4AVJA

Structure of the fimh lectin domain in the trigonal space group, in complex with a methanol triazol ethyl phenyl alpha-d-mannoside at 2.1 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords FIMH
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4avjA00
5F3FA 4AUYA 3ZL1A 4AVJA 4AUUA 4AV5A 2WMPB 4J3OF 5LNEA 2UY6B 3RFZA 3ME0B 4XO9A 4XOCA 4XOEA 1KLFB 1N0LB 5AB1A 3BWUF 4BUQA 1KIUB 2JTYA 4X5QA 4J3OH 2J2ZB 4CSTA 5JQIB 1TR7A 4XOBA 5FWRA 3MCYA 5ABZA 1UWFA 2VCOA 4XO8A 4X5PA 5F2FA 5FS5A 4J3OG 3ZPDA 3BFWA 3JWNE 5IQNA 3SQBB 4XODA 2XG5B 5FLUA 4AVHA 4CSSA 5AAPA 5AALA 1N12A 4AV4A 4AVIA 4XOAA 3JWNG 4CA4A 2UY7B 2W07B 3ZL2A 5LNGA 4AVKA 5CGBA 2XG4B 4AUJA 5IQOA 5IQMA 4AV0A 4X50A 3BFQG 4LOVA 5FX3A 4ATTA 2JMRA 3JWNH 4X5RA 1QUNB 1ZE3H 1PDKB
chains in the Genus database with same CATH superfamily
2NY3C 4GOSA 1I53A 5AB2A 2VC2L 2VAAA 4B9ZA 2EVJA 2BVOB 2QKIC 1FBIH 4DOHB 1KN4H 2X4RA 4PLJC 1A4AA 1PFCA 2BNUA 2QV2A 4OCLC 4XOBA 4L29B 2YBRA 4Z3TA 3LV3B 2J21A 5F6IC 1UYWH 3UBHA 1DZBA 1V3LA 2DZEA 3QQ4B 3KPLB 4OZHF 4GBXD 5DEZA 3RVUC 5I1CH 2Z91A 5D1QA 5D1XB 1U8IB 2YUXA 3PWVA 3VGGA 1KGUA 2VXQH 5DUMH 4M7JL 2APXA 1KCUH 1EEQA 4PJDF 2CLVB 4X7TA 4AGOA 3LRGA 3SBPA 1IAIL 2KDYA 4HKBB 5KSAA 5FR3A 3QEQB 4YHML 1G7LA 5A1AA 3SDCA 3IDMA 1JCKA 4FFVD 2FLMA 1R47A 5DQDL 4HIXH 4QNPF 3SQBB 3U83A 4MXQC 2F53E 1SXCA 1AGBB 3HG5A 3FRPG 3PQYA 1KCVL 1ZV2A 7FABL 2QPDB 1NCNA 1QVOA 2A9DA 3BWAA 1HL4A 5KVFE 2P44B 4TS6A 1UM5L 4O58H 4QHKJ 1GJIA 3V5KA 1BV8A 2EAEA 1ZLWH 4BWTA 2GYSA 1G5GA 3AITA 4YIQB 2GJ6D 2F58H 2KDGA 3BKJL 3HE7B 4TNEA 3TT1L 1LEGA 4XNUL 3KW8A 1EH9A 3RE0A 1GCFA 3BKML 5CD3B 4Y4KA 5HJGA 4L4JA 3IJSA 3K2KA 2MNUA 3DV6B 3FB7B 4C4BA 1J1OL 3HLAA 3ZUNC 4YSRA 1X7QA 1AQHA 1FYTA 2ZZUT 3QRGH 1RXLA 4GKSA 5E8NA 4PJ7A 3QB7C 4UYPA 4JFFD 1BXVA 4RDQG 3K6SB 4LCCC 1BZ9A 1CFSB 3EHBD 4L8SB 4BKLB 3K6IA 5L2KE 1JYXA 3ARFC 2FATL 3EDEA 2WZPA 4E0RA 4GW5B 5E9DE 1KCUL 4MB5A 1JV2A 2JCCF 2ZX7A 4LBEA 4G42B 3RUGF 3FRPA 2NY4B 1X44A 3MLUH 1AR1B 4BBWA 4JPWH 2D03L 4QRPB 5J1TC 1UOVA 1SBBA 4DCQA 3L81A 4J2XA 4H2CA 2OI9C 4R3SB 1A25A 5AALA 1INEH 3AWGA 5DK3A 1FNGA 2X9WA 3FUEA 1P9MC 2DBLL 1VKXA 2B1HH 5EO9B 1GJWA 2YAMA 4XCFH 4UQ2B 1BZOA 5C3LD 2CA4A 5C9JB 2O93L 2AC0A 4G5AA 1QUPA 5D72L 2OFQA 5E00B 5DMKB 4U05A 5BUPA 1J48A 1MJ7H 1E2WA 2XPYA 1AGDB 2Q9OA 2XN0A 3QXUA 2A6KA 4PJAA 4TLKA 1BQLL 1KXHA 5FGCB 1O9WA 3MDJA 1E28B 1RQ5A 3QUZC 4BH7B 4E9VA 1R0AH 5I2IA 2RALA 4H4NA 2MRYA 3G9AB 1LE9A 4PV8A 4FQCL 3AU1B 1BQLH 1KIQB 4IMLA 4KFMA 3C87A 2V6HA 1QQDA 3MLWH 4DOHE 4FFWC 5ITFA 1M6OA 2V9RA 1N6UA 3FYIB 4WENB 5EZLB 4YX2L 3MYJA 2D9CA 4OGQC 1BZ7A 2Z7UA 4G9DA 1E4JA 2EC9U 2RD0A 3JTTB 4HS8H 1JZ4A 1ET8A 3HG2A 3D07A 3SOBL 2WNKA 4EN3A 2WMPB 2GFBA 5IQ9B 5CMAB 3MGOB 1FNEA 4OZ4B 2VSMB 3F85A 4P5TD 3DK0A 3EO9L 1YEGH 3DRTA 3THML 3FN0L 5CILL 2RA1A 3K46A 4G7SB 3BPLB 4CA4A 2KPNA 4YS4A 1P84J 2F54D 1CXLA 1OK8A 3OWRA 3PWPB 4XN7A 1KFAL 2JIXB 1AS6A 1JZHA 1U8LA 5DMGD 1FGVH 3LN5B 3NIGB 4X98A 2OYPA 4F37F 4Z1PA 3FU3A 3SGDI 5ISZE 2OL3A 2EXWC 4PVMA 4LVOB 4A1RA 1NC4D 4Y2NA 1AACA 2ARJQ 3R06B 4KTDH 4JDEB 4HAFA 5I73C 3Q3GB 1DQDL 4JQVC 4LNVA 5D2LA 2OSLB 4DGIH 5D7IB 4JX0A 1H8NA 2DWEB 5T1KD 1WEJL 3MRMB 1BJ1J 1JZDC 1OARH 1KT2B 1T20B 2CBMA 2IWFA 4H1LG 1WITA 1R17A 3HNTL 1ZHLB 4HSAC 2MCPL 3CXHJ 3IEAA 3MV9B 5EF1A 2YQ2A 3CFMA 4KVCL 1IC1A 5DJYB 2EVIA 2IOIA 3QUYD 2ZWSA 4RQQB 2XZQL 1RPKA 2F8IA 1HYSC 3ARGD 4KH9A 3VMNA 4TNGA 1QATA 4PJCF 3P4OA 2VN5A 1PSKL 3MLPA 25C8L 2KLSA 1CDGA 1FE8H 3BGFB 4UB0H 3V4LA 5HHQB 2W07B 4LSUH 3N40P 3EYUL 4AQAB 2JE8A 3JVFC 3OHMB 1HL8A 2FQEA 4P4RA 2JF1A 5BZDA 5F6IB 2YFOA 1BZEA 3F01A 4WFHD 1S7RA 5D1XC 3M7OA 3CN3A 5IV2A 5SWQB 1LHZA 4WWKD 1A7BA 1JRHL 1E8WA 1L7IH 1ZT7A 2J6EA 3BP4B 4U0QB 4WJ5A 1ZLSL 1M6UA 4F7CA 1QNZH 5I8OH 1NAMH 4NFDA 1S7WA 1YECL 4C57C 2WVUA 3B5TA 3OLEA 4X9YA 5JOFA 1PS3A 4E9SA 2IADB 1MFMA 1X5ZA 3FT2A 1JAEA 4KJPD 4Y4HD 5ELIA 3CXFA 3EXLA 4Q8BA 1GTNA 3QDGD 3SBWA 4F7PB 5F89A 3HG1D 4U4BA 1CL7L 1YPZA 2HLFC 2WXIA 4O5LH 4QYAA 4WWKA 5CEZL 4XNZC 1TJHL 1NEUA 2HPOA 4DP0X 1Z9SA 5AAWA 1MZYA 5JORB 2BW5A 4XHJD 2CDGB 3ZDXB 4P9MH 3LKOB 3VI3F 1J87A 3JV4B 3UPCA 1RZ8B 4H5SA 3MPCA 2WN2A 4HZAA 4J8RB 4PJ9D 2H26A 3CBKB 4DKEH 3QS3A 1CLYH 1DQKA 1LE5A 3PGCB 3LQAC 3ATEA 1J88A 3HC4H 5JPMB 3V0AC 1WEJH 4L0YA 4RMSA 4YZWA 1CDYA 4O02B 3X13A 4Y4KC 5K9KA 3VJ6B 3SDAD 3QUYA 1EIBA 2XWBA 4JFQB 4LQFL 4NC1C 3GXMA 3FQWB 3KPNA 5K5YA 3EDDA 4F37K 5KN5A 4HHWA 1ILSA 1G7PB 3SBWC 1PG7L 4Z7UA 4GO6B 3FCTA 3BFWA 1T7VA 3IRCA 4MNQE 1U58B 4NN6B 4XMUA 1ONQB 5FKAA 4AVIA 3WN5C 1T22A 5JQ6H 3TA3A 4YL4A 3CVBA 1NGYA 4N26A 3V6OA 1A14H 2A9MH 3PHQA 2JTDA 4PJEF 4MX7A 2CO3A 5T5FA 4OZFA 4DTGH 5EO1B 3WEXA 5F96L 4YHYC 1JRHH 3UGEA 3N42B 1W0WA 4FNSA 5D9SB 3GIVA 2R0KL 4LB8A 1G5AA 1ZA3A 1XL4A 3NFNB 4XP4H 4YFLI 4OFPA 5I5IA 3LV3A 1AC6A 1E5BA 1NEZG 3MRKB 2V5TA 3MV9E 3UAJD 2G5BA 3T9WA 1NGPL 3QNZB 3HHRB 3KYMB 4Y4KD 3PWVB 1YEEL 2LE9A 3CVHB 5SX4I 3UJIL 4HWZB 4BZ1H 1E3FA 2MOGA 2NW2A 3OKMB 5DJ8A 4AI7A 3ULVE 3C6SA 3IGFA 4GUPB 3WAJA 1QBML 2VQ1B 2ID5A 1XF2A 1EJOH 5L0QB 4NDMA 3ZQXA 2YD1A 1QLRA 3KPQB 3MJ8B 3CH1B 3ZE2F 2FBOJ 2FZ3A 4JRXA 4RDQF 2VUYA 4JY6B 4IBVA 5H35B 4XCYB 1SOKA 2BDNH 1NZRA 2F7IA 2GAZA 4GO8A 3QULB 3FCSB 4IBTA 2X4OA 3L2NA 5BRZE 1JZ3A 4FZ8H 3MRHB 4P5MA 1DSWA 1Q72H 2BC4B 5DRXA 4F1ZA 3QNXA 1C7TA 3DX6A 2BW4A 4Z5RA 2PO6B 1ZDQA 4DQOL 1DJWA 4YSDA 1WGOA 1RZJC 1INQB 4PMEA 4IGBC 4HWUA 1HZHH 3ABKB 5GIRA 5CZXC 4FJYA 5E94A 2R1YA 1JD7A 1KGXA 3QIWC 5HHMB 4I48B 2DB8A 4U1NA 1F13A 2BJMH 3R8BB 1SN0A 4QRRB 3LNIA 4X6EB 4K23H 2Y7QB 3DO3A 4EO5A 2BWDA 2LU7A 3O45A 4ZT1A 1OW0C 4IRJB 3F58H 2BSRA 1A4KA 1RK0A 2FECI 3S36L 4RRPG 1OSPL 3QEHA 1NBVH 4NSKA 3ATBA 5BVPL 2LFGA 3SDAC 2V33A 1FFTB 3T77B 4XNYH 3QXDB 1O9VA 2YD2A 3MRDA 5I17B 3RUGA 3T2NH 1ORSB 4M6NH 1NANH 4NENB 5ICXB 3G5XB 2HX8A 3SGJC 1LLAA 3O3DB 1JGEB 5C08D 5T1LA 3ZOAA 4LKCB 4U3SB 3Q7JA 3UJTH 3F6IA 4J12A 5GPRA 1MHPH 2AXGA 4HKJB 4TNFA 1TDQA 3T08A 4IGBD 1IAOB 3TYGH 3MRNB 2W59A 3QPKA 2P8MB 5DRZA 4N25A 5IQMA 1UD4A 4ZTPL 5EN2B 3FUJA 2ZUQB 4BH8A 1N64L 1P5UA 3FTGA 1W6LA 4FFTA 4JO2L 5I8CA 5EBGA 3TA3C 3GJEB 2JXMA 3WFDH 3VE0B 2CGYA 5DRNB 5I66B 1NWPA 1REIA 3IJHB 4U6XA 4XZUA 5EBWA 2GJ6A 4GY4A 3GBMH 4LT7A 1F4HA 4K94L 1KIQA 4IMLB 3Q6FB 3JWDL 3KAAA 3RBSA 4IIQA 5DJXB 1MI5E 1HHIB 4JY4B 5KYYA 4EPSA 3QZBA 2FEEL 1JXKA 5BVJB 1FV1B 1G7QB 2QPSA 1OGAA 2E9JA 3CHSA 4TVPH 3W11C 2AKRA 5L4IA 2DQTH 1BEYL 4GPVA 3QZWA 2ROYA 3VUAA 2OTUB 1UOLA 5MHSD 1SNRA 3DUSB 3FDWA 4JN2B 3F7YB 3STBA 3WDIA 4JPWL 1GA2A 2LLGA 1MY5A 1PKQA 3BISA 4Y1TA 3QHTC 2BZDA 1RKRA 4JL1A 3EGDA 4WHYG 1FZMB 1U3NA 1MVYA 2VC2H 5FYKE 3CMOH 1YG9A 1JGDB 3LIZL 4PGZA 4WW2A 2P5PA 3DJTA 1AGCB 4GB9A 5HYEA 4ANUA 4RIRB 3POCA 1QLFA 4BK8A 4NHCH 5LDSA 3ARTA 3JWOH 2A38A 2APTA 3QORD 5I75B 3SQOH 3LIZA 4S1SL 2Z65C 2C1PA 4OFIA 2CLZB 2GIMA 2I5YH 3MYZA 5TDPA 3MHZA 5CZXD 2GBVA 1TMQA 4FI7A 2FK9A 1PZ3A 2RJMA 5AB0A 3NESA 3SB3A 2QGBA 3X1EA 5C3IA 1OGPA 1XIWC 3IETB 5F9JB 3O81A 2HB0A 3KPPB 3T65A 2F58L 3BKJH 3WD5H 3HKFA 1CDCA 1VCBC 2WLMA 3DJRA 3J07A 1LO4L 4NNXB 3GQFA 4TSAL 5EO0B 1HSBB 4IS6A 3EGSB 3SYPA 1E4WL 1ZIBA 1KLUB 4RESB 4A38A 2XWTB 3CDCA 4CILA 3QUMA 3R1GL 5FW6A 5JMOC 3NJLA 1AFVH 3RFZA 4QOKA 3APDA 3LPPA 4KK9C 1IGTB 2UY7A 3RWGA 1IKFH 1A6ZB 1F1GA 3UZQB 4HJ0C 3HIZA 3R19A 1Q9KB 3F3HA 4ES8A 5C0CE 1YYCA 2UZYB 4NHUB 4G6FD 3FQXB 2F6AA 1KCWA 1EXHA 1GPOL 4ONGL 4W9KC 4OIFA 1YA5A 3S96B 5LN8A 1OAUL 4JR9L 4N2OA 3E8VA 5KSVB 1V3KA 1SHSA 2NY2C 1EV2E 5C7ZA 4TNWK 2E56A 4R7DB 3U82B 4Y9EA 2X4SB 3MUJA 4LSTH 1I1YB 1EEYB 4LP5A 4DUWA 1D5BA 1E27B 5L2JA 4ZRGA 4X0KA 3QZOA 5DQ9A 4IJ3B 4ESKA 3DYMA 2OX5B 1NMAH 5D7IE 5EMYA 4XWOD 4BGDA 4Y16C 5CSZA 3LPWA 3FT3A 3MLXL 2QFRA 1H3UA 1OLLA 2I26N 1NLDL 2VISB 2Z4QA 4OD1H 3PIQB 2HT2D 5E7FA 4G71B 1UXWB 2R29A 1SUJA 3OKKA 1PX3A 1XBDA 1SYSA 4JHAL 2WINA 5AW9B 3U7YL 1CR9L 2DWSA 1E6OL 5CBEB 5F71A 2W81C 1T1WB 2DWDB 4X9FA 2OLDA 4AQ8A 3HI1B 4NT6B 3TEUA 4FG0A 1MXDA 2G4GA 2A1WL 2V3FA 4NO0B 1MWAH 4AGPA 2YPVL 3RGHA 1KG0A 3GZKA 4HSCX 4QF1B 3RP1A 4UMGA 5JPMA 5GS0C 4DK6A 5FECB 1GGBH 1CFQB 3V7AG 4ACTA 4M62H 4ODWB 3UBXA 4Z7NE 1F90H 4P57B 4LSQH 3MXWL 5B39A 4XMLH 3ZDXF 4QR7A 3TZVC 3KVPA 3G3LA 1NPNA 1SFHA 4YGVB 1S8DA 4PRPB 2J56A 5EORH 3WYRA 3X1GA 3UIZA 1CGSH 3WUWG 3RVVC 2GBUA 2V7NA 1MHCA 4FEMA 3GBEA 2YD4A 5AUMB 1KF9B 1T89A 1NKOA 4D9LL 2RB8A 3MRFB 1Z66A 4FHJA 5AKVA 3THMH 1N26A 1Z5LA 3ECBA 5FUCE 2ATPB 1YEDB 3LKSB 2OXHA 4L2YA 3IFNH 5ESAB 5BRZD 1DYZA 3GM0A 4L3ED 4YNYA 3NABL 4PI2A 1IGYA 5DFTA 4QI3A 1OGTA 4PVBA 3ARXA 4AYDC 4Z3FA 3J27A 3D25A 3KH4A 3BSGA 4JHZA 3RZCC 4DZBA 5A3ID 5KVGL 2WLNA 3HZ3A 4IDJL 2AQ2A 1P7QA 2R69A 3S8WA 1T1ZB 2C9VA 4WFGD 3HG4A 1KYOK 4KJWC 1XCQA 4KK8D 4O9HH 3K72A 1R19A 3FHAA 5CLTA 4JRYD 4NPYA 3IU4H 3NA4A 3NZ8A 1NANI 4YZFF 5G5DB 4KTGA 4FMFA 1R33A 3D09A 2EXYC 3M7FB 3Q9QA 2G5RA 1RHHA 3P3RA 1KTDB 3QDME 4MJHA 2BFVH 3CDYA 4PIBA 3UO8B 4XX1G 1DSFH 1N10A 1GGYA 3UC2A 4XXCC 4A7SA 3L3IA 1CB4A 2DEYX 2B2XH 1MZZA 1Q0YH 1HOCA 2HFTA 4Z78A 3NQIA 4NLHA 4JRXE 2X89D 4V1DA 4A6YH 4B9YA 4HH8A 5BS0A 2ZKWA 4H0LC 5GZND 1NFAA 2B2XL 2B9BA 1WHOA 2HG5A 1ADQL 4ZW6A 2JELH 2JJUA 2NSMA 3GB7A 3PNWA 2A0LD 4DP4X 1QSEB 2VLKD 5I1GH 3NAAH 3VFTA 1D5IH 5C08A 1KC5L 2YQBA 1XEUA 1ZLVK 4XRCA 3VWJD 3BN9D 4U6YA 3QDAA 4FQQB 1KYOJ 3GMLB 4KVNL 1PG7W 3L16A 5JW4M 3W81A 4EZJA 1BDYA 3AREB 4LGSB 3C2AH 4NGHL 1IV8A 1RIVH 5DFWH 2XV0A 4G6AC 4PR5B 1FORH 2AK4E 4PM1A 2CBTA 1MFDH 3K1KC 3GSVB 1WZMA 4G11A 4MYWB 1U41A 4G8GA 2PW1B 3OBAA 3LQAL 5JXEA 1MNUH 2O26U 1U3ZA 2VDQL 4X99B 3QRGL 2WLLA 1PMYA 3E9TA 4M7ZC 1KCBA 2JI3A 5CEXA 5BUAA 4MCZB 3RA7H 4S1DC 3X1NA 4JAMA 4FX5A 4IDLA 4UQCA 1XR8A 5IVZA 1CT8B 1JIBA 1THAA 3APCA 5DA0B 3VDCA 2DBJA 4U31A 4V2CB 3OKOB 5L8KB 4KO5A 4X8CA 4QIRA 1CURA 1ZY9A 4IHBA 5DYOB 1SVZA 1KTBA 3E6FA 2CK0L 2VXSH 5F97E 3TLRA 4HKJA 5CF3A 2LLNA 3RNKB 3CZKA 3QCVL 1TNNA 1O6TA 3CXDL 3VU2A 3IB4A 2X05A 5FLVA 3BH8B 1N5AB 5IJDC 5IESH 4HIHB 3K2IA 4LEXL 1KBWA 5IVXE 1C16A 1LNUA 2BNQB 3PYCA 1T89C 4NQDD 1B0WA 4LRNH 3MGTB 4ZQKA 5ICUA 5LBSA 5E08H 4F7MB 4PRBA 5F8RC 1S9XB 3NTCH 3C12A 3SKJL 1UWXH 4M7KL 5CNHA 4RGNB 4R96B 5IF0B 5C1MB 4N9GA 2YPLA 4UT9H 3VI4A 4PJXE 4AGNA 1H5BC 1YPZE 1I1AD 1FJ1B 3LNDA 3L5XL 2ZPKL 2JLLA 2A83B 1MW1A 3FQ1A 2VLJA 4GAAA 1OCCB 1C8PA 4OZIA 4TL4A 3ISWA 3I75A 4YDLC 3AGWA 1GXEA 3LEVL 3NZHH 3DVNB 4TUKL 1OOAA 5GGRA 4I4WA 3GGWB 3BVNA 2X7LA 4YO0A 5F9OL 3V6OE 3WNPA 3HZKA 1J0YA 5CWSA 3CDGA 3T0VA 4PB0L 5B21A 2A6JA 4ZXBC 1MN4A 3OHXB 2HLAA 2K70A 5F9OH 2EE9A 4B9CA 4O4YH 3ZHDA 1QI3A 5DURB 3UDWC 4HXBL 1KGYE 4S2SB 2O4EA 2A74A 1IC7L 2AJUH 4WAFA 3L4VA 1GC1C 1OWWA 1YUHB 3KM1A 1BX2B 3ECWA 3NRQA 2V2WA 2CJUH 3B3BA 4RA3A 4FP8L 4N24A 3TJHD 3U1PA 5EU3B 2WUBL 4PJ8B 4KJYB 3VNYA 3C60D 2A77H 2XQ0A 5INCA 15C8L 1AZUA 3GC3A 1OT4A 1CC3A 3DHPA 1J8HD 3FFDB 1HI6B 1S2EA 1U4EA 3GBML 4UAOB 2HCZX 4AIZB 1P84K 5DVPA 1Y1DA 2ICEC 2BSED 2Y07H 3WFCL 4JDVB 3GMRA 5DMIL 3TBTA 4PJFE 5E1IA 4D0DA 3BUQA 2ESVA 2DM2A 3IJYB 1BD2B 4Z77B 2CGRL 2WVTA 1F3JA 3LVEA 3EGSA 3QJUB 2BCKB 1TSRA 1I9RL 3F65A 1NIBA 3RU8L 4OSUL 3F7QA 1QEXA 2QHRH 4UIKH 3T8XB 3BRDA 1IGTA 4FL4B 4ODUA 1TT6A 1NGQH 4M1CD 4DKDC 4MRCA 3QQ9C 2IGFH 2JCWA 3B1TA 2WYTA 3BWUF 1T03H 4P9HL 1E8XA 1WT5C 2IXQA 1AXIB 4XMWA 3ROOA 4UUJA 5F1KC 4G8EA 3MUUA 4WUUE 3BVTA 3QIUB 2NY4C 2LAGB 5TGBA 3ARZA 4OF0A 1C1EL 3VXTA 12E8L 4ZO8A 4NQSA 4DHLA 3IYLW 5I6XC 1BXAA 3EO1B 5DHVB 2J1YA 1ZPUA 3L7EA 9CGTA 3NJGA 1ZS2A 5AW2B 4FQXD 4XP1H 5L2JB 1J0JA 1NCIA 4TV3A 1W72L 2QZQA 5C8JA 2JKWA 1I1RA 3W0WD 2Y36H 3FT3B 3WFCH 5KSAB 1XR9B 1ZJBA 2EC9T 1UWEH 1Q8MA 3IDXL 1N2RA 1PAZA 3QEQA 5IQNA 5T1DH 5LN4A 2JK5A 1PF3A 2UZIH 1U91B 4KKBD 4LF3A 1OT2A 5I1HL 4LLYA 5E6RB 1KIRB 3OR7B 4NC1E 1DN0B 3ORJA 4BK5C 4MVBD 4KX7A 2FNWA 2PXYB 3DVIA 3O6FA 2CJUL 3O8XA 4GW1A 5C0IB 4OZGB 5ADOH 4LRNL 1DSFL 4LARH 4PRNA 5MP6L 2Y36L 4AZ8B 5TTRA 4PJIE 3V7AE 1SVBA 2NUTB 3BEVB 3ULVL 2BIQA 3H6AA 4CC4C 5TPWH 5HDRA 4YSQA 3SE3C 5C0AA 3KPRE 3BPLC 5TQ2H 4FFYH 4G8AC 5LGYA 1S9YB 1JXGA 2E0PA 4N3UA 4HF5L 3UZVB 3GNMH 3CLWA 4AVKA 4CJ1A 4XN1A 4MKMA 3RHWK 4JLRA 1T2JA 2FX9H 2HRHA 4TUKH 3W38A 2Y6TE 2QKIB 2Y7SA 3PGDB 1WBXA 1Q1PA 1S5IH 1HT6A 4QTHB 5GS0L 5E2WH 3GXPA 2WJ7A 4OLZL 3O0LA 1V7ML 3BWAB 4JREB 3UTSD 4MD4A 5GSVA 1VZHA 2DI9A 4N0CD 5IK3A 3ZHKA 3IMTA 1T03L 3QNYB 1SHWA 1NBVL 3OXSB 4G42A 2D3VA 1A14L 3VRJB 3QUHA 4BK5A 4UOZA 4UTBA 1YEIL 4AY0A 4PJIF 3VXRA 1IGIL 1YEDA 4TYUA 5JIKA 5CCGE 3Q8EA 5J11B 3TV3H 3KPMB 4Q74A 3T0BA 1U93B 4KRNA 5F0MB 3BUBA 4UTBL 3RPBA 1DVZA 4FA6A 4WO4A 3WXWH 3MO1B 4F9PC 4JFTA 4PJGA 3IAPA 3HBGA 5AD0B 4HEPG 3F5WB 2XBTA 3IXAB 4PCSA 4X5XA 2A7BA 3DETC 4XPGL 4YHIB 1BA9A 2WXRA 3WIFA 5IT2H 3BPNC 3SGEI 5H8DA 4HSQA 4AVHA 1ZWIA 5EUOF 5TH2B 4X4ME 1QZNA 1VZIA 4QHUB 4PJHE 4QHMB 4EJ1C 1U33A 1BOGB 3VXMA 1LD9A 5IB4A 2MH4A 3DOSB 4XN8A 3ZL4H 3HNSL 4I1PA 2HJLB 3NCMA 4H1LH 3I3BA 5HPOA 3OZKA 4F5CA 4FQHB 1F2QA 4ZPVA 1MFVA 4L8DB 2IGLA 2V2TA 4YOKA 4W68A 4P48A 1YN7B 2YUVA 2WMPA 4TMPA 4K8RH 3X1BA 2BNRB 4AGMA 1SY6L 1GL4B 2IFFH 4GXUN 4WTZG 3CIQA 1AP2A 1E5ZA 2CMRL 4Z6AT 4X7SL 2CKBL 2VZUA 1UC6A 5D55A 1FLTX 3QWOA 5J3HD 4GXVH 1FAKT 2VW7A 1CDUA 2O5XL 4DP9X 5ES4B 1X5HA 3FQYA 4H88L 2C3XA 3DI3B 4XP4L 2BNQE 1FZKB 2V3DA 2NY0D 3B2PA 4JJ5A 2OK0H 3ARFB 4PJXF 3MYJB 3WFEL 3F7VA 1NBYB 3VFGH 3KYAA 3LOWA 1AYRA 4R90H 3I3EA 3VFUA 5IMLB 1TZGH 1M05A 4BFOA 1SEBA 4PJIB 2WP3T 2WQSA 4U0RB 4C55A 2D3JA 2EVGA 1G43A 1R3JA 2GG1A 4UT9A 5T1DL 4CC4A 4MGXA 2W94A 2X12A 2W0FB 2XQYK 3SDXF 3OKOA 3VAEA 2VKXA 4JFFB 2QV4A 4MMZB 4R2GD 4RMRA 1CXEA 4B9JA 1U8NB 4P3CL 2CCVA 4BYHA 3HZVA 4OZHE 1RH8A 2XXCB 4X9GA 4RSYA 4JL2A 3PREA 1F8TL 5AFAA 2AMGA 3SEPA 1U8OA 3F62A 3H53A 3IGAA 3W5NA 3WL9B 1BFTA 3D34A 4IBYA 2GC7C 4OQTH 3SDCD 4OTXL 2GITA 3VSUA 5FCUL 1UA7A 1M7XA 2P5WD 4G7YL 2IPTL 2PCPB 3OM3B 4ENEC 2XIBA 5AG9A 1YMME 5D7IA 4FXLA 5EULV 1CLCA 3T4YA 2GSMB 3NN8B 1XX9C 3HPJA 5DC4B 2CDFB 2ROXA 2GABA 3R0MA 2OJ1A 4PJDB 3UTZA 4U1IB 4Q9RH 5LXGH 2RBLA 5EORL 4JG0H 5FYJE 5A7EA 4OZFG 2SODB 3JYBA 4Z7VB 4ODXA 5DRWB 3T4AC 5C92A 1MDAA 4G3YL 1IC5L 4C59B 3NK4A 2ADIB 5IR1B 2WQRA 4MWFA 4QRUA 1XF3A 3VGEA 2AXJA 4N5UA 3O11A 5CU9A 3ILDA 3GSNB 1J7VR 4ALAH 4KHXH 2E9IA 2WXJA 5DD5H 3ULUD 2DQCH 4WWKB 4OZHA 4FTVB 1U8PA 2VLKB 1PNDA 3DX4A 1BD2E 2EYRB 1RUQH 3O4LE 2XFGB 3TS8A 1XTLA 4PY7B 1NM9A 4L3AA 4YWGL 3LKOA 1T5XB 2BDNL 2PCFA 1RL1A 5LNGA 1AMYA 2E59A 1KPRB 3HPLB 1NGWB 4UM9A 2ZICA 4Z7QF 3WOVA 2B08A 5F0LB 3SDXB 5MEOB 5MI0C 2WLJA 4NXSA 2GTZA 4N8CL 4BFJA 3BVDB 2DH2A 4WUKL 4ANVA 3L5WB 2FAUA 3U0TB 5FPIA 3OJVC 4S1DD 4X0NA 1EQWA 3DBSA 3MR9A 2F74A 4GQQA 4Y4FA 3FMGH 3ZE0F 1OHZA 3H2QA 1ID2A 1MIEL 2IANE 3WMQA 4N2CA 3BUIA 2OW7A 2YEQA 1G9MC 4L4TA 4J3WA 3GKWL 2EADA 3O6KL 5KW9H 1TZIB 2R0KH 2Y2WA 4UDTA 4KUZH 2WGNB 1JK8B 2C7FA 3RGVD 3VXQB 4I3RH 4EN2A 4LPWA 1SGKA 1NGYB 3IN0A 4JANA 5E99L 1IKNC 1CGTA 1RVFH 1U8QA 2PYED 2WO4A 4MTMA 1I9JH 1LEIB 5E2VL 4NUMA 3ARBA 5TGBB 3FKUS 4OJYA 1WA0X 1HHKB 4BHUA 4ZMTA 3GIVB 1WFOA 2GSGA 4HGWA 1X6NA 1VGKB 4BINA 5A2IH 5J13B 3A4EA 3FUIA 1HINH 2D8KA 5E1QA 2G2PA 3ZL2A 3VXME 2JKIS 2VXVL 2CHDA 1PX8A 4NCDA 5I15L 1WP6A 5BRZB 5ABAA 3RDTC 1MWAB 3L9RA 5LGHH 5F1NB 1KTCA 3HAEB 1BXXA 2VXSL 1U58A 1FFOA 4KO7A 3GFUA 3KXFE 4MXWL 5FFGA 3HRZA 2X42A 3HJEA 4AQEA 4BCXA 1CPUA 3MRIA 2BSCA 4X6CF 4WV1C 5IOKA 4OUUA 2JK5B 4Y1AE 3RVUD 5DQJA 2N59A 5LGJA 1QO3A 3AXIA 1SXNA 3CCHB 4NQUA 4OGZA 4R4BA 5KZCD 4JHAH 3NFNA 3HUJF 5EWIL 1XCTA 2G3NA 1X7TA 3K1DA 3NMEA 4H1LA 2VITA 4PW3A 3G6AA 5H94A 4CVXB 4CU8A 1KCVH 5LGHL 1IKNA 2PCXA 3WJJA 4OV5B 3JBG7 3AMKA 4L05A 4BRJA 1HNFA 5JPMC 4RVBA 5D7EA 3QJXA 2X2UA 5HGDA 3GS0A 5E5RB 3VXRE 2YRBA 5GHWH 5DFVC 5I6LA 1A21A 2Z7YA 3BP7A 3FB6B 5LG6A 2ZXBA 4NPJA 2ILLA 3OMIB 1DVFC 3PE9A 3WN5B 2BXZA 3EBAA 1XGRA 3T0WA 4HLEA 3RPIA 1RZ7H 1IQWH 2DLFH 3PRZA 2P24A 4L37A 1L5GB 4Q9CA 1GZQB 4FCAA 4FXKB 5IKCB 3H55A 1J5OL 4F58H 3MRRA 4XCYA 1D5IL 5GS1B 2YSTA 1J1PH 4LXFA 4QTHA 3OF6A 1C08B 4XBPB 5DSCB 4HUWA 5FO9A 3V6FB 3D7PA 3WELA 6PCYA 3KWVA 1MDTA 2A9ML 2J72A 3GRBA 3UCQA 2EIJB 1ZT4B 3GSOA 3SCMC 2NY7L 1AG6A 1OSZA 4UZUA 4LVEA 2HMIC 4JQXC 3OJDA 5FOJA 2MHAA 5HVWA 4WHDA 1GKOA 4L9LA 3H9SD 4UNIA 1VFAB 3Q2VA 5DJDB 1X3DA 1JI1A 5C9JA 2IH1A 1O6VA 2V5YA 2AEWA 1BBJB 2WQVA 4YE4H 3JTSB 4WO4B 3GSQB 5FHAL 3VFPB 5FUZL 3ARDD 1YN6A 1IB5A 4AVJA 1EHKB 4W9JC 2VN6A 3K3QA 3WFBL 4BXSV 1E30A 4N8VG 3U7AA 32C2B 4XXCA 2EUVA 4KKPA 4A2GA 2PXYC 3FQNA 3D0LB 3O4OB 5DGRA 1LWJA 1XIWA 4L23A 3IAGC 4GAGH 4BFIA 1U8KB 3QPXL 1WWBX 4YC2C 1F4YH 5K33A 4GG6B 2ZUWA 2VDKH 3U36A 3IMVA 5ACMA 4AC4A 1FFPA 4AW4A 2CUIA 4Z76B 2DQFA 1QHQA 4HUCA 4QXTB 3Q2LA 3RDTD 3SCMD 3ZDYE 1UJ3A 3EJUA 4JY4A 3AM8C 4ZUWB 2GFBB 3HE6D 4K15A 4ZPVB 1UACH 4ODVH 3WNLA 1BEXA 3X1FA 4BUQA 1JDCA 3U9UA 3LIZH 4A39A 1SYVA 5HHMD 2XG4A 4GAJH 4GKZB 5J1AA 3FB5B 3OVUB 3TVMB 1KCSL 2H6PB 2VLRE 4Q7DA 3PWPA 3HRZC 5E1HB 5GSRA 3VXPB 5CILH 1QI5A 2LR4A 2WBWB 1A0QH 2YC1A 1H0DB 5EBWB 3LN5A 2ZWKA 4R9HA 1QI4A 3P77B 1AGCA 3FBKA 4JZJC 2PXYD 3BT2L 3FB8A 3SGKA 3GUFA 1DVYA 5DEFB 2EYSA 4R7XA 5IG7A 1N7ML 5LKNA 2CKNA 4KRMB 4ZMAT 4APQD 3GLDA 4J3OH 1MRDL 4FZEL 5LBSL 4M3HA 1A6TA 1XT5A 4MDJA 4B9IA 3QZMA 2BZ7A 3NZUA 5A2BA 4QJ3B 1F45A 3L1OL 4XC3L 5AVRB 3T65B 1VDGA 5KYWA 1R0AL 2YKKA 2UWEE 1WCBB 2JQAA 1IQDA 1L0YA 3X14A 3VXUA 1T1XA 2VDML 2DM3A 4B9GA 4WW2B 4JCLA 5D7LB 5C0BA 3PWUB 4M02A 3E80A 3FQRB 2UVEA 3UBFA 2QPUA 3O0RL 3ARFD 5CN1A 1HQRB 1RUML 2O5ZL 1ZHKB 3ASOB 4M48H 4GAYA 4NKDB 2ZCKH 2ZP8A 5F0PB 2UWEF 3TFKD 1KXVA 4UDUB 5LHDA 3GI8L 4JG9A 3SCMA 1FFRA 3FUFA 3MJWA 1H3XA 4WSKA 3UZEC 4Q89A 1DTUA 3RZCD 2L8AA 3ILEA 1D5ZA 1GPOH 1OAQH 4ONGH 4X4ZA 2WTPA 5K9JL 2CRIA 1E9OA 1W72B 2VLRA 3IPFA 2BS71 3RIFF 3UACA 4LBAA 1C8QA 1OAZH 2F8OA 5KUKA 5IV2B 2JI2A 2XETA 5E70A 3ULSB 5LXGL 1YEKL 2WYHA 5LNDA 1VERA 3EUUA 1KENH 4ZFFA 2HWZH 4TSBH 2FH8A 3VYPA 1S7XA 2VDPL 3SKMB 5IIEA 2Q3XA 1YY9C 5HGGS 3WTYA 1HJCA 1E4KC 1EEZB 2W65B 4L5FE 3HE6C 3KYKH 4WI7A 4NKMA 4K2UL 2KQNA 5FEBA 5D4IA 4X6DA 3WTXA 4UQ3B 1WA1X 3WE6B 1SMAA 4RMBA 5IEHB 4F91B 3V52H 4GRWB 4XNXL 5EOQH 5LAPA 1PZ5B 1WG3A 5DZPA 4QRRD 3QFDA 3LX9A 2NXZD 1WWAX 2YGQA 4Z7WE 5LQBH 1CDJA 3HI5H 3JWOL 5TDNA 3BWUC 1UKTA 3JUYA 5E6UB 4WIQA 1QBMH 4MA1B 1AC0A 2BY1A 3L1OH 5HGAA 5AG8A 4ZX4A 2VDNH 3AREC 3EF7A 1HHGA 5F3BA 5T5FL 3X13B 5K9KB 4QRTB 1KBVA 2NTFB 5IUCA 3RY4A 3S88L 5KOMC 2OMXB 3LQMA 2FH6A 4OQ1A 2Y7LA 3U30C 3KCPA 4TVPE 2J6WA 1OAKL 4IHOA 5IHUH 4FERA 5I1AA 5SX5K 1SYSB 2PR4H 1DQIA 1OTSD 3AQDA 3HN3A 3MKKA 2Z4TA 4G72B 4W6YB 1QVOB 2V7NB 3OZ9L 4AV0A 2FJHA 3DC0A 4MJ6B 4HAKA 4MA3A 5AW1B 1RJLB 4NKOA 5F9WC 2JCCA 2QQLL 3GHEL 4IMKC 4Q52A 3ABLB 4S0TD 2CJ3A 3NCJL 1V05A 3S37L 1AAJA 2FYYA 3QP3A 2XZCL 3N42F 1ZGLM 3L4YA 3NJJA 5BS0E 2FEEI 2NNFA 4POZD 4TNWF 2G3MA 3U4BH 4AJVA 4QWWC 2LTQC 3QR2A 5BJTA 4PJAF 5B7MA 1G9MH 3ASNB 2QZ5A 1SOXA 4OM0L 2QSQA 4XNXH 5EOQL 1Y7VA 4Y1AA 1AH1A 2YD9A 3BSZH 4EDWL 1MJUL 3PV6B 4LCYA 1RUQL 5IJVB 1FQ9C 2VZTA 2IPUG 3A6CH 3C2SA 3QSKB 3MNVB 2O6CA 5HP5A 3NZ8B 4XNBA 1Y18B 1OARL 3LPGA 3K6OA 2NXYC 5BO0D 3WUWB 1JUFA 2IH3A 5EOTA 4Z0XB 5KTEL 4U6VH 2WANA 4QO1A 4FRWA 5C6WH 4OD3H 2MOQA 5LGJB 4HUVA 5PCYA 4I2XB 3FN3A 2X3CA 4P3CH 3DTUB 3DSNA 5DHYA 2ZP9A 1AHKA 2VO8A 4W70A 5ACZA 1XIWD 3H9SB 3TBYA 5C70A 1CBVL 3INOA 4AYEC 4RISL 4G2AA 1IEAB 5IMOB 1CK0L 2YUWA 2ZP0T 1MIML 3I6KA 3RAJL 1A8ZA 3TZVB 2JVUA 3SE8H 1JXFA 1E40A 3DX0A 5AKTA 3HMXL 3UYPA 3VXSD 4AM0A 4G6KH 2Q10A 3IK2A 1TVBA 4WLCA 4XVTL 5JIPA 2R2BA 2AEOA 5CU5A 3GJFH 3I02B 4P2CG 2OJZH 4K5LA 1V7MH 1KNOA 4PUBL 5GS3A 2MCAA 3IFPB 3C75A 3PJSA 1K8IA 4AM0Q 2X1WL 2O5XH 4H44C 4MYPA 1MUJA 4NQCE 4Z7WF 3SBQA 1TCRB 1A6UL 4WI0B 2FATH 4JN1L 1DQQA 1J8SA 1MHEB 1PLGL 2CMRH 1BQHB 1SBSL 1UZ6F 3QC6X 4UAOC 3S5LG 3QJVB 5HJ3A 4JFDB 3OKLB 4I0PD 5AVXB 5BOPA 1P4BL 4QXVA 1J11A 4PBDA 5I0WA 1CZ8H 1PZUB 3AU0A 5GGRY 4YPJA 4F9PA 5LUMA 1PW3A 3WKPA 3O4LA 5AZEH 2DWTA 3E6FB 2YXMA 3WKML 3P2TA 4JO8A 5IBLD 5I18H 3CZJA 4DPBX 4HUKB 1UGKA 5ICZA 4E42A 5C09E 5KAQG 5C86A 1ICTA 3GXTA 3AJ7A 3QUGA 1OK0A 1COBA 3KDPB 3KPSE 4NQXA 5GJTL 1UEMA 1UM5H 4O58L 3IXTB 2Y25A 2CKBA 4JZOB 5IHWA 3ZHLA 5HD8C 2KZ1B 3V95A 5IQ9A 3P30L 3Q13A 1A7RL 4EAEA 2OXGA 2EE0A 1S9XA 1D9KB 3CXDH 4K9EL 4NXKA 2X1OA 2NR6A 3RWFB 4JY5H 1K5WA 2GEEA 3QS2A 1YYML 1FLRH 4ELMA 1V10A 4M8RA 2D0GA 1ODAA 3HC0A 5I0YA 3QZWB 4BE5A 3GSNL 2YGVA 1IAKB 2DYPD 1H8LA 1KFAH 1C5BL 1BZ8A 1C1EH 2GW5A 2AQRA 2N56A 3QJOA 2O61B 2QR0B 4ZS6D 2Y1ZA 3SKOB 3C9NA 3B9KB 4P2RA 2XHNA 5AVQB 2FT7A 1ET5A 3KEHA 1TYEB 2YJQA 4PRIA 1EFQA 2WBJC 1YEHL 2E6JA 3KYOB 3ZPDA 3NG5A 3R7QA 1CLZL 1QRND 3H9HB 3N1MC 4BDVA 3V5HA 4CVZA 5I6KA 4LSPL 1KBKA 1DSYA 3LEYH 1OV8A 1EAPA 3MA7A 5C0GA 1VADA 1W2KT 4TULL 2PYEA 2CCLA 4DGUA 2VXUL 5IG7B 4HIIB 3L13A 4ZMYA 5JNYB 2G2NA 3LZRA 1BG1A 4KZDH 2QBWA 4EBQL 1SEQL 1NFDB 5L6YH 3T3MB 4PJ8A 1KB5H 3EOTH 1IGMH 3WXWL 1TJGL 1INDL 3HN8A 1DJZA 4PYGA 5KBPA 3P2DA 4XBGA 5GGVL 3MBED 1QPKA 4IGBB 3FT2B 5I76B 3P9WB 1KGWA 1NWOA 5C0ND 1S5HA 3IDIA 3QARA 3QDMB 5T1JA 1PTZA 4LQ1A 1Z3GL 4X5RA 5I18L 3EH1A 3HVDA 2HMID 2PTUA 2P45B 2DY2A 4M6ML 4DT2A 1DQML 2DD8L 4PPTA 5DJ6B 1HXKA 1I3RA 4MA7L 5JQIB 1A3RL 3ILPA 4M3KB 5IREA 4M8UA 2AK4D 3KGUA 4PLOB 3UTPE 3KM2A 3H1ZA 2CKBH 4POZC 4RX4D 3ZN6A 2LT9A 2KYIA 3MRPB 5A43C 1MFAL 1UD2A 4Q97A 4G8EB 1RIVL 1HAUA 4Q6IA 5I23A 2VXTH 4XMTA 1ZMYA 5FYKL 2OJEA 1RHFA 2ZYSA 4YDIH 4I3SL 2QGEA 4Z77A 3D33A 5FYJH 1JJUA 1AGEB 4HS6B 1A1OA 1ZV9A 3FT4B 1DBMH 2R4SL 3ZT6A 2VDRB 3QZPA 4PWKA 5DFVD 3N40F 2VE6B 3M17A 4PS3A 1UWGH 1KB9K 4P46D 4APQB 2CU9A 4JPKH 3QG7H 1XVSA 1AD0A 1H15A 3QZNA 2YPKB 3PJNA 3CVIH 3KHQA 1MFBL 2VISA 3SO5A 5I1HH 3RIAK 4KHTH 9PCYA 3HUJB 4ODTL 5JYLA 4H7VA 3TASA 2P43B 1L9SA 1UOWA 4H8WH 2C3VA 4AL8L 3AUWB 1A6WL 4TXVB 2AQ1A 2QSCL 5FM4A 1KJ2B 1HHJA 1NC2B 4RNRA 2VDLL 4YHNA 5E4AA 2ZYRA 3QUYB 1PZ5A 4KZDL 4JFQA 2J88H 1KG0B 2CDEA 2DTSA 1O7SA 3EO1A 1ORQA 1HQ4B 1G0YR 2WHVA 5KN5B 3L95B 5I0DA 3FCTB 4Y4KB 2D0FA 3GF8A 3PL6B 4A7GA 4DETA 1EZSA 1QTPA 5FYLD 5EEZA 4QXUH 3SOTA 2JCCE 1G0DA 2XA8H 3H2PA 5C09B 4AMXA 1G7JB 5C0DB 1YUKB 2NR6D 2X6AA 3QISA 2DQIL 3WI9A 4HOMA 1FL5B 3B9VA 3HC3H 4FL4C 2D7TH 2JB5L 2WC7A 1M56B 1WUZA 2BH0A 4OI7A 2RQEA 4FFZA 3EJJX 4PRHD 4QTIH 4M5ZH 4NBXB 2DLTA 3O8XD 3KXFD 1D6VL 4FYQA 2P9RA 4OZGA 5D5ME 4X7SH 1CG9A 4HF5H 1G9EA 4YN3A 1RFDH 5DD0L 1L9TA 2J8UA 1OQOA 1D6VH 2ATKA 4Z5RB 3VD1A 1FG2B 2WAQA 4MXVF 1ES0B 5EUKA 3MBXL 4LL4A 2XG5A 3UC0L 5HXMA 1TJIL 4YHOL 3U2IA 2XRAL 4LLWA 1U3HB 2D7TL 4L8BB 1RZGA 4ZTOH 2EP6A 1IBGH 3G5ZB 1UUNA 3F8UB 3KPMA 3D0VB 4GUCA 1E5AA 4OJFH 4FNQA 3BHBB 4QRQB 5A16B 2EDMA 4RGOL 2MCG1 1MPAH 2ENPA 5DMKA 4ELDA 4QY8B 1R4XA 2QKIA 3UGUA 1XGUB 3HBZA 2ED8A 5JA9A 3MFGB 3QULA 1ZLUH 1UWEL 3IDXH 4Y1SA 2XQBL 4AIXA 2DJMA 1VHPA 4N1EA 1RUPL 2QFPA 1QQDB 4CDHA 1ZLDA 4IU2B 1W72H 4Q6IC 1T4WA 2XWDA 4QO1B 2P52A 1R6VA 5ICXA 4NI3A 1A6WH 2R1YB 1PYWB 4UT6H 3CDFA 1EJ8A 4JPSA 5C08B 1E7VA 1YQVH 4I1NB 1NDTA 3DUUB 1I3VA 1WDAA 4HHGA 5EFIB 3ESOA 3WJLA 5AYUH 1JNHB 4YR6A 4WKXA 3QAZC 4TM9A 2AQSA 1DVXA 1EO8H 4M5YL 5D7SH 5FO2A 5CLYA 5INDB 2D73A 4M00A 1NEPA 4XNMA 2HWZL 3AXHA 3NPZB 5I8KH 5KVFH 1I85A 1NAKH 4NRYA 3B7TA 1T5WB 3C60A 4JREC 3DOIA 4GIAA 4JM2A 2MNWA 4K71B 1QRNA 4EDXA 2Q7AA 4X5LA 1H3WM 1R3LB 2IWEA 3BQUC 3FPXA 1XL6A 4JDEA 4KI5F 2OQJB 1W8EA 4XO4A 3FOLB 5JHLA 5KYXA 3ROLA 3NCYP 1EAQA 3KVQA 2EH7L 2K8QA 2LU3A 1QFWL 2P4AB 2XQBH 4HOZA 1AP2B 1AE6H 3GS7A 1L9NA 4ZUUA 4D9QE 2NZ9D 4D0CB 2YD6A 2B9AA 3QJTB 4ODTH 1TO5A 3I2CL 1CFBA 4U1JB 3SE4A 2EABA 1XB3A 2X10A 1VFBA 3CTTA 2HVKB 5GRWA 2WXOA 4NN7C 5AAWC 1VAHA 2NNAB 1ZAGA 5LCVA 3D5OF 4M8QA 2WXPA 4JDTH 4X5WA 3MLTA 2N7BA 1QA9A 1OVZA 3HHMA 3V4PL 1FVCA 4AV5A 4EI5A 1QOKA 3O6MH 4ZMLA 4UIMA 1ROCA 3GWJA 1XB6A 3LN4A 3O6FD 3BQVA 4K94C 4P4RB 4PGEA 3EFDH 3IJ9A 3KPPA 2FB4H 2VDPB 3MOAH 3MU3A 3BO8A 3IFLL 2EYTA 4MAYA 4Y19D 2NXZC 2TRYA 3CXHK 1MHHB 2X6CA 3CFKA 3PU7A 3RB5A 5CJ5A 2E8ZA 4CAGA 3L3KB 4OZIE 3FTSA 5IJKC 4HQQH 1IAKA 4GUOA 1EK3A 4F7CB 4NQCA 2DQIH 4M1GH 3BWZA 4DP7X 1A0QL 5EZPA 4QXGL 2Y9RT 1T66D 4I0PA 3P4OB 5BVPH 4OB5L 2ADIA 2I60L 2VDOB 2FO8A 4RSVA 2EH8H 3JWNC 4OCMC 4GIOA 4TN9A 5J6HA 2P80A 4DK5A 2WSKA 5H2BB 2FX7L 3BI9X 4WGVB 5CJXC 2BS9A 3D9AH 1BX2A 2I25N 2KT6A 4GKOA 4BV1A 2O5NA 2FQGA 2AZUA 4F5CE 1LO2H 3OGCB 3O6FC 4N0UB 4OZHB 4YBLC 1JF1B 3TO4C 4DJMA 4N0CC 4TPRL 3TBVB 1B2WH 2DIEA 3L3OA 2G75A 3T0EB 4P99A 3MFFB 4E9YA 2FRGP 4P2QD 3WJLC 3L4ZA 2VM3A 4M9OA 2AK1L 4M61A 2YEZA 1BM7A 4UQEA 1SJHB 1RUKH 4N90D 3EUDA 1MHPL 3ZUCA 2AS5M 3GSWB 3R8QA 1RUAH 2ZOLA 4QWWD 2AXFB 4N0FA 4XGZB 4CW1B 2OX5A 1A3LH 5LBGA 3GLAA 4HA1A 4Q2ZA 1MJUH 4JCMA 5AOZA 3JWNE 4PYHA 4ABQA 4AJ0A 1FL6B 1TU2A 3FPYA 2LFEA 1EGJH 5I0ZA 4FQ2L 2V4LA 4DKAA 4XCEB 1X5GA 1DBBH 1RU9H 4HWBH 2ESVD 3S3BB 2BP0B 4NZUH 3UH8A 5ITBL 1CD8A 5I1IH 3WTVA 2JMRA 4HCRL 4ZFZB 3CFCL 4IIZA 3L08A 1GMIA 2B7DT 4ZUSA 4GQ9H 5L4JA 2OMVB 3QUZD 3DMMA 1E2ZA 5EZJA 4KROD 1X5JA 4YVUA 2EKJA 4ABVA 4CJ0A 1BXUA 4Y1AD 2EDWA 3B9KC 3QPQC 2K3HA 2HKHL 3VXUD 5F8QC 1L0QA 5A6IA 3QIBD 4PUBH 4WO4C 3PJLA 1GJUA 1HILB 5L7XH 2MTAA 2GSGB 4HGWB 1QUNA 4FMVA 1VCAA 4FADA 1OAUH 3UO1L 4XVTH 5IJCC 4L18A 5IMMA 2X4RB 4ZAKA 2HFGL 5C0AE 2XY1A 1KGCD 3VWJC 3DJ9A 4R7LA 4APQA 5DVMA 2K3TA 1ACYH 1IX2A 2YGPA 5CBEA 1H15B 2A74C 3W56A 1E6OH 1Q9LB 2AAAA 2XZZA 3CFIC 4KOBA 4LPUA 4YK4C 1IM3A 3NVQA 2X40A 1JL8A 1N2RB 2X9ZA 4UDTB 4Z95H 4OZFB 4LEXH 3NDZE 2JKRM 2IDTA 4NP4L 2J8OA 4EZKA 4MAYC 3IMSA 1QSFE 4YUEL 1CLVA 5J57B 4G7VL 2XBDA 5KS9B 2EIZB 4I18B 1QTSA 4FFZH 3FCSA 1NIDA 1XB8A 4HKBA 4TSAH 3PABB 1AKPA 4GP8B 5FB8B 2GK0A 3MXVH 3DX6B 3KBPA 2P8PA 4WU7A 2B8OT 3NRFA 1LO5A 5HHNA 4UTCA 1H9DA 2PWGA 3RI5F 4OLVL 1NMBL 1GAFH 4QLWA 5L88H 4CADA 2AGJL 2VQ1A 2EDYA 1I4FB 2BIMA 1FC1A 3GTNA 5IFHL 3IRPX 3IFOB 3GMPB 5K39A 5C0CB 3RDTA 1CE1H 4ADJA 4I85A 3L3GB 5J1SC 2NTSP 1KTDA 4Z7UF 2Q7YA 4JY6A 4JZJB 4CMHB 4POYA 3HMXH 3HR5B 3T6XA 3FRPB 5C7XH 3HE7A 1GTFA 2ZXEB 1HCFX 1RLWA 2DPKA 4F2MA 3N1QC 4KXAA 1P6WA 3C60C 3BD3A 1ZK5A 3QNXB 4FA7B 2NYYC 2HG5B 2VR3A 2CA3A 3OX8A 1P7QB 1XSOA 3GYRA 2QQQA 3SYCA 1KCRL 5F9AC 2OZ4L 5CIPA 1U8CA 3HHSB 5GISL 1X9LA 4KITB 3PWLB 3BVWA 1MRCL 4AKPA 1NCCH 3EO9H 1QKZL 3GT6A 4LSRL 3K6SA 1RIHL 3AADB 4EE2A 1GOHA 2C1OA 3RZCB 5IZ7A 1BFOA 5JXED 2JJTA 4CC0A 2WWMC 4MBOA 3EJZD 1H6TA 1JGVH 3OV6A 1LDPH 1MI5B 2OZ4A 4L4VB 2Y7QA 5E5MB 4TTDD 5CN3A 4ZFOA 3KLSA 4UMSA 5CP7B 1MPAL 4WQOA 5EN2A 3QG7L 1DVFA 3MRRB 3PQYE 3ZE2E 4ONOA 2VLMD 1ZA6B 4G83A 1Y0LA 3OF6D 3VE0A 4IRSD 4U3CA 5JHDE 3IE9A 3C8KB 1IGML 4J3OG 4L1SA 4UQ2A 4Y5XA 4JB9L 4FLOA 4QHMA 4N8CH 3MBWB 4JVPA 5IVZB 2L0DA 3G5XA 4HCIA 2HPTA 3HKZA 4ODHH 3GHBH 3GZPA 3VD0A 1SRDA 3ABZA 1AGDA 1XH3A 4J28A 2X89A 4V1DD 4YWGH 1RPUA 3FTVA 3RKPA 2PPFA 1G7QA 4TQEL 3DURA 4M5ZL 5TJWK 5I2IB 3VD4A 3ARPA 2DQDL 3LS4H 4YXLH 3OAYH 3F7YA 1TG8A 1Q1JH 3BZFB 3DUUA 1QRNE 1I7RA 3MX0A 4NQEE 3NEXA 3VFPA 3PP3K 4TTDC 3DVFA 2KLRA 4JR9H 1EDHA 1AVAA 3VX1A 4UT9L 4B60A 5CEXB 4DP5X 2ZCLH 3IJHA 1YQ2A 2JQZA 4TSBL 2JQMA 2ZXGA 4EN3B 3ZGHA 2ZKHH 3CLFH 1XR8B 2C3HA 1UM4L 5KSBF 3TYFB 1K6QL 3PWPE 2OI9B 1A5FH 1U8KA 5GHWL 3BP6B 4G8GE 3CFEB 5DJ2B 4Z0BH 3UOAB 1S9WA 1NCDL 4GQZA 3I9AA 4IIQC 1BVNP 5C07B 2RCSH 2DYRB 2H9GA 2EYSB 3GSXA 1AJ7H 3GO1L 1VLXA 3ZYOA 3RNKA 2AABL 2Y69B 4NJ9H 4HETA 3PWPD 4MDJB 5HHXH 2IAMB 5CZKA 4F7EB 1FZMA 1JWSB 1N5AA 3IF1B 4YE0A 5E5LA 5C09D 4DGYL 4J3BA 3NCWA 4LSPH 4LU5L 4D0BB 4LPTA 3BAWA 1JTOA 4DP6X 3FBQA 4D8PA 4WHTB 2EO7A 4AITA 4C54A 4M6NL 1EZVX 3HE6A 3L54A 4KPHH 4OFVA 5FUZH 3P77A 3O4OC 1R24A 2W0LA 5B1BB 3D2UA 2NNAA 3EJYC 3EFFB 4JQIL 5AVYB 1PL3A 5BZDB 5DK0A 1ID5I 4YMPA 2D0HA 3ZHNA 2GT9B 5IQ7H 2VDMB 5K1NA 4KXDA 1OGAD 4E9QA 4WY7L 4GEIA 2ZSVA 1I8MA 3SGKC 4NHUA 1F5WA 3EJZC 4KQ4L 3F58L 5I1KH 1Z5HA 3SDXE 4DKTA 1MFAH 1WIUA 1T2QL 1ED3A 1B9KA 4J7RA 2ICEA 1R5VB 5HDQH 1BM3H 4FHBD 3WNIA 1NCJA 4DAGH 5DUPL 5EZIL 1VEOA 4RQQA 3TCTA 1DEEA 3QFJA 5FW8A 1OAQL 4LDCA 2V5SA 4NO2B 1G9NC 2WBKA 1I7ZB 4RLDA 1DJYA 1WZKA 3ETSA 1HZHL 1KC5H 4HU8A 5I1CL 4BQCA 1TQCC 2DM7A 4FTVD 5BUGA 1MCKA 2GUOA 3G9VA 4PN6A 1II4E 5E8EA 2H8PA 2L3BA 4MB3A 4UM9D 3DA0A 4NQVA 5FM5O 1HQRA 3HI6L 4GMTL 5DC9B 5GRJL 3S5LA 1BM3L 4DAGL 4R4NC 3CQQA 3VU1A 3EJYD 4PJCE 3EG9A 5IHZB 4F33A 1D5XA 2AQTA 3REWA 4EOWL 3GLZA 4WHCA 4ORGB 3HR6A 1IAMA 1NCWL 2ICWI 4JFYB 4QRSA 1UASA 3SQRA 4NKMB 1QFPA 4EBQH 3PXHA 5ENWB 3TO2A 2H2SC 4KGLA 1THCA 5IROC 1D7FA 3KPLA 2XKNA 3AAZA 4E5XB 7PCYA 3T3MF 3GXUB 1E4HA 1Z9PA 1D5BB 1E27A 1NUDA 4P9HC 5CLZA 5G4NA 3S3PA 1MCEA 1FO0L 1TFPA 4AYGA 1JV5A 4KKAC 4KTEL 1SJHA 4RZKA 1J18A 3QG6B 3CNKA 4NX0A 1GY1A 3DO7A 1ONQA 5FKAB 5FHAH 2F8XC 3RWJA 2GHWB 3FSOA 2FD6L 3EKCA 2IXQB 4GRLC 5B39B 2D31B 4GQPH 3OKDB 1B0IA 1XV8A 3A4AA 5HPMB 3BRFA 3GBNL 3EOBB 2MOVA 3CU7A 4G7RB 2ZIDA 4QKXB 1KDJA 3GSNH 4JFFE 1YHPA 4UOW1 2QQNL 3MAWA 4PGCA 1O6SB 4JG0L 5KS9E 3P9LB 4B53A 1EXUB 3LDBB 5DTFB 1HHHA 1XZ0A 3KYMA 3TURA 2XZAL 2IDFA 5EZJB 3VX0A 2XX0A 1L7IL 1XXFC 1ZLSH 3U9PH 2NW2B 3OKMA 4PFEA 5DJ8B 5FDYA 1ODUA 1IT9H 2GJ6E 3MZGB 4DZBB 5T3XE 5GS0H 1JZ6A 5IBTL 3QRBA 1CQKA 2OM5A 3PHQB 3VD3A 1NFIA 5T3ZD 1BF8A 2IANA 3SDCC 4MX7B 5E8OB 1I1FA 1SDDB 3HAEA 3P0YL 3QORB 5HHXL 5I71C 4M93B 4S11A 5I6MA 1FFOB 1FNHA 4ZOCA 4YPGB 4U1GC 3LXCA 2UYLA 3O6FB 4GW1B 1AJ7L 3GO1H 1MNNA 5I16B 1AKJB 3U4BL 1UHVA 3MRIB 1JWUA 5DQDH 4PJFF 3DIVA 1CN4A 4PAZA 5IK3B 3MNZA 5AKSA 3QJFA 4P23D 5E7BA 5IVNA 2YARA 3CFJB 4YAQB 3D18A 1FI8C 4LOEA 2R27A 4HWZA 1JHLH 2AF2A 3IJSB 3CHQA 3V52L 1AI1L 1INQA 1MRDH 4MA1C 3SSGA 3ZE1E 2E6PA 1A65A 5IOPA 2CBQA 1MQ8A 5CBAA 1IBYA 4I48A 2HKAA 4NDMB 3VNZA 1KB9J 3IPEA 1OW0A 3MUZ1 3EBGA 5EC2A 2UZIL 1LWHA 4K7PL 4FI6A 2ODIA 4ZMWA 3IJ8A 5H35A 3US0A 5F7EL 3TWCH 3KBFA 4BKLA 1DCEA 5T3XD 2BSTB 4OM1H 5EUOB 5FYLE 3X12B 1DO5A 5K59E 2GEQA 4YHIA 2XZAH 4TQ8A 2X4OB 3IKCA 3X11B 3WN5A 1Y18A 2LGNA 3PWNB 1BQRA 1FPTL 2Y0SA 5TQ0H 2H0EA 1MW3A 3FH8A 1CBJA 1M57B 3MBEB 4KI5D 4MNQA 3WENA 4OJAA 1IGFL 7PAZA 1DANT 4I0CC 4NQEA 3UFIA 1G7MA 1CGWA 4FYRA 3VXRB 8FABB 3Q8CA 3E6HA 3HG1B 1NAKL 3DROA 3DSNB 5MHSE 4P5RA 1QR4A 1RVFL 1AHWC 1TYJA 2VJ8A 3CX5J 2DQJL 1ML0A 1JPSL 1KZQA 4OU3A 3OWEA 4XVSL 1T0NA 4NO5A 4GP4B 4ZD3H 5CUSH 4M6OL 1LL1A 1UCTA 3HHSA 1YNTA 1D7CA 3FO2B 2NY3D 2Z6FA 4L5FL 5CCKH 5HI4C 1HH6A 4XP6L 1VFAA 1TKWA 3U2SB 4PV8B 3SDDD 2IV8A 4C47A 1TETL 2DMBA 3GSVA 1KXTA 4E41B 3QWOB 4A7VA 1U8LB 4AC2A 2JKLA 4AMWA 4ATTA 3R4DA 5JHDA 3RL1B 3TN0D 1LD9B 3WS3A 2R2CA 4Y88A 4G43B 2F68X 3DYPA 2YO3A 1MUJB 4PWIA 4PWEA 4X4MA 4X83A 3SBRA 4ERSH 2X6MA 4KXZH 3QQ9D 5JW3H 2P5WA 1ACXA 3MUGB 4XWOC 5DI8B 1CI5A 3SODB 1YEJH 4FQJL 3T2PA 5KVDH 4WWID 4WI4A 4UOW0 1Z32X 3ZKNC 2HVJA 2DQFB 1D9KA 1BLIA 1UJ3B 4ZUWA 2JXMB 3V4PA 3IT8D 1UATA 1H6UA 4S1RH 1TTAA 4OM1L 3NZSA 3RWHA 4K4KA 4NUGL 4PJGF 2DQTL 2OMWA 4F58L 3UTQB 1LQSR 2I07A 2ZCKL 3QHFH 4AYBA 1PIFA 1USZA 1E42A 1GAFL 1AS7A 4WW1B 5L88L 1FZKA 3NSYA 4GAFB 4DESA 3CHPA 1U8OB 5EPMB 3O2DL 2HLAB 5IGXL 3KS0J 4GAJL 1I7TA 3UAFA 3DGGA 3IFLH 2GBTA 2OSLA 3NA9L 3WIIH 2OV0A 2YPLB 3FXIC 1UXLA 5T1KA 1T20A 4Y8AA 5DEFA 4Z7VE 1F4WH 4NZTH 3T6ZA 2V8MA 2CPCA 3K8LA 3TTSA 1YC7A 4MMZA 1A7PH 1H5BA 3L2MA 1VADB 4DEPB 4MCNA 5C0EA 5EC1B 1A6TB 4NNXA 2PYEB 4AQZA 3BN9C 4KROC 4Z9KB 4FQXA 3FH5A 2ZUQC 1N9PA 2GCYA 1QSFA 3LKRA 3N3EA 1GS8A 4EIUA 2Y06L 4HZLB 4PTTA 1J8HE 1NFDA 1UJTA 2QR0A 2DQCL 1JWSA 3IF1A 1OP3K 3TBTB 5IM7B 3EF4A 2DM4A 3TGXA 3T6WA 5HHQA 1A6ZA 3X17A 4D2NA 4S0SD 2GSIB 2A9AA 1F3JB 4K8RD 4DK3A 1V27A 5LVEA 2YN5A 4TPRH 4WZ9A 5ISZA 3J8F7 4MXVE 2FWOB 4BQBA 4OVUA 3G7TA 2UXTA 3QEQE 4N6RA 4HUMB 4HJ1A 4FXKC 3A0OA 5K9OB 3IJEA 2EUWA 2GJPA 4IK6A 3TBSB 3S5YA 4NWUH 3KPTA 4KJQC 2YLHA 2PCYA 3CLFL 4HT1L 4BUHA 2BJML 3NIFE 4PJBF 5C7XL 1YJDC 5HYSB 1D5ZB 1C5CH 1PZDA 3QR0A 4YHPB 3AVEA 5MEOA 3NGBB 3NJMA 1WO2A 5FX3A 4KKZA 3RWGB 4O02A 3SE3A 4XO3A 2A99A 4DZ8A 3ZZ1A 5B38B 4B27A 4Z3EA 1PZSA 3ZTJG 4OLZH 1CXIA 4UF7C 5IB2B 2WXNA 5GS2H 5JMRA 2YRZA 4RFNB 3PF2A 4NQED 4XCNB 3Q1SH 3FQWA 3KPNB 2WBJB 1KYUA 3GRWH 2VH5H 3L7EB 4Y4HA 5IVXA 2BVOA 4S0HA 1FBIL 2F53B 4MNQD 1NTDA 4RZCB 1MFDL 1XCXA 4PU2A 3BAKA 3V9CA 2EYRA 4L4TB 1UCBL 4V1DE 2QJDA 2BERA 3FT9A 1AXSA 1NEZA 3QQNA 1J0KA 1LP9F 3ESPA 2WYZA 5FV2A 4OCXL 4JFYA 5FKPA 4HWEL 1ZXKA 2FUQA 1ZA3B 5DQ9B 3U6XS 4RCAA 4QCIA 1T7ZA 3EYSL 8PAZA 1J0IA 5GGUB 2A77L 4M4RA 3GJFK 4I87A 2J8UE 5IW6A 3F83A 1BMZA 3PIQA 3L1GA 4W6XB 4G6FB 1OF0A 4PV9B 1BREA 3WEAA 4LIQE 3ES6A 5D5MA 1YNLH 2XICA 3HVNA 4N5EC 1JVKA 2OZNA 1HHGB 1EHLL 1WAAE 1P5VA 4AL8C 3UDWA 1INDH 1QAWA 4P4KC 4GYBA 1R5IA 5HJBA 3VXSE 4KMLB 4XMPH 5EN3A 4NQDB 1SEQH 5GRXG 5L6YL 2FBJH 4GO9A 5KVGE 3UJJH 3L5IA 4WV1A 2YFNA 1S7SA 3U4KA 4WTXA 5C0DA 1YEJL 3VGFA 2OMUA 3CSFA 4WFEE 1MAKA 5D1ZA 3P9MA 4XNDA 1LEGB 1DQJB 5D5MF 5DMJB 4E68A 3O8XB 5E24E 4LCIH 3FFOA 3ZMNA 2EDKA 4O2EB 2UUDH 3IGUA 1OP5H 3KDMA 3DV6A 2V9QA 2J5LB 3FSVA 1NSNH 2VDQB 3B37A 1A7OL 3ULUH 1CG9B 3Q05A 4GSDL 1R75A 3CFDB 2X6VA 2JLPA 4NM4H 5EU7C 5E2WL 1M2VA 1P2CA 1UZ8B 3QNFA 5F1NA 3RWDA 3TBWB 4BD4A 3ZKXC 1MF2H 5EUKB 2MTPA 5FUOL 4WDIB 1NCBH 3TH3T 1NUNB 3IMBA 1L0XA 3ZTNL 3LRSA 3O45B 5IB3A 4ZD3L 3O6LL 4IRZH 3VI4E 3FQ2A 2WLZA 1UD5A 5KBMA 5BW7A 4FXKA 2G9KA 1CICC 1G9NL 4NAMA 5SWZD 3QCVH 3BFOA 4XN9A 5CEZH 4LEBA 2B16A 4ZFOL 4QHNB 2VITB 4CVXA 3V10A 4Y5VC 5K9QG 3L3JA 3EH2A 3CVHH 4JQXA 3QJFB 2WLYA 3VXMB 3GSOB 4UZSA 3PHOB 5D72H 4C4KT 3BMVA 2KZKA 2CHXA 4P46B 4NERA 4J3SA 4YQXL 3FFCB 5F72S 5KYUA 1ANUA 3TJEH 3W11D 1D5RA 2TSBA 2N01B 3AQXA 3MO1A 3AMLA 3HCVA 4LCWD 4M5YH 3I6KB 4WKZA 5D7SL 5ESQA 4APXB 5DRZB 1FHGA 1PEZA 3M07A 4CBPA 3L3DB 4QJ4B 1WAPA 4YXHH 4O2CA 2CO7A 1RZ7L 5CHNA 3U0PB 2NT1A 5FGBC 4L4TE 4V1DB 5AYUL 3GJEA 2BP8A 4G9DB 1NBZA 1JZIA 2KI6A 2G30A 3PCYA 4AK2A 3T71A 4NWTH 2APWA 1CIUA 1PD1A 1W8NA 4PB0H 5M95B 3ZQWA 4F7KA 4JFHE 2X88A 2XJKA 2F53D 4MNQB 2AK4B 1ILUA 5GS1C 5J0BA 1GYWA 4FYSA 4KY2A 5DZAA 5FS5A 1AIZA 1E5YA 1PX4A 2IFGA 1DBAL 3IU3B 5FXCH 5IFAH 3PGFH 2P5WE 1DL7L 3HN5A 3QFJD 5HJ3B 3REVB 2JIXA 4N8UA 2B4CC 1T0NB 1YMMD 1N5YL 3QXVA 2XXFA 4R5XA 3OR6A 5DWUL 1IM9D 4LCCA 3QEUA 5DO8A 4F8OA 3C09B 1MCDA 3KCWA 4OLXH 3KWTA 2ZWYA 4YVNA 3MGTA 4ZQKB 3GMMB 3ZZLA 3BKCL 5FK9B 4A66A 1TJGH 2OSYA 3Q3GA 3RVXD 1E6JH 4GRLA 2IAMD 3SJVE 3MBXH 5TE4L 3HZMA 4M7LL 1HHIA 3ALXA 4NJAL 3A67L 3CX2A 1SJMA 1FFPB 4Z76A 4PJHF 1NM4A 1CL7I 1LO4H 3IXTA 5MENB 1KLFA 4PS4H 2HTLD 1I31A 4HBCH 1HCYA 1CIDA 1YY9D 1NH6A 4JHWL 4NRZA 4U2YA 4ENZA 4MD0A 4IYKA 4JQIA 2XTJB 4JJOA 1WYJA 4FNUA 1NPJA 4XPHH 5FFLA 2JB5H 2TAAA 5T3ZL 3T09A 4HLZG 1E9QA 1CE1L 4PIRF 5AOMA 1FGNL 3JUZA 4CSSA 3BO8B 3B9DA 5IEKB 3O6KH 5KW9L 1QMUA 3HZVB 1T04A 5CN2A 3X14B 1MWOA 4IRSC 2BNQD 4UILH 5BZWA 3W9EB 4M7ZB 3LD8B 5AW6B 3MACL 5C0BB 4R2GB 1YMMB 4OGYL 3Q48A 3BESR 3WL9A 4ZJ9A 2A74B 3KPSA 3DXAD 1A6VH 2YAOA 3CMOL 4X5WB 5I73B 5CGYD 5DJAA 3C08H 2AANA 2AQ3A 5EZOL 1BVLA 2F7RA 4IK7A 1OXYA 4GAYB 4NKDA 2PCPA 5AVZB 3SJVD 1AANA 3DGGB 1OTUD 3OGOE 4BDVB 1VGEH 4UT7H 5ADPH 4K7FA 2A9NH 3LXBA 1WZ1L 2X70A 4WJ5B 4CKVX 5C08E 4ZMZA 1GSKA 5H2BA 2IEPA 4JKMA 1KPUB 3SPCA 5KSVA 2VR9A 4FNLH 1MW0A 1FA4A 3UMNA 4ZG1A 2FIKB 2Y5TA 1WCBA 5T3XL 1Z1WA 2FR4B 2WQXA 3DRQB 4I18C 4BQ6A 4KI5C 3QBTB 1YPZB 4Q6KA 1QR1A 3S88H 5FGBA 2GKIA 1HXYB 1RK1B 1SHXA 4IU3B 4YDJB 4HWEH 5E5UB 1AE6L 1IBGL 2FDBP 5I0VA 5JR1H 3GDCA 2X0UA 3KBEA 4IRSA 3OAUH 4LHJB 3QDMA 1BWMA 3N85H 1E8ZA 2YPVA 2VNCA 5C6TH 1GHFH 1KXVC 2H26B 5DJCA 4YBHA 4BFBD 3AS0A 2FSDA 2VGLM 2WINB 1W15A 3BCDA 1ZSHA 5LWYL 5I1KL 3V9FA 3LTVA 3BSZA 5L8JB 1PKQE 4KBPA 1VZGA 3MACH 1JF1A 1MREH 3K2MC 1USQA 4UU9A 3SN6N 1AHWA 5KOVC 2ALAA 2ZPKH 2AP2A 2IBZY 5DZVA 2NQ3A 1EGJL 3DWTA 2J44A 5KBLA 1JWMA 4Z7VF 3BKMH 3ARBB 1SUHA 1M42A 3HMWL 4B97A 2H1XA 3BAXA 5IBLC 4ODWA 2HT3D 1AGEA 1VGKA 3S36H 3TA3B 2R9HC 2DQHH 1CFTB 3EYVB 2ADFL 4PB9H 2P48B 1TSHA 3IMWA 3D05A 5BRZA 4JW3A 4FS0A 1AO7E 1B2YA 1WV7T 2VYRE 4K3JH 5FF6A 4ZAKB 1YVLA 1KWKA 4ZFZA 4DP1X 1B6DA 4AEIL 2X1XR 3V5KB 5L2KD 2CBPA 4OD3L 1A1MB 3GPSA 2Z7WA 4HIEB 5D7LE 3TO4B 3UTTE 2LW3A 5E4EC 2OMVA 5K93A 5GJTH 2KL6A 4MD5A 2Z8WC 1V5JA 1D5MA 2PPEA 4NBZB 4FG6C 5H94B 1MKFA 2GY7B 4ZBJA 1W0YT 3VFGL 1J5HA 2XTJD 2BM3A 2P46B 4F93B 2EDLA 4HG4J 2FZ3B 2B0SH 4JRXB 4F27A 5JIIA 1QBAA 4P5TC 1IGJA 4RBPH 3HLKA 5ILTH 2ARJA 1VF5C 3LS4L 1ZEAL 4YXLL 4NPYB 3C8HA 3HS0C 5A2KH 1KIRA 2G60H 1EUTA 3IE4A 1E4XL 4LHUG 1Z2KA 3LVTA 2X9YA 4ZXBD 4E5XG 3VSVA 3L45A 1FORL 1SJXA 4KJPC 1P4LB 4H0GA 4PRNB 3EFDL 3HW7A 2GBAA 3UPAA 2P24B 5IKCA 1TQVA 1S7SB 4FNTA 4PRIE 3CJJA 1MCIA 3JV6B 1JVOA 4JQVA 5JIMA 3WLWC 3PDDA 4P2RE 1UB5A 4H1LB 3UCRA 4PRHE 1FNGB 1FNSH 4GXFA 1AXTL 2FYYB 2FGWH 3L5XH 3MJ7A 4HUWB 5JO5B 3QDJE 1IBZA 4HV8A 1ZTXL 3VFTB 3QZLA 4Z7WA 5BJTB 4HEPA 4QKTA 1F58L 4HIJB 1MAJA 4GMSH 3QUZA 4PW9A 5DYFA 1F56A 3MROA 4NBYB 5MERA 2QVFB 1JFHA 4GG6E 3EADA 3P11H 3RWDB 3QEHB 3STZB 1K2DA 3G5ZA 4M1DL 4KXBA 4AE0A 4OFYA 2VZVA 1BFVH 5C0CA 3GIZL 1JK9A 4LPYA 4QRPA 5CZVL 3TESA 3JTSA 4I0KA 5LJYH 1WZ1H 2XIDA 5G2NA 1LO2L 3QWNA 4CU7A 3CZEA 5IW1B 1YC8A 1N3NA 2E9WA 1NAMB 3LH9A 4YL9A 5DSCA 2Y07L 2QEJA 4XODA 1RP9A 3SPJA 3S35X 3WLWD 4MCYB 4QHNA 4QJ5B 3P11L 4WI0A 3U4AA 2PYEE 2CZNA 4PWJA 4U6YB 2P5EB 4PJGB 1F4AA 3VFNB 2ZX8A 2XN9B 2Z0BA 3C5JB 3K2UL 1NJ9A 4R97C 4YDVB 5K1VA 4BH7A 1BPLB 3B9AA 4Y9CA 4DPAX 4DW2L 3NJFA 4C56A 1LTXA 5DZLA 1E65A 3CZGA 3LD8C 5AW0B 3K2UH 3WXVH 3RX5A 1DBKL 2Z1KA 4HKXA 5F7WC 1WIOA 1JNHA 3MJGX 3ZYJA 2E7CA 2DIAA 2HN7A 5JHLL 3CE1A 3S3CB 3G6DH 3FB5A 3JTTA 2BPBA 3RAJH 3FU7A 5DVOA 3WKQA 2BNQA 1ZA6A 4GSRA 4M56A 1UB6A 3CDZA 3CWGA 3X2QB 1TEYA 4GH7B 5BVJA 2Y3AA 3W57A 1XF1A 1PZCA 1LWRA 2IVFC 3BLKA 4AOFA 4E9LA 3U2JA 4RFEB 1YN7A 3UZEA 4DEUA 3F05A 3UAAA 1SMOA 1A3RH 3FN9A 2UZPA 3MCLL 5FC9A 5C3TA 4LK4A 4ZX6A 3U36B 3DDGA 2VAJA 3GIZH 2P3YA 3GS4A 3LMJL 5CZVH 4NOFA 2Z8SA 1ASQA 5CP3H 3OPZL 2QT6A 3MA9H 5SWZA 2PETA 3WHE1 3WBDA 1ZHLA 5DWUH 4BZ2H 4YBQC 1AQ8A 1MCBA 4XPBL 3A21A 2CIIB 1PEWA 4Q4EA 3FO9A 4ZMQA 1EBAA 3NSJA 2XG4B 5J1AB 1S3RA 4FNLL 1C12B 3BKYL 4GRLD 2A6JB 4WK4B 2BSBA 5GSRB 3C9NB 3ZIYA 1PY4A 1S3KH 1CZ8L 2YGOA 4GRMA 4PJHA 3QEUB 1JOIA 1F4WL 1LQBC 3R18A 4U1JA 3WLBB 2YXWA 4HJTA 4XC3H 4U33A 1F02I 4N20A 3DX9B 1G6RB 3FQRA 4JO3L 3PWJA 4JBSA 1GGIL 4ABUA 1FJ1A 1R24B 2W0FA 1D2OA 3QEGL 4JPVH 4PP2A 4JPIB 4PLKD 5TE6H 1KEGL 3U0WH 1FZJB 5DU7A 2UWEB 3ILQC 5EU3A 3R7RA 3LDBC 3QK0A 3I75B 1R3KB 4RMUA 1QSZA 2J1XA 1HSBA 3KLDA 4NZUL 1NDGB 3ARQA 4NRZB 3VM7A 2HJKA 4K5NA 3RX9A 1OAYL 1E50A 5CJOH 5EU6E 5F0JB 4HC1L 4F2ME 3PAYA 1UQSA 1XSKA 4F7EA 4YFEA 3B9KA 3HAEG 5D2LF 4LVHC 5DUBA 1M3IA 2ICWJ 1TEGA 1MREL 2ZOWA 4L1HA 4D0BA 3D85B 3LQAH 3QZWG 1B0RB 1YEKH 4MNHA 5ERWB 4HC1A 4J27A 4L1LA 5FA3A 4PRDA 3FRUB 4HUNB 2ZOKA 1PG7H 3S96A 3SKNB 4J5VA 3ZTDC 5AOJA 2E9BA 1G1YA 2H8PB 5D7JC 5SX4H 4WNQB 4LCWA 4U0RC 3RZWA 2BIIA 1JNNH 3ZDYF 1EEZA 1FAIH 4Q9QH 3EYQC 2MPAL 3ISRA 4JM2C 5AOIA 1GMEA 2N3JA 4IKLA 1C5DA 4QD2E 5E56A 5F1IA 5TF1H 5IHZA 3KPRA 1UG9A 5DCCA 4ZI8A 5CFAA 1A9EB 3INUH 1U4FA 3KL0A 1MLCB 1K4DA 1MCHA 3WE1A 1FO0H 3NIDE 5E95B 2Y06H 3BIKA 3ZDYB 1R5WA 2Y6SC 3KYKL 3Q44A 4A2MA 4IKIA 2QMKA 2WNXA 3B2UC 2XKNB 3AAZB 4QAMB 3U7YH 4E5XA 4HS6A 2HRGA 1UZGA 3ARED 3IS1X 2XDHA 1U3HD 4Z7UB 2SEBB 1GRWA 1RIUL 4UTAH 4CW1A 3BPOB 1W80A 1KBPA 4XT1C 4ZO9A 5DJ6A 1VPOL 4GSQA 4O02L 3RLSA 2OMXA 2GTWA 2YQ3A 3EYOB 1VA9A 4JKPL 2ORBH 4M43H 5DURD 5EOCH 2FB4L 1RP8A 3BJ91 4UQ3A 2VL4A 4LLDB 5EO1A 4LEEA 4LF3B 2G9HB 5JW4Q 3GJFA 4AE1A 2EE6A 4G6ML 4NNPL 4K73A 2PLTA 3LZFL 1IBBA 4QF1A 1T4KB 4NQCD 3UAJC 5EF3A 1UENA 1MVFA 2FUTA 4MJ5B 4Y4FB 3RRQA 3VFOB 3ETBF 1JPTL 4TVPL 3WEOA 1AHWB 1P6FA 4MJ6A 1Z3GH 4DTGL 2ZCHH 4JVWA 3MLVH 2ITDA 3PAVA 1HHHB 1XZ0B 1VACB 4KUCD 5C8JB 2BIPA 1SHMA 1CGSL 2YPKA 2C4FT 1F6LL 3QO0B 1GW0A 1MAMH 2FO1A 3AC0A 3PL6D 1UT9A 2ERJB 3DX3A 4K23L 4GI8A 5I1AB 4PRPE 2OSWA 1IE4A 3SE9L 5F3HB 3LJ3A 4OJDH 4M7LH 4WJKB 2WXQA 4JZNA 5MEND 4XAKE 5JQHC 1F3RB 4LCYB 3MRKA 1NGZA 4HBQA 3L1FA 3O6LH 4R4BB 2ESVE 4X6DF 2FJHB 3TO4A 5F6HJ 2P8LA 3QH3B 2YMOA 5F7UA 1TETH 2NCEA 3KL5A 1AKJA 2D7QA 2EZ0C 4ENED 1CFNB 1UJ3C 3MRLB 4MD5B 2WY3B 2YMXH 1MOEA 4N90E 4JG1L 1HU8A 4PHXA 2F54A 3F6LA 1HWWA 3UZVA 2DMCA 5MEPB 1IE5A 4N0YH 1ZVNA 3TT3L 4WNJA 4FQLH 4CNIB 1Q0EA 1EPFA 2VLLA 1RPQA 3DNKA 1UT2A 5B1KA 3F5WA 1IFRA 1SVCP 2XVBA 5B1CA 5E2UH 3T2OA 1MCPL 4I3GA 1HOCB 3U1SH 1F00I 4Z78B 4HBCL 3CCHA 1OB1B 1DVSA 4Z23A 1DJSA 5C0NC 5IJBC 1IC4H 4NJAH 4JM2F 2XOTA 4QHUA 3S37X 4DN4L 2B5IB 4N2FA 1ORSA 2AERT 5E94B 5KANI 4R7NA 2VJXA 1J9SA 4FFVC 4MJIB 4N5ED 1BLNA 1U3HA 1TCRA 4L8BA 4X6EA 3AREA 5IHUL 1HEJC 4MXQD 1GOFA 3SPGA 2KH2B 5AD0A 2IH1B 3V4VA 4JFDA 4Z7WB 2ZOTA 1FL3A 2FWUA 3OJMB 4KROB 4RWYH 1JGLH 4HIJA 3PUUA 4RBPK 1CWVA 1EDQA 4JPQA 1L9PA 3BEWB 5ISZD 1D3CA 1CD9B 2AZAA 1P69B 5DRNA 2PWEA 4M93C 4BXVA 5FO9B 3IKCB 5JOPD 2XTLA 3U2SA 3CQPA 1OT1A 1O0VA 2DYSB 4XN2A 5DXWA 1CYWA 1WPCA 1EDYA 4ZX3A 2ARWA 2M8XA 4FCHA 3BT0A 4JFXA 3D8MA 4NQEB 3U46B 4GLRI 1Y0LB 1WE5A 1XGZA 3QO1A 4GG6A 1XGYH 1JGLL 4PJ5B 4ZFQA 2HT4C 3W82A 3DROB 3ELAT 1M05B 4N2KA 2OP4H 2J8UF 1ZK9A 2NY6D 2IQ9H 4X9BA 1TPXB 3ABGA 3MUGA 3MJ9A 4W9ZA 3BH8A 4I5BB 3II1A 2H3NB 4LSSL 4UINL 3VVWA 1QFUH 4YDVA 3G5VA 2NZ1A 4GIPD 4XE0A 4AMKH 3RDJA 4GG6F 4NRXA 1AS8A 5AB1A 1JXDA 5HDBE 1EZLA 2Z92B 1GYUA 3KW7A 3Q6FA 3S3JA 4WCYH 5ICZB 3AQYA 2V37A 4GSUA 4NWUL 4XNMB 3C5SB 1UH4A 5KYYB 4QRAA