY2A 3M7WA 3PSVA 5F4WA 2JGQA 3LHVA 2R8WA 3O16A 3S8HA 3S1VA 1KLZA 1EB3A 4ADTA 2CZDA 2VFIA 1V7YA 1G4TA 3HMJG 2Q3RA 4NX5A 1Q6OA 3QH2A 3S1UA 4IWWA 1OJXA 4EF8A 4YCPA 2V5BA 2HS8A 3OG3A 4MPQA 3NM1A 3LX9A 4HN4A 3TIMA 3SECA 1N55A 1R2RA 1W5MA 4I9AA 1F6PA 4Z1AA 3L21A 1X7FA 3BLIA 5F1VA 4E0CA 2CLHA 3EWWA 4JYDA 1YYAA 3N9SA 1H7XA 2NXIA 2Y63A 4M6QA 3LBCA 5IM51 4BWLA 3I7QA 1F05A 2Y7DA 4LOCA 1OVDA 1C8VA 5BRBA 3EKZA 2ZTJA 3W1XA 3MJYA 2BX7A 3MW7A 3B0VC 4LS1A 4M6PA 4PODA 1P0NA 3F03K 1YDOA 4PH6A 4OWGA 2ZZ2A 5LHFA 2PRHA 2VOMA 4WY0B 4OGZA 3KOFA 5D32A 1FDZA 1ZY9A 4LT9A 2QCDA 2Z0IA 3B03A 3FEMA 3W3OA 5AHEA 5EKYA 1I2RA 5D37A 3NZ1A 4AHPA 3W7DA 1DL3A 1TB3A 3T44A 1SZGA 5CPOA 3WK1A 2WO5A 3W1LA 2FDSA 1KFBA 1QO5A 4P2VA 3NVTA 2FJKA 1X8FA 1KM0A 3KVLA 3CEUA 1XUZA 1W3NA 2TYSA 1KTNA 2AQWA 1JUKA 2A7NA 3M47A 4ICNA 3W7IA 3LHZA 2BLEA 1F73A 1XBXA 4ORMA 3WJWA 1VJIA 4ZQCA 4CQ9A 1GEQA 3I65A 3QZEA 1LLZA 3U6WA 3ABOA 5KITA 2QJGA 4Y8FA 3W7JA 2G95A 1LBFA 3UWYA 4M6VA 3DBPA 3OHIA 3P62A 5A8GA 3L5MA 3SGZA 2CLIA 1TRDA 4UFKA 5CG7A 2A5HA 1TPB1 4JX5A 5LNVA 1SW3A 1TPC1 2ZYFA 2ABBA 1H51A 5G1TA 4QNWA 3F4NA 4S1FA 3UXAA 5FF0A 1DJQA 2H3BA 4FNRA 6ALDA 3GXNA 4MY8A 1L6SA 2V8ZA 3NQEA 3RMJA 2TRSA 3B05A 3FIGA 4GUGA 3OVRA 1OYCA 2VXNA 2R94A 1JUBA 1SZNA 3N14A 2H8XA 3QPYA 5FF7A 4CNNA 4XTIA 1OFOA 3Q58A 3CEPA 8TIMA 3BGJA 3RF9A 2V82A 1ZFJA 3NR0A 3LM7A 3DAQA 4NUWA 3GVGA 4O28A 4OT7A 4EVZA 1I2QA 2QCGA 3QPZA 2DJXA 4WD0A 2QCNA 3VE9A 5TQLA 1JR1A 1VGAA 4N9DA 1GYLA 2QAFA 1JCXA 1DV7A 4JIQA 5K7JA 1FY6A 2VFFA 4FB7A 4DF1A 5IBXC 3LV5A 4LW7A 4KFNA 3PBUA 3TSMA 1YXDA 3A9IA 3AJXA 2WJZA 3G1FA 5KZDA 1W5PA 1Z48A 3DFOA 1N8FA 2O7SA 5H91A 1MEWA 1HG3A 4O15A 4WQ6A 1FBAA 4UTTC 5I3IA 3E02A 2Q8LA 1DKWA 4Y9AA 1IIHA 3B04A 1OYBA 3BW4A 5TIMA 1MEHA 5DCDA 1SFLA 1LYXA 3MI3A 4HNUA 3DXIA 4AHOA 5DCEA 3M5ZA 3CLMA 1JVNA 3O1NA 1W3TA 2E6YA 2ZZ5A 3UWVA 3C4UA 4O16A 2QCLA 3THQA 1VYRA 3HGSA 3MWAA 3UXDA 2CWNA 1A5AA 3A23A 1GT8A 3STEA 4WY0F 1K3UA 2DZXA 2CZFA 2ZRYA 2Z1BA 3HOJA 3W70A 1QPNA 5AC6A 2DZVA 4AHQA 3DH7A 2EHHA 4O0KA 4H4IA 1L6YA 4MLJA 1SZFA 1NSJA 4LC8A 1ZCOA 3L67A 5FF3A 1I8JA 3W23A 1H1ZA 4ZVJA 1SU5A 1Z42A 1LM1A 2B7PA 2ZZ1A 4RXFA 3A24A 5G5IA 3NPWA 1XC4A 3AO0A 4MZ8A 1S5WA 3G18A 5DXXA 2ATMA 2G97A 1SQ7A 3PAJA 3S5OA 4GFSA 3IV3A 4AVFA 2WQPA 5I3HA 3QM3A 4UTWA 3A21A 3KFTA 3O8AA 4IMEA 4UTWC 2E5CA 4M7TA 4QIUA 4DEFA 3PG8A 2GQ9A 2NV1A 2WKJA 3LCHA 4U28A 1AL7A 5DBUA 4IX0A 1VHNA 4O4WA 2CZ5A 5KTLA 4OV4A 4Z1CA 1BTMA 1W37A 1X1ZA 1W31A 1FCVA 3B4UA 3W6YA 3R12A 2VEKA 1GVOA 4RJEA 3BPWA 5C55A 4IXXA 4WXZA 3NQMA 4N9BA 1KFEA 3W07A 1LRTA 1TV5A 1OFBA 1TQXA 4TO8A 4HPXA 3TXZA 4GE8A 3G8RA 4FX7A 3PM6A 1JCMP 1QR7A 3S42A 3TDFA 4IPIA 1AL8A 3B06A 4LRTA 1NVMA 2B7NA 3CT7A 1G4SA 2C18A 3JRKA 3TE9A 2GQAA 4I7WA 4K6AA 5I3KA 3QEZA 4OV9A 4JTGA 3O07A 1YPIA 4AXKA 1S3HA 1XKYA 5CKSA 1KFJA 5AYYA 3LCIA 2JKAA 2DU2A 3H53A 3W83A 2YZRA 3NQDA 2ZTKA 2TPSA 1TIMA 3G3DA 1XL9A 4XBSA 2BZNA 1OF6A 4KFOA 3E96A 5HULA 1ICQA 3G1AA 3GAYA 3GX9A 3EWZA 4NX0A 1SO5A 2J9XA 4RZ6A 3RFAA 3IVSA 1P4CA 2Y61A 1B4EA 1RQEA 2PCQA 2ZZ3A 4A3UA 3DZ1A 3VCRA 1EA0A 3NL3A 3W9ZA 4NZFA 4UC5A 4FIRA 4LVGA 1TSIA 1GVSA 1H7RA 4MZ1A 2QR6A 4IMCA 3IEBA 4ALDA 5HR6A 4Y6GA 1CX9A 4M19A 1X1OA 3BVJA 4UUIA 3TW6A 5KZEA 5AYXA 4GWEA 2QJHA 3GZ3A 1EPXA 3EKLA 4X3ZA 5EA9A 4MJZA 1S5VA 4RLIA 3OA3A 5CSRA 3W85A 2AGKA 3LCFA 4LU0A 2Q8ZA 1EP3A 5KZMA 2V0TA 1FWRA 4UCGA 4CLMA 4DBDA 5DCBA 1OX4A 4GUIA 1LBLA 1TQJA 4Z0JA 3TH6A 3GLCA 5F4XA 1W8SA 4KWVA 3KAOA 3MUXA 1P1XA 4O18A 1XBVA 1TV8A 1DHPA 4S2CA 4UNLA 1GOXA 2C3ZA 2A7RA 4NNAA 1NEYA 3PC0A 3TAOA 4B5NA 2YFNA 3W1PA 3GDRA 3LV6A 1PV8A 1MZHA 2YXGA 4P61A 2NZLA 5CZTA 2GJLA 1BWLA 3A22A 3HB9A 5AHFA 5EBUA 3RU6A 2C6QA 4JYFA 1GJPA 1GVRA 2NUWA 5I3JA 1ALDA 5AYZA 3EX4A 3VFLA 4JYEA 5F2GA 4BI7A 3LXAA 3E49A 2P0OA 4HIBA 3UNDA 4WUIA 3CWNA 1FWTA 1FWWA 2ATSA 2RDWA 3TAKA 4MYAA 2OCZA 3KRUA 4Q32A 3TX9A 1BKSA 5IBXA 4K7YA 1QPQA 1KW1A 4AF0B 1ZAJA 1NF0A 1MEIA 4H6KA 1B9BA 5G1YA 3NOEA 2A4AA 1D9EA 2DZTA 1JULA 3PUEA 3LTYA 1VYPX 2ISVA 5CGQA 1OX5A 4XWUA 5CPMA 2NUYA 3C2EA 3FA5A 4HSNA 3OIXA 4LV4A 3DGRA 1DQWA 1FDJA 4O1CA 1LROA 4DXVA 1G4PA 1GTEA 2KZHA 4ZL1A 4RK8A 5K4XA 1FCUA 3M44A 4UXDA 2FIQA 3M0ZA 2HSAA 2JK2A 1Y0EA 3CHVA 4EWND 1UJPA 2QUUA 1U5JA 2VKZG 1SO4A 3CIWA 1KV5A 3W1NA 3G1YA 3G0SA 2TMDA 2Z6IA 2ZRWA 4YMZA 4BI6A 3LXCA 4O10A 4JGDA 4JX4A 4QNEA 3I6RA 3TCEA 3FJLA 2ZRZA 1XDLA 3INPA 3UD6A 1IXPA 4UFLA 1LOQA 4OHQA 1ADOA 1KTBA 4UNKA 3C2RA 1W5NA 2PRLA 4QSHA 5E1QA 1G4EA 1PHWA 5CZSA 2JKEA 4JY9A 3HGRA 4UTTA 2JKPA 3M41A 3N19B 4LRSA 3W7GA 3P82A 3GXTA 4LWWA 3G1HA 4ZQNA 3TJXA 3L0NA 1IGSA 1PIIA 3UPWA 2Z6JA 2E6AA 3W1TA 3CC1A 3N2MA 4O52A 1LRNA 1XBZA 1XBYA 3MHGA 3N2XA 1DBTA 3BLFA 2WV8A 1AW2A 3ZFHA 1J5TA 3DENA 1VZWA 5U4NA 3SJ3A 1QDSA 1YTDA 5KINA 1W0MA 2RDUA 5K9DA 3ABRA 1W5QA 2X1TA 1PCKA 2ZA2A 3L9CA 4A29A 3PBVA 4YXGA 3UY8A 3HQ1A 4N2YA 4JIPA 3TV8A 3IGUA 3GR8A 1BEUA 3IIOA 2FB2A 4UMCA 5E93A 4O0ZA 1YADA 3MI2A 3TA6A 1KBIA 3P74A 1F76A 4WY0A 2E5BA 3K30A 3WK0A 1TTJA 4TR9A 3C61A 3TFXA 1M7OA 4LVFA 2H8ZA 2A7PA 3G24A 3OVQA 1LZOA 2Y85A 5J5RA 3KRSA 2A1YA 1Q6QA 2WPBA 3P5ZA 1XDMA 1K8YA 3FFSA 4AH7A 1V5XA 5HUOA 3DFSA 3S5NA 3CQ0A 4NQ1A 3USBA 3MP5A 4ORIA 3UWWA 5D02A 1TJRA 3EWXA 1VCGA 3TC7A 5EMUA 1VQTA 1G7VA 3TK7A 1LBMA 1WXJA 2QCEA 1DVJA 3W2KA 1VHCA 3W2MA 1QOPA 3GIYA 4O13A 2W0UA 3NA8A 3DHFA 3DHDA 3FKKA 4WOZA 4FXSA 2YYTA 4ADSA 4HNVA 2C14A 3C8FA 1LOLA 2ZRXA 4MFEA 3NDOA 4POCA 2X1SA 1KBJA 5HQEA 5AN7A 3QW3A 1YXYA 4LS2A 2ALDA 2C13A 4RX0A 4YLWA 5SWUA 1FDYA 2BSLA 4JTTA 5G2WA 4ZQMA 5I3FA 1TO3A 5LGZA 3P8IA 2P1FA 3C3NA 1F7BA 3EB2A 1N7KA 3C6CA 4E2DA 4O1AA 3IGSA 2GUUA 3BG9A 2OX1A 4CCEA 5LZLA 1ZALA 4NVTA 4JD4A 2I1OA 3TU9A 4LVBA 5HWJA 3RLUA 4JDYA 4DPQA 5G4WA 3BGGA 1ZAHA 2OT0A 3NQ2A 1TYGA 1IF2A 2DJLA 4FEZA 2EGZA 5HJLA 5BMWA 3IIXA 1M7PA 6TIMA 4NZJA 1L2UA 2YX0A 5EPDA 3W2LA 2F7FA 1QMLA 1R2SA 1W56A 4MY9A 1W5OA 3CB8A 4Z0SA 5CZJA 3QSTA 4UTJA 3FYPA 2E09A 3LI1A 1IIGA 3PSWA 3W7EA 3N3MA 5K2ZA 4CQ8A 2YYUA 1KM5A 2J27A 2VEPA 4TIMA 1R30A 5CZ0A 1FWNA 1YTKA 1QCWA 2WNNA 3CM4A 4NNCA 2E77A 1UUMA 2PRMA 3RK8A 5HUPA 4PTNA 5MHBA 1WV2A 5KMYA 1QAPA 4FX6M 5K3VA 2NWRA 1BWKA 3EWYA 3SZ8A 3W7OA 1TJPA 5C5YA 3GK0A 3SR7A 2F84A 5A5WA 1TREA 1SZEA 1L6WA 1KM6A 1R47A 2EF9A 1MO0A 3MP3A 4GRSA 4YL2A 1TPFA 4QJ1A 4EOUA 3TQVA 3W71A 4JTHA 2RKXA 2E5DA 1EIXA 3L2IA 5BMXA 2I14A 4NJGA 2PC4A 3NG3A 3NQ7A 2QDHA 3M16A 3NQCA 2YDAA 3H54A 1OX4B 3P5YA 4W9TA 4A2RA 1HO1A 1TPUA 3FS2A 1OF8A 2FQIA 1B4KA 1DORA 5D05A 1K03A 4FNSA 1OFEA 4MOZA 4N6FA 3G3MA 4OBTA 2DZWA 1Z41A 4O11A 7TIMA 2A6NA 2FPYA 3G0UA 1GWJA 4KFPA 3N34A 4J9JA 3T55A 1A53A 1WOAA 3EEGA 1PE1A 4RZ4A 3BLEA 3G8EA 2Y7EA 3F1QA 3KXQA 4ZMGA 1O94A 4RZ5A 2QCHA 3W88A 2ZCGA 2D73A 3QRHA 3UPBA 4O19A 1R46A 4TX9A 3TUUA 5G4EA 4E38A 3EX2A 5FEXA 3FJ6A 3ATZA 3IIPA 5D03A 2FPVA 1TRIA 3EXSA 3W84A 1EUNA 4XZ9A 3MYPA 1QO2A 2WSQA 1K7FA 2YPIA 4GNJA 3P61A 3W7MA 1AW5A 1JCYA 5T26A 5FEWA 1KFCA 5HWNA 1RQHA 3UYCA 1IXOA 3DI0A 5AHIA 3U8GA 1THFD 3LRKA 3V1PA 2XFWA 4MFDA 2VEIA 4UR8A 1JCJA 3UZ5A 1H7WA 5DY3A 4DO5A 1M5WA 1GVFA 2NX9A 4CNOA 3HPXA 3QMTA 1E51A 1TPH1 3LERA 4Y90A 3TKFA 3H55A 1VPXA 4JICA 1M6JA 3NQ6A 4CCCA 3O6DA 2YFOA 1H61A 1FQ0A 4K36A 1I2OA 1C9DA 4K8EA 2NV2A 2B4GA 2QF7A 2YSWA 1H1YA 1H62A 3PY2A 4O4VA 4AEOA 3G1SA 3W1QA 1OG0A 3TR2A 1QNVA 4NT0A 4YCOA 3LGEA 2QEZA 1B3OA 1P0KA 4FNPA 2X30A 4BI5A 2CW6A 3NPVA 1PHQA 4FXRA 1HUVA 1RZMA 1OFDA 4D2JA 1W54A 3Q2DA 1X6UA 1TMHA 4AF0A 4ML9A 1FX6A 1K02A 1KM1A 1FCBA 3HPSA 2DORA 4XKYA 2Y7FA 5ABTA 4Z1BA 3R89A 3GNDA 1XCFA 1PS9A 4UTKA 2FFCA 2OMAA 4DPPA 3TXVA 3QC3A 3NQ8A 4MLRA 1G7UA 4EF9A 1H7NA 3M6YA 5FI8A 4IQLA 3QQ0A 4IJBA 4JN6A 3TC6A 4JTIA 1IXQA 4R53A 1T0OA 2PE4A 3P8JA 2ZDRA 4TU1A 2CLOA 4LC6A 3WJXA 4NJKA 3W1MA 3HPZA 4JDBA 1HO4A 3VI2A 5G2HA 1T8XA 5HNRA 2V30A 2X1RA 3LHWA 3PG9A 2YCEA 4JXCA 2CFFA 4PL1A 3L0GA 2FB3A 1WAUA 1G67A 2ZA3A 1GQNA 1Q6RA 2OJPA 4OQVA 3HG5A 2XN1A 2A6LA 5K9XA 3W1AA 3UQNA 1I2NA 5LHEA 3STFA 1LCOA 2WSRA 1JQXA 3T4CA 1LOSA 3LOTA 1NF7A 1FXQA 2R91A 3IIVA 2DZSA 4RCXA 4QAIA 4MY1A 1PVNA 3C2OA 1TPEA 3S6DA 5D33A 1HTIA 4JTEA 2NXGA 1FWSA 3A5FA 1I2PA 2ZRVA 2QKFA 5EL1A 2A85A 1UUOA 5FEPA 3RLVA 3VNDA 5KSWA 3NNTA 4BF9A 4JX6A 3NXFA 4L4LA 3LLDA 2E6DA 3IRDA 4K8HA 4N9CA 3MMTA 4O57A 4PC8A 2RDTA 1KM4A 4I7UA 1EWDA 4NJJA 1QPOA 1TTQA 1S5TA 1F6KA 2ZZ7A 1VCVA 4WX2A 4JY8A 4MUZA 5CPLA 1RPXA 3NZRA 4GUHA 1G69A 2E68A 4LVDA 2X2GA 3F4WA 1GZGA 1SFJA 3R8RA 3BARA 1LDCA 1TPDA 4Q4KA 1EP1A 4C1KA 2ZBTA 3W72A 3W7QA 1K8XA 4NJHA 2EPHA 3QMRA 4R33A 5DXYA 3GNNA 3O05A 4AB4A 4A21A 3CIXA 3UWQA 1TCDA 1WOBA 4AWTA 3P7YA 5LNSA 5D38A 2J24A 3TMLA 5C54A 1Q3NA 4HT3A 3L0KA 4I7VA 3MHFA 3EXTA 3W7LA 3FLUA 3DU0A 2QCFA 3HJZA 5HR7A 3TROA 3UY7A 5C2XA 2B0MA 2QAPA 4O54A 3SSJA 3NQAA 1LTDA 4WXYA 2CU0A 1H63A 5LKYA 5LNWA 4RV8A 3S5YA 4R34A 2Y70A 3L65A 5AB3A 4JNMA 2C15A 3PULA 3DFPA 2NUXA 2Y88A 1EX5A 3O6YX 3S1WA 3HO8A 3BV4A 3P67A 4S2BA 2V5LA 3G1DA 1ICSA 1YDVA 2GOUA 3LTSA 1GG1A 2WNZA 3M43A 4MIMA 3HGJA 4JTFA 1J4EA 2OT1A 4QISA 4LVAA 2A2IA 3S0CA 2BWGA 3NPUA 1QFEA 4O12A 4RKAA 3TSDA 5H2ZA 3GYEA 3LI0A 4UTMA 1KFKA 1LRQA 3UWUA 4RR4A 4PL2A 3SY5A 1OABA 3M1ZA 1J2WA 4DBEA 1OFAA 2VC6A 1AG1O 5F1UA 3S5ZA 4WJEA 3FYOA 1VS1A 4DF0A 1TV7A 3WJSA 4UTLA 5HWMA 1OK6A 2C0AA 1DOSA 4DELA 4PCFA 3IVTA 2V2DA 3S1XA 3QYQA 2VFGA 3N9RA 2V81A 2J88A 3GXPA 3W7RA 5LGXA 3MYOA 2YW4A 2A21A 3SI9A
chains in the Genus database with same CATH superfamily
2OYMA 1VFHA 2ZX7A 2XIBA 3JS3A 3U7VA 1OGSA 3BJFA 3NGJA 4XAFA 2Q3OA 3A4XA 3P0XA 3R94A 1B3WA 2YR1A 4N4QA 1ADDA 2Z00A 3O6AA 4UTHA 2B7OA 4B16A 4B92A 2AL2B 4JQ2A 4K39A 2G5WA 3AYSA 3W29A 3BSMA 3S47A 3NSMA 2G41A 3SEPA 4LUSB 3RMEA 4HNTA 2W91A 2ON3A 2QQ6A 4GXPA 1A0EA 3BO9A 1JJKA 2XGIA 3ONBA 2CLLA 3WLKX 2D3LA 4H7CA 3WELA 1TUXA 5HOSA 4IGHA 2WHKA 1GEHA 1P6BA 3M6DA 2Z25A 4INFA 1O5XA 4J3WA 3HG2A 4KCUA 3N25A 1ZAIA 4L1XA 4YTRA 3V16A 4FPSA 1ML1A 4NKCA 3VIPA 1JUEA 4L80A 4E3VA 2EKCA 2P10A 3N73A 1OHLA 1A5CA 3LXBA 1VEMA 5DRCA 1RVGA 3GVVA 1HKKA 2OKTA 3WBWA 1VBGA 1PTAA 2QIWA 1TTIA 1KRCC 1KFLA 3GTIA 4HNNA 2VCBA 3PHAA 1HNYA 1JZ2A 4Z08A 2HBVA 1W2PA 3NPXA 4LY8A 3CGTA 1E55A 4LNCA 2QPSA 4AAJA 3NEVA 1PEZA 1ZPTA 4NHVA 4ZTXA 4PB5A 1JCLA 2F8QA 4PFHA 3W1UA 2BP1A 3Q45A 1BF2A 3BG3A 3GNPA 4W8BA 2BVTA 1M65A 1YIXA 2BOGX 3UXKA 2WSYA 1XGEA 3O6CA 3HF3A 4IMFA 3FJ4A 4IOTA 3DX5A 1WDWA 4OE7A 3FA3A 3FOKA 8RUCA 1U1UA 2PGRA 1H09A 3NO5A 3WIJA 1KA9F 2AMGA 5CCZA 5D2WA 4GY7A 1ZENA 4JTJA 5C9UA 3RO8A 2HVOA 5I79A 4GIAA 3KVJA 4XKMA 3WJZA 3GWQA 1M7XA 4LSBA 1HP5A 4J2PA 3KX6A 3NAVA 4TXEA 1JQVA 4C1LA 3H2AA 3ITOA 4A22A 5G2IA 2XN0A 1AFSA 4JHMA 5DLCA 4AWUA 3WNLA 3TQ0A 4C1NB 2DIEA 4WGHA 3P2VA 1SR9A 2J7FA 4ATLA 3GKFA 4TMCA 3TWAA 3Q37A 1UWSA 1GYNA 2ZQ0A 5I07A 4P8VA 2PS2A 1E0TA 2BASA 3HQPA 4IIFA 3VYLA 4BR1A 2BXVA 3QQ1A 1A49A 2D20A 5BOOA 2H3DA 3R11A 4DYKA 3COTA 3FXYA 2X1UA 1VRDA 2VMFA 3W01A 2GVLA 1Z6KA 3QR0A 2VJXA 3PR2A 3B0UX 4N9EA 3FX4A 1RBLA 5D09A 4J1OA 2VZSA 4B2DD 5DMMA 4ZOBA 5HPCA 4HKPA 4JR5A 4JL2A 3WFLA 4J3VA 4UFMA 3EX6A 5K9CA 3R5EA 2C1IA 4KGLA 4LY4A 3GC2A 3KTXA 2IKJA 1AH4A 2YDQA 4A4AA 1XUUA 3GDLA 4C1NA 5GNXA 3W28A 1PZ2A 2IXUA 3BCDA 2Y89A 4H3DA 2E7FA 2OELA 3GBDA 1JNDA 1WA3A 1KM2A 1V77A 1BQCA 2GGHA 2NQJA 4D6EA 3BK0A 4WKHA 2CHRA 2X1IA 4C6BA 3W2JA 5CAKA 2H6RA 1E6PA 3EGJA 5HQMA 5GJPA 3QKZA 4JFUA 1V6XA 3CPRA 4UMAA 2WOQA 4P7NA 3MI6A 4GUJA 1F74A 2WC3A 4C7GA 3MY9A 1QBBA 1E5JA 3CYVA 4L4PA 2WMFA 3MZ2A 4LAZA 4GC4A 1V3LA 2DSZA 2GWGA 4H9MA 4F0RA 2ZE0A 1EWEA 1QNSA 5ABGA 1TCMA 3E2SA 4DO6A 1XI3A 1NWUA 3PZIA 5BWFA 1ZHAA 1HL2A 1NOWA 3KBSA 4HN8A 5EU9A 3TW7A 3ZT5A 3LZ3A 5L6UA 3L68A 1CXIA 3QSRA 1KWGA 4XKYB 2IQTA 3QOKA 1NJJA 2AAMA 4PMQA 1QNRA 4FR1A 1RV8A 3LCGA 1EJSC 1NOFA 2QJMA 2AGTA 4JIEA 1TTPA 2ZA1A 3HGOA 1RXOB 4AVOA 5C9RA 2BTMA 1JD7A 3AU2A 1TA3B 3GY1A 1D3GA 3HA1A 3K8KA 4MVAA 3M5YA 2ISSA 4ZXLA 1UASA 3H12A 1IEVA 1HL9A 3S9YA 1JGMA 1W1VA 2B31A 3TJLA 1FWJC 1NP0A 2WKGA 3ZT6A 1UW9A 2Y7GA 1LWHA 1QW9A 1GW1A 3WF1A 4HHHA 4I90A 5RUBA 3PUDA 3ZWTA 3W86A 3EX3A 2QIIA 5A2BA 1UROA 4HCDA 2P88A 2RGLA 3B8DA 4YVPA 2DP3A 1CZ1A 4PFMA 3SIZA 2NX3A 3TOPA 1NDYA 3HURA 1GPWA 3PPHA 4GACA 4A2SA 1AA1B 4O50A 1VR6A 3PUOA 3WK2A 2FPTA 3UW6A 4CEXC 2E25A 2V2CA 2P3EA 2HNEA 4MKNA 2NT0A 4Q4RA 3MBFA 4DI8A 4DX3A 4EANA 2ACSA 2FLIA 2D0FA 2PDHA 3VGBA 4ILSA 1PL9A 2Y24A 1H5YA 4UMBA 3HBLA 2Y1HA 4AD4A 4PRWA 3DFTA 1ZU8A 3IGHX 5GVJA 1VFFA 1EOKA 1LLOA 2E6FA 2A0NA 4HJWA 4MSSA 4PMVA 4H83A 1XIBA 1E4LA 1WE5A 3E12A 5EB8A 2BY2A 4PMXA 2HS6A 1V3JA 2IKHA 1UIOA 2XH2A 1J0IA 1W1YA 3NQGA 3FAWA 5AHLA 3CQJA 1EDTA 1E15A 4UTIA 1RK6A 1KGWA 3THCA 2X0HA 3QKEA 1KD0A 2I9UA 3CV7A 5CC6A 1GG0A 5LSMA 1K9TA 5E9XA 3SRDA 3U4AA 3UZWA 3C2VA 5DY2A 3UZYA 1NDVA 3S83A 3LHVA 2ZXBA 3G2GA 2YCKX 3SCQA 4C60A 1KLZA 2WMIB 3VIKA 4MWAA 2VFIA 4Q7IA 3PTKA 2GQ3A 3HMJG 4DWSD 1LWIA 2Q3RA 4ZOEA 2C0HA 1SJBA 4RE4A 3FDGA 3RM8A 2V5BA 2VNCA 2DY3A 4DUXA 3LX9A 4JIIX 3VDHA 4PTMA 5LA1A 1R2RA 2PDWA 2REQA 3O0FA 2XSXA 3BLIA 2DVXA 3GTHA 4A8NA 2NQZA 1H7XA 3ARWA 1NIUA 4LOCA 1C8VA 3EKZA 2QXWA 2ZTJA 2CESA 3MJYA 1XIHA 4QJ4B 3R8HA 3AMKA 4RNIA 1YDOA 4DZHA 2ZUTA 3AIRA 3A3WA 3KCOA 1XIIA 4HCLA 4OWGA 4C6OA 4OGZA 3TQPA 1XLIA 3E5BA 2BDQA 2VWTA 5A2CA 1I2RA 4AHPA 4E8CA 3WK1A 1ZGDA 2WO5A 3E2VA 2QS8A 2FJKA 3AFBA 3QC0A 3QY6A 1T6MA 2OEJA 1W3NA 2XVGA 3VKKA 4GH1A 1HIZA 1WP6A 1LJYA 2AQWA 1JUKA 2A7NA 2CXGA 2BLEA 4IF2A 3WJWA 1VJIA 3WH8A 1GEQA 1XP3A 3BOLA 3I65A 2R1NA 2Z2BA 2C79A 3U6WA 2W66A 3ABOA 3QV9A 5KITA 3ES8A 4YS1A 3PZUA 4M6VA 5A8GA 3SGZA 2CLIA 2DUXA 3LK6A 4OTKA 5IFTA 2FHCA 5CG7A 1SJCA 1TPB1 4QG6A 3VNLA 4Q4OA 6REQB 1SW3A 4MWAC 3U48A 2CWXA 5REQB 3VUSA 2WLZA 3OZPA 4JN8A 1OD8A 4FNRA 2WVVB 4MB4A 3NQEA 3OVRA 3FIGA 1SZRA 2J25A 1E9YB 4YHGA 4K1WA 4AZHA 4AFYA 3WZ0E 4DZAA 1J93A 4IFKA 5FF7A 4CNNA 1HJQA 4PBGA 3BGJA 3DAQA 4KF1A 4ZO6A 4H7VA 1KBLA 1FH9A 5J8LA 3SN4A 1HJUA 1JCXA 1DV7A 4FA3A 2VFFA 5IBXC 4ICMA 2O4QA 3ISIX 3VKBA 3QV8A 4QFUA 1YXDA 5ABEA 1F8MA 3G1FA 4S39A 5KEZA 1HVQA 4QEEA 3DFOA 1B9ZA 3PZ9A 4GHRA 4HU4A 1DIEA 2QZRA 4O15A 4WQ6A 1E1EA 1DKWA 3KCJA 1BVWA 2FH6A 1MEHA 3MI3A 4HNUA 2PP1A 4DI9A 1XWYA 4AHOA 5DCEA 4UTFA 4P7OA 2V69A 1JVNA 3BH4A 4QDWA 1MW2A 3C4UA 5HNTA 2UY2A 2INZA 1VYRA 3LUTA 4L9ZA 3UXDA 4RDYA 1RVKA 1RSCA 1JYWA 2CZFA 2WVVA 3HOJA 1QPNA 4HTBA 4ECLA 2DZVA 4J3ZA 2FZNA 4JNZA 1BVZA 1Q65A 2VO5A 1H1ZA 3MMUA 1JEZA 4FLSA 3T2PA 3HQOA 1LM1A 2B7PA 4RXFA 3VM5A 3A24A 5G5IA 3AO0A 2Y0FA 3LGGA 2ATMA 4DAIA 4RPQA 2P0IA 4D6GA 3BUVA 1REQA 2WM1A 1XLMA 1J5SA 2GDQA 4J3TA 3IV3A 5A6BA 3O8AA 1Y65A 2C7FA 2VRJA 4J35A 4QXIA 3LCHA 1ZJAA 3CHDA 1XQLA 2ZADA 1VHNA 5KTLA 4OV4A 2XH7A 1A5KC 1BTCA 5E6YA 4JIRA 3R12A 1I0BA 1A0DA 2PMQA 2ZX6A 3W07A 1TQXA 4ZO7A 1S5NA 4UQBA 1WO2A 3H6OA 3BSHA 1ISWA 1C93A 3TXZA 1ISXA 4NYUA 4FMVA 2WVTA 1JCMP 2BVDA 3VX0A 4M1BA 4C6CA 1M03A 3VMNA 4RE2A 1NVMA 2CKSA 1GUVA 1A80A 1WXYA 3SADA 4I7WA 4PE8A 4OV9A 4AXKA 2FVKA 3LCIA 3NXLA 2HPIA 4DLMA 2BOFX 3H53A 3KS6A 3B8SA 3CAWA 2HCVA 1XR2A 2Y5EA 2Z4GA 1OF6A 3NTYA 5HULA 3QV7A 3KWXA 3G1AA 3WCZA 4IGMA 5HAOA 2J9XA 5BZAA 1C8QA 4M0XA 2ODOA 1BFNA 5ECUA 4DAFA 5CC3A 3SCSA 4MADA 3W26A 1OZQA 2VC9A 4NZFA 1MXGA 3AXMA 1SYTA 4LVGA 1UKPA 3QHMA 1UOZA 4MZ1A 1XLEA 4W93A 3ARYA 4IGNA 4ALDA 3AMCA 4Y6GA 3BVJA 3TW6A 5AYXA 3M64A 4GWEA 4J3SA 4V27A 3GZ3A 3E0WA 3EKLA 1H4PA 5EA9A 3SM0A 3UERA 4RLIA 1MYRA 2PLCA 2D0GA 4UCGA 5F4XA 1XS2A 1W8SA 3BE7A 1EHNA 1ODZA 1R7AA 3B9AA 5LIUX 3VKDA 4S2CA 1P48A 4D6HA 2C3ZA 5AC4A 3PC0A 3TAOA 3WLRA 2XWEA 2YFNA 4CN4A 3WH7A 3UG3A 1JDFA 4ROQA 2J7HA 5FJJA 5CLTA 3SY8A 2HPMA 1KCLA 5CZTA 3HB9A 3RU6A 5AHFA 4UOZA 1CWYA 4EPBC 4C5ZA 3U7BA 1PKNA 5AYZA 3EX4A 3O2LA 3VFLA 5I3DA 1S1RA 3EDDA 5I02A 5H6HA 4BI7A 4GINA 4OVXA 2D0HA 4F0SA 2P0OA 4WUIA 5H8MA 2DIJA 2ATSA 1TWDA 2RDWA 1MW3A 1JYXA 2DDXA 3HM7A 3CL8A 3MV11 4D6CA 5FIPA 1QNPA 4Q32A 1ZUAX 1BKHA 2R82A 3IACA 1BKSA 4K7YA 3GXMA 1KW1A 4QGCA 3OOQA 4IFOA 5G1YA 3ZO9A 4IJCA 1NFPA 2WVSA 1I60A 2DZTA 5CGQA 1B31A 4Q8TA 3ARRA 4LV4A 1PWMA 1FDJA 4O1CA 1UKQA 4W84A 3S9IA 1XF0A 4FOJA 4RK8A 3M0MA 2VZVA 3M44A 5EBAA 1A4LA 5A95A 3ZVIA 3NZQA 3QY8A 4MKSA 1UJPA 4KWUA 2VKZG 8XIMA 3PJUA 3CIWA 3WD0A 2QJJA 3W1NA 3G1YA 1C9WA 3GHTA 1TKKA 1DXFA 3N1AA 2J8TA 3UD6A 1IXPA 1EYWA 4OHQA 1EC7A 4XD4A 4UNIA 4YU1A 3MSDA 5EMYA 3MJMA 5CBIA 4JTAA 5CZSA 2WXDM 3HGRA 4UTTA 3TZFA 3W7GA 1KQYA 2PTWA 1T5AA 1OC6A 5AKQA 3SAZA 3WH5A 1ENUA 3KW3A 1CGWA 3OPSA 4JIHA 4C6QA 2E6AA 3W1TA 3CC1A 4O52A 1LRNA 3RILA 3SCVA 3V18A 1IEWA 1V7AA 5IDIA 3ZFHA 2ACUA 2V38A 1VZWA 5U4NA 2NSXA 3UG5A 1QDSA 1YTDA 4DJFC 1DEDA 2ZKMX 3ABRA 2X1TA 1XSJA 4ZBCA 4CVWA 4HU3A 3C0LA 1Q6DA 3CUZA 3Q67A 2NV9A 3UZXA 1CBGA 1P0EA 3IIOA 3MA8A 3AXXA 3AIBA 3W81A 4S23A 3TA6A 1KBIA 4GI6A 4D8AA 3SRKA 1KXTA 3PBMA 2HBXA 1E4IA 1HJVA 3SQMA 2A7PA 2FKPA 3A3XA 3LNPA 5A6AA 1H2JA 4WDTA 3V36A 3KTCA 4NQ1A 5D02A 3UWWA 1SJAA 1XIEA 2JEQA 4F8XA 1LBMA 1WXJA 3FHAA 3W2KA 1VHCA 3ARQA 1TZZA 4QE1A 3DHFA 3CL6A 2YYTA 3RCNA 3GE7A 1XRSA 5CJMA 4R7WA 2RJHA 3VXGA 4ADSA 4HNVA 3C8FA 1XG3A 3M4HA 5I2UA 3B9EA 3NDOA 4X0NA 2X1SA 2QW5A 3AMLA 3QW3A 2YDRA 2ASHA 1YXYA 4KGJA 2Q01A 3HJEA 1YNYA 2GJXB 4DZIA 4W7WA 1XSKA 1I0DA 3ANVA 3CO4A 5I3FA 1W1TA 5LGZA 2P1FA 5IHRA 3EB2A 1GOIA 2WB5A 3IJDA 4Z17A 4IL2A 4O1AA 2GUUA 4WCJA 3K46A 4NVTA 3SCOA 1CGYA 3F5JA 3OQ8A 3AHTA 1PZ3A 3KEHA 1LG2A 3S5SA 1PX3A 2HNHA 5G4WA 4GZIA 3NQ2A 4A3QA 1IF2A 2JIEA 2BNJA 1OCJA 3CV1A 2HVMA 5EPDA 1WZLA 1V6TA 5FL0A 2F7FA 1W56A 2VL4A 4MY9A 1F4HA 3SCPA 2XFFA 4JNYA 3CB8A 4AUBA 3R7MA 4XAGA 1IIGA 3K8MA 2XZ9A 4B91A 2Z1XA 1EQCA 1YTKA 3BCJA 3T2OA 4FALA 4CVUA 5D9NA 3GH4A 1RA0A 3WF4A 1Z8AA 5MHBA 4FR6A 4B9YA 1QAPA 3WD4A 4M1RA 3GU2A 3QFWA 1DXIA 2BOEX 4KW2A 3DG7A 3QPEA 5C5YA 3PANA 3GK0A 3SR7A 1TREA 1T7LA 4Z2LA 1JD9A 4LAOA 4D72A 3NURA 3ID7A 2EF9A 4KH2A 3NWRA 4FZIA 1PPIA 1TPFA 4LPCA 2R9RA 4HMNA 3L2IA 3WUGA 2ZVIA 4NJGA 3OZYA 4MAVA 1FWDC 2ZUVA 3H2MA 3NQCA 1ZP3A 1OD0A 3H54A 4YYFA 1UBPC 4C7DA 3VUPA 4Y9PA 1HO1A 4HA0A 3RCMA 1MUWA 3QY7A 2HEJA 3KL0A 3IUDA 1POKA 1UWAA 1DORA 1OFEA 1GZ1A 3ABXA 2OLHA 2QLYA 3VDAA 4L61A 2VEFA 2A6NA 4KFPA 2WZHA 2OLSA 3N34A 2VR2A 1IZKA 4HZ6A 1ZL1A 3EEGA 3G8EA 2GUBA 1UZHA 2VHLA 5PTDA 1O94A 1SM9A 4RZ5A 3W88A 2PDFA 4U2ZA 2D73A 3QRHA 1QASA 3MB9A 4TX9A 4E38A 3EX2A 3WD1A 1RUSA 1I1WA 5D8ZA 5HXMA 1IEIA 3CMFA 1IT0A 4TV5A 2WSQA 2YPIA 2R1MA 3P61A 2WK2A 3NGFA 2FZBA 5FEWA 2VCCA 5TNVA 4IPPA 1IXOA 1DWJM 1THFD 4ZODA 4RE3A 4UR8A 1H7WA 1E1CA 2Z1WA 1E51A 1IWAA 1TPH1 3LERA 1CNVA 3CQHA 1BYBA 2A3HA 1J0YA 3H55A 5FSDC 1M6JA 3NQ6A 2YKKA 2NVAA 1H61A 2B4GA 3ZLFA 5HANA 4AEOA 3G1SA 3T4WA 3WNPA 4ZR8A 3GG8A 3AMGA 2QEZA 3VTRA 3RCYA 1P7TB 4FNPA 2X30A 4M80A 4KERA 1U30A 1HUVA 2EPKX 2VX5A 1OFDA 2Q71A 4D2JA 4W7UA 3I10A 1XYFA 1TMHA 3KBWA 2V3GA 3HPSA 4NG3A 1Z7AA 4Z1BA 4DNMA 2OMAA 4KCTA 2HK0A 1G7UA 3O0KA 1VBRA 1H7NA 2W61A 2FMOA 1IXQA 3WQEA 4R53A 2ZDRA 4LAKA 3WL1A 1FWEC 4LC6A 1MFVA 1ZZMA 2NVCA 5G2HA 2G4JA 3A4WA 2V30A 2IQDA 4J7RA 3E74A 4W85A 1ZBKA 4GFIA 1G67A 2ZA3A 1GQNA 2ZUUA 2A6LA 3W1AA 3CHFA 5CQ1A 1GKRA 3T4CA 1SR0A 1LOSA 2R91A 2DZSA 2V63A 4QAIA 3B8TA 4OBRA 4IIBA 3KS5A 2XPKA 5LA0A 1TPEA 5DX7A 3BLLA 2WJEA 1HTIA 3UF9A 2BBFA 3AHZA 2PU0A 1Q4WA 2A85A 1XIDA 1RALA 2VGGA 5FEPA 3VNDA 1GQIA 3VINA 3HV8A 4ZSUA 4GYJA 3UESA 4F4RA 4PMZA 4DJFA 1ZBCA 3LN3A 2HDJA 3IRDA 4K8HA 2INFA 3WH9A 1CXKA 3IJLA 4HNOA 1TTQA 3CZLA 4EAYA 5C2CA 3CQIA 1N8IA 1KXHA 3EKGA 3BAXA 4IG2A 2ZZ7A 3GC4A 2D2OA 1VCVA 4QHRA 4KRTA 3A64A 4MDPA 5CPLA 1RPXA 3SGGA 1BPLB 2PAJA 1GK8A 2GFTA 2X2GA 3F4WA 1GZGA 4XAPA 4H04A 4F3HA 3E3HA 4J5NA 1LDCA 3GW3A 4UZUA 4PUKA 3PTMA 4NJHA 4PUNA 5LXEA 4PZVA 2PDCA 3N2OA 3DG3A 4R33A 3M7SA 3HPAA 5DXYA 4GA8A 1LL7A 3OLIA 3UWQA 3S1GA 4AY7A 1WOBA 2WC7A 3P7YA 3ARTA 3BJSA 3ZXWA 4I7VA 4J2MA 1GOOA 4XAYA 4RV3A 1E6ZA 3CMJA 3ECQA 1FFRA 2WSKA 3RITA 2D69A 4R34A 2ZUNA 3L65A 5AB3A 1U1JA 3R10A 1R0MA 3LS9A 2NUXA 3MDWA 2V5JA 1XD0A 3P67A 4S2BA 3G1DA 1ICSA 4DJED 2PDGA 3WEMA 1R86A 1QW8A 4JEJA 3UCCA 2WNZA 3LQGA 4JTFA 4LVAA 2J8GA 1B5TA 4O12A 4UWMA 1KFKA 3UWUA 2WBGA 3EMCA 2F6XA 3LYEA 3M1ZA 1J2WA 4DBEA 5F1UA 1OSEA 2PDBA 2AL1A 3H4XA 1CTNA 1A47A 6XIMA 5I00A 3RRXA 1V6WA 1DOSA 5DMLA 4NZ1A 2VGIA 2V81A 5A6MA 3PZTA 3W7RA 2OQYA 2Y2WA 2DUZA 4UCFA 1FP8A 3N29A 4JTKA 1K9DA 3WLLA 4HOXA 4EPKA 1EUAA 3A4AA 3VABA 3H2CA 1E3ZA 2ZC1A 3GD6A 3UCDA 1DJYA 1ZLPA 3KBVA 3KRZA 4IH3A 4HHMA 5D2VA 5AOUA 1W1PA 4RDWA 5EY5A 3R2GA 5CAHA 1BLIA 5CPNA 2R14A 3NZGA 2DW7A 3G0XA 3VGHA 3TN6A 1TJ1A 1UG6A 3TN3A 1W3JA 3APTA 2UY3A 3T78A 4MB3A 4ZQOA 3IANA 2VDHA 2QCCA 3PBGA 2GQ8A 2IPWA 1K8CA 5EMJA 3D0CA 1QI4A 3UZZA 2CLKA 3VIFA 1DP0A 1RQBA 2YBVA 2UV8G 1EJTC 1TWZA 1A0CA 3ITLA 1J12A 1W9XA 4EX4A 2QCMA 3FVMA 4EACA 3SB0A 2OODA 4AIEA 3GAKA 4DYEA 4GXMA 2J9YA 3WQDA 3THAA 4WR3A 2ESCA 4QG9A 1HFBA 3TNOA 3MP4A 3W22A 1QNOA 1J9YA 2BY3A 4W5UA 4XSLA 2QUNA 2CZEA 3EDKA 1Z44A 2DH3A 3RNDA 1QATA 2O7QA 4HHPA 4R85A 2E9MA 1UD3A 1D3HA 3GB6A 1UCWA 4PEKA 3QFEA 1KCKA 3T7VA 5BNKA 3ZJ7A 2P8CA 2GJXA 2J4GA 2YA2A 1SW7A 3N2CA 3RJXA 2V67A 2ZFAA 4M7SA 4DM1A 3JW7A 5AY7A 4E4FA 4GQ0A 5BU9A 3C52A 4V28A 5M3WA 5J5DA 1E72M 5IFPA 3HN3A 3O06A 2G37A 4UQCA 3R0KA 1MRQA 2XSAA 3TVAA 1JDDA 4NXSA 1BG9A 1EGMA 3DFQA 3L5LA 5GPRA 3ATYA 1IQ8A 1PIFA 3DESA 2ZUWA 5D2YA 4DWDA 4HNLA 3RM4A 4G1KA 3NL6A 3CUHA 3BSGA 3D46A 4BFAA 2R1KA 3T0CA 1U22A 2OZ0A 1FWAC 3L66A 2FYMA 1G6CA 1SUXA 3CHCA 3QQWA 1E9ZB 4M51A 5BW6A 2E1WA 4KESA 3SFKA 4O17A 4JOMA 3R8GA 4ZZ9A 3N18A 2PUZA 2WMHA 4IUGA 1XM3A 3LA4A 2NQHA 3PS7A 4HOZA 3B0PA 4ONVA 4GXWA 4L65A 3MKKA 2PWEA 3LRLA 3G1XA 3REQA 5JIPA 5DN1A 4MZYA 3IK2A 1UIPA 2JGYA 3N15A 1OY0A 4CKQA 1ITCA 3GH7A 4AZCB 2XGBA 1KCZA 2QJIA 1TWIA 4NYYA 3W2UA 3W38A 3W7PA 3GKAA 4GBUA 3Q94A 2VWSA 1ZQ5A 4YYCA 3KZPA 5D4YA 3ITTA 1UB3A 4NJIA 3I3DA 1WDPA 2AQVA 1WZKA 5A6KA 1JYNA 3QMSA 4G5DA 3VIJA 4D1JA 2GK1B 3SUWA 4BKNA 3LCLA 1EJUC 3ZR4A 3QYSA 3VDGA 3LZ5A 3PF3A 1WQ5A 4NNBA 4AWSA 3ZM8A 2AKZA 4FO4A 4MJ2A 4H2CA 4LCSA 3IS4A 1U5HA 4I8YA 2F6UA 2PDUA 3UU0A 3P80A 5E70A 3W7KA 5HNUA 1WBJA 3F2BA 3TFCA 2QULA 2YLLA 4Z1DA 3FY1A 1O6IA 4HK7A 4FNQA 4J40A 2AAAA 1UC4A 1X39A 3RYSA 5D2XA 3P84A 2PC8A 1F5ZA 2TSYA 1RA5A 1KFWA 3GU9A 5GQBA 1YXCA 3OZMA 3VDCA 3GFYA 3PZGA 3TLLA 2NLIA 1SO6A 2VX4A 4AIUA 3E0VA 3M5XA 3KBJA 4K68A 1RD6A 1RBAA 3AHVA 1X1NA 2XVKA 1B57A 1DJIA 3HTWA 4KIEA 1W1IE 3OEXA 5TBOA 4QDPA 3T07A 3EDFA 5HJXA 2Y6ZA 1Y5XA 1Y7VA 4FLQA 5D2TA 4FXJA 1O4UA 4KETA 2X05A 1RJRA 1SSDA 2QDGA 1YNPA 5JBEA 4G9PA 4O53A 1R2TA 4R88A 1WDRA 3MC5A 1JFHA 4F79A 3A3HA 1X98A 3W25A 4F0KA 3NSNA 4B5SA 1K8ZA 2G96A 1H50A 1X97A 3AYVA 3C0JA 2RFGA 5LYRA 1TX2A 3IARA 5HMSA 4YTTA 2QJNA 2XIJA 3UR2A 1B3XA 4XZBA 4TX6A 2V5KA 4TX8A 2JEPA 4K37A 3F5KA 1V79A 3LBMA 1KB3A 3AHXA 1E0UA 4G6CA 1YPXA 2PURA 4O8RA 4LUIA 3KP0A 3W0KA 4FF7A 3B9NA 3STCA 4D8LA 4S38A 3IIZA 2QPXA 1X7IA 3UNTA 1YLVA 1C29A 4MWAB 1CB2A 1GTHA 2RH9A 1R6WA 2W6RA 5BCAA 1CI1A 3EPOA 4E8DA 1YE4A 5HNNA 4DBWA 5LNUA 1RY0A 4AD2A 5A6TC 3SY1A 1NH6A 3PBYA 2V9DA 3VGDA 3BAWA 3EA1A 3R4IA 3MANA 2DVTA 3KL5A 1O12A 5I6SA 1KBKA 3IAQA 1AQFA 4C6MA 2A3AA 2W79A 3CWOX 5K4ZA 3W24A 3KM8A 8XIAA 4IX2A 2PODA 2HTMA 4OKDA 3BW3A 1XLJA 5ECVA 3EWDA 1V6UA 4KKXA 4CD5A 3M0HA 4O14A 1TPVA 2E8ZA 4QITA 3DI1A 1W17A 5C6MA 4E2BA 3FA4A 4XG1A 2OZTA 4WLCA 4PMYA 3NUKA 4F9JA 3ELFA 3SCRA 4RW5A 3DFYA 2W9MA 2GOKA 1UP3A 2G50A 2VEMA 3K5XA 2OOGA 2FH8A 1W1B1 4H01A 1B0IA 4ZA0A 4LS0A 1JFXA 3EA3A 5DO8A 1H7PA 3SUUA 2ABAA 2CLFA 1GVQA 3EWBX 1E3XA 1ME8A 4UFHA 2E9BA 4QROA 4AX7A 4Q4PA 4WSJA 4XVEA 1GKPA 4PTVA 2OG9A 4IUOA 2W67A 4N6EA 1Q45A 1TR1A 4LCRA 4ZQRA 2OZ8A 2QGHA 5FF2A 5I06A 4LFYA 3BMVA 1JXJA 3ZYZA 1JZ5A 1EEPA 4GPNA 1H11A 4XZLX 3FGCB 1VB9A 4YNGA 1EDQA 5F4WA 1F6YA 1XRFA 2J77A 1EO7A 1EB3A 3S1VA 4ADTA 1YNQA 4ZE5A 3RAOA 1Z32X 4NY2A 1G4TA 2PDMA 4NX5A 4CNUA 2J6VA 3QH2A 1OJXA 1VPYA 4EF8A 3EMQA 5D9PA 3WQ4A 4DO7A 4MPQA 2YIHA 4OOUA 3TIMA 3K2GA 2DGAA 3A12A 1E43A 3WMSA 4GZEA 3H2OA 1VD6A 1E6NA 3ORWA 2ZC8A 4AVNA 5F1VA 2CLHA 3EWWA 4GQQA 3M0LA 1YYAA 5A8OA 2YXOA 1F05A 1O5QA 1B90A 3MW7A 1XYZA 3AS0A 2UY5A 4PODA 2WZMA 3F03K 2PGFA 4HCHA 4PH6A 5I77A 2ZZ2A 5LHFA 1A4MA 3U5YA 3KOFA 5FCZA 1IZJA 3OQEA 3WH6A 1GGOA 3ZJKA 3AZRA 3CLWA 1WKDA 2Z0IA 3L7RA 3W3OA 2Z7KA 3NZ1A 4YHEA 2E40A 5CPOA 4QE4A 1QO5A 4P2VA 1EL3A 1D7FA 1OCNA 2GWNA 1KBBA 3KVLA 1KCXA 3CEUA 1XUZA 4OBSA 2TYSA 1UD6A 1PKYA 4ICNA 4ZXOA 3FW6A 2VC5A 4H6EA 1LQ0A 3TLQA 1WZMA 1DPMA 1NWTA 1V6YA 4GQGA 3QZEA 1W3KA 1XYBA 3EOLA 3EPMA 3L12A 3TWBA 1HN1A 2QJGA 3ITXA 2G95A 1LBFA 1E1CB 2Z1KA 1TPC1 4W88A 5G1TA 4S1FA 3UXAA 3WUEA 5FF0A 4A05A 3R0DA 4V1XA 3G77A 3VX1A 3EBVA 1MWOA 3WLHA 1RP9A 3VKAA 4GUGA 3CTTA 3KOYA 3H7VA 4MNKA 2R94A 1NDZA 1JUBA 1TV2A 1UH3A 5CH9A 4H9XA 2VYOA 3TYBA 4TVDA 1XH2A 4ZO9A 3RF9A 3NR0A 2OX4A 1MQPA 1M7JA 2QCGA 1S2TA 2IXVA 1A3XA 3VD5A 2QCNA 3OYXA 3ITGA 1JR1A 4GCXA 4N9DA 1GYLA 4PUEA 3U57A 5K7JA 3STPA 4DF1A 3U3HA 4KFNA 4GMEA 3PBUA 3TSMA 1JPMA 1GOMA 3AJXA 3AUOA 1W5PA 4DM2A 1Z48A 4AWEA 1W9BM 5AYBA 1FBAA 1MQRA 3E02A 4HYWA 2Q8LA 3S46A 1J79A 2YDSA 1OYBA 3TTSA 3M0VA 1Q5MA 1UKTA 3DXIA 3CXOA 1P43A 3M5ZA 2IPJA 5E9AA 3O1NA 1W3TA 1QI5A 1RCXB 4JAWA 2OR2A 3IAPA 2QT3A 2GJRA 1A5AA 2WMIA 2XH4A 3A23A 2J8FA 3RUBL 2ZRYA 3FGCA 3GIPA 4AHQA 2VX6A 1J0JA 1W8GA 2ZDSA 1L6YA 4MLJA 1SZFA 1NSJA 4LC8A 5FF3A 5GNZA 1I8JA 3ZZ1A 2G3MA 1YE6A 3VNYA 4I8DA 3SBFA 3BJTA 4DJEC 3MCOA 1GPFA 3NPWA 3RPMA 1XD1A 5DXXA 2V3DA 4L1GA 2G97A 1O66A 4LAMA 3ES7A 4ERGA 4GFSA 1Q13A 2WAGA 1ONEA 3ARUA 4NILA 3A21A 3V4BA 4UTWC 3BAKA 5CGMA 3ZJ8A 3ZSTA 4IM4A 4DJFD 2OO6A 4IX0A 2CZ5A 3QBUA 4WKFA 1BTMA 1W31A 4M8UA 1PKMA 3NEHA 2GUYA 4GYKA 4QR6A 1IT8A 4RJEA 5G1MA 4JKLA 5C55A 1CCWB 3DERA 2UWFA 1XCXA 4AYSA 3GIQA 4I6VA 1UD4A 1W3LA 2BHUA 1DWHM 3G8RA 4FX7A 3PM6A 1QR7A 3CB3A 4IPIA 3WENA 4D9PA 3DG6A 3PPGA 3LM3A 4CU6A 4U10A 4S3KA 4GNKB 5DQPA 4GO9A 4K6AA 5I3KA 3WLOA 1JDCA 1EH9A 3CV2A 4JTGA 3V0SA 1XKYA 5CKSA 2XYLA 2G3IA 3CPGA 4JTDA 4ZTYA 3W83A 5FJIA 1TIMA 4E2OA 1EPVA 3G3DA 1XL9A 4KFOA 1ICQA 3MVIA 4N42A 4Q8WA 1SO5A 3RFAA 3PWGA 3IVSA 4PSRA 1RQEA 2PCQA 2FTWA 4A3UA 1DHKA 2RDXA 3MO4A 3WQPA 1EJ7L 2PF8A 3NL3A 3W9ZA 4UC5A 6REQA 2YL8A 4Q8UA 4FIRA 5A1AA 1GVSA 3IEBA 3MUIA 4OIFA 2CYGA 2XM2A 5KZEA 5I03A 1HT6A 3WDQA 2QJHA 5FJTA 4X3ZA 1F8IA 3E0LA 3BGAA 3OA3A 5C70A 2AGKA 1YDYA 2Q8ZA 2PDXA 1EP3A 5KZMA 5DCBA 1OX4A 3BLOA 3TR9A 3GLCA 4DXKA 1R9XA 3KAOA 4O18A 1XBVA 1TV8A 4HU8A 4XIMA 4Z42C 1XGDA 5CSYA 1PV8A 2XISA 2NZLA 1OC5A 1JL8A 5EBUA 4XB3A 5CXPA 4Y8EA 4JYFA 3N6QA 9XIAA 3AMDA 2NUWA 3ZIZA 3N12A 2DZBA 5A6BD 1UZDA 3B8UA 1VFLA 1HQTA 3CWNA 4GYPC 2ZX9A 1FWWA 2OO0A 3TAKA 2DIKA 4R7OA 3VZYA 3PFRA 4WJ8A 3URQA 2OCZA 5CSUA 2A3EA 2KX9A 1JPHA 4FF5A 1FWFC 3GO2A 4D8ZA 4IGSA 4XD3A 2NW0A 1KGUA 4AF0B 3AYTA 1ZAJA 1NF0A 1B9BA 2R1PA 1OIMA 3QZAA 4WVXA 3LTYA 1VYPX 1OX5A 1W9VA 3FA5A 1Y5WA 1DQWA 4PB4A 1VJSA 2GL5A 4DXVA 4QG8A 2KZHA 4ZL1A 1FKWA 2ZOXA 5K4XA 1FCUA 1PBGA 3ZR5A 1K77A 2FIQA 3N2BA 2GDVA 2JK2A 1Y0EA 4Q8NA 2QUUA 1U5JA 3B0YA 1SO4A 2PDPA 1KV5A 4ASTA 3GVQA 2TMDA 2ZRWA 4BI6A 4YMZA 2VUYA 3LXCA 4CQBA 2Z29A 1DJXA 1TMLA 3MSRA 4JGDA 4X2PA 3I6RA 3FJLA 4C6DA 2ZRZA 2IS7A 3SI9A 1KNWA 3SIMA 3GR4A 1MUCA 1ITQA 4J4KA 1KRBC 2CXEA 4DUVA 2R1LA 4ROPA 3POCA 3RJYA 2A3BA 2JKEA 3SFWA 1HKIA 2JKPA 1GZJA 3M41A 3N19B 4LRSA 3P82A 2EG7A 3GXTA 1NELA 3OVGA 1BSIA 1PZ1A 4ZQNA 4MWAD 4AMCA 1PIIA 1EOMA 3N2MA 3AS3A 4HBKA 1W1A1 5BU6A 2X09A 1DIDA 2PDIA 3MHGA 2FJUB 3BLFA 3EDEA 2PB1A 4GOAA 1CENA 1J5TA 3DENA 2C1GA 3SJ3A 5KINA 3M0KA 1W0MA 2F6KA 3Q65A 1OT1A 4ZFCA 4YXGA 4N2YA 4JIPA 3TV8A 3IGUA 1Q6EA 1Q6GA 3AROA 3TTEA 2FB2A 1Q4NX 1C91A 4FS9A 4O0ZA 4ML4A 3MI2A 3W53A 3TNBA 3UFYA 1XKJA 4WY0A 2OGYA 2PGEA 2VT0A 4GLEA 3WMBA 3G24A 3BOFA 1BYAA 1O5RA 3V7PA 4JTQA 3UXIA 2WPBA 3WLPA 4B5WA 3P5ZA 4MAZA 3A13A 1V5XA 5HUOA 3DFSA 3CQ0A 1FVPA 3USBA 4ORIA 3TC7A 3VOFA 1DYSA 1BWVA 1UQZA 1VQTA 3W2MA 1GVEA 1J0HA 4O13A 2W0UA 3NA8A 4RE0A 3PZNA 4WF7A 3BMWA 1TWWA 5CC7A 3ZR6A 1LOLA 2ZRXA 4MFEA 5AN7A 3PJXA 2Y4SA 4FLRA 1E40A 2C13A 2EG8A 2EPLX 4YLWA 5SWUA 5G2WA 2VUNA 1AQHA 1TO3A 3P8IA 1EXBA 3C3NA 1JG9A 1NARA 3UJFA 1UR1A 2UZ9A 3PNUA 1WAWA 2OX1A 1X8CA 2XVNA 4MB5A 2GK1A 2VRKA 4JD4A 1MI3A 4MHBA 1HGWA 3H22A 3U2ZA 2I1OA 4EWJA 3VD9A 7ENLA 4DPQA 1U33A 3OLGA 1JDAA 3K4WA 1WXZA 1TYGA 3VKCA 3CAQA 3H24A 3IIXA 3KDNA 4WGXA 7REQA 4RZBA 1EYEA 3W2LA 5J04A 4Q6JA 3CS2A 4GY0A 1E1FA 6XIAA 4Z0SA 5CZJA 3BQ5A 2XJ7A 5K2ZA 4CQ8A 1KM5A 2J27A 5JH2A 1HL8A 4IHCA 5CJ5A 3I6EA 1PAMA 2BGQA 4ZOCA 1QCWA 3WDRA 4ZENA 1JZ3A 2WHMA 2WNNA 3CM4A 3GNOA 2ZXAA 3RK8A 4PTNA 3LENA 3O3RA 5LA2A 5KMYA 3MCNA 5K3VA 3SRFA 4IL0A 3KE0A 4L1WA 4TTGA 4A8LA 2C71A 3LPFA 3SZ8A 3W7OA 4B4FA 5A5WA 1L6WA 1KM6A 1MO0A 1DTUA 4YL2A 3CBWA 4QJ1A 3BQ6A 3W71A 4F9DA 2E5DA 2WZIA 4EXAA 2I14A 4BJHA 3NG3A 2QDHA 1FH7A 1TR9A 3WD3A 2CEQA 4QJ5B 3R79A 1T40A 1OX4B 4YTUA 4W9TA 4TQTA 1E73M 4A2RA 2GGJA 1P0DA 4BS0A 3AIUA 1TPUA 3VD3A 1M01A 2VZTA 5D05A 1K03A 4FNSA 1PDZA 2O4MA 4K8GA 1RAKA 3WLTA 7TIMA 5CBBA 3G0UA 4XO6A 4AZCA 1ZJHA 3IRSA 2XGZA 3FN9A 3T55A 3UR7A 1A53A 1WOAA 3OZOA 4BQ5A 1WKFA 2F38A 1XCWA 3BLEA 2J7CA 4KQNA 3TZNA 4DWSC 3CQKA 3RN6A 3RO6A 3RDKA 2P76A 4H41A 3N17A 4BQ2A 1XIGA 1R46A 4IIHA 2OWCA 2XVLA 4OUIA 2O9TA 4CU8A 3N4EA 1TRIA 3EXSA 3W84A 1K7FA 1S3TC 3W7MA 3B97A 2C8NA 1JCYA 4HZ7A 4MM1A 2QV4A 1KFCA 3AHYA 3E2RA 1TX0A 3F4VA 3U8GA 3QLDA 1BQGA 3QHNA 2XFWA 4MFDA 1TE1A 3RRAA 1JCJA 5JVLA 2TODA 2CLPA 5E5CA 3UZ5A 5DY3A 4DO5A 4BEQA 1M5WA 4IMAA 2PTXA 1GVFA 4CNOA 1VEPA 5AVHA 3H2FA 2EBNA 2W4XA 4H8NA 1IE7C 3WLJA 4LCQA 2YFOA 4AZGA 2PBGA 1I2OA 2NV2A 2X2YA 2YSWA 3T0AA 2BGSA 5A8PA 4UQEA 3TA9A 1QNVA 2YCJA 3TYEA 4NT0A 3H23A 3T05A 1K6AA 2D24A 2CW6A 3NPVA 3P6LA 4FXRA 1RZMA 3PAOA 2ANUA 3S2JA 3TP4A 4AF0A 3S2LA 3EEZA 1FCBA 3NOYA 3S9ZA 2DORA 2AQOA 3T9PA 2X0YA 3GNDA 4XIAA 1PS9A 2FFCA 3GM8A 5IXEA 3BZJA 2FGZA 4E8GA 5T91A 5FI8A 4IQLA 2O0TA 3TC6A 5I7GA 2OSWA 1XV8A 1O68A 1T0OA 2YBTA 4TU1A 4AY8A 3SO7A 2IPGA 4PSPA 4JDBA 3GTNA 3ITYA 1W3HA 2X1RA 4JXCA 3UCQA 5AZ0A 4UQ9A 3DUGA 4X0VA 1WAUA 4EE9A 4Q8VA 1SFTA 3DCPA 4OQVA 3OW1A 3VMPA 3UQNA 3DDMA 5LHEA 1IR2A 5I0DA 4IQDA 2WSRA 1W32A 2QUMA 3LOTA 3G6LA 1NF7A 3SSZA 4PB3A 4IP5A 4DB7A 1E4MM 3B0XA 1TVNA 3S6DA 1SFSA 3MDUA 1B3ZA 3VIHA 1UZ4A 1FWSA 4P7RA 1V0KA 2GGEA 3ANUA 4D71A 1BAGA 5EL1A 1UUOA 3MZNA 1A3WA 3PP7A 1NWSA 2FHBA 3K8LA 3B8VA 2QGYA 3VNJA 3N11A 3NXFA 4L4LA 3AUJA 2E6DA 3P0WA 4PC8A 4PULA 4GC3A 3TEVA 2FDMA 3GFXA 1EWDA 4H9VA 1OCBA 1I9CB 4WX2A 3WLSA 4JY8A 1RBOB 2ZXQA 4XV0A 4KRZA 3H8AA 4GUHA 2QPUA 4LVDA 1SFJA 4MF4A 4NAFB 4BCEA 1EP1A 5FJUA 1YX1A 4C1KA 2Z26A 3FAXA 4H1ZA 2EPHA 2X7WA 2I57A 3MVTA 3GNNA 2CERA 1FA2A 4DJDA 1TCDA 4PBEA 2JF6A 3WNKA 5C54A 4HT3A 3BWWA 3MHFA 1DE6A 1J8VA 3FLUA 3HJZA 3MSGA 4H19A 3TROA 3UY7A 2D2JA 4IQJA 3SSJA 3NQAA 4GJJA 3W4RA 4WXYA 5LNWA 1H63A 5LKYA 1Q8AA 1UPMB 3WX7A 4RV8A 4LYQA 4W5ZA 1G01A 4UR9A 1S5MA 5TF0A 3FYYA 3DFPA 3OBAA 1EX5A 3S1WA 3HO8A 2Y5JA 3BV4A 2V5LA 2OZ3A 4LB4A 1YDVA 3REQB 3LTSA 3ALFA 3ZOAA 2W63A 4MIMA 2X0SA 5I09A 1NFGA 2CBIA 2BWGA 3NPUA 1QFEA 2OU4A 4RKAA 5H2ZA 1YBQB 1BXNA 4LH8A 3M46A 2OYKA 4RR4A 4LB3A 4FI4A 2Z24A 1QUMA 7XIMA 1K9EA 2JALA 1OFAA 2VC6A 1C7TA 4WJEA 3FYOA 1VS1A 4KEMA 4DF0A 1FTXA 1TV7A 4UTLA 1NWRA 4Z1YA 1E0WA 3A6OA 4S3FA 4DELA 2V2DA 3S1XA 4DHGA 3N9RA 3G6MA 1OG6A 2J88A 3MTWA 3L4YA 2VEGA 1UP0A 1JCNA 3VE7A 1XIFA 2XIIA 2PFHA 4WSKA 1DQUA 3DBNA 1LT7A 5BOFA 3I7SA 3TMQA 4L4MA 2OGJA 2DSKA 4LTSA 1VYSX 2JBMA 2PSNA 3MS8A 3R1ZA 3U2OA 1L9WA 4IQEA 1UWRA 2NVDA 1P7TA 3CAKA 1GW9A 4GZ7A 3DKJA 3OGVA 3VGEA 3GVWA 2VRQA 4QSFA 2Y62A 3VOCA 4C6PA 4HPJA 2VFHA 1UKSA 4GO8A 1JZ6A 5EYWA 4Y9OA 1KV8A 1MW1A 3GS6A 1GJWA 5D8WA 1S2VA 5I3GA 4H9TA 2IPFA 4RNFA 5U7SA 4P8WA 1MXDA 3IGXA 5F2IA 3E0IA 3BV7A 1AQ0A 2E3ZA 3DKLA 1GVYA 4RW3A 2PWDA 3LCXA 3NJ3A 3MMDA 4ZE4A 3DOPA 2I5IA 4OECA 3GXDA 4LV9A 3RPDA 1R9YA 2GJPA 2WC4A 4ATDA 1ME7A 4IT1A 2BVYA 4LBRA 4HMCA 1ZTVA 5FOOA 3CUIA 1GKQA 4W4QA 3IUHA 4KCWA 3W75A 1BF6A 5BXRA 3TYCA 3WQCA 2ZZ4A 4MB1A 3RG6A 1ZJBA 2QVHA 1J0ZA 2PLJA 2J7GA 2RUSA 3KP1A 4GJIA 1ZNNA 2ACQA 3ZWSA 3DFNA 3BG5A 4I9TA 2I9EA 3PZOA 3LBOA 5GJNA 2ZZ6A 3KCLA 1RD5A 3QOMA 4AG0A 3WYZA 4JTSA 1OC7A 3W74A 1OFRA 3LLFA 3M5VA 1AJ0A 4DRSA 1XLCA 3C56A 3ZVHB 1AK5A 1FHUA 3CO8A 2I56A 1V0LA 3NVDA 4UR7A 4XBKA 3BAJA 3GHRA 3IJ7A 1K4HA 3LCWA 3VC6A 2DZAA 1US0A 5DMYA 2V3FA 2WHLA 3CZJA 1WNOA 4CGTA 1SPQA 1MXSA 2XU2A 2HJPA 1CXFA 3VAVA 4IPNB 1W3IA 3UBPC 2WNQA 4Z2JA 4CNPA 1WCGA 2WMJA 4HTYA 3KUMA 1TZ9A 4OZOA 4WDXA 1LLWA 1FHLA 1KTCA 4JPGA 3QW4B 4DF2A 2WMKA 3CHEA 3QTGA 3APGA 4U3AA 3BW2A 2GVJA 1KM3A 2PDQA 1XFBA 4KBXA 2OQHA 1VFOA 3UA3A 1MRAA 2VR5A 4R7JA 1U1HA 1AJ2A 3KBNA 2PWGA 3BCFA 1L0PA 1EJWC 5DELA 3UG8A 1SGJA 2W3ZA 5AC7A 3K1DA 2EPNA 1EO5A 2HVNA 4ZQPA 4DXXA 1DQXA 4KWWA 2EKGA 2WCAA 4GIEA 3GG0A 2QVNA 3UWZA 4B5XA 2RAGA 3UZJA 3W7HA 4Y7EA 1XGZA 5HBFA 3PWAA 5DMNA 5XINA 3SW6A 2GJNA 6ENLA 1VJZA 1Q2SA 4AD3A 3GDKA 3FK4A 3GHUA 4GQBA 3WSUA 4AY1A 4P8XA 2Y8VA 1FUYA 3M9YA 2C1HA 3LLXA 3R25A 1KRMA 1UC5A 3I4EA 2H9AA 3ICJA 5MF5A 2DEPA 3GDBA 5FEZA 3W1RA 3E9AA 3WMLA 4PMDA 3WL0A 4Q8PA 4QQ3A 5AFDA 5A6SA 1RH9A 4GUFA 3K13A 4O1BA 2WCSA 4CEUC 3SCNA 4I9MA 1CLKA 5FF4A 3GRIA 5GJMA 3U4FA 2Q6ZA 1R5YA 3F7JA 3VKJA 3R13A 3WBXA 2GGGA 3A47A 3AXHA 1TE6A 2J79A 3PB0A 3W7NA 2DZPA 1DJGA 3UR5A 1YDNA 4D6FA 5JIWA 1E70M 4WOQA 2YW3A 4N4PA 3V75A 5F2MA 3ZMRA 1OK4A 4X9YA 1UQYA 2W62A 3GTXA 1B1YA 3FSTA 1HP4A 3EX1A 3L5AA 4JTLA 2VFDA 4X22A 3O63A 4PMJA 5HJYA 3FKRA 5CGTA 3LB0A 4FLOA 4HJFA 5BROA 1Q8JA 3T42A 1UKOA 1WX0A 3T40A 1G1YA 1EJVC 2QCDB 1C3FA 2CCRA 1UWIA 4LUTB 2IQ0A 2PCEA 2ZRUA 1I4NA 3NFUA 4CCDA 1NP2A 2VDIA 3WF0A 3MO7A 3EYPA 1U83A 1ICPA 1VC4A 1UWUA 4U4MA 1K7XA 1TELA 2EJAA 1J11A 2CLEA 4PMUA 3EOOA 3OVPA 3EWUA 4XTDA 3WY1A 1F3TA 2IW0A 3LMZA 1O7AA 3KVKA 2B7QA 4G7EA 4PRRA 4CNSA 4KRUA 4F2UA 4ZGYA 4RNJA 5DBTA 1RPKA 3LRMA 4UFJA 4K38A 4IXHA 1HKVA 2AKMA 1DJZA 1M1BA 4H9YA 3FHQA 2JQXA 4XUGA 2CIPA 4MG4A 5CSSA 2ZX8A 1IXNA 4NZCA 2ISWA 2J62A 1BSLA 1IYXA 1YPFA 5AHNA 3HG4A 3SCTA 2J7BA 2C16A 5B7ZA 4ZB5A 5C2GA 3TSBA 2BY0A 3PB2A 4NRSA 4TMBA 4IPJA 1HKJA 1TWSA 1US2A 1LP6A 4QM1A 4JTUA 3C86A 3UWEA 1PCWA 2CITA 5BXTA 3NL5A 4FNTA 1VLWA 4CQCA 2PA6A 5EMLA 2QUVA 3XINA 4DWSB 3NQVA 2Z2UA 4LANA 4G7FA 3NO3A 2WHJA 3GZAA 3NM3A 1XW8A 1DIKA 1S2CA 3WBYA 9CGTA 5CBJA 2VENA 4QCEA 4BQ3A 3AIWA 2PWUA 3POHA 4FX8A 3H4WA 5D30A 3HV9A 2FZMA 2RJGA 4HP5A 4YWIA 4M81A 1OM0A 2QUTA 3MUY1 4F2TA 3TONA 4D6DA 1HXJA 1ME9A 2E0PA 2PDJA 4AYGA 1V03A 2YLAA 4HD5A 4PEEA 3FNDA 1Z89A 1GHSA 4WEVX 3C0QA 5HQLA 4A3RA 3EXRA 4JTCA 1OYAA 1JRBA 4AD1A 1HVXA 4LBUA 4M24A 3M7WA 4ACZA 3RXZA 2R8WA 3O16A 3S8HA 3VOHA 3JVAA 1V7YA 5JU6A 1TMQA 4D1IA 4HK5A 1Q6OA 4HYRA 2VURA 2V6AA 1IT7A 1RK5A 4MMWA 4WIWA 3A9BA 3OG3A 2HS8A 2FGLA 3QGKC 3SECA 1EC9A 1N55A 4LQ1A 4TVUA 1W5MA 1F6PA 4Z1AA 3L21A 5M17A 1X7FA 3L4XA 1EA9C 4E0CA 1OZMA 1XRTA 4JYDA 3N9SA 3LBCA 4NI8A 1CXLA 3I7QA 2Y7DA 1OVDA 1BGGA 3W1XA 4HVXA 4ZSTA 1U2YA 4K2SA 3B0VC 4LS1A 4M6PA 1Q2RA 1P0NA 4FSAA 2R6OA 3RX4A 5M2FX 2IKIA 4NIRA 4US5D 1WDSA 5REQA 3W37A 2PF0A 3PPCA 1EF2A 5D32A 1GOWA 4H9UA 4LT9A 3B03A 1FRBA 5EKYA 4XUYA 1DL3A 3ERPA 3T44A 3H4GA 4DJDD 4IFRA 3W1LA 2FDSA 1KFBA 1XJBA 4KS0A 1TV4A 1X8FA 1KM0A 3CH9A 1YKWA 1NM9A 1N82A 3B4YA 3M47A 1VAHA 1F73A 4ORMA 3NZPA 4ZQCA 4CQ9A 1DJHA 1LLZA 3DYPA 1Q7QA 2F61A 3HFTA 3KL3A 4Y8FA 3VK5A 3UWYA 1PUDA 3P62A 1LL4A 2PEVA 3L5MA 4ACYA 3TN5A 4OUEA 4RUBA 4JFSA 4MUPA 4G8TA 3ARPA 8A3HA 5LNVA 3AXIA 2ABBA 1H51A 3II1A 4QNWA 3F4NA 3GW0A 4LEFA 2XFYA 2G3FA 6ALDA 3THUA 3MKVA 1F4AA 4MY8A 2V8ZA 3RMJA 1JF5A 2TRSA 3B05A 2V5DA 2WWCA 2VXNA 1SZNA 4C6EA 1H1NA 2H8XA 4HB7A 3Q58A 3GSMA 3AIQA 2PTZA 2V82A 4S3EA 4OJYA 1OGGA 4O28A 4OT7A 4EVZA 2BMBA 2DJXA 1V51A 7PTDA 4WD0A 4ERIA 5TQLA 2HRWA 1VGAA 1XISA 7A3HA 4MNLA 1DWIM 2QAFA 4GBDA 5H1WA 3LV5A 3NIYA 4PBFA 1KWKA 3UA4A 4XK2A 2HQAA 4NZ3A 4MGGA 4AD5A 2XSBA 3A9IA 4JN7A 2O7SA 4GQRA 1MEWA 1GOQA 1HG3A 5I3IA 4DJEA 4UTTC 2NQLA 4YVXA 3B04A 3LGDA 2G4FA 5DCDA 5EMMA 1SVDA 2SFPA 3CLMA 4CD8A 4D6IA 4LBSA 2E6YA 2QCLA 3LSBA 3THQA 1DJWA 3HGSA 3IV8A 3UT0A 3LY0A 1GT8A 4NZ5A 4EP8C 3W70A 1GCYA 5AC6A 3VO0A 4F0LA 3D3FA 4HHLA 4O0KA 3FCPA 4H4IA 2OSYA 3L4TA 4W8LA 3IJ9A 5LXXA 2V5CA 3W23A 2O92A 1S2UA 3XIMA 1H5VA 5FKYA 1SU5A 6CGTA 1Z42A 2ZZ1A 1IEXA 2YA1A 1AQMA 3ARXA 1XC4A 2XFRA 2Z1SA 4MZ8A 5CPQA 1S5WA 3DYOA 1G9HA 3DC8A 3S5OA 4I5XA 1R3WA 2WQPA 4IISA 1QI3A 3KFTA 4IMEA 5BYWA 1EXPA 2E5CA 4M7TA 4QIUA 1KR1A 4DEFA 3C2YA 5MKGB 1OADA 2OTDA 1CLXA 2WKJA 4GYFA 1AL7A 3R43A 3BL3A 2GGIA 3RGTA 4O4WA 2GZXA 1BVNP 3BAIA 4KEVA 4Z1CA 5XIMA 4A8RA 2BODX 1W37A 1X1ZA 1FCVA 3B4UA 1ZBVA 3W6YA 5G4HC 2EG6A 1LT8A 2VEKA 3MV01 3UJEA