4AVJA

Structure of the fimh lectin domain in the trigonal space group, in complex with a methanol triazol ethyl phenyl alpha-d-mannoside at 2.1 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4avjA00
2JTYA 5CGBA 2WMPB 5AALA 5AAPA 4J3OF 3BFWA 2W07B 5AB1A 4X5QA 4XO8A 4AVKA 1N0LB 1UWFA 1N12A 4BUQA 4AV5A 4XOBA 5IQOA 5IQMA 5IQNA 4LOVA 5F2FA 5FWRA 5FS5A 4X5RA 3SQBB 4J3OG 5FLUA 2VCOA 1KIUB 5F3FA 4AUYA 4CSTA 2XG5B 5LNEA 5LNGA 3JWNG 3ZL2A 4CSSA 3ZPDA 3ZL1A 4AVHA 4AUJA 2UY6B 3JWNE 1PDKB 4XO9A 4AUUA 1KLFB 1TR7A 4XODA 4ATTA 1ZE3H 4J3OH 3BWUF 2JMRA 2XG4B 3JWNH 3ME0B 1QUNB 5ABZA 2UY7B 4AVJA 4CA4A 4XOAA 3BFQG 2J2ZB 4AV0A 4AVIA 3RFZA 5FX3A 4AV4A 4X50A 5JQIB 3MCYA 4XOCA 4X5PA 4XOEA
chains in the Genus database with same CATH superfamily
5EG6C 4R0LC 5A2IH 1BD2A 5DD6B 1VKXB 2Z91B 5ERWB 2DIBA 3JVFC 4C4UA 3D48R 4PTUA 3WTWA 4HBCH 1BXXA 4PJEA 5I6XB 1TJMA 4RSYA 3Q8FA 1DLFH 3L3IA 4QY8B 1C5CL 1CE1H 1IBYA 35C8H 3CZFB 3F64A 3HNTL 4P23A 4C59B 1W6LA 1ESOA 2VZOA 3FAWA 2X4RB 3TYGL 2YD2A 4NXSA 2Q2EB 2QPDB 3NQKA 2V2WA 3CZJA 3LAFA 3V9CA 2VL5A 3VD4A 4AOFA 3CZSA 1JWUB 1ZV9A 1JNHA 1YC7A 4IRZH 2GTWA 2E46A 2N0KA 5HDWA 3FYEB 3BP6B 4AL8L 3WN5A 2ZWSA 1I7TA 2G9HA 2YD9A 5BVPH 5HJDA 4OCWH 4PJFE 2A9NH 4PBWD 3IXAA 4MNHA 5E1HB 3SYPA 4KKQA 4EO5A 1NIDA 1Q9LB 4J3UA 2C4FU 4I1NB 4HKZA 5DTFB 3VI3B 1DCEA 3DMMA 4PR5B 1KYOJ 4ADGA 4N2GA 5DUBA 2V17H 5DFVD 3HPLA 3R0MA 3ARXA 5B1CA 3RIAF 3NCYP 4YDVB 4NO0B 2PCYA 5AW7B 4FXTA 2IGFH 1NFIA 2P24B 1KPUB 2WP3T 2ZKMX 4NKMA 4K5OA 2VR3A 3IMWA 4ZFOL 2ICES 4NYLA 1AD9B 1T22B 2DQUL 5BS0A 3PQYD 4KUCF 1VPOH 5EEUA 1N70A 5DVOA 3GSUA 2Q86B 1U8PB 3LS5H 4WWPA 4X7EC 5EZLB 3UX9B 5FWQA 1NFDF 1KIPB 1AS7A 1W0VA 4XMLL 3AREC 3SYCA 5C0FB 1TR7A 4F9LA 1ZSDB 3MA9L 1A3RH 4K9EH 5DURD 2D7PA 4I1RA 4UQ3B 4LIQH 1WK0A 2XVBA 3MC0A 2H0JA 3EG9A 5JHMA 4XZ4A 2B1AH 4QLWA 3ZE1F 2YGVA 2KL6A 3KJ6L 2X4PA 2CO3A 5EF0A 1J5OL 1XR9A 2KI6A 4MCZB 2BVYA 1NINA 1RI8A 4FA8A 2R4SH 4K2UH 5HDQL 2K4WA 5ANHA 4LKCB 1XCXA 1A4JB 1GJIA 4P06A 2QPFA 3MJ7B 3RGHA 3MLZH 2EEAA 1R3KB 3BDBA 3SJVD 4JFED 5A6IA 2BNQD 4HWEH 1XDTT 5HD8D 4HJ1A 4FMFA 1NMBL 1S7UB 3VFUA 2F5BL 1HHHB 4C56E 2XBZA 4WGWB 5AW5B 4RFOL 1ADWA 1KCVH 3NOIA 3NSCA 4UQDA 4WKXA 4N4YB 4N0CD 2Z0BA 4DF9A 1MXGA 4KNTA 1YEHH 4DW2H 2YAHA 4ZX6A 3FO9B 1HHIA 4YUEL 4RQQB 3BE1H 4QRSB 2R2CA 5LWYL 2I07B 3ILEA 1ZVSB 4W9HC 3VTTA 4KU1A 4MS6A 4DFHA 5BW7A 3IAGC 3W56A 4EIUA 4HUUA 4MD5B 4DGYL 1YY8B 1SM3L 4IU2A 1ZCRA 4PJAB 1J48A 4KH9A 2HX9A 1UB5B 3ARTA 3BEVA 4I0PC 5H94A 4ABVA 1H0DB 1ACZA 4QOKE 4DEUA 1CUOA 5I18H 1P1ZB 2AXGB 5MEPA 5D9SA 1XSJA 1YNTA 4BFIB 2YUVA 4Q56A 3WTYA 2VAAA 4UIKL 4LMQE 4OV5A 1YQVL 1Q9WB 3R4RA 4NAJA 2X6VA 1ZHLB 2NY3C 2YS4A 1U8CA 3LKQA 1GZPA 4GXUN 3ZDXF 1FO0H 4OJEH 2F8IA 2A83A 1AS8A 4TM9A 3FQ2A 5KOMC 4BKTC 2RFXB 2CAKA 3QEUB 4ADJA 1X4YA 3T0WA 1ZGLA 4GQ9H 2BLFA 4H26A 4KRMB 1VSCA 3CCHB 3FUEA 5DJ0B 5L0QC 1URLA 2G30A 1I1FB 3WFHA 4RMSA 3DDFA 2VT0A 1M7XA 3L17A 3GXTA 4HUXB 4NQCB 4GH7B 4OAWA 2XLLA 5GS0H 3VM7A 4NRZA 1KPRA 3OAZK 1MRCL 5DQJB 5K33A 3PABA 5T1DL 1ODAA 1CXFA 1FH5L 1ZANH 1ZT7A 5ID0B 2AJSH 3ULVH 1E27B 3H2QA 3V10A 1U95B 2KERA 2H2PC 1RY7B 1V8HA 2CRMA 3ECVA 5K1JA 1PZ3A 2F8XC 1L9QA 2ZF9A 3FUJA 1RZJL 1KCRH 3T3ME 2BRRL 4PP1C 3HBPA 3LNFA 3X1GA 3K81A 1WFJA 2C1PA 4HUWB 2FBJL 1X3DA 5JIHA 3VXNB 2H6PA 4XE0A 3UO8B 4DWHA 4H1LB 2AMGA 2G9KA 2EYRA 4XP6H 3W11C 1OGAA 4KMLB 3D25B 4OKDA 3TH2T 4XZUB 4MJ4A 4W9EC 3QUMH 1JXDA 2MQGA 4CMMB 4PCYA 3RX7A 1OSZB 4UNTA 1E90A 5I6XC 3OC8A 5D7SL 5J6GB 1B9ZA 4UINL 4RZCB 1F3JA 3NGBB 4LL9A 3W37A 3OF6A 4A2HA 1IC7H 3EYVA 2ISDA 2G2RA 4L4TA 4CVZA 4OFYA 1DLHB 2RTTA 5DD0H 4NLHA 4KTDL 3EFFA 4GO8A 4OF6A 1J1XH 1EHLH 3KJ4B 3PGCA 4J3OF 4OZIF 1CE6A 1M71A 1DZBA 4U4BA 1ZKAA 3FHAA 1UXSA 3S0PA 4U0QB 4PB0L 1QD0A 2ZPKH 1U2CA 2XV6B 3EYUL 2XOTA 4DZ8A 1CBVL 4XMVA 3ME0A 4PAZA 4N2KA 4DKTA 2EVGA 5KN5B 5E6RB 4YN3A 5JHDE 5E5MA 3MRKA 1NFDB 2VIRA 1LO2L 2AXFB 1X4XA 4CKQA 4U1SB 1LWHA 1CMOA 2OCJA 3HHSB 4YNYB 4QHUB 5C1MB 1ZS8B 4RMWA 1A6UL 4ZZKA 1HQ4B 4XCCL 3DJTA 3AS1A 3SB3A 3V5DB 3D8MA 3C5SA 2XN9D 4Q9BA 3ZE1B 4LLMB 5A7BA 2F19L 4UQAA 3LMJH 5CEYB 5BO0D 4U2YA 4FNUA 4PW9A 1EJOL 1EAJA 1AG6A 4HOWA 3F85A 4XP1H 4X5RA 4PG2C 2HVKA 4TPRL 4JFPB 1PLGL 1AHWB 4JFFE 3BKYH 1I8UA 4FL4B 3LRSA 1V7ML 2VN3A 3JV4A 4OJDH 5I1IL 3EYOA 2H3KA 2H32A 1NSNH 3BRFA 1RJYB 3GDCA 4XCNA 5EC2A 3FUDA 4TSCL 3SKMA 4A2EA 2XIBA 3FQYA 1XCTB 2YMXH 5FECB 2VDMH 4XPGH 1M9WA 1MRFL 4F7MA 4Z23A 1G0XA 2YEZB 2W5PA 3DYPA 4PRNB 3WLWD 2FSEA 1KELH 5I0ZA 3UP6A 5AUMA 4KK5C 5CKAA 4M1CC 1JZ2A 4FQXB 2VZVA 4A7VA 2PCPA 1NDGB 1U3YA 3FQXA 1MZZA 1MI5A 5HVFB 5JOPE 4OCMC 4X6CA 2WN2A 1FLRH 1JGLL 4BFNA 4ELMF 5LG6A 3O41A 4A68A 2XPGA 3MJ9L 4R2GD 2D7TL 3QFDA 5IVZA 4ATTA 3IU4L 1ZLWH 3P0YL 2E6PA 2JMRA 2YD5A 5GGRB 1INEL 2XN1A 4IBTA 3U36A 2WJ5A 5IT2L 2WD0A 1RU9L 3HHRB 4F57L 4RH4A 4MGXA 1KYOK 1SEQH 1BQLL 1W6WA 4MKTA 3IFPB 1WBXB 3NJIA 2HFEA 1E4XH 3OMZA 3CHQA 4K94C 4TMPA 4LLQA 1TZHA 3MXVH 1QWHA 3DX8A 4U6HB 1AKPA 4YQXH 2HLFC 3ZDXB 1KXVC 4BV1A 1G6RL 1DQQA 4HXAL 3KPPA 4R96A 3ZL4L 4PJFA 1MAMH 1FYTB 3IPFA 1M7UA 5I15H 3D0VB 1JNNH 5E8DH 1RCYA 2Q8AL 4X6FB 5F1OB 5I6LA 1QFWL 5I8OH 5CD5C 4DUXA 5DC9B 5F89B 3BT2L 2QSCH 1SXNA 4KKLD 5J1AA 1FGNH 4BKSC 3KWUA 3BJLA 5D1XE 4X5QA 1E9OB 5F7EH 2VW7A 5IESL 4JL2A 1T0OA 1EX0A 2VDRH 1ANUA 3UMNA 1FV1B 1PZDA 3HCVA 3UFIA 4TVUA 5I1HL 3ES6A 4P46B 1GKEA 2QJDA 1YYMH 1R0AL 2W0KA 2OMUA 4YSSA 2DL2A 3MUJA 4DK6A 5I8CB 1TCMA 4GRWH 3FBQA 1I1AC 3MAWA 3A4AA 4ABUA 1G6RA 2ADJB 3LQAH 3ML9A 3ZK0A 4B50A 1DQLH 3T65B 2ATKA 2HKHL 2Q9OA 2VLLB 4KAQL 1Y6MR 1AMXA 1PY9A 4XCEA 3OX8B 3M07A 3VRLF 1AYRA 2ITFA 3O9WA 2V33A 5AAWA 2X5PA 3AC0A 4GBXB 3WEOA 4EVNA 5E6SB 3B37A 3FT3B 5H2BA 2JH2A 3RGVD 5LQBH 3GSWB 3QDGD 3RPIA 3VVWA 2VDQH 4AUYA 3MTXA 4P2OB 3D18B 4GS7B 2F1EA 1QVOA 4C55A 2ZZUT 1BXAA 2CO6A 2NSMA 4TS6A 1T4WA 2CLVA 4WENB 2MCMA 4JEGB 2WKGA 2JKXA 3KWXA 4LEOA 4WUKH 4XBEL 5F88B 4JG9A 2R9HD 4LDLB 2WSPA 3Q1EA 1R5IA 2I9TA 2RGSA 1IILE 2IAMD 2OXGB 2WTRB 1YN6B 3WMSA 1YHPA 3SBRA 3VRJB 2K0RA 3KPRD 1AGBA 1J1PL 4GIPD 2R0WH 4NZUL 3UAJD 4C56A 5I1DB 4OZIB 5FEBA 4M5YL 3KLAA 3W0WB 5HVHB 1SBSH 1KB5L 4ANXA 3IPEA 4R5XA 2YAQA 4KVCL 3QAZB 1R9FA 1GHFH 3MBXL 4HHAA 1EA9C 4M1GL 1FYHB 1XCQA 5DEFB 1LL1A 1BLNB 2XWTA 3SYAA 2NT0A 1IAMA 3SBWA 1K8DA 3EOBA 2AJVL 4RCAA 4ES9A 3V52L 3NGBC 1IGYA 5CF3A 3LEVH 3SGDH 4FS0A 3ZSSA 4MZ2A 2YQBA 3OZLA 4AH2A 4NIKB 1I4FA 4Y8DC 4W9FC 2PTUA 3REWB 4UCFA 1T89C 4PBXA 4QOKA 3WG7B 4JRLA 4AV0A 2IDSA 2A99A 2HFGH 3H9HB 2CCLA 2A77H 3KJ4C 4XC1L 2F5AH 5I17B 3HE7A 4NUGL 3H2WA 1TOXA 3TEWA 4AE0A 5JPNB 5AB2A 1BVLB 2KZKA 1KB5A 3FK3A 1CFQB 4P9HL 3LKOB 4OIFA 3NIDE 3NDZE 5AVRB 3T4AA 1D6EA 3FU8A 1GGBL 1NCAL 4HDIB 3L5IA 3ZDYF 1N10A 1WP6A 3FFOA 1N64L 4QHKJ 5BZWA 2FX8L 2YPLD 3Q2CA 4HBQA 1ZLVH 5LKNA 2BS71 4WU7A 2AK1L 4UMGA 5ALCH 3PLYA 3NIGB 5AZ2H 1QLEB 4BCZA 3BW9B 1RIUH 5ISZE 3JV0A 3RWCA 1KGCD 1Q9OA 4XXDA 1Y0LA 1JZFA 2ADFL 2K6YA 4MWFA 1AXIB 2R2EB 1PY4A 3THMH 3PWLB 1FN4B 2WM0A 4FNLL 4IU3A 1EO8H 3L3JB 3F6JA 1NIFA 2ZXAA 3R8BB 3SPGA 1QOKA 2MQCA 4FL4C 2NR6C 2X4SA 1E8XA 1ZT1A 3D9AL 3QG6B 5B4MD 1UADC 2R29A 1KTBA 3HMWL 1JHLH 1TZGH 3MREA 3NCEB 3EJYD 1X5MA 3MRQB 3DHJA 2QADD 1LMIA 5CZRA 3BAIA 1T0NB 1MQKL 4XNYL 1I7UB 4XMPL 5KVFH 3DJZA 1WDAA 3QPXH 2EDLA 2DYSB 4PGDB 2MPAL 1CTNA 2PWEA 5IJVB 3EYFB 3QYCA 3X13B 3RWEB 3LSOA 1HWGB 2ZUYA 3GEWB 1UT1A 5CP7A 4DK3A 5F7UA 2ADYA 3MBED 4MMZB 4WF7A 4FQXC 4UU9B 5BUAA 4KQ0A 5DC2A 3DUHA 3D08A 3GGWA 1A6AB 2AEWA 2OMWA 1J11A 3FTVA 5EZOH 4E42A 2V2TA 2NXZB 3O2WH 4GY4A 5EWIL 2DF3A 1YNKL 2JQMA 1OSPL 3O6FA 4DVBA 2XNAB 2VZTA 4F8LA 2FJSA 1NCDL 1Z3GL 1EXGA 3UPRB 2CKBB 2Z7YA 1INQA 1MJUH 1Z32X 2VLRD 5SWZB 3BVXA 1MCSA 4NUQA 3EGSB 4PJ5D 5IVNA 3VWJB 3SPIA 5AW6B 1G7HB 5I6OA 3OR7B 2H47C 4LSDA 3O6MH 3O3UN 2JSFA 5HHOE 2NY7L 4Y5VA 4UT7H 3FQ4A 1FBIL 1IGJA 3JTSB 3ULUF 3RIFK 2B39A 2DQTL 3EGDA 1G6VK 5EDXA 1MUJA 5DD1L 2J2ZB 5JHDA 1AOHA 3UTSB 4KXAA 4H0LC 5F0MB 3QZOA 4L0ZA 3V5HA 4NRYA 2J72A 3A6BH 1T04A 5TDPB 2IDUA 4NT6B 5I66A 2EUXA 5EIVA 4MNQB 2Y7NA 4XOCA 4RNRB 4HF5H 3KD4A 3Q3GA 5KSBE 3WLBA 3QCTL 4I0PD 5F72S 3KGRA 4XAKD 4EXPX 4JN2A 4W81A 3MRLA 4NBZB 1SEBA 4P46C 1QFWI 3MMEB 4JO4L 5CJQH 3AZUA 4ZMVA 1A9BA 3WNNA 5DT1H 2IO5A 3WTXA 3QNZA 2ED7A 1EZSA 4WJG3 3T0EE 4OJAA 3ZMNA 4HX1A 3OTTA 4OGYH 5L8JB 2C9UA 4XBPB 4LNRB 2J5LC 2Y1VA 2Y36L 1BYOA 5FO8A 1A64A 4OLVL 4FQCH 3GPSA 4GBXC 2I25N 4TUKH 5CBAB 1AC0A 5E5UB 4ACTA 4PJ6A 3UTPD 4U6TA 1U58B 3PJNA 4DTGL 5A3ID 4XPFH 1WFTA 3T2QA 4HHGA 1XGPB 3OB0K 3QISA 4I89A 4JZNA 4BJLA 1BFOA 4P2OC 5ANMB 1GGYA 3GLZA 3LIZL 5CLYA 3HC0A 1ID5I 4FFYL 5D1QB 5GGUB 1DCLA 1JAEA 4UTAA 4V33A 3FONA 5EO1B 4L8BB 4YOKA 4HG4J 2E75C 2EE2A 3UEZA 1LNUB 1CF8H 1O6VA 2IPTL 1LO0L 2DQJH 2OL3H 2YQGA 1JF1A 4HT1H 4JPSA 3BFOA 3QAZC 4MA3A 1ZGLP 2XN9E 1QPXA 1T1WB 3E6FA 4KX9A 2WNKA 2VMEA 5DU7A 2D3LA 1GC1C 4HH9A 1ETZB 4FZEH 4KBPA 4NENB 4AEIL 1X7QA 1M6UA 4GUQA 4PLKC 1IBGL 4MJ6A 3RWHA 3ZDYB 5IG7B 2W9LA 4LMQI 3OAUH 3VGDA 4UT9H 2VDNB 5JR1L 3AACA 5A6LA 3J2PA 3GRGA 4G6KH 3QJVB 4JKWA 3UH8A 2JB6B 2JI1A 3JYCA 4GMTH 3V9FA 1YDPB 4NUMA 2BIHA 4A7SA 4OB5H 1RJZA 4KDTC 3TBBA 5I1GH 4RFEA 5D1XA 3HNVH 4GRMB 2BERA 4Q0XL 3G5YA 2DQIL 1U6AH 2QQQA 1A2YA 3HG5A 1JERA 2JJVA 1H15B 4EI0A 1BAGA 2ESVD 3CDGB 4AVJA 1QP1A 5CEXA 5L2KD 1A7NL 2PR4H 4YFLF 2GB2A 3IFLL 4N68A 3IGKA 2AC0A 2EIMB 2X6UA 3CFBA 1TZOA 5DJYA 3AQDA 1LQBC 4Z9KB 3VXPA 1HI6A 4GLRI 1GVIA 2OCCB 3QNFA 1ZTMA 2CR6A 3KPOA 3O45B 4YEFA 3FN0H 4PTTA 3TBSA 4CVXA 5C0CD 1R5VB 1VFAB 4OIBA 5JA9A 5AALA 1QASA 1J0JA 1L3NA 3IMRA 3ULSB 4RMBA 4DPBX 3ZTDC 4W6YB 5BQDA 4MMYA 1AFVL 1ADQL 5TE7H 4AZ8B 4CN6A 1S7VB 2BVUA 3DX2A 5DJ8A 3BH8B 1QI3A 1SHMA 4J12A 3CC5B 1E8YA 2EIDA 1NOFA 3L4ZA 3S2CA 3MBWA 4XN8A 4FI8A 1IGTA 1MFCH 3WBDA 4G8FA 1PZAA 1XGZA 1PX3A 2JF1A 4BRJA 1C5CH 4JHVA 4BWWA 5I1KL 3PWUA 1WFOA 1KSRA 3KVPA 5DJAB 3TYGH 1KJ2B 1L0XA 3O2DL 3OKKA 5T1LB 1OP3H 1GXEA 4WW2C 1JK8A 5J89A 2Z8VC 1WPCA 4EZMA 3AB0B 3P77A 4QF1A 3KPNB 2AKRA 5H35B 3ZMEA 4YPJA 5HDRA 3TESA 4PS8A 4A39A 4AL8H 2FGWL 4I3GA 4ISVB 4KTGA 3B34A 3P4MB 2NXZC 4O2FB 4KKCC 1T83C 3PQYA 4A7GF 2XWBA 1KTLA 3PIQB 1FAIL 2WOYA 5EOTB 4MAZA 4MXQC 3HZMA 3WEXB 4E0RB 4ZUTB 2YSSB 1HYSC 4JJ5B 4UOQA 3P3TA 5F7NC 3DI3B 1E9PB 4CSZA 1S3RA 3H54A 5IMOA 3VWJC 4G1EA 1JWMB 2WP3O 3U2IA 3QQ3B 4YBLB 3GD1C 3O2DA 3QDGE 2CO2A 5KJ7E 1FA4A 2ZOWA 2DQUH 1P7HL 3MRCA 1TEGA 3IGAA 2FEJA 2HLFD 4WTQA 3X11A 3WFZA 1YUHA 4I0CC 2WKLA 4AGMA 5A2KH 4PRID 4NP9A 3SJVA 4JFEA 2BH0A 2BNQA 4WLCA 3ZQXA 3G6JA 1S8DA 2YXMA 4XMLH 4E5XB 4WJ5B 3ZN6A 5B1JA 3MA9H 2WWKT 4LAJH 1E28A 4G1MB 2V8LA 1J05B 3AUWB 4FMVA 5C0JB 2B5IB 4UNUA 43CAA 5I1AB 3KJ6H 5CHNB 3QXDA 5DMYA 3BZDA 1D5IL 3DUUA 2X1XR 2EXTA 3NCXA 3K0WA 4Y16C 4N8VA 5HDQH 1YJDL 5DQDL 1ERNA 2OMYA 3D51A 1U21A 3GLEA 1T1XA 4JG0L 1QW9A 3V7MA 1DVZA 4FHKA 4JANA 1NMBH 4TUUA 3KNBB 1I1AD 3AT9A 3TASA 2APTA 1HILB 2F5BH 3DOIA 5JW5B 1ONQB 4RFOH 3MLRL 2VLKB 1JZ5A 4YXHL 2X9WA 4ZW6A 1OTUC 2EIZB 4APQB 4ZYKB 4YUEH 3PHQA 2DB8A 5LWYH 5CCKH 5E03A 3Q06A 1OW0A 4EOWL 1Z1WA 3FAXA 3OKNB 4I9WE 5GHWL 3Q2WA 3NA9L 4EXKA 3UBXA 4DGYH 1DO5A 1AANA 1SM3H 2EH8L 4ZAKB 5I75B 4D2NA 4B0MB 3TP4A 5CLZA 4KK8C 3PHOA 3MV9B 1FI8C 1K2DB 3P3YA 1M1SA 1YY9D 5F7HA 2XSKA 3FQUB 1JN6B 5TJWK 4EI5B 1BOYA 4F8NA 1KJ3L 1KGCE 2ICEC 3G6DL 2ADGB 2ZNWA 4N8VG 4OCYH 4UIKH 5IJCC 1YQVH 1EBAA 1Q1JL 4LOUD 4Y19D 2BS9A 4JHAL 5GQBA 5DJ2B 1QATA 5CO1A 1F0LA 5D7KD 4P4KD 1MW0A 4U6YA 1TSRA 3OLEA 2XQBL 2VJ8A 4LKXA 5JHAA 2BM3A 1IEBB 4YVNA 1KCKA 3IDGA 3MNZA 5HDLA 5DHVB 1QR1A 5SWQA 3H53A 2YSTA 3MRIB 5KSBA 3QHZL 4OCRH 2VN6A 3SO3C 3O3AA 5JYMA 4BQ9A 3MJ8A 3IVKA 1MRCH 4MHHI 2DEWX 4NSKA 5T1DH 4IEFB 5GSVB 1FH5H 4KXZI 3UBXG 4HV8B 1RD6A 4GW5B 2BWIA 3OKOA 1O6TA 4J1UB 5EMYA 1QO3A 2B16A 2EC9U 2TAAA 1JNLL 2WLIA 4L3AA 5F1SA 2LTQB 1WC7B 1FNEA 2EE6A 1RZJH 3FDWA 1N2RB 3SPVB 3VGAB 3HA0A 4N22A 4HG4K 2AANA 2P52A 4ACPA 4YX2L 5CSGA 2F8VA 2FBJH 3GK8L 5MERA 3VRIB 2VLRE 4W6XB 1F4WL 1T20A 4PJ5E 1ZXKA 5DRWB 3IE9A 2CO1A 4NQXA 5DEZA 4XX5A 1CLVA 5B22A 4AQ8C 2O6DA 1UUSA 2GIXA 2JXMB 3TT1L 2Y5EA 1AG0A 1RSFA 4KJQC 1KLUB 1V54B 3QO1B 2P7TB 4GKNA 2AABL 4PIBA 2UZYA 3WTUA 1A0QH 1SVCP 4GP8B 2J44A 2W8CA 3U4EB 5D7SH 4UINH 5I0DA 4HUKB 2YC1B 5E6ZA 4PS7A 1NCWL 1JWSA 1VEOA 3QWRD 5HYQA 4OVVA 4AE1A 1J0HA 5ES4B 5E23A 1X44A 5HY9A 3AB0C 5C0BD 1SJEA 2I26N 4OBRA 3FTYA 3ZLQC 4AV5A 1C9SA 2XN9A 3H9ZA 5DJZA 3ULUC 4XAKE 2AQNA 3BP4B 2EKSA 4PB0H 5AW4B 4B7LA 3EYUH 2H32H 1WCBB 2C9QA 2FSDA 2XFXA 4CC4A 3VXRD 5A1AA 4PI0A 1D5BA 1Y1DA 3L5JA 4U33A 3GMPB 1HEJC 2MFNA 3T6ZA 5D7LB 1A6UH 3E9TA 4XCCH 1C5BL 4ATWA 1Z9SB 4B9FA 4FXGA 5FOBA 2X53A 5FDWB 1HXMB 3BX7C 4YBLC 3BPCB 5G4MA 5BVJA 2ED8A 1EJOH 1QBLL 2WOBA 7FABL 1JVOA 1V05A 4S1SL 5C0NC 2OLDA 4FQPA 3QIUD 1WWBX 1PLGH 3U4AA 4ZW8A 1LD9A 4NERA 1HNGA 5GISL 2DOCA 3DYMA 4UI2A 5I1IH 1V7MH 4KV5F 1RUML 3FF7A 3HG0A 4HETA 3BQVA 1BZOA 4PJIE 3U7YH 1GS6X 1CICB 2FLMA 1D5MA 4TSCH 1SBBA 2FRGP 3UC0L 2NY0B 4KZCA 3MV8D 1TVBA 2BSDA 3VJ6A 4AIXA 1CFNA 1MRFH 3B9KB 3MRGA 3M1CA 3LRKA 5KSUB 2WQAA 4PS4L 4XNUL 2B5IC 4XODA 3FU0A 4XRCB 5DZPA 1LEKA 4YLCA 1U3ZA 3X12B 4PLNC 1JVLA 3BWUF 1YCSA 1THAA 3DPBA 1FFPA 1K8IB 1S9YA 1JGLH 5HHPB 5ITFA 2NYKA 5EO9A 3LVTA 5F9AC 5TF0A 2D7TH 2YD4A 3PJSA 1DANT 4LDOB 3RWJB 4DN4L 3CMGA 1KTCA 4CU7A 1Z5YD 5ESAA 1INEH 4R5VA 5IT2H 5DJXB 1RU9H 3T8XB 3UBXI 4F57H 2JI2A 4O51B 2EO9A 1BQLH 5EO0B 3GBNL 4G7VL 4X9IA 1HNYA 3A21A 3TN0B 4GAYB 4MJIB 2FNWA 4HUCA 1QLFA 4APQC 2VW4A 1FUNA 1CWVA 4MNGB 1T4KA 3CSYA 1JPGA 1LDPL 1F58L 5C2UB 2DEXX 1G6RH 1IX2A 1GRWA 2ESVE 4HXAH 2GC4C 4A6YL 5L2KE 3VXTA 5TDNB 3I9IA 2YLHA 5TGBA 2OTWB 4N85A 2VQ1A 4OLUL 2MH4A 3SBQA 4CGUB 3UZEC 4M4PA 4G5AA 1GIGL 2CA4A 5IVOA 5FHAH 1KZYA 2ICWB 3US0A 4HS3A 1N0XH 2Q8AH 1QFWH 1IKOP 4ELKB 5C7XL 5FGRA 3BT2H 2X0WA 1DJGA 2EDJA 2E0PA 3QZWA 4FTVB 5F9JA 3RWDB 5C0CE 1EV2E 5IREA 5IESH 4JZJA 3PY9A 3OJDB 3PWJA 2IDFA 2J88H 5I26A 2YZ1A 1CLYL 3AW5A 5I1HH 1M2VB 3CDZB 4HK3N 4XPHL 3GKZA 3RGVA 1YEDA 3QDGA 3VNZA 1R0AH 2QELA 5ALBL 5CN2A 4U1MA 4GG8B 3DPDA 4IKJA 3BP7B 5EHFA 1DE4B 3CUPA 1AZRA 2E9JA 4N2IA 3NH7L 5GIRB 2VB5A 3N50A 5FKAB 5TTRA 1KEML 5AVVB 4A6YA 2O61A 1JPTL 2HKHH 3QDMB 3STZB 4PLKD 2ZKWA 4Q2ZA 2IWFA 3GJEA 3VFTB 5IVXF 1OLZA 2IAMA 5KZCB 2FE0A 3HS0B 3ZHLA 2O5NA 3KPRA 4MTMA 3UAJA 1WZ1L 1B4JL 4UT6L 1MCNA 2ITDA 5C07B 4LRIC 4WU5A 1BEXA 1DBMH 1NICA 3NN8B 3HZYA 1SLWA 1OGPA 1OCZB 1NBCA 1OY3B 4H8WC 3EJJX 1SDAB 3JV6A 1FVEB 5I71B 1JGUL 4HLZG 4Z7WE 1ITBB 2FT6A 2LTQC 4FG6C 4NQDD 3DSNA 4UDTB 4MLSA 4ZQTA 4UMSA 2YUXA 5C3IA 1MVUB 5CN1A 3VGAC 4YHML 1JCKA 1XR8A 1J1PH 4NZUH 4KJPC 1K4CB 4M5YH 4XCFL 3SKNA 1KB5H 3ECBA 3LKRA 4Z7VB 4KVCH 1EO7A 3TURA 3MBXH 3EGXB 4M1GH 1BVNP 2CMRH 4HJUA 3OKEB 5KYWB 4WI5A 4IM8A 2Q7YA 4MJ2A 4LSQL 2YA2A 1IL1B 3EOAA 4UT6A 3UAFA 1AIFB 1OTSD 4F8PA 1OVZA 2AJVH 3AG3B 2BSRB 4H5SA 1OCOB 4KRPD 3CQFA 3V52H 5B38A 5MP6L 4D3CL 5JDSA 3FB5A 3ZZLA 4TUJB 4WGVB 4DP6X 3FQ1A 3OC5A 3LD8B 4PRIE 3REVB 3GMRA 2YPLA 5ICZB 1HNFA 3FU5A 4RGMC 5BQ7A 2EXYC 4XC1H 5EU3B 1TNNA 3LZFH 5K9JL 4R9HA 3SGJA 3TO2A 3VGHA 3DXAB 4HJGA 3SCMB 4MYPA 4NUGH 4WTXA 4YHNA 5JIIA 5IKCB 2BW4A 3V0AC 1N0LB 4OJFL 2AXWA 2BCKB 5E2TL 3VTMA 1QR4A 4P9HH 3AU0A 1I1YA 1OAQL 3ASWA 3IN0A 4JQXC 3NK4A 4UTCA 3GUFA 1N64H 2FX8H 3PXHA 1QA9A 3U6RA 4AQZA 1NCTA 2AK1H 5SWSD 1LO5A 4DO5A 1Z0MA 5C71A 3LRGA 3E6HA 1OO2A 1XMEB 3D6GA 3TCLB 3BVNA 5HYFA 2Z31D 3W39A 2IALA 4MSWA 4MXQD 4KO6A 4TSBL 2ADFH 4HIJA 4WFED 1KPVA 4YWGL 4R4ND 2G60L 4K3DL 1D5ZA 1IFGA 3WS3B 2XTJB 4JRWA 3GTTA 3MBEA 4FNLH 4F58H 5EPMB 1OAZL 1IBDA 2APVA 5B38G 4YO0B 5JW3H 3D9AH 4KO5A 5DHMC 1G1KA 4Y2NA 1L0YA 1WRFA 3L2LA 3HMWH 4XNBA 2K1MA 5E9AA 5FCUL 4ERSH 2FATH 2OW7A 1ILSA 1CICC 2MSPA 4XNYH 3UXFA 1MQKH 2A6KB 3K74B 4XMPH 3TU6A 1WV7T 1DP0A 4ZQKB 1ND0B 1NCIA 4MA1B 1RZKC 3KL3A 5IJKA 4ZO6A 1HDMA 5EU5B 1CIDA 2MPAH 1NA8A 3FU7B 2A6IB 1N6QL 3VD3A 1B6DA 5I76B 5TDOA 3G5VA 2VLRA 3BJ91 5ENWB 4AUUA 2FJFB 4N26A 4PJ5A 3L9EA 2OXHB 4Z7AA 2GSMB 4Y19E 2WBWB 1BFTA 4R7NA 4W9ZA 3QT2A 2JK5B 1CB4A 4M03A 4BH8B 3QJOA 1YEGL 5D7KE 3ARYA 2NW3B 3FCTB 4P0DA 5I74B 1A14L 3AT0A 4DPRA 2D7MA 4Y16D 1OSPH 2PPCA 5AW9B 1NCDH 1Z3GH 4X98B 3DV4A 3L3OB 5DZLA 3ELQA 4NC2B 2DL9A 3ALXA 1MWAL 3ARGB 2JKJA 5DD5H 4OCXL 1IQDA 5GS3A 1JPFB 3SE8H 4I0PA 1F3DH 4PWIA 5TK4A 3NJVA 3SDYL 5IHLB 4BWUA 3LXUX 1BA9A 4XH2B 3F05A 1PQZB 2XICA 3FH8A 2VQUA 2WKOF 4QCIB 2QSTA 5DD1H 2XPYA 2CJTA 4UM9D 3U30C 1WWCA 1N8ZA 1ZWIA 2NYYC 5IVXB 3LHPH 3NZ8A 1AZZC 3HR6A 1CYWA 4M6NH 3WL9A 2NZ9D 4ONGL 5HHNA 2DIAA 1WVZA 3QCTH 1ID2A 4OFKA 3MV11 4HMCA 5EEVA 1NC2D 1V3KA 5J57B 2XHNA 1JXGA 2UV3A 3C5JB 3ISWA 4JO4H 4PUBL 3LV3B 3UIYA 4UTAH 4FRWA 1CG9A 1N59A 3PAYA 4BQBA 1SYVB 2V4LA 1FL3A 1RK7A 4Z77B 3BZ5A 2IH1A 1XAKA 1A4KA 4KY2A 4NFCA 3BAJA 1P6FA 1RVFL 4JFOA 4OCLC 1ZEAL 2Y36H 4KHTL 4R7XA 3GUTB 4OLVH 1QYGL 3F7QA 4IOIB 1SN5A 4ZMLA 3CN3A 3TC9A 3QJFB 3HS0C 3HUJF 2JJSC 1Q1PA 1T7YA 3CVBA 3OZ9L 5T3XE 2WQWA 1BZEA 3KPMB 4DTGH 3AAZA 4NPYB 1VAHA 4B60A 4DIXA 2R23A 1G5GA 2DWEB 3HZKB 4LVNB 4EN3B 4HLEA 1OARL 1OK8A 1M9SA 4BKLB 1ZLEA 4DP5X 1LEIB 3G3LA 1YEJL 1KCLA 1C8QA 4JDEB 5AOMA 2HN7A 3KLDA 4FFYH 3MLTA 4PLOB 3BKJL 3RA7L 5GZOD 2C8NA 2GHZA 5I5IA 1TYEB 4YSRA 3LKSB 2V3EA 3DGGB 5FM5M 2GC7C 4HC1L 2Z91A 4ZW3A 1CL7L 1CR9H 3T0BA 2IPTH 3CPLB 3H42H 1PLAA 2C3XA 2Y7MA 2DTSA 4L1SA 1KBPA 3VFOB 2M8XA 3UTZB 2F0CA 4HCIA 4BFOA 4BQCA 3C5XA 2DAVA 4NHCL 2ILLA 4U1JA 4EDXB 4BBWA 2Z0UA 3BLPX 2EDOA 4AEIH 5GGTA 1XL6A 2ESVA 2NY4B 5L2KA 3IS0X 2IADB 3IDNB 4XVTL 3NEXA 1KIUA 1RZGA 1W9XA 1FZOB 2ARJQ 3L3DB 4P59L 3QNXB 3IXTB 3ZDXE 5JR1H 2MNJB 1BM7A 1B2YA 2F7PA 4JFTA 2FB4L 4XBGA 3LD8C 4Y5YB 4OLXL 1KBKA 3IDJB 1SUJA 4I5BB 2E7LC 4KXZH 3IGUA 3MV8E 1GGIL 1Q9LA 4FXKA 5DTFA 1PF3A 3TO4D 1SNRA 4Q0XH 5C0CA 2DQIH 1IC5H 4HC1A 4HH8A 4I18A 2LT9A 1B4LA 3OAZH 3MFGB 4G9FB 2XKNA 4TNWF 2MMXA 1KLFA 4ZTOL 4YSTA 4Q74A 4FNQA 1CD1B 1T3FB 1S9XA 2YGOA 1A7NH 4NB7A 1JYNA 1TF4A 2ZXGA 3IFLH 5I1LA 3CXFA 4PJDA 4RMRA 3CH1A 1MLCA 4H8QA 3MRHB 1T5XB 1ZLDA 3GMNB 4A2FA 1TJHL 4M6OL 3FO0L 1AD9A 1EEYA 2PW1A 3MRNB 4PG2A 1NCBL 4X0KA 4F8TA 1AR1B 3BWUC 1NJ9B 3ZTEA 4H8PA 3ZZ1A 1U8KB 3CZGA 3GKWL 2OKMA 3C08L 3HTLX 4S1DC 5AKTA 4N0FA 2Q6WB 4S1RL 2DJMA 1WT5A 3WKNA 1AFVH 1ADQH 1BW8A 2UVFA 3DX7B 4K94L 5C0FA 3BUTA 2E5EA 2PYEB 4YE4H 1A1MB 2JELL 1XEDA 2NNXA 4UQ3A 4I87A 4LOVA 2D3VA 4QRBA 5C0ND 1JUFA 2BW5A 2C7UB 3QARA 2NUTA 4Z7WA 3L2MA 5I16B 4RAHA 3GS0A 2AK4D 4MA1C 5EORL 3VH8B 2LR4A 1LO4H 2GJ6D 1XF2B 4CADA 5I1KH 2HKFL 3O2DH 1WICA 4IRJC 4KOBA 2ZSWB 1UXMA 4P5KB 4PRAB 1DQJB 4NQUA 5AYUL 4AYMC 3M17B 1CD9B 4OZIE 3W0WE 1HQRA 1UOWA 4QRPB 2R1WA 2WV3A 1UQSB 2YBRA 4XWOD 1JZJA 5I74C 3AG4B 1LLAA 2ZX5A 4D9RE 2EC9T 3FTZA 1FAIH 2HUHA 1OGTB 4QRSA 4PJ9B 1LWRA 2WPGA 4K3GA 1FNGA 1I8AA 2X3AA 4PRIA 1NMAL 5C0AB 2WTPA 3ARGC 4PQXA 2COQA 4QKXB 2AJ3A 4BXVA 3TBVA 4Z7UA 2YAEA 2VISB 4OUUA 2VLKD 4QHKI 1FL6A 4WGKA 2AJYL 1RZIA 1E5ZA 1IC4L 1VF5C 2PCFB 3ESPA 3BH9A 3K5SA 4AJWA 3BH4A 1JZEA 3CU7A 5FO7B 2WXOA 4NQDE 1U8OB 2WZPD 4YHZL 3VXUB 3VGGA 1W8NA 3HUJB 1NBVL 2WWKO 3OKLA 5KYUB 3GMOB 4Y1TA 2MOGA 2ZWKA 3S5LA 3WAKA 4F7CA 2APSA 1ZRUA 1F4AA 1BSIA 1I1AA 2LHAA 1IJ9A 2ZJSH 4X7FC 1IGML 4CSPA 3NAAL 4RAUB 3NIGE 1FFOA 3SBPA 2X0VA 2A9DA 3B3IA 2H6UA 2W0PA 1D5IH 3MNVA 3Q01A 3TIEA 4HKBB 1B0GB 3V6ZB 1YJDH 3UTOA 5AD0B 1EFQA 2P26A 2DWSA 4LHQB 4XTRC 5DQDH 3BZEA 4XNQB 1NLBL 1LYQA 2Q1EA 1ZT4A 2XRAL 2XQYK 4GKZA 2KPNA 4NNXA 5ESVB 4JG0H 2QHLA 2C34A 1EJ6A 2LQRA 4P5MB 4YHIB 4ELME 4MKMA 5F44A 4OFIA 4AKOA 2QL1A 2CBTA 3MO1B 3Q8AA 2B4CL 2H26A 5IMMA 4OKVA 1WZLA 2IXQA 4HP5A 4JFWA 3MLRH 3GEFA 4C57C 3DBXB 3S88L 5GZNC 3L4WA 3US1A 3N43F 4YXHH 4EN3C 5BRZD 4LVNC 4ZUVB 1L9OA 2VITB 4YH6A 4WSGA 5ETUB 3RHWF 2FQGA 4QRTA 4FAAB 3RLSA 4LLVA 2YEVB 1SOQA 4Y19A 4EOWH 3LXBA 1MRDL 1YYCA 2XZCL 5GHWH 3DRTB 3NA9H 4P4KA 3WV0A 2A7BA 2PO6B 3OWRA 2EH8H 2I9LA 1OCWL 2O5YL 3S5LG 3WTSA 3KPSB 5DHDA 4NDMB 3OXRB 3U9WA 3RWFA 1UH4A 1BQSA 4NPKA 4CSTA 1KFAL 1HHGB 2DLGA 3ESUF 2CCWA 4A1RA 5LXGL 3JWOC 3OXSA 1DEEB 1S7XA 3NP3A 1CGSH 3RJDA 3C9NA 4FG6D 3VMOA 3VXOA 2Y25A 4HUVB 2V5RA 3IU3B 2F58L 3G6DH 3VGBA 4NN5B 3VYOA 5BUPA 4N0YL 2RALA 3LCYA 4WFEE 5E8PA 3H8NA 2UY6B 3RGBA 4AIOA 1Q1JH 1L9MA 1X5IA 2AV7A 4JHAH 4KJPD 4QTHB 1NWPA 2PXYC 1T89A 1CL7I 3MNWB 5SWZE 3TJEL 4NAMA 2BNRB 3DUSB 3MCLH 3M1BA 4OF3A 2XQBH 3TTSA 5IK3A 3RTLA 5CJOL 1YMHA 1AXTL 4LBEA 1X5HA 5DEJA 3IF1A 5T3XL 2AEQH 4XN9A 5CFAA 4NO3A 1YPZF 4UOW0 2DKUA 1S7WA 5F6HJ 3UTSE 3QHZH 1ACXA 1M53A 2O30A 2YN5A 1F8TL 3I3DA 2DM2A 3FFCB 1F6FB 2LU7A 1U8IA 1NPJA 5D2NB 1EFXD 1HKLL 5CFHA 3K6NA 3V5DA 1ZA3A 3EO1B 2V9RA 5HJ3A 4PJGE 1A4AA 1IM3A 4FMKA 3K72B 1JNLH 3CFEB 1O6SA 4MDIA 3R06A 5D5MA 3U83A 5C0RL 5AKSA 1DVUA 3L4VA 3QWRA 2JKWA 3D85D 4YX2H 3FO1B 3HLAB 3GK8H 4LSVH 5AKVA 4PSPA 4QWWC 1CYXA 1F4WH 3ZZSA 2CUIA 1SDYA 2I24N 4FJYA 3QRLA 4CC1A 5C0BA 5K9QI 1WBYB 5EIIB 5IGXL 1KN4L 4GPVA 3TT1H 1JYVA 3DX9B 4LP8A 1VESA 3EO0B 4AMWA 2AABH 4CU8A 5IUCA 4BSJA 4GXFA 4U1NA 4BUQA 5CR8A 1RZ7L 3TVMB 2J4WL 4PGBB 1KMGA 3QQ4B 3VXRA 4W1TA 3VCLA 3GMLA 3N91A 3GXMA 1TCRB 3KXFB 3LKNB 4N0UB 2NX5D 3W9EB 5IQMA 4PHXA 5DLML 4AYFB 3GJFK 1CFSB 3T3PF 5EH1A 1KB9J 3HG3A 4N2MA 5JW4Q 1SLXA 1AHMA 2Y5TA 2JQAA 2FJHB 3T5WA 4AKQA 1SFHA 4DT2A 2HTLD 2YD6A 1I8MA 2WYHA 3IFPA 4TKWA 4UZSA 4Y4HC 2VDPL 3QIUA 4OI9A 1TO5A 5DC4B 3AROA 4KK6D 1IKNC 3TBTA 5IB4A 2MRYA 3RNQA 4PD4K 1GR7A 1U8HA 1L6ZA 1I7RB 3L5HA 3CLEL 3OM3B 4HS6B 3EDFA 1C5BH 1NGZA 4FP8L 1Z0NA 4TTGA 3MV8A 3GMQB 1MJJA 3E8VA 4X6FA 5D70L 2WN3A 2EIKB 1QBLH 4X8JB 1MFDH 7FABH 2HG0A 3D39B 3HAEA 4GXUM 4S1SH 4X9YA 1G7PA 4CRPA 2DLTA 1XH2A 3PV6A 4J3XA 5KVDE 1KF9B 4TVPD 1RUMH 4PVBA 1MH5B 3PRZA 5ESQB 5IROC 2D7NA 3I9GL 4NM4L 1D5RA 3UC0H 2BP8B 5I82A 3O8XD 5GRVK 1NGYB 5E4IA 4BUGA 1X7SA 3N43B 3Q2LA 2VSCA 3DROA 4PS4H 4XNUH 2NYYD 2K3TA 4PJCF 4IBUA 5DUMH 1ZVHA 3WJJC 4NWUL 2OPCA 4I77L 4TNEA 3V0JA 4U1IB 1J9RA 3W5MA 3N0AA 2YXVA 1GC1L 3K4ZA 1HS6A 3GRBA 4HLZH 2F2HA 2ZX9A 3WKQA 5C0DB 1CT8B 3C5ZB 3FCSA 2BHFA 2EABA 5CUSL 5HGHA 4JDTL 4DN4H 3HMXL 4L8SB 3D52A 3NFNA 1EEZB 2N1TE 4F8QA 4TRPL 4YDIL 4N8CL 4JFYB 1KT2B 4PRBB 4RDQF 1EUTA 3GBNH 1U91A 4G7VH 4RMQA 1WAAE 3HAEG 2Z35B 3C60B 3GRWL 4G6AC 2Q10A 2YOCA 1LDPH 1F58H 5D71L 2QVTA 3FB6A 4A6YH 3P9LA 4F9PC 1A6PA 2OTUB 3GPEA 3KBHE 4OLUH 4WY7L 2PO6C 2KDYA 2V2XB 3G6AB 1JPEA 4YVUA 3VD5A 1T0PB 1P4LB 1GIGH 3ULUE 5DK0A 3H2PA 2CLRB 4LCYA 4Y1AD 5HXMA 4KI5F 1T0MA 5C7XH 3NEOA 2QMJA 5IMLA 1LWJA 1YPZB 1MHCA 3HMXA 3FF8A 2MEJB 3K0YA 1TO4A 4NN5C 4D8OA 5K69A 3BRGC 3BXNB 1WA0X 2MPVA 4J4PC 4HEME 5KBPA 4PBDA 1CLYH 3DRQA 4ZSOB 1MHHA 1PD6A 3F7RA 3GRWA 4XPHH 5F97E 3REWA 3QJXA 4IBWA 2Z93B 5ALBH 2Y07L 1H6UA 3X14B 1ETA1 5ICXB 5CWSB 3CLFL 3WJMB 4MQ7A 1S9WA 5L4MA 1KEMH 5LGYA 2H0FA 2WLYA 2WSKA 3CSTA 1JPTH 4IMKC 5GJSL 2WZ0A 4NQDA 4A7QA 5FIEA 3O3BA 2DWDB 1KOAA 2AK4E 1O9WA 1BMGA 2F1AA 2L7UA 2P48B 3BWSA 4M62L 5JOFB 4IMLA 3U9PL 2EXSA 4OLYL 4OR1A 3KAAA 4JO1L 4L9DA 1WZ1H 3TNNA 1XF3A 1J8SA 1B4JH 4UT6H 5D2NC 3CFIC 2M83A 3OB0H 4K55A 3BPOB 3I6KB 3MRPB 3GSNL 3GSRB 1XTLA 2GYSA 5IB5A 1BFVL 3F7KA 2A73A 1UOVA 4LGSB 4X8XA 1NAKL 2FLRT 1JGUH 4X4YB 1S9KC 4WDIA 3AGVA 4FG4A 5AOKA 3FRPA 1U8LB 5AB9A 2X4QA 3MI6A 3L1FA 2KLSA 2GEEA 5L88L 5CD3B 2KKQA 2CKBL 1TQCC 5GSRB 2K3HA 3T3PB 2A9ML 4F7EB 5IW1A 4XCFH 2VRKA 3BUYA 5CINL 5GS1C 3WNIA 3B2DC 2AFNA 4LF3B 1D2OA 2IF7A 1SXCA 1JZHA 2PTTA 2R0ZL 4Y2DD 2NNAB 2FYVA 2VLKE 4S1DD 2H2SC 2W92A 3BLBA 3FS9A 4JRYD 2YQ3A 4WW2A 1AP2B 4L8DB 2YPVL 3GSNA 1AZVA 1W80A 3KPQA 4PV8A 4D3CH 3BI9X 1EMTL 5I0WA 4KKAC 3T8VA 2QMKA 3ARWA 4MJ5A 4ALAC 3KH4A 3PCYA 3MV7D 5SWSA 1Q94B 1ORQA 4GSDL 3WNMA 5K9JH 5FF6A 3W3BA 4Z0BL 2XQ0A 1L5GB 2W9DL 4WI0A 2Z31A 4W9JC 3MV9E 3KYOB 4PLJD 1UB6A 3LXAA 1G94A 3DGDA 3RPBA 1XZWA 4OJFH 3IJSA 2NY2B 5E2TH 4IRJD 5A2JH 2WC7A 3FRPG 3FT4B 3SQOL 2UZXA 1OAQH 3FULA 1XIWD 5FHBH 3ZTJG 2R1XA 3PFUA 1SVZA 1ACCA 1WS8A 3FH7A 4PJBE 1FAKT 3PP3K 3R19A 1J0IA 1MCJA 3GM0A 4RA0C 3EADA 5BZDB 3BWAB 1P6WA 1PMYA 4K7PX 2A9CA 3SQBB 4C54A 4YJZL 5IQ9B 4RGNB 2YPVA 1U8NB 4HKJB 4PJCB 3ROOA 5D4QA 2FUTA 5BUGA 5TH2B 2Z4TA 4A37A 3IMUA 2G60H 5E9NA 1S7RA 1IGIL 2WXGA 3ASOB 5ADOL 5MEQA 5BRZE 1OAZH 2FD6H 3ARGD 5EFIA 3I6LD 1LE9B 1U92B 4GSRA 1XZ0B 4HZLA 4JBSA 3G7TA 5FCUH 4PJGA 4ZJ9A 3Q1SL 1LEIA 2IBGA 4GP5B 3QJSB 3N40F 4FABL 3ATBA 3KGSA 4DHLA 4LAQL 4Y5XC 1PIGA 3AS2A 4RZKA 4O58L 4Y16A 3MJ6A 1FFNA 1DUZB 3INUL 3FRUB 2OP4L 1N6QH 25C8L 4X7CC 2X4NA 4PRHB 3VA2C 1MAJA 5D7IB 5F6IB 1U8JA 2E7DA 2B14A 2E3VA 1OB1A 3B7SA 2EXWC 2HUEA 1MCWM 4TQHA 4LCCA 4HSCX 4KJWC 3VD2A 4CDGC 1YEGH 4F33A 2X2IA 3C5ZC 4L1LA 4OLZL 1SFDA 1XGPA 3PG2A 1A14H 1CC3A 1JGDA 2X4OA 3TPUB 1AR2A 1REIA 4Z0XB 1LE5B 1VLXA 3EAKA 3LEXB 4UM9A 2Q20A 4XTRD 2E9BA 3NCYS 4U1GC 1F13A 1GMIA 2QHRL 4AXWA 1ZA6B 1DFXA 5LBSA 5HVWA 5KW9L 2R2HB 2BY3A 2LU5A 1OSEA 1MWAH 2CUHA 3ECUA 4OCXH 4TULL 3UBGA 4TNFA 5KVDL 1OZUA 2C9RA 5D8JL 1F1GA 4NNYA 2WBXA 2A4EA 4X5XA 2VC2L 3SDYH 4IRSD 1HOEA 1NC2A 1RZ8B 1CYGA 5E94A 5GZND 2EYTA 4UAOB 5E2UL 4AEHL 2GK0B 1SDDA 1SOSA 3FJTA 2ICEA 4M6AA 4QXTB 2YD3A 5E8OA 4EAEA 3LN5B 4F27A 1SPDA 2NNCA 3L9BA 3KLKA 4GRLD 4B9GA 5EU6B 5DFWH 3Q6GL 4BDVB 2IEPA 2MOQA 1WWAX 3NDYE 2I32A 3KBEA 4NN6B 1ZXQA 3GZPA 2N7BA 4FQIL 1NLDH 1HXYB 2EO1A 3N04A 3IFOA 4YDJB 4JAMA 5D7LE 4UILL 3JWDC 3RKPA 4POYA 4GG6A 3SE3A 3MLXL 4OZHF 4PUBH 1IEAA 3NEEA 3QUYB 5C8JB 3ZO9A 4F3FB 1NGWB 5ACZB 4WFFD 2NQDA 3OPZL 2AQ2A 4JFXA 4WNQB 4NXKA 4HCRA 2PXYD 2WY3B 1RPKA 1UENA 2ERJB 4YSUA 1ZEAH 4KHTH 5GZOA 4ELDA 3QUKA 1AZUA 1QYGH 3QUZB 43C9A 3BYTA 1S9VA 1RJCA 1AHKA 3GSOA 3OZ9H 4L29A 4P49A 4TQ8A 3U6XS 1KJ2L 4YHYB 2GUOA 4JY4A 5DMKB 4PGEB 3BPOC 5JORB 1DN0B 5HJGA 3P11L 4LCWB 1OARH 1WZMA 5E5LA 3ULUL 4L0PB 1YEJH 4QAMB 2V9UA 5DS8A 4G9FD 5AG9A 3IFNL 1I8KB 2TRYA 1SYSA 4UOW1 2BZ7A 3I3EA 1HTYA 1NANH 3BKJH 4LXFA 3RA7H 2BVTA 1U4FA 3R8QA 3TBYA 4HALA 3MPCA 3BH8A 1DYZA 4HC1H 4L3CB 1CL7H 2XQYA 1COBA 3VVVA 5IHWA 1WAAA 2NOYA 1QAWA 1G9MC 1TFHA 2CGZA 3TO4A 4S10A 3D07A 1H9DA 3V0VB 2DIJA 5KBKA 2WVVA 2WNWA 2QQKL 4WEMB 2EH7L 4Q9CA 1NDMA 3K1DA 3VI4F 1QNIA 4XVTH 4QWWD 4S1QH 3KDMB 2L7EA 3KPNA 4YR6A 3BCDA 1ZHKB 4P59H 4MNGE 4TVPE 3LPFA 2PYED 3PGDA 3WKML 2FB4H 3FTWA 4OLXH 3AXLA 2A6DB 5DWUL 3VFPA 5J0BA 4HU8A 4IJ3B 1HIMH 2OM5A 3DSFL 4A04A 3RL2B 2MHAA 5C08D 3OL2A 1GGIH 1U8MB 3BP5A 2FEDC 5LAPA 3SDAB 4BSWA 3TEXA 2RBLA 4U0RB 4OLWH 1WAPA 5IOPA 1O75A 2YRPA 2NY2C 4OSUL 2TSBA 2D7QA 4AGPA 4ZTOH 4HEMA 4FTVE 3VFRB 3HI1B 3Q9PA 4EIGB 4M6ML 4YXKL 1UT2A 2EE9A 1CGTA 1NTDA 3B83A 4RIRA 4OFPA 6FABL 1LILA 1QPKA 4GQQA 2GI0A 2J8OA 5HI4D 2D4FA 2OSXA 1IIKA 4HAFA 1E5UI 2V6HA 4MCNA 1RP9A 4HFUL 2A0LC 4XXWC 2YKLL 2XQYG 5HGAA 3ARUA 1TJHH 4Y4HD 4M6OH 4A7UA 1ML0A 3MYJA 4JM0A 5AZUA 1QQDA 4Y4KB 3BAEL 1GS8A 1NCBH 3WDJA 3EJZC 4M4RB 3ZQ9A 2AK4A 3UZQA 2GJ6A 2VGLM 5PCYA 3GKWH 3C08H 1C5DB 4FJ6A 4LOEA 3F2LA 3OGCA 3LN4A 2LU4A 3TNMA 1BQUA 1HEZB 4JY5H 2UXVA 1IAOA 4YSPA 2EDWA 4FCHA 5JLZB 2BVQB 3HS9A 2JELH 1P7QB 3G5WA 2Y72A 3L6FA 4G1MA 1QRND 4DP8X 3ZW3A 3L08A 2ALWA 1CFTA 4EI6A 3U2SA 5HPMA 4G8EB 2VYRE 4GQZA 5EORH 1KIQB 2IPKB 4Y1AE 2K9UA 3FPYA 4BZ1L 5DRXA 1NAMB 2GBAA 3U0PB 2HKFH 5KJRL 1A9EB 3DHUA 2COVD 4KWUA 3ROLA 5F6IC 3KYMA 5AG8A 1E43A 4K07A 2MTPA 4M61A 3WNJA 1SHWA 5F9DC 4L3ED 5AYUH 1QSFB 4U1KA 1T7VA 4DO6A 3JXAA 5JNYB 5I6NA 4PN6A 2VRAA 2VLKA 4IOSD 3P4NB 4WO4C 1AGEA 2YJQA 3FTGB 4Z7VE 2CJSA 4F2EA 3OJMB 4KI5C 1RV6X 3SE4A 2P5WB 3QR2A 3V4LA 2HJLA 3S4SA 2C3HA 2FT8A 4J7RA 3O4OB 1G1OA 1U3HB 1HT6A 2X1WL 2H3NB 1JL8A 4IGBC 1YAZA 2WZPA 3IYLW 4L4VD 3S37X 3UZEA 4QJ5B 4JX0A 5T8IA 4OFQA 4HPOL 4O2CA 7CGTA 3QORD 4OZHB 2BVPA 4OD2A 5HYJD 1LJMA 2IGTA 2NPLX 1FNHA 4Z8FL 3FQUA 1KCSL 3GJFA 2AJYH 2IOIA 1IM9D 2NT1A 3DXAE 4YE0A 5JIPA 2XWEA 4JKPL 1DVQA 1GZQB 3E7JA 5K9OA 4J5VA 5BNXD 3IK2A 4H8WL 4PJBA 3N1FC 3SSGA 3U0WL 4KV5E 3VFVB 1ET8A 3RAJL 4NFBA 4YHZH 1PPIA 2W0FA 1NBVH 1J9SA 5GRVL 5IEHB 2WQUA 3BAKA 4NN6C 3KPSD 2CHDA 4PG9A 4PS3A 3O4LB 2OV0A 4BIKA 3QE5A 5DLLA 5JHBA 1IEBA 2LW3A 3EHBB 2XU9A 1C12B 2P8LA 3QUYC 4N1HB 4LDCA 5BRZA 1DZ0A 1AOZA 1BMZA 1FGVL 2NXYD 3RU8L 3ZO0A 4HJJL 5EN3A 3S4SG 4MRBA 1YEEL 3DVNB 3MJGX 1NLBH 1TZ8A 1TU2A 2R56L 1OANA 2J6EL 2XRAH 1BX2B 4M29A 1J5CA 1HCYA 5KSAD 2B59A 4LRIA 4I9XA 4WW1B 1N3NB 5LB1A 5BXFB 3QUZC 1Z9MA 4K8RC 5FB8A 2B4CH 1NUNB 3I6SA 1IGCH 5DHYA 5F7DB 2K70A 1QKZH 1AXSA 1KV3A 2GVYA 2BC4B 3MV7E 3MX0A 3C2AL 3TLRA 1MHEB 3V4VL 3ZDWA 3V0DA 4YHYC 3S88H 1SQMA 1GY1A 2XIDA 3DX3A 3QUHA 1J87A 3V6OC 1M6OB 3VI4B 1QFHA 5FFLA 1KNOB 2ZE0A 4HYTB 3GB7B 4LCUA 4YSDA 1KDIA 1MRDH 2XZCH 2FWOB 3VWKD 5IHZA 2VZ3A 2P8PA 1CFVL 3WKYA 3ZDZF 2O5YH 1OCWH 5FOJA 3N85L 4KDVA 5D93C 1OM3L 4HK3J 3RDTD 2J25A 4BZ2L 5J8OA 3PL6B 2QPUA 2R7EB 1KFAH 1YMMB 2HRHA 4XNMB 5LXGH 3SN6N 2J6EA 2K4AA 4W6WB 3ZMRA 2RA1A 3GIVB 4YDKL 1RZFL 2EECA 4TYUA 3D0LA 1JPST 2F58H 4JFSA 1HZKA 4HCGA 4WAFA 4DGWC 3AITA 4AZUA 2JJUA 5CR1A 3V4VA 2FVNA 4G59C 3WHXB 2B8OT 1EFXA 3TJEH 2QR0A 5C9JB 5L9DL 3GMMA 1VERA 1JBJA 1TTCA 1FVDA 3EYSL 5HJBA 7PCYA 3RUGF 5BJTA 5BV7B 3MRMA 4JVPA 3D50A 3GSXA 3LH8A 4ES8A 4GW1B 3ARFB 5CJOH 1AXTH 5AVZB 1KIRA 1DJWA 1E4KC 4IJ3C 3F12B 3FT2A 4N2BA 2ARWA 1MCLA 3GLDA 1DUYB 1NC4B 3Q6FB 3IDXL 3QH3B 2D31B 3ZR6A 2VE6B 1C08B 4U0RC 4BZ2A 4KKAD 3ULVF 2CQVA 2F68X 1HX0A 3K3QA 3V6BR 4FQHB 3S2AA 5FKPA 3E2HC 2WZ5A 3GFUA 1F8TH 3I75B 3D85A 4UYQA 1G1YA 4XMKL 5E95B 5IVXE 5MEND 5EEYA 4UWQB 2WTOA 3I2CL 1HKLH 4PRDB 4XOEA 2JCCA 1R33A 3ILQD 4FQJL 2EIJB 1W8OA 3WIIL 3DIFA 4OFDA 4JRXB 2EDTA 3DWTA 2W07B 3FHEA 4LFHD 2FJGA 2ZOOA 3C8KB 3JTTA 4C4KT 3NIFF 3VB8A 5J1TC 3QJUB 4HU2A 3QO0A 4Y4KC 3E3QE 5C0RH 5CLWA 5A6MA 3G08B 1XGRB 3V8CA 1QTSA 1WSST 4ZS7L 5E1AA 2ZAHA 1KXTA 1BXUA 5DYOA 2NX5A 4JK0D 5LNDA 1ORSA 4AQ1A 3RY4A 2ZUQB 3BIAX 5IGXH 1KN4H 4TVPL 3VXSB 2EYSA 3NCJL 2CIIA 1AE6L 4M00A 4BCXA 1D9KB 2WMPA 1RZ7H 2J4WH 3KM2A 3RURA 1I75A 1BG1A 1I8LA 2W65A 4DUWA 5HHMD 1UH3A 3C6LB 4F2MB 1T5WA 3L5WB 4PP2B 1HHKB 2BSTB 4LEXL 1F2QA 5EC1B 4L37A 3HAEH 4Z7OF 4KZEL 3B2UC 5HI3D 2IBBA 1CJYA 5DLMH 3MGAA 1E2ZA 2VR9A 1S7SA 3G04B 3TJPA 2BPBA 5FYKD 4OTXL 4O51A 1AC6A 3FL7A 3Q2VA 1N8OE 2VDPH 4QHLA 3QC5X 1ECZA 2GTZB 3RZCA 3E80A 3K6SA 1BVNT 4FKHA 3QZLA 4HULB 2EXWD 5CCGE 4R4BA 2XWJA 4WFFE 2IMNA 3PYCA 5C0EA 4AJ0A 5D1ZB 1U3HC 4KJWD 1F42A 3C5ZD 3CLEH 5AVUB 4QRUB 3GI8L 3JQOB 4YFLI 4FP8H 3VMNA 3L7EB 2FX9L 1P9MC 3BEWA 3O8XA 5IBTL 4DGVL 1II4E 1T2XA 4G6FB 4R8WL 4MDJB 1XGUB 2A74B 5D70H 1VGEL 3QDJD 2H4EA 1NBYB 4BSVB 1MCDA 1SLVA 2AQRA 3F5WB 5I1CL 3BSGA 4L23A 1R24B 3D4CA 1QSEB 2O6FA 4OCNC 4HJSA 3G5XA 2M1KA 2J1KA 3OJDA 1BECA 1XH3B 4G9FE 2KS0A 3RWGA 2EVJA 4P3WA 1BQRA 1NOLA 1GYCA 2OTPA 3I9GH 4NM4H 1DQML 2QFPA 1AGDB 2JJTA 3O6LL 3ZKND 2RHEA 4NHUA 3C2SA 3U46B 5HBBA 3B1UA 4QT5B 4XX1G 1P4BL 1TKWB 5GIRA 3S97C 1U8QB 3K2UL 2OAAA 4N2CA 4ZMNA 4JB9L 1LP9F 5F7KC 5D6DC 4XN5A 3RVVD 1F6AB 2VABB 5FA3B 4NWUH 4I77H 1E42A 5MEOA 2PPDA 4D0DB 5E1IA 3ZDZB 1WCQA 4IIQB 3FYIB 4UB0L 4UIMB 5ITBL 5CUSH 4QXVA 3QIWC 4JDTH 3HMXH 4PRPD 3OVUB 2PYEE 2FZ3A 4MX7B 4YGVB 2X70B 4TRPH 4YDIH 1G7MB 2DWTA 3QG7L 1FO0B 4N8CH 4Y1AA 2C9SA 3GHBL 1CI5A 2GSGA 1BG9A 1MCPH 2QKIB 4ODSL 3GRWH 5C08E 3OMAB 3L45A 3IDIB 5HI5D 1TZIA 2BHYA 3FUNA 4Z18A 2YAPA 1A7RH 1JTTA 1YVLA 5D71H 4C47A 3EDJA 4HWUA 3RUGB 2OJZL 3OKYA 1OWWA 1I85A 3ASNB 4WY7H 2HJKA 4HOMA 1EXUB 3PJLA 1SXBA 4WEEA 3QYMA 2GABA 5L2JA 3SKUD 4EBQL 5IFJA 2XDHA 2CRZA 1B0RA 1U93A 3PL6C 3Q13A 3D4GA 3RQ3A 3E0GA 2HT3D 4HIHA 1UZ8A 2J8UF 1OT4A 3VXQB 3UTTD 1AO7B 3T77B 4RGOH 5IUSA 1SXSA 4ZW7A 4PGCA 4GRWF 1MW1A 1S7QB 4DKAA 3ABZA 2EKJA 4PJXF 5G5DB 3UAAA 2XX1A 3P73A 5C0AE 1MCCA 2Y07H 4LDEB 4M7LT 3SGKA 3ZTJH 1Z7JA 3FN9A 3CLFH 3NIFB 1P6AB 4JN1L 5BV7C 5LN4A 1E67A 3K71B 4OZ4A 5G2NA 3EBHA 2GY5A 3C75A 1DQDL 4IKLA 3SDDB 3UADA 4PGJA 1QBBA 3AXHA 5GJSH 3STLB 1A8JH 2B0SL 3SZKC 4GO6B 1OAYH 2WWMC 4AQEA 2ZOKB 4ZXBD 2FYYB 3QUMB 3U1PA 2IBZX 4M62H 1MFVA 1RUAL 1FC2D 3ARDD 4FF9A 3U9PH 4QRAA 4OLYH 2XWZA 3HG1D 3QA3B 4JO1H 1AIZA 3QJHA 2J43A 1X5XA 2J21A 5C70A 1D7FA 1JJUA 3VXUE 3HUJE 5TPWL 1J1OL 5K9KB 3GSNH 3K8MA 4L3EE 4X4XA 1BFVH 3K6DA 1H9VA 4Y2DA 3MLUL 3SKOB 3EJSA 3F83A 4Y88A 5H8DA 1NAKH 3H9YA 1MY7A 3MUHL 4JRYA 3OLGA 1FSKB 2DQCL 3BGAA 3QJRB 3WE6A 1WTLA 2AJZB 3BESR 3HPJA 2BFVL 3E1ZA 2VMDA 1Q0YH 3BZFB 5L88H 4H25B 1W0WB 2CKBH 2Z8RA 2A9MH 2A0LD 3LB6C 3MV7A 3Q5YA 1CD8A 4NLAA 1IKFL 1N6VA 5CINH 1AGCB 1J8KA 2VM4A 4FTDA 5KJ4A 3EJZD 1N5AA 2X44D 3PWNA 4E41B 5AFAA 1A1NB 5HYJE 2V0AA 3HC4L 1UWXK 3PWPD 4IRJA 3SOTA 2BOBB 3O11B 1D9KC 2YPVH 3HN8A 4G6ML 4KJYA 1XIWA 5C0GB 1EMTH 2ZKYA 3C6LC 2VMJA 1YNLH 4QXUL 2AERT 3ZTCC 3ARBD 4DEWA 1BV8A 1JHTA 4AENA 1FVCB 3QIBC 3VFMB 4DOHB 4Y8AA 4Z0BH 3KPSE 2W9DH 4K7FB 4PJHF 3VDCA 4KITB 1AKJD 2FNBA 2K45A 5F7MC 2ICWI 3D2UD 3H9SB 2AZAA 1UZ6F 1SJHA 4LSUH 4K9EC 3H56A 5K39B 1THCA 4JFQA 2R15A 1ZOXA 3RBGA 1UKQA 3ARGA 1DEDA 5C09D 4CSSA 1RAMA 4P48A 3OG4B 5D1ZC 1E50A 1HVXA 3DTXA 5BRPA 4WO4D 1RULL 3QEQA 2BNRE 1AAJA 4LLWA 1J8HD 3WE1A 1F18A 4KNUA 1BBJB 4Y7MA 2OMZA 4TNVF 4Z95L 1LP9B 1BZ9B 1PDKB 5F0JB 4BHUA 2A74C 4JFDD 2MCPL 2APWA 1BVKB 3IJHB 1FNLA 2V5MA 3T1FB 1DVFD 3EH1A 4IGBD 4PEEA 3X1NA 5ADOH 1MN4A 2AXHA 1E6OL 2ODHA 4JDVB 1FG2A 1R3HB 2L7QA 4G82A 3RY6C 1KJVA 1XBDA 1OIOA 4LK4A 4P04A 4XCYB 4D9QD 3Q0HA 5LCVA 2OR7A 3FFCE 2F7IA 3TJHD 4JVWA 4K3JL 2D03L 3Q1SH 4AM0Q 1A3QA 1LEGA 4F7PB 2R0KL 4YIQB 4FABH 5LBSH 1AY1L 3LV3A 4LAQH 4B97A 4O58H 1H8LA 4OF0A 4J3WA 2V7NA 3UZVB 5ABZA 3INUH 2Y1AA 1CVSC 2OP4H 4JHUA 1GKOA 4MD4A 25C8H 4WI2A 5F3HA 3VXMB 1PZ5B 4O2EA 4NUJA 1MOEA 5F3BA 4FE9A 3JWOL 1BZ7B 3QI9B 3U7WL 2ZKHH 5DD3H 3KBFA 5DA4A 1HINL 4WFHD 4IOIA 1DSYA 3CLWA 3HG4A 5CGMA 1E9QB 1KUMA 5E8NA 1CDYA 3IS1X 1GTNA 2HB0A 2NY5C 3N3EA 4IIQC 3JSSA 4IRSA 2VMFA 5GZNA 5D2LB 2VDRB 2ZF8A 1Y07A 3GLAA 5CCHE 2YARA 1TLMA 3LIUA 5D4IA 5I6PA 2J8UB 2RCSL 4JQIL 3FQTB 2QKIC 3MQIA 2V9TA 4GRLA 4GRWB 3VAEA 1TQTA 5FGSA 4NOFA 5C2BL 3CV5A 4TULH 4Z5RB 4PJXB 3RWIB 4BQ8A 5D8JH 5KVDH 1UJ3B 3WS6A 5MENE 3KYKL 2VC2H 1RK0B 3RVWC 1HZLA 3CPLA 1H3VA 2VDOH 5K1VA 5E2UH 4GUPA 4AEHH 3CVDA 4CJ0A 3TZVB 5GS0C 3MGTB 2PN5A 4FHJA 1Z9PA 4FG2A 3IB4A 3UGEA 4DPAX 2VDQB 3MTRA 3UTQA 3HEIB 2CUMA 2NDGA 4ECNA 2PXYA 2G75A 2XTSA 3Q6GH 1SLUA 2VXTL 3IXTA 4FQIH 4YDNA 4JQIA 2CIKB 2N0MA 1KGJA 3VFWB 1BVOA 2VUKA 1VFBA 3PDOA 1FZKA 3MLXH 2JKIS 4Y9GA 5MHSE 4G3YL 4MVBD 2ZAGA 5LO7A 4ETQA 1EEQA 1KV7A 3FC8A 4JHBA 3OPZH 4P5TB 2NUPB 4G9FA 4RESB 5KBDA 3BIKB 3DV6A 1XB8A 4QRRB 4NKOA 1L6PA 1IO4C 3P4OB 4BCYA 4LPCA 1GYWA 4GW4A 4PSRA 2P8MB 1KJ2H 2N3JA 5DS2A 2H8PA 4PIRF 1OPOA 3P11H 3QWOB 4DZBA 2UX6A 1BXVA 4P57B 1G9NC 1NBZA 1VCBC 3KPLB 1OE3A 4U05A 4HD9A 4U4IA 4ZPTA 1T66C 3U7AA 3V6FA 1IGFL 3IFNH 2HT2D 3S96B 4TXVB 2Q6WA 1UD8A 5IHHA 4OZFA 1FSKC 1I3VA 2OMTB 4QHNA 2LOEA 3IMTA 3BFQG 3GM8A 3IETA 3I02B 3CVHA 3QBTB 1G5AA 4O00A 5FK9A 2AQQA 4PJHB 1QG3A 3IDYB 1X5LA 3TA3B 3V9EA 2V37A 3TBWA 4QRQB 5C08A 1D5XA 1MCEA 5A16B 3F7YB 1Q9KA 1DDHB 2OMVA 4C8XA 4CN4A 3KHOA 4P07A 2EDMA 5KG9A 1C16A 2D7OA 1MHPL 4G42B 2QQKH 5DRZB 2EH7H 3FSOA 2ZTBA 3MRBA 4PRAA 3WDHA 1ZV5A 3BFWA 4LHUB 4UQ2A 1GJUA 2IQAA 3RTQD 3EW3B 3V7AE 2VR7A 3SY0B 2VLJD 5JO5A 3WKMH 1LK3L 2X42A 1P7QD 1MFEL 2HRPL 1GZHC 2DLFL 5DWUH 3EJPA 4NP4L 2G5UA 3DSFH 4PJEF 4Y4HA 1P4IL 1NKRA 3IDMB 3SE9H 4B9JA 5C6PB 2OBGA 5HGDA 1M1XB 1IKNA 4YHKL 5D7HA 4OSUH 1YPZE 3U79A 4BHUI 5IFAL 2A6JB 1VADB 4KPHL 4M6MH 4YPGA 4HOZA 4OZFG 4LQFL 3VD0A 3IRPX 3RB5A 6FABH 2CR0A 3RL1B 1GW6A 1A1OB 2BSED 5B8CA 4HFUH 3UO1L 1QRNA 5KYYA 3QFJA 3E38A 5IZ7A 4QO1A 3B1TA 4I4WA 4PRPE 3BAEH 1CFBA 2BO0A 3GZQA 2GBUA 3KWWA 4ZD3L 3QGVA 5DMJB 5DVKA 3U2JA 2G5BA 4FLSA 1DJSA 5F3FA 2XWRA 4JW3A 4EF3A 2V9QA 5TF1L 4ETYA 5L4IA 1M42A 4JPQA 3ATFA 2OYLA 4DAGL 3CFJA 1U8OA 2QV4A 2ZG3A 5J11B 4W9LC 1RLBA 1VEMA 4PCTA 4NQEB 4L3EA 4PCSA 2UZIL 1PW3A 4UDUB 1YN7B 4X0NA 4WWNA 4XVSL 4ZPVB 3AQZA 4P2QB 5AZEH 4IHBA 4IOSA 5DVPA 3HR5A 1GGUA 2Y7QA 3KR3L 3U82B 4TNGA 3MSPA 3IRCA 4LT7A 3LQZA 3N1PC 1UA3A 2ARJA 3MGOA 2KZBA 1Q72L 3PREA 4L9LB 1KG0A 5KJRH 4MD0B 2WLMA 3UTTE 4APXA 3GJFH 2QGCA 4M93C 3UJJH 4A63A 4MS8C 2YMOA 5CN3A 3QPKA 4L4VA 2JTDA 1A6ZB 3RNKB 1F3DJ 2R1YB 4WUUD 3LH2L 3QORA 4HGWA 4M1DL 2BNUB 1A4CA 1VZHA 5HYJA 1A3LL 5IB3B 3MFFB 3A23A 3V5KA 1RHHA 1IM9A 2UYLA 4LLDB 4YZFF 1QSVA 4M7ZB 4B3VA 1ZHBA 4YMPA 5D6CA 2R0LL 1D7CA 1CLCA 3KCWA 2UWEA 1G7IA 2E4TA 1RK1A 1EAOA 2BVOA 4YGAB 3QIWD 4PJ8D 3LQAC 1OF2A 4OZGA 2H5UA 3BO8A 4I3SH 1XV8A 4Q6IB 3ZOAA 4HPOH 4F24A 4N0RA 1UJ3C 1SN0A 3B8SA 4QHPA 1DJHA 3QULA 1OZTG 4QTIL 1A6TA 1DEEA 4Z8FH 1KCSH 4JKPH 2G0KA 3UPAA 3BN3B 1MLBA 3QR1A 3ZTNL 5IM7B 5I6MA 4H8WH 1M7IB 3WI9A 3L9RA 3U0WH 3FB8B 4Q97A 1DVSA 4JM2C 3RAJH 3BD4A 1CZ8L 3P2TA 4I0KA 3D3VD 4X99A 5KSAA 1R1CA 2XWXA 2P44B 4WHDA 3Q44A 4I85A 4MAYB 4AW4A 5FW7A 4WV1A 3QK0A 4QYOB 2IMMA 3I84A 2PTVA 3UBFA 3HZVA 3LKPB 4NS0A 3BSZL 2OK0L 1KGYE 5K59F 1X9UA 4GEIA 1YNTF 3MLPA 1TQBB 4KTYA 5JHLL 2OL3B 3RU8H 4LARL 4HJJH 5DI8A 4P5TC 2LAAA 4ZI8A 1SY6L 4IDLA 2R56H 2J6EH 3VWKA 3F6LA 3D1MC 3APMA 4ZFQA 1CQYA 3QXAA 1W16A 1HESA 3H3PL 3HW7A 2W95A 1PYWA 3L3HA 4M8VA 3RDTA 4JMXA 4IS6A 2X1OA 4W68A 4ALAL 3CFDB 4ODXB 3V4VH 1DJXA 3OKMB 1QMUA 2DM4A 4Y4FC 2W59A 2ODIA 6TAAA 4Q9RL 3F6IA 4U1LA 1YEFH 4ZDHA 1WQVT 3W9DB 3U4KA 2X12A 4YAQB 2FEEL 5D7IE 4UM8A 2OQJA 1MCFA 1BD2B 1ED3A 5GS1A 1WH0A 2XY2A 2DM7A 3T4YA 5JHLA 5JQ6L 4I2XB 2XY1A 4PTUB 4BZ2H 3FQNA 1DSWA 4PJEB 1A7OL 4NZ8A 4AQAA 1L0PA 3QC6X 1SY6A 2BINA 3L3IB 3IDYC 2D3NA 3TA3C 5I8KH 4F20A 1J8HE 4KI5E 4M5ZL 4P23B 3ISYA 4YDKH 1RZFH 5FO2A 3VUAA 4QKTA 2J71A 4DO4A 2LLLA 1TYRA 4K9JA 5TE6H 2V2WB 2WLLA 3H85A 4MRCA 2VL5B 3OJVC 5MENA 1U36A 5LAXA 1JNHB 3ISRA 2IWEA 2H0EA 3ZE0F 2GTWB 2GTQA 4P2CG 3BISA 1SVBA 3HB3D 2WLJA 3TM6A 4JFFD 3IKCA 3WN5B 5L9DH 1I7TB 3EYSH 4NJAL 5CGTA 4X9HA 4D9QE 1PTZA 2BP5M 3IXAB 4MNHB 1XEUA 3HRZA 1HAUA 4HKZB 1NGPL 3DMMB 5F1NB 4OV6F 3IDXH 3HI5L 1TJIL 5FDYA 5DUBB 3OPUA 4NKDA 3HPLB 5FYKL 2ZOLA 2NCMA 4XMKH 4P3CL 3I2CH 3QIBD 4FQJH 1L9TA 1NFIB 4YHOL 1N12A 2IH3A 3WIIH 4NKMB 5JOPD 4TN9A 1YYLL 1J7VR 4EUPA 4NYLB 1JZ8A 4C4KO 5BS0B 2WGXA 3FB7B 2CHZA 4S11A 3EFOA 3CQQA 3GSUB 3NZUA 5GRXG 3CHRA 4RLDA 3RVXC 1J18A 4FYSA 1Z3RA 5AAMC 3MROA 4ZS7H 5D96B 3OD3A 1ASPA 1W0VB 3DIVA 4L1TA 3D0AA 2HG5A 3GSVA 2BOCA 3RKDC 5CILH 5IJDC 4EKXA 4Y5XA 4F5CA 3AU1B 3EG9B 3K46A 4JQVC 5DJDB 2HXAA 5GGSA 1LVEA 4JPKH 4TVPH 3UIZA 2X4PB 3L3KA 1S7TA 4LFHG 2WHVA 1XR9B 1E4WL 1OP9A 3JUZA 3H0TA 3NCJH 3VG9B 3JWNG 1HHJA 1AE6H 2CM6A 2TSAA 4IOFD 4TLKA 1H5BA 4GQPH 4TLTA 4LCWE 3ZL1A 1QSED 4K71B 1P0SE 2X2UA 2DMGA 2MCG1 4L48A 2AEPL 2P43B 2OJEA 5FC9A 1WIPA 4LEXH 4QDGA 4KZEH 3C5ZA 5E99H 3DHMA 4N2LA 4X4ZA 3VFUB 2FR4A 2KH2B 2QQLL 4DP2X 2YUWA 3WNKA 4EUPG 2Y1ZA 3DO3A 4Q4EA 4JDZA 5B3SB 3G5ZA 4OD1L 4I1PA 3QDJA 1K5WA 3JWDL 2DQEL 1HHIB 4G8IA 4WFGD 1BGXL 3RB7A 3SKJL 1F4YL 4R3SA 4M7ZC 1Z6JT 4RDBA 3PP3H 4AIZB 4N8UA 4X6CF 1M56B 4HUUB 1X5FA 2KMWA 3F8UB 1C7TA 1NIAA 4IU2B 3LDBB 3VQ1C 1OEZW 1MW3A 3BEVB 3CFKA 3GI8H 5H94B 3ZKXB 2FX9H 4DGVH 5IBTH 4Q6IC 4XOAA 3UERA 3N06B 2O6CA 1U2YA 3TFKC 5IBLC 4R8WH 3GQFA 5MEPB 1P2CA 1M2OA 1VGEH 2ZNXA 1XGQA 3BQUC 2B15A 1YNTB 3HBGA 4ZNEE 2VAAB 2E8YA 5HHVL 5DO8A 3CN0A 4YK4B 1E3XA 4OV5B 3S5ZA 1MPAL 1FDLL 5EOCL 3PXJA 1GMEA 1U8CB 3LKQB 1GZPB 3O3EA 1FZMA 5DDHA 4ZMQA 2A83B 2P4AB 1NCUA 2VR4A 5LN8A 2NY6D 1DQMH 5M95B 1ZGLB 3O6LH 4PJFF 2Z93A 2D9CA 3FQWA 4H26B 1UACL 1RUPL 4ZO9A 4PRPA 3X14A 3VGEA 2AQPA 1P4BH 4MAYC 1TFPA 5A43C 1F41A 3K2UH 2EDKA 4LSTL 3WFHB 4JB9H 3RFZC 3WD5L 5ABAA 1AO7D 2EDHA 4X2UA 5DF0A 4OAWB 5EBLA 4X5WA 4NRZB 1KPRB 5JOFA 3V7AG 2EO7A 3PABB 3OG6B 3O3DA 3QFGA 4K23L 4OFVA 1ZT7B 2XI9A 4UB0H 5ITBH 5F7YC 1S4IA 4NWTL 1LE9A 3SDXA 3M45A 3IJEA 3GSRA 2VLJE 4J28A 1H3XA 1JGEA 1EGJL 3VFNA 3IJ9A 4WWKD 4ZBJA 4F1SA 3AMKA 1SMOA 3GHBH 2XJKA 4KMQA 4J6IA 1I3UA 2BIPA 3UTTA 2DI9A 2F74A 2C1PB 3CU1A 3MYZA 2J6WA 4ZOAA 2VM9A 2H6PB 4RMVA 2HVJA 3WFDL 4DFIA 3BPLB 4HPHA 3HKFA 1URZA 2EYRB 3RFRA 1OGAB 2OJZH 4XPTL 1T1YA 1ZV2A 3BN9C 2PKDA 3QQXA 3LPGA 4NQSA 4EBQH 2KC0A 1QTYT 1S2EA 2AF2A 4LRNH 4E68A 4AGLA 4ZFOA 5IQ7L 2WB1A 3QUXC 3CX5J 2PUQT 1F3JB 4FQ2H 4ENZA 4E9WA 3PE9A 3EYVB 3WGVB 2FEEI 4ZXBA 2FK9A 1HSAA 3M46A 2G2RB 3S3SA 5ISZD 4GJTB 4L4TB 4CVZB 1NCJA 2FL5A 3X3GL 3ARDA 3EFFB 1T2JA 1I3GL 2R69L 3HG1A 1E8WA 5GGRY 1PCSA 3PGCB 4BA0A 1CE6B 1E30A 4XVUC 1M71B 3LZOA 3WTVA 5B39A 4MZIA 1UXSB 3S3PA 3MA7A 5I24A 3CSPA 4H88H 3QZMA 4JN1H 3CDFA 4DZ8B 3ME0B 1L7IL 3ZBMA 1DQDH 5KBNC 1IAKA 2B0SH 5E5MB 1QEWA 3MRKB 2VIRB 2AI0L 3HE6D 2Z92A 4P05A 4MQXC 1HWHB 4MA7L 2DYPD 2EDXA 3GSQA 3FQRA 1BFSA 4AT6B 1B0WA 1JGIA 3MRFA 4XXWA 3J7HA 3C5SB 3CHPA 3OSVA 5TPWH 3MVSA 1J1OH 3BOVA 1UD5A 1JGVL 3T9WA 5EOQL 3ZKMC 1I3RA 4OVUA 4HKJA 4WUUE 3GC3A 3DO7A 1BQHA 1IT9L 2BP0A 3O4LE 2HVKB 2WO2B 3BUQA 5IEKA 2WBJD 3PAVA 3PWPA 4BA8A 2DQCH 3JV4B 3LRSB 4OGQC 3UCRA 4AL8C 1M7DA 4LASL 3CIQA 3TS8A 1HWWA 5JW4R 2H32B 5EF3A 4HK0A 1L9NA 2CBOA 1U4EA 4XCNB 3VYNA 3MOBL 5EC2B 2EUWA 3SKMB 5D96C 4D8PA 4G9DA 3ARBA 4GMSH 5B39G 4F7MB 4S0SD 1BIIA 2FSEB 1XX9C 3C6SA 5CU9A 5AUMB 4ZUUA 1AKJA 3T0VA 3FOLA 4OGAD 3QXTA 4G8GD 2X88A 1WITA 5FA4A 5HHOD 3HC4H 2WINA 2PCPB 3D2UA 3VG9C 1KGXA 3FQXB 2VKWA