4AVJA

Structure of the fimh lectin domain in the trigonal space group, in complex with a methanol triazol ethyl phenyl alpha-d-mannoside at 2.1 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4avjA00
4X5RA 2W07B 3JWNG 4X5PA 3MCYA 5F3FA 5IQOA 3ZL1A 4ATTA 4J3OG 2J2ZB 5AALA 4AVJA 3RFZA 5AB1A 4AV0A 5JQIB 2VCOA 4XO8A 4XOCA 3SQBB 2UY6B 4J3OF 1QUNB 4BUQA 5IQMA 4AUUA 5LNEA 4X50A 3ME0B 1KLFB 1TR7A 1PDKB 3BFQG 3BWUF 4XODA 4LOVA 5ABZA 1ZE3H 2JTYA 2XG5B 1N0LB 5FLUA 4AUJA 3JWNE 3JWNH 4CSSA 5FX3A 3BFWA 1UWFA 1KIUB 5IQNA 4AVHA 4XOAA 5AAPA 4AUYA 4X5QA 4AVKA 4AVIA 4AV4A 5FS5A 4XO9A 5FWRA 4CSTA 4XOEA 2JMRA 3ZPDA 4XOBA 2XG4B 5CGBA 4AV5A 5F2FA 2WMPB 1N12A 4J3OH 4CA4A 5LNGA 3ZL2A 2UY7B
chains in the Genus database with same CATH superfamily
3DPDA 3MKKA 4LQ1A 2X05A 4YS4A 4IBUA 2AMUA 5ENWA 1WWAX 4U1KB 4MD5B 3CFBA 3OF6D 1CPUA 3EFOB 3VXOA 1ZLSL 3V0FA 1EHLH 4MQ7B 3JTBA 3CC5B 4AG4L 4W9FC 3HI1B 3GJEB 2CDEA 4MHHG 4OUUA 4WFHE 2PCXA 1MDAA 3EFDL 3GWJA 1QTSA 4S1QL 3Q05A 4XAWL 2QZQA 3M6DA 3AQXA 4IW4C 2YC1B 3DYMA 4X80L 3SHSA 1F6FB 4G7YH 3WHXA 1DQQB 4I18A 2XOTA 3D3VA 1RIVH 5CU5A 1MH5A 2DQEL 3QNXA 3D48R 1UH3A 1NDMB 4M62H 3UCRA 4J6IA 4XHJD 4NDMA 2EIBA 3AS3A 3MREB 3OF6A 3GSNB 5C09B 5IKCA 2Y22A 4JQIH 1UM6H 2PTVA 1INDL 1HIML 4DPBX 3C6LD 5I8EB 3S35L 3N40F 1NAMH 2OMVA 3MYJB 3RTQA 3W0WB 4IU3B 1JPST 1U3JA 5I30L 1A25A 2GTZA 4WVRA 2BP3A 4JM2F 2YQBA 5ABZA 1KWKA 3L4WA 5ITFA 4O9HH 5IHHA 2WCGA 3NCJH 2QQLH 4PJCA 4UQ3B 4QUOA 2V33A 2G2RA 4N0FB 4PP1C 4K7PL 1JZ6A 4XXCA 4QRRA 4ELMF 3N0PB 3VXUD 4L9DA 5D7LE 2FBJL 3KYNB 4WKZA 3WE6B 1QMUA 3TA3B 4BK4A 3ZUNC 5I73B 4OV6F 5JQ6H 3MV9D 1C5CH 1BM3H 1KYOK 3C6LA 3PQYE 1IM3D 5E9DD 1SXZA 2R39A 4UTBL 4OZFH 3CQPA 3CHQA 2HWZL 4PLOB 4WSJA 3V4VB 3ZZSA 4FZEH 4ZMZA 4F93B 5LQBL 1NQBA 1IKNC 1V54B 1ICTA 5EH1A 4QJ4B 2VXSH 3FW6A 1A7PL 2EH8L 2VTFA 2YA2A 4Q2ZA 4X4XB 1OAZL 3HG4A 3S36H 2K6WA 2DYPB 5HHME 2F8OA 4JY4B 4MNGE 2HJLA 3PAUA 2F7PA 2DM2A 3C60C 3VD2A 4JFDB 1JHTB 3ZT5A 2P24A 1FNGB 5LB1A 3CDGA 3Q5YA 2VQUA 1MZZA 2BFVH 1QSFB 1G6VK 3KPLA 4M3HA 4QOKE 4AEIL 4C83B 3MV9A 1EZVX 1P0SE 1TVDA 4MLSA 5CGTA 4M8VA 5BZWB 3QUZA 3CZJA 4GG6F 2R59A 4P46C 5E9DA 4D0BB 1H3UA 4Y5XA 3KLKA 4N2KA 2CRYA 3UTSA 1AFVL 1XZ0B 3RDJA 4OLXH 1EUTA 1ZTXE 3P30L 4Q4IA 1SJVA 4C57C 4D9LH 5I1JH 4GAYB 4GQRA 3TWCH 1FE8H 4S1RH 1RHFA 4AJWA 2V7HB 5G4OA 1KEGH 5I0VA 3MR9B 3O6KL 3KR3H 1UTDA 4KKCC 2PW1B 5CD5C 1PEWA 5HYSB 3FN0H 2YSSA 1MLCB 1AGCB 2ZYIA 3SDCD 2KZKA 3QJVB 1EXUB 1R75A 4M56A 4NXSA 4FOMA 4Y5YC 3U9UA 3VNZA 1PZBA 4NPKA 1G7PB 3QIUC 1WK0A 3A23A 4ORZC 4B7IA 2D9QB 4CJ0A 3LKSB 4YPJA 2OZ4H 3SBPA 2E47A 2YA1A 2G5RA 4JFVA 3N42B 5A3ID 1NDTA 1I1AB 4GRLD 2CK0H 4KAQL 4Z3TA 4UOW1 1X7QB 2VDPB 1VIWA 1MI5B 3FPYA 4DAGH 4Z77A 3E6HB 4NJAH 4L8DA 4ZOAA 2ZXAA 3MFFA 4WHYG 4M5ZL 2HLAA 3NEEA 1ZT4A 2XXCB 3OR6A 3P0VL 4MD4B 2QTEA 5IFHH 1U30A 1PZ3A 3VXRE 5D5MB 1N26A 1MVUA 3GM0A 1TSHA 3VD9A 3AM8A 4X7SL 3QUKB 1PSKL 4HC1H 4Q0XL 4HWEH 1DBML 3JWOH 4ANKA 4ZPVB 1XF5A 2RGSA 1L9RA 1UACL 1G1OA 3PIQB 4KZDH 3LNFA 3BWSA 3PE9A 3QCVH 4A2FA 4XNQA 3RU8L 1JF6A 5INDB 5ISZB 1DVXA 4P06A 1ZIAA 4GUCA 3VI3E 3OKDA 4AMKH 2NLJB 2X7LB 3BEWA 2B9AA 5KSAB 4RAVA 2NZ1A 1JPSL 3PLYA 3H54A 4Q56A 2EVJA 3LZOA 3ROLA 1VFAA 1M7UA 1GZHC 1M7DA 3MLZH 5E0FA 3TURA 1OSPL 5H4YA 4FFYL 4ZTEA 4WFFD 5ID0A 1O9ZA 4CKQA 4MJ6B 1GH7A 3VQ1C 1E40A 2KQMA 2VRKA 3ARUA 3MLUL 2XKSA 5MHSE 4IRJA 4PGDB 1PCXA 2X53A 1BZOA 3L48A 2Y23A 5D6CA 3TX4A 4TUKH 1KT2A 2CO2A 2VJ8A 3HCVB 3MACH 1G7LA 2D0HA 3A4AA 3QDAA 4NSKA 5F7EH 4UT7L 1FZJB 3ZOAA 2JH2A 4R0LA 3BIBX 5FK9A 4PBVC 2VLLA 1MDTA 3KXFE 1N12A 1NBZA 3HRZC 2P8LB 2Z8SA 4OGYH 1E27A 1ZVHA 2ZD0A 1RY7B 5GRUL 1RZGB 3KL3A 4W81A 1XH1A 1WEJL 4ODXB 5K1JA 3QDJA 5F7LB 4K3HA 2P46B 1GGCH 3KNBA 1F11B 3BISA 3NACH 4JO4L 4TM9A 1YEIH 3Q3GA 4E42B 5IMMB 1JWMA 4X4ZA 1UEYA 1X4YA 2BO0A 5C08E 2E9BA 3SODB 2OLDA 4WFEE 3L4ZA 2GITA 3MJ9A 2E7HA 4WGWB 4KFMA 2WO3B 3AS2A 2VC2B 2MQGA 3SKJL 1F3DJ 1CBJA 2AVGA 4JG9A 3KBHE 4NKMA 4ZO6A 2DIJA 5I1CH 3S9DB 3FFCD 4HH9A 2J5LB 5ERWA 5GRVL 4DN3H 3GGWA 1NGXA 3IJ8A 4V2BA 3V5DA 4H1LG 4KRLB 5E6UB 1F8TH 3TN0C 4MJID 4P3CH 2PPCA 3VXMB 3K6SB 1SOQA 1LP9F 4GIAA 2PO6D 3RFZB 3D39B 4I1NB 4LOUD 5FYJH 4NFCA 1SVCP 2A6JA 4FE9A 1REIA 1U91A 1G4RA 2DWEA 4KDWA 4Y4HB 4NNXB 4HKZA 1XF4B 4OJYA 5CIPB 5IROD 1A14H 2Y9RT 4FERA 4J3OC 5I28A 5C0AE 3FFCA 2BNRB 5EA0L 4JK0D 4Z5RA 5KG9B 4NQVB 3SE4A 4P2QD 3AWEA 2A73B 4D3CL 1HS6A 3VCLA 1GRWA 2VR5A 4IGBC 3LMJH 4UAHA 3QO0B 4JFTA 1DUYB 1EHXA 5HYFA 2K7PA 5DEJA 1XGUB 3CFDB 3LIZL 3JT2A 2AQNA 3EOBA 3POCA 1GPOH 2VGLM 4D9RD 1I8IB 1D3CA 1KNOB 1CDBA 4QKTA 2XWRA 3V0VA 1P4BH 4AITA 1KG0A 3ULVF 3ESPA 3E6FA 2BP0B 1ES0A 1TZIB 2VLRD 3L45A 4N5UA 4PRPE 2N01B 3KPRD 3JV4A 1D2OA 2FLRT 5DMIL 4BDVA 1YAZA 3MMEA 3P0YL 4P2QA 5DK2B 2Y2TA 4X5WA 3S3PA 3ULUE 1ZGLA 1QNZH 1XR8B 3BIKA 5CP7B 1QR4A 4YHOL 2YRLA 1SJHA 5JOEA 1XDTT 2CALA 3JUZA 3W39B 4IU2B 2W9DH 1AZUA 2GFBB 2NCMA 1G9NL 1FV1A 2AXGA 1OOAA 3GXIA 5F7KC 4UZSA 3DO3A 5E8DL 1OM3L 4LK4A 5HHPB 2XQYK 5CCJA 4H5SA 4I18C 2QSCL 3P9WB 4FCAA 4G6AD 3MRKB 5EU7E 2NUPA 4DZ8A 2VLRA 5KBDA 3BYYA 4XBPB 3KPRA 1OD9A 3LQAL 3JZYA 4OZGB 2YD7A 3KG5A 3ZTDC 5E4AA 2E8YA 3RTQC 1G7JA 1IAKA 2W80C 4I85A 4BBWA 3FS9A 1K4CA 4KX9A 1AXTL 2Y07L 1EZSA 3WJLA 2DLHA 4B41A 5HVGB 2CBQA 3KM1A 3MBEA 4YHML 3WKMH 5DJ8B 1YMMD 2EO7A 3GKZA 4LLQB 3C5JB 1S9VA 3LZFH 4I3GA 2PWHA 4Z7OF 4XXCC 2G5UA 3OKLB 3H4HA 1FFOA 3PP3K 4KI1A 5JDSB 3I6LD 2O6PA 4XHJC 2MHAA 2YJLA 4OCWH 3BP7A 3QZLA 2GYSA 1G7IB 2HAZA 1L5GB 2VR6A 4QHMB 3NSXA 3UJJH 3DA0A 4PJXA 3D6GA 3VXPA 4D9QD 1CZ8H 3C6LC 4ZO7A 2BY2A 1CE1L 4LXFA 1TTCA 4J3TA 4P9MH 4IDJH 1RULL 2RFXB 3MROA 4GQZA 5EIIA 5IUSA 2CO4A 1JYXA 2VQ4A 4WNQB 1JGLL 3P9LB 3S98A 1W0VB 2CO3A 2IALB 2VT0A 4XWOC 1MAML 5KVFE 5LBGA 4DQAA 3CVHH 4LNRA 1PEZA 5A6IA 1QFOA 1WA0X 1V3KA 3O3DA 5AUMA 4OV5B 4LSVH 2QSTA 2D31A 1MOEA 2XZQL 2WBXA 1QLEL 3O41B 2BLFA 4ZPTA 3FRPB 5ICYB 3D2UD 3ZGIA 4V11A 4XP5L 3L6FA 3QB7C 3P9MA 2QVMA 3QUZC 5KVEE 2OCFD 4Z0BH 4QGTA 3RDTD 4Y5XC 4ANWA 1F02I 2YQ2A 3QUMA 3PHQB 4F92B 4TVPE 5J56B 4MA7L 3HUJF 5JIKA 1GAFH 3U48A 4BCXA 1I9EA 3B2MA 5F93C 1ZA3A 3UIZA 3HHRB 2OL3H 2BSED 1DVFD 2CUHA 1IKOP 1OP4A 2IWFA 5KVFL 2O6FA 5FKPA 2WMPB 1R1CA 1OL0A 1RXLA 2F19L 3TBSB 3U36A 1IZKA 4TUUA 3SPVA 2DJUA 3BZEB 4P5KB 2ZPKH 4HHAA 4DT2A 3DWTA 2B4CL 3RVTD 5E2TL 4RSYA 3SO3C 2IBBA 4YHYB 3RDTA 3MAWA 3HC4L 2A9CA 3QFJD 3AZUA 4NO3B 4JFEA 2BHUA 4JHAH 2LAAA 2FGWH 4QXVA 4G7SB 5E1AB 1HCVA 4DVRL 1QYGH 5DJDB 4ICWA 2C9RA 5B3SB 3UMTA 3GMMB 1SEBA 4QIRA 4QNPF 1K85A 1HTYA 2B59B 1GJWA 5I19H 3BVNA 2ILLA 2MCMA 2W59A 4KJPD 2CLZB 3FOMB 3IMSA 3AM8C 5GS0L 1UUSA 5FUZL 3QE5A 1KACB 4W6XB 4TQPA 1WPCA 2XTLA 3QXUA 3G5XA 2NX5B 1K4DB 2NPLX 3BDYH 4PWKA 4NQDD 4JFSA 4H8HA 3BKML 1NFKA 1T6WA 3O6MH 4YHPB 4KQ0A 3BPCB 5T5FH 2JJWA 1JZ5A 2LE9A 2ITDB 3VXUB 4FQHB 1I1YA 4DIXA 5DEFA 3CQQA 4ZS7H 3CZNA 2XKNB 2ZP8A 1SM3H 4W6WB 1K3ZA 1S78C 3BH8B 4GO8A 4CDGC 4LLMB 3NGBB 4ELMA 4UOQA 1TUPA 4HJGA 4Y0GA 4Y4KB 3T3MB 5ADPL 3HAEB 4IRJC 3BCFA 1IM3B 4WENB 1U93B 3N42F 4JGMA 3MXWL 3QCTH 4R2GD 4YZFE 4X6BB 4AOFA 5F9WB 1TZ8A 4ODTL 1FO0A 2R0LL 3ENEA 1A5FL 3RKDD 4R0LC 5ACMA 1TETL 3WFBH 4NQDA 4M5YL 5J6HA 4J28A 3P73A 1WTGT 4ZMQA 1FUNA 4PB0H 5D5MF 2CHZA 3F7LA 3TOPA 4O58L 3G6AB 2BIMA 2Q1EA 3WXVH 3QK0A 3NCMA 2JXMA 5F7BA 1LM8V 2CLRB 1DVTA 2P9RA 1JF1A 4GXVL 2N7SA 4HZAA 3VRIB 4BZ2H 3I6GA 5K93A 2NXZC 4L23A 4QYOA 1W72H 1YHPA 1ET7A 4PV8A 4S2SB 5IOPA 3CH8A 2Q87A 1IC7L 1QBML 4GG6A 3PWUB 5IMOA 5DHXB 4WU7B 4GO6B 1FPTH 1XGPA 4YLQT 4HJJL 4CVXB 3MXVL 2BCKA 3WFCL 1U8LA 2L3BA 1I9IL 3E1F1 2YD6A 4AXWB 4PRNB 1RUPH 3ML8A 2KPNA 1YDPA 4Z7VE 1OO2A 3SYPA 1S9XB 4HG4K 3DX4A 5HY9B 3FQXA 1QPKA 4AL8L 3EYUH 1MRDL 3SDCB 3UAJD 3V7AE 4LSPH 1D5IL 1OTTD 2O72A 3B2PA 3HBZA 4JRYB 4OLZL 3TP4A 4M3KB 5J12B 1ZSDA 4MBRA 4M1GL 3WDJA 2FLBT 3KEDA 4BE6A 4YAQA 2VLKD 4GRLB 4M93C 1M1XA 2X3CA 3PABA 2WVSA 4WO4A 5JW4Q 2NW3A 2IXQA 4GW5B 2BHFA 5B8CC 2CIKA 2E56A 1OGTB 1NFDE 1TQVA 1CDUA 2XACC 3LN9A 2CM5A 1BQHG 1S7XA 1RZ8B 2XLLA 1MNNA 4QTFA 1KJMA 1HOEA 2YGNA 5L8LB 3GMNB 2XRAL 2A9NH 1RIUH 4EZKA 2BXZA 3PGCA 5GHWL 2EH7H 2L7EA 4PJ9D 3SE4C 4CDHA 3ISRA 3DX1A 1BM7A 5HHQA 3QDMB 1NEZG 1S7RA 3W1ZA 4N2IA 2YMTA 4GSDL 4M6MH 4LOUC 4S1DC 3DJRA 3T0BA 2WZ6A 4F33B 5J57B 5IF0A 5A16B 1EERB 4HALA 3M1CA 5JW4N 3ME0B 4PV9B 4UQ9A 5FYKD 1ED3A 1QSZA 2YOCA 4PWFA 3GS4A 4GIOA 2Y7SA 1WICA 2R2HA 4D8OA 5HI3D 4PG9A 5I6KA 3MRNA 5C0FB 5GS1B 4K8RH 4OJFH 2CZNA 5EULV 5I6NA 4HFWA 3OGCB 4HPYH 5IV2B 2WTRA 4YWGL 1URLA 5KBMA 4AM0Q 1P4LA 5LWYH 4PVNA 3HC3L 2RQEA 1XR9B 5DQ9B 1AS6A 4L37A 5FEBA 2IOIA 2WLIB 4K3EH 3IJEA 3SOBL 4YSQA 1BFOA 3TPKA 4FYTA 5MERB 3RNQB 1A7RH 3EW3B 2BDNH 1XF3A 2QQKL 1KFGA 5A40E 3D85A 5I1GH 4UUJA 5C0RL 4DEWA 5CJQH 4AL8C 1OAKH 3O4OC 3QG7H 3U7AA 3QQDA 1NCWL 4A7VA 2IWGA 4YSDA 1A2YB 1FL5B 1S7UB 4YDIL 3L1EA 3OPZH 1H19A 4PLJD 3KW8A 3V0IA 1N68A 3T0WA 5C9JA 4XPTL 3MBWB 1OSEA 2XG4B 4TNEA 1YYLH 4BCZA 2P8MA 2PXYA 4F91B 4P8QA 4N3TA 3WJLC 2DD8H 3MBEC 2AEOA 2EDMA 5C3IA 4BHUI 3P11L 1U8HA 1P5UA 4S0TD 4JFPB 2PABA 2HG5B 2VH5H 4BSVA 5G5DA 1B0IA 5E70A 5IM7B 3O3AB 3BPNC 3GDBA 2X0VA 1MCJA 4KGJA 2J43A 4JLRA 6FABH 2ZX6A 3BKJL 2R23A 3ARBA 3QG6B 4HKBA 4YHLL 5CF3A 2H4EA 2OTWB 3QWRA 3O2DH 2ZUSA 3IEAA 3CVBA 1BVOA 5CAYB 2BP5M 2DKMA 4MJIB 1CB4A 2Y06H 4EN3D 4I2XB 2X4TB 4R5VA 4XN4A 1GGUA 5FYLL 3CD4A 5HDQH 3ARXA 2H1PL 3X14A 1YQVL 2ESVA 4DOHE 4RZKA 1I7TB 1LP9A 2IH9A 2F58L 4ZSOA 3BVDB 3ZKXB 4EXKA 1CFTB 3L5IA 1UWGL 3H7BA 4KVNL 2UY6B 1X5AA 2J6EA 1SXBA 4OJDH 4NIYE 1NCDL 1ECYA 5IW6B 1ZXQA 3DYPA 1E0OB 4P2OB 4X6DB 5FXCH 4UV4H 2AEQL 1GHFL 4HPOL 2I24N 4NQEE 1JHKH 4F3FA 2XWXA 4R90L 4LU5L 5F3HA 1KLFB 5I1DB 4B60A 2PCPA 3B7TA 2UZXB 4LKCB 1B88A 1IX2A 4PD4J 1HL8A 2VM3A 4KGLA 3WIHH 3MNVA 4DGUA 2YKLH 3O4LE 4NO5A 3BUYB 2ICWB 4JKMA 5EZLA 2VM4A 2X38A 2EE3A 4NQCD 3B2UD 2JTYA 3T2LA 1KPRA 2FK9A 3D87B 3CCHB 5DCCA 4F5CA 3NJXA 3STZA 4NFDA 1XCTA 1FZOB 5FB8B 2X6MA 4NZUL 2F7IA 2B08A 1G9MH 1KCKA 2J8UB 2E76C 4KKLD 3RDTC 2EIZB 4ZI8A 4GRWH 3ZX1A 3JUYA 4KVCL 1VCAA 3B4NA 1WWBX 2F7RA 2WIIB 1JNHA 4K9EC 1IC4H 2FWUA 4MGXA 3V8OA 3ZBMA 2A6DB 5BO1H 5ADOL 4Y1TA 2KLSA 2GAZA 4N8UA 4MFHA 2I32A 3SBWA 4KKNA 4HA1A 1CU4H 2AJSH 4YLCA 5CBAA 2A6IA 2J88L 3GLAA 2WNKA 4NQCA 1KLUB 1SBBA 1G7HB 1QRKA 1KBGL 5BPPA 1X5XA 5CKAA 3UPRA 3S0PA 2CO1A 4ONGL 2EDKA 3EHBD 4BFGA 3UYPA 4GOSA 4H20L 2BK8A 4QJ3B 1BXXA 3A6BL 1K5NA 3HFFA 1EGJL 3ILPB 3I6KB 2AK4E 4BFFA 5ANHA 1QPXA 2EP6A 5KZCD 1FC1A 1G7QB 1L4IA 2GTWB 3HI5H 4NRYB 4APXA 4F8TA 4WV1A 3CXFA 4X0KA 5FKAB 2X88A 1T0MA 3HMWL 1OZUA 3CLFL 1FGNL 2Q86B 4PJAE 2DWTA 4JPVH 3QUXD 2MNUA 4JANB 4GXUM 1BF5A 3B9DA 4LLWA 2VMEA 2VDLL 3HI6H 4O02L 1X5HA 3KJ4B 3MLXH 4HIXL 1ZV5A 4OLYL 4XCNA 5DRZA 5E94A 1E9PB 4IKJA 3GJEA 3SE6A 1QA9A 1PU0A 4XNXL 1CE6B 1TVBA 3B5TA 4UMGA 4OLEA 3NSDA 2YPLB 3LD8C 4NOBA 2DBLH 5IEKB 1ZJAA 1O5PA 3W2DL 4DGVH 2FCBA 4JCWA 5DK0A 2X0UA 4FC3E 3D2UB 3UACA 1NGZA 3F6LA 3UIYA 1NCAL 5FFLA 2Q3ZA 2Y72A 5C09A 5CSBA 4NZJA 1CFQB 2APBA 4HLZH 3W0WA 4FTVE 4IU3A 4XODA 3RKDC 4QTHB 3VFRB 3KPSD 3KPOA 5AENA 3QORA 3QQ4B 4BD4A 3HUJA 1DVFB 3ESVF 5E95B 1BW8A 4GKSB 4Y7OC 4LL1A 5KVDE 3EXJA 2Y6TE 5GISL 1XSIA 4LRIA 1VZGA 1UJ3B 5D2LB 1T83A 3WNNA 3T3MF 2BMKB 2Z4TA 4NNYA 2QLYA 1W6LA 1ACYL 4AUYA 1SYVA 4U31A 5HDLA 2AK1H 5DJ6A 5SV4A 1BQUA 4BZ1H 3FTWA 4CBPA 4WO4C 3FAXA 1S7SA 2OSXA 2R69A 5MEND 2PTUA 4L4VE 4XCEA 3Q8AA 2C5DC 1W6WA 3SDDD 3TBWB 5GXBB 3H4FA 3H3KA 1XAKA 3MRPB 2HKHL 5ALCL 3ERXA 5CGBA 4GNKB 3TIEB 4ODHH 1L3WA 4DQOH 2LT9A 1RKRA 1Q0XH 2ID5A 4MA8L 2FHBA 1YY9D 2EYRA 5TDPB 1DSFH 1A6UH 1INQA 1Q9KA 2R4SH 1NCJA 3PWPD 4HH8A 4UOJA 5DJXA 5H8DA 4HIEA 3MNWB 4MAZA 4Z7WA 3T0EE 3U4EA 5HYEA 1I3RB 3BZFA 3AROA 1WT5C 5BZWA 4XZUB 4OI9A 4D0BA 5C0IA 4WUUB 1UWEL 4ZQTA 1F1GA 3O11B 1DFBL 1ZLSH 2WLJA 3T6ZA 4G5AA 2F54D 3KPQB 1KCVL 3MR9A 2J6EL 4AG4H 2D73A 5C6TH 2PW1A 5KW9L 3CHPA 4ZFQA 3UROR 4AV0A 4P48A 1HILB 1UXSA 4UI2A 2IADB 4B9IA 3EFDH 2AKRA 3CVDA 2K3HA 3KYMB 4S1QH 5E5RB 1AGCA 3QI9D 4XAWH 4AQ1B 4CAGA 4L18A 4HSCX 1VFBB 4X80H 4XB7A 5LAXB 2F1BA 3HKZA 3IXTA 4R2GB 3DPBB 4APQD 5I74B 5D7EA 2DQEH 3BWZA 2JLLA 3LKSA 4WEMB 4FABH 4HJSA 1E28B 1R5IA 2BWDA 3IKCB 4HAFA 3SYOA 4DO4A 1E5BA 1VEMA 3BZDA 2FJHB 5D1XE 3HB3B 2P5EE 4OGAD 4RDQG 5I6XC 1ZD6A 1INDH 2X2YA 2VR9A 1FH5L 3S35H 1BV8A 4I89A 4F2MA 3VXTB 1CXKA 4AQEA 5I30H 5G2NA 2XQYG 3ULVL 4P0DA 5D5MA 4OZIB 3UTZA 4EI0A 2XV2A 1MCHA 5HPMB 2VLME 1MAJA 1MN4A 1S7VB 5D7JB 1L3NA 4B9CA 3EXLA 4LMQI 4Q74A 2IIJA 1KTDB 3CSYB 5EIQA 1TCRB 1JPGB 2PXYC 4K7PH 3ABZA 3A21A 4KKQA 3GRGA 2APVA 2FBJH 5IFAL 4YSPA 3VFGL 4HZLA 3OMZA 3O3EA 1VGEL 4H8WL 1YVLA 4A7GF 2X7LA 5KSBF 1P5UC 5KSAA 3F64A 3JV6B 3L2MA 1MFUA 2DQHL 3BSHA 4FKKA 1JPTL 1E5YA 3LXAA 4OCRL 2VMCA 3L9BA 3U30B 3VFSB 4UTBH 5EORL 2DQ6A 2OXGB 4G9FE 4OIFA 1JG9A 1MCIA 5E1IA 6TAAA 5IZ7A 3IPBA 5LQBH 3IETA 3UOAB 1AO7E 1OGPA 2WLZA 2Z9TA 4F15B 2EH8H 3PCYA 5B38B 1OAZH 4AC2A 1VFMA 2FR4A 3OKNA 1BFSA 1FYTA 4UNIA 4OFDA 1AI1H 4PGDA 5I8OL 5EDSA 1KXVA 4LPCA 3K4ZA 5L0QB 1OANA 3FZUD 1A9BA 3GT6A 5EOCJ 5T3ZD 4WU5A 4PJDA 1YNLL 2HG0A 1OB0A 1RL1A 3QEQB 4CL7A 4AEIH 5F9OL 2BZCA 2X9YA 2VZUA 4MXQC 1AP2B 5JYMA 1UA7A 1MEXL 4J1UA 5D93B 1AFVH 4H1LA 4ADJA 3OMAB 4M8QA 2YMOA 4NLHA 1CT8A 2HRHA 2P8LA 4ZAKB 5KBLA 4IJTA 3I75A 1VCBC 4JN1L 4A6YB 3MHZA 4CC4C 1ZLDA 2Z7WA 1NICA 4ZD3L 4EI5B 3QXTA 2HTLD 3CZGA 3EADA 1F11A 3UG3A 2K45A 5AVSB 4ESKA 4WSKA 5C0JB 3T2NL 3RWGB 4PYGA 3WY2A 1T0OA 4R9HA 1ORQB 3OQ3B 2QFPA 4W9DC 3S35X 2AXFB 1DVUA 4XP6L 1AR1C 4P23B 3WOVA 2IV8A 4QT5A 3IFNL 4KAQH 4R7NA 3ULAB 2ZX9A 1JMZA 3P2BA 1JD9A 1INEL 3TASA 4LAJH 4QXGH 4Z7UB 4K7PX 1LEGB 5DO8A 4M5ZH 3RIKA 3X1GA 2EC8A 1BVLB 3BGMA 3S5LG 2CJ3A 3DYOA 2F53E 4TNVK 3EJYD 5D1ZA 3AXHA 3FC8A 4ODUA 4X7SH 1PSKH 4Q0XH 3SBWC 4ONHA 1DBMH 3FSVA 4FNRA 3BSZL 1M9WA 2YD1A 1UACH 3DO7B 4JFDE 4R97B 1N8ZB 3ZUCA 4HWBH 3KGRA 1KIPA 1T5XB 3F6IA 4QRTA 3RU8H 2X09A 1R3HA 3UDWA 4DKEH 3CU7A 2WXKA 1USQA 3SJVD 1QSFE 3UTQA 3FRUA 3VDAA 1MAKA 4X6DF 2VW7A 3TIDB 3C6SA 4HV8B 1J9RA 4OQ1A 1OWRM 3U9WA 1JPSH 4FLRA 1C7TA 4G6KL 4QRQA 3VW3L 3TL5A 2R69L 4GQ9L 3F04A 5T33H 2AJ3A 2ZYHA 1R24A 4PRDA 3V5KB 1OSPH 3HW7A 4U1SA 3V4VL 4FFYH 1IM9A 5EPMB 1XGUA 3BD4A 1Z0NA 4WV1C 4XPGL 1G0DA 5I66A 2WJ7A 1I4FB 4LPVA 2O6EA 1OCOB 2E6JA 1I8IA 5B39G 1MCWW 3VGGA 1BYNA 1CFVH 1S8DA 3MLUH 3B3IA 4XN7A 2WD0A 2CGRL 2DQTL 3NZUA 1ZS8B 2E6PA 5I8KH 2BP0A 3RGVD 2EILB 1JSYA 3WHE0 1E5AA 1G7MB 5EV7A 3B83A 3EHBC 4B7LA 3PPSA 2WJ5A 3DOSB 4W9HC 4AV5A 2K9FB 3BEVA 1I8AA 4EN3B 3LKPA 4XTRD 5CP7A 2H32H 4W9ZA 2XN1A 1CK0L 1TU2B 4X4YB 2KHAA 4A1RA 1F6AB 2UXTA 3EDJA 1NUDA 4WWPA 5IFJA 1GY2A 1ZAGA 5GRUH 2GFBA 4R26L 3UBFA 1WEJH 1A0QL 1AGDA 3L16A 2WKOA 5I1KL 4NN5C 3WXWH 4JO4H 4GT0A 3VX0A 1VADB 1GSKA 1T03L 3RGVA 4BEIA 4MNQD 3NCYS 3TBTA 4BYHA 2CBTA 5EC2A 1FZMB 5A43C 1ACZA 5ILTL 3FYEB 1XSJA 5E2VL 3RYMA 3SKOB 1M6OA 3BDBA 5B1JA 1V3JA 4PWHA 4XO5A 2P80A 2X3AA 4PTTB 1TOXA 5ISZE 43C9A 3TJEL 1DLHA 1NCHA 4N2GA 2VDPL 2Z3FA 4PVBA 4KO9A 5FHBL 3KH3A 3QORC 4G6FB 4AGMA 3MLWL 3ARWA 3N2JA 5PAZA 4LLQA 4YE4L 3QJFB 4LRIC 3OKLA 4IBWA 1T83C 2XQBL 1UKSA 2L7UA 5C71A 2K9UA 1QTYT 2C9AA 1G7IA 1ZHBB 4YHNA 5JHDD 2V5TA 4PCKA 3V0GA 4C4KT 1MELA 2VKXA 3B1TA 3PXLA 4PJBB 4A2EA 4DN4L 3SPGA 3PXHA 1T04B 1PY0A 2YSTA 2RFXA 5AVWB 3FTVA 4HUUA 5EA0H 1F56A 3BAXA 4U1GC 5F7YC 2DQCL 5CZKA 5IWLA 2XG5B 2Y0SA 2UVFA 3SSGA 3WTSA 5KSUB 4D3CH 3ECBB 2ZXWB 4RGMB 3BJLA 5CP3A 1CGWA 2XICA 4XRCA 4ANVA 4BUGA 2BVPB 2FO1A 3KAAA 3OC5A 3QQ3B 3LPPA 1KIUB 1G6RB 4L8BA 3LIZH 4J2QA 2BINA 1H8LA 5E6ID 1B0WA 1KIRA 2MIZA 1F13A 4L1LA 1LYQA 4JHBA 2CXGA 3T4YB 3OM3B 2RTTA 4HOWA 2E86A 5KZCB 2D7PA 4LCYB 1OB1B 1JMXA 1WG3A 1AS7A 2P49B 4JY5L 1ILSA 5HD8C 2ED7A 4X7TB 3UFIA 3QZWG 5DMIH 3P0YH 1MJJB 2R9HD 2CMRL 2WQ8A 1XCQA 4Y9FA 2AJVL 1S3KL 3NIFE 4YHOH 2ZE0A 5D2LF 3WKNA 4RZCA 1AS8A 1LHZA 3ARDD 2AQQA 1YY9C 1MJ7L 2WW8A 3F7VA 3QUXB 4RMTA 2DIAA 4N2CA 3TCLA 4I77L 4DPRA 1G9NH 2IBZY 4C54A 1MF2L 4FHKA 4P5KA 1C16A 4BGDA 5E8DH 1TZAA 3MRCB 1JXGA 4FXGB 4OZFG 1OM3H 3VXME 2QSCH 5DVLA 2DDQL 2P52A 3D9AL 3D39E 3F8UB 3LQZA 3QRGL 5EOTA 3SBQA 3U46B 3WEMA 5KBNC 2ARJA 1WZ1L 4L3ED 1PCSA 4PGBA 4MA1B 1D9KB 2HYMA 4LCUB 4AYFB 3LQAH 3NIGE 3QFDB 3DX9B 4AM0B 1P6AB 2F18A 2VC2L 3FQ2A 2XA3A 1O6TA 1TTFA 2C4FT 1IE4A 1PLGL 3QUYA 1AXTH 2CLZA 2WINA 3VFVB 4FULA 4M6NH 1XTMA 2YD4A 1A6ZB 3K5RA 1DLFH 2BVYA 4RDQF 3UO8B 4A2GA 4MD0A 4JKWA 2Y25A 5EU6B 5IJKA 2IOMA 4RGOL 3TJHC 4Q9RL 1OQOA 2WNXA 4N9GB 4QO1B 1CDIA 3W9DA 4OGAC 4E41B 1BD2B 4EDWL 4IYKA 1NGQH 2BVTA 3E80A 1JP5A 4YIQB 3VB9A 1TITA 3GMPB 5BXFB 1CE1H 2D7TL 5EFIB 2G5BA 1BIHA 2Y5TB 1DQLL 4G6JH 3PJSA 4IRZL 1RULH 1U58A 5AW8B 3TBBA 5GZOD 2VSMB 1TJIL 3MZGB 3BH8A 5DD0L 5D7KD 3QNZA 1JGLH 4LLMA 2XKUA 1A6TB 5IHBA 1BSIA 3OKEB 3KGUA 1L9SA 1MAMH 3TF7C 1J8SA 2UXGA 1U93A 3IMVA 1KXVC 2OYLA 4LCWE 1KTLA 3Q8CA 4NN7B 3PWJA 5HI4D 3MRHB 4JVWA 3LHPL 5DQJA 3FB7B 3NJVA 1QLEH 5EWIL 3A67L 1SOSA 3SDDB 4CADB 2VQ1B 4P57A 4H26A 5KTEL 1OD7A 1GYWA 1I7UB 4XP5H 5AEAA 5AZEL 4G7QB 3WNIA 5DU7A 1KGWA 1TJXA 5ACLA 2BVQA 4LHUD 1CGUA 1KC5L 2NY0B 2Q20A 4MA7H 4ELKB 4EUPH 3PWPB 4OZGE 3PPEA 5IUCA 4BFRA 2CLRA 1L0QA 2XPYA 4P2YA 3FUDA 3VM7A 3EOAA 3TT3L 1WC7A 2BP8B 5F72S 2Q8BL 5I8CA 4OLWL 4ZFOB 4L29A 3FZUC 3LZQA 2O30A 4M8RA 1N19A 2F19H 4WU7A 1BQHA 3H3PL 3WO3B 4JR9L 5EU4B 1A4KB 4CILA 2F54B 5DXWA 3C5SA 2GSIB 3F84A 3E8UL 3KPMB 2Z6FA 3LN5B 5E2TH 2DLFL 5BJTB 1R3JA 3HC4H 3QUGA 4UIMB 5GGRY 1KJVA 5I76A 4UTAA 1LK2A 3L3DA 4L3FA 3QI9B 4QHPA 4DVRH 1ZPUA 1MCQA 2CA4A 2CLVA 2NT0A 3NABH 4MXWL 3TBCA 4APQB 5B21A 1DEEB 3VGAC 4JQVC 3CX5J 3ZYJA 4YNYA 3G6JA 1R6VA 3HFMH 1KB5B 3ALPA 5D1ZC 3MO1B 5TGBB 4DEPB 5FUZH 3HLKA 2HT2D 4AYGA 1OGTA 2RIKA 4GBXB 5HHNA 4AVJA 1IFGA 2VDRB 3MJ8B 4N8CL 3Q5TA 1BPVA 1QWNA 1AR2A 1U8NA 4Y4FD 3DJTA 4L4TA 3UDWC 4LIQH 3DKHA 3DURA 3KS0H 5F96L 5IW3A 3SGDH 3MRQA 1NMBL 4U4BA 2Y36L 3TH4T 5TD4A 1F4YL 1ESOA 1A4BA 3DARA 4IHOB 3BKMH 3KPPB 2ZWNA 4WQOA 4ATWA 1R33A 5IBLD 4MCYA 4AENA 1Y0LB 4BUHA 4AQAA 3UTTA 2QDVA 1MNUH 4E9WA 2Y5EA 5MEPB 2NNXA 3QDMA 3VD4A 1U4EA 3EJYC 4LVHC 1WAAE 3OMIB 1SPDA 1Q94A 2PPEA 3D3VE 4YGVA 4F33A 1EZVY 2KYIA 5A16A 1QI5A 1XH3B 3BRFA 5MEQB 3WUWG 1JYNA 5AYQA 3DROB 3QNFA 4A7GA 2AVFA 3MXWH 4F57H 5JA9A 4U3SA 5KSBA 1IMHC 4I1PA 2IPUG 4YXLL 3DGCR 4ODTH 5L2JB 1A5FH 4E9QA 1TETH 2GPZA 4HYTB 1I8MA 2PPAA 4M5YH 1DJYA 2HUHA 1V8HA 2Z93B 4EBQL 3KH4A 2X6VA 1SLXA 5IV2A 5FR3A 3JWNE 4WK4B 3L3JA 4O58H 5FPIA 4PREB 3BQVA 3BLKA 3EYOB 1NKOA 4PJCE 2EIJB 5HDBF 5D1QD 3NN8B 2WLIA 1CURA 4JDVB 2HCZX 3LJ3A 2I5YL 2FECL 3OWEA 1CLVA 2UVEA 5MERA 4R3SB 3CN4A 3SGEI 1DUZB 2MPAL 1Z5LA 1E6OL 3RGVC 4OQTL 5JXAL 4AEFA 1RFDL 4HJJH 3MXVH 5JHMA 1RUKL 2WGNB 5B1JC 4LEBA 3B7UX 1I9IH 1A65A 2NY1C 1J9QA 1S7UA 4LFHG 1EDHA 3V4PB 3IMUA 2OI9C 3MBWA 1D5MB 1NZRA 5CILL 1J8HB 3IGFA 4KC3B 4AL8H 1MRDH 1W8OA 1QBAA 2EE9A 2PCFA 3KEHA 4QAMB 4JFQB 3DIFB 5F7WC 4Y1SA 1D5IH 3HZVB 3PREA 4NUJB 3RNKA 2XCMC 4OLZH 1M4KA 5D4JA 3D25A 3DOHA 1AZZC 5CCGE 3VXUE 4JFPA 4M1GH 1YPZB 4IS6B 3SO5A 3EJPA 3HHSB 2GJ6B 3D30A 2AQ2A 3QPXL 1PD1A 4FDWA 3D06A 3RWJA 4FQXD 3MV9E 3UYOD 3OXSA 3O9WD 2ZAGA 5E9DE 3MV8D 2OTWA 2ZF8A 5L6YL 4NT6A 3GBDA 4NUMA 3MUGA 5DJ0A 3CLEL 3MV7A 4I2XA 4NZDA 1HYSD 2OR8A 5E8NA 5D8JL 4QKXB 4PP2B 5DI8A 5DQDL 3VD5A 3L95A 2UWEB 3UTOA 2XRAH 5IWLC 1CLCA 2YXFA 3L7EA 3P3UA 5F3BB 1UGKA 1YA5A 1CFTA 3VB8A 3VFTB 2Q7YB 1AZRA 1V27A 3CVIL 3EH2A 5DDHA 4FFZL 2A1WL 4TOYL 7PAZA 1MWAB 1KXQA 1ROCA 4GSDH 2NY3D 3O9WA 5F1KC 4JFOB 3WENA 4UINL 5J6SA 5IW6A 3RUGF 2GBAA 3I02B 3FB6B 6PCYA 3HS0A 4L5FL 2XWCA 2HX7A 4CC1A 1M7IA 1VESA 1IEBB 4JO2L 1URIA 2C34A 3CWGA 1T7ZA 3QH3B 4WEBL 4CU8A 5CFHA 4XNYH 3LB6D 3DHPA 5EUKB 1PL3A 35C8L 4YWGH 2MCG1 4KTGA 3BUYA 3DX6A 4YSUA 5L2KD 2CRIA 1IBZA 4S10A 3HC3H 5SWSD 3CUPB 2Y2WA 4PRHD 5A2JH 1HWHB 2NNFA 2NXYC 3PDOB 3CCHA 3OKKA 3IT8D 2AABL 1PPIA 4HKJA 4PJBF 3F7YA 1MCNA 4N0UA 3BHBA 1RV6X 3PHOA 3Q1EA 2QQKH 2CR0A 2LV4A 1RJYB 2JWYA 3WSQL 2DWDB 2HJKB 2WIIA 3FUMA 5HSFA 3U2JA 1S9WB 1NCWH 3GC3A 3L13A 1E4KA 2R9HC 1S7WA 2UZPA 4U1MB 4YDIH 5C0CB 3VNYA 2D7QA 5I1IL 3GMQA 4XPTH 2AF2A 3NJIA 1SEQL 2EDNA 4N2BA 3ARDC 4K9EH 2OXHA 1KLUA 3QUYC 4MNQB 1UD4A 2XPGB 1HZHL 3DK0A 3QWQB 4M3JA 1SF3A 3FOLA 4QI3A 4CMMB 1IC0A 4ORGA 5LAPA 4YJZL 5GSVB 3P4MA 2Q6WB 3VH8G 2CJUL 1C5DB 5CEZH 4DFHA 5IJKC 4LP4A 3PL6D 4CC0A 1RHHB 3ILPA 5CXPA 3ZO9A 2X41A 1JBJA 1IFHH 2I07A 1QRND 3HPLB 4JB9L 4YHLH 4KY1L 4R4BA 2XA8L 3AAZA 4X6FB 3HG1D 3N04A 5KYXA 2C7FA 2B5IB 4R84A 1IO4C 4EXPX 1ADQA 3TCTA 3U79A 2EKJA 4WFFE 4X8XA 1Y18A 2BSRB 5TDNA 3ZMRA 5FYLH 2EAEA 2FBOJ 3FUFA 4DK6A 1T80A 2AQRA 2H1PH 1E90A 1MFDL 1EHKB 1Z9LA 2F58H 1L7TH 1HI6B 2PP8A 1HQ4B 1M1SA 1UWGH 2ZOTA 3EZJB 1YEEL 3MBXL 3Q9PA 1TVHB 1KBKA 3ECUA 4X6CB 3BP4A 1VFUA 2ZWLT 3KLDA 4KUCF 2IH3A 1E9PA 4C8XA 2FT6A 2R83A 3OB8A 5FYJU 4FFTA 1KMGA 1CE6A 2EEAA 3DX0A 2Z7ZA 5DJ2A 2ATAA 3DX2A 1N8OE 2VABA 1YMHA 2AEQH 1YEJL 2C1OB 2YPLA 3EOTL 4MCZB 4AGOA 5CSZA 1FO0H 2J44A 3GSWB 3VGHA 4K5NA 4LU5H 3NFNB 4XN9A 3AT0A 1KTRL 3COOA 3MTXA 3L3OB 4TSCL 2WNWA 3U9PL 4JAMA 3UTPD 3KCPA 2V3FA 3Q13A 5E6IB 5INCB 4ZOEA 3GBNL 4NNPL 3TNNA 4WHCA 1RZJL 5HI4C 2HXAA 5BV7B 4TL4A 2QLVB 3D50A 3PFQA 3GB7B 3O45B 3QDGB 5EG6C 4ODSL 4NZUH 1TENA 1WWCA 2EADA 3CLWA 4PMEA 2HN7A 2OSLB 2WXPA 5IIEB 3FFCE 1NINA 4FG6D 5I1AB 4KVCH 2XWBA 4I13B 1UJ3A 2X4QA 4OD1L 1GMIA 1IJNA 2Q2EB 4PRIA 5ADOH 2P5WD 4MJIE 4OJAA 5FM5M 3FT4B 2L7JA 5FWRA 3WEOA 3K8LA 5AD0A 3UBXG 2J88H 2VQTA 5KJ4A 4PJEF 1KBGH 1RIHL 2FJGA 4L3EB 3TJPA 5D72L 1ZT7B 5HGAA 1E9OA 5CLZA 3KPNB 1EJFA 2QTVA 3HBQA 4G1MB 1FJ1B 2H45A 1Z9SA 2CD0A 3MRPA 4HUKB 2X87A 4H20H 3T65B 3KL5A 2WWNA 4KHTL 1YECL 4HKXA 5DURD 3X1FA 3TFKD 3A6BH 3M1BA 3TIEA 3U6XA 2E7DA 2O61A 1E4XL 2Z1PA 1A1MA 4P2QE 5HHOA 4U7MA 3L9YA 2MMXA 1N3NA 4HQQL 3KWWA 4TVSa 4X6DE 3U0WL 5TDPA 1SHXA 5B4MD 3HMWH 5GRVK 3QIBD 2F1EA 2HVJB 1CLYL 1CFNB 1S2EA 4QTIL 3ILQD 3BPOC 1FZKB 3PU7A 4KUZH 5DJCB 5TDOB 3PFUA 3ZMEA 4D9RE 3PGFH 2HFGL 3ZE0F 4ZUSA 4NN6C 2K4AA 1VGKB 3ABGA 4WUUA 2VERA 5DZOA 3DTXA 1WHOA 2B1AH 5EC1A 2VDLH 2XQYA 2CBOA 2ENSA 2P44B 4U0RC 3SCMB 4O02H 5CEXA 2E46A 2VLRE 4HIXH 4OLYH 5K9OB 4HHWA 2C1PB 3KPRE 3JWDL 4RBPH 4P2RA 4WW2B 4YR6B 2VM9A 2BOBB 2N0KA 1PDKA 4XNXH 5LN8A 3O8XA 2J8UE 1B9KA 3AREA 4KHXH 2Q76B 2IDQA 5IBLC 4BKTC 1WP6A 2I7SA 4XVTL 3H0TA 4L9LB 2E27L 3CTTA 4KNQA 5DMJB 4U1NA 3EFFB 3W2DH 5KYYA 3I74A 5C0BA 1R3KB 3S5YA 3MLVL 1SYSA 3MKGA 4I5BA 1MW0A 2W94A 1XL6A 1NCAH 1CFSA 4MQXD 4XMLL 5DRWA 5F7MC 4ZJ9A 5DSCB 1CXHA 1MY5A 3APMA 1UCTA 4ZMWA 4L8CB 4K5LA 5J89A 2LFGA 4LHUB 2OMNA 1T2JA 3PV6B 2ZX5A 1FNHA 4PJXE 2KH2B 4YDLB 3MNDA 4RISL 1U3HA 1BVNT 2VUOA 5D7JA 4UU9A 3GO1L 4AIOA 1DQTA 5GISH 2XWZA 3NZHL 1MFMA 3MRIB 4HIJB 3L9RA 1YMME 2EICA 2N7BA 4B95C 5KYUB 2F7OA 2WLHA 5D1QC 1YY8A 4MHHI 1BIIA 2HMIC 5HHXL 3T8XB 1ACYH 2VITB 1E8XA 2R1XA 2C26A 2Z91A 1H8OA 2QPFA 2V8LA 3I6LE 5E99L 4X5QA 4N2HA 4AKPA 1T6BX 2QADD 3VFSA 3K81A 1KJ2A 3FBKA 1PS3A 1WWWX 4ZUWA 4Z9KB 4D9QE 3ZT6A 1DVYA 4KROD 4WGVB 4OT1L 1SVBA 4RA0C 3BFOA 1MCOL 2APXA 5DRXA 1RK0A 2DPKA 4AW7A 1OAXL 3QYMA 4HS6B 3AADB 2H8PB 1EH9A 2HKHH 4X5XB 5ALCH 5GRZA 4Z7NE 3NESA 4WWKB 5KAQF 4DSYA 4MNHB 1AQMA 2ZUUA 3CFEA 3RPKA 5LBVA 1XIWA 3EF7A 3MYZA 1OAQL 2DMGA 4MA8H 2CUMA 4LVOC 2WIMA 1EDQA 3L9EA 4YHKL 1JN6A 4NZTL 3NT0A 1ADQL 4WCYL 2EDOA 4Y4FB 5IQ7L 3IVKA 4KRMB 2YEZA 3JWDC 3S3JA 2C7UB 2I25N 4Q8BA 5F8RC 1UWEH 1OWWA 3L7FB 4ZAKA 3O9WC 1GS8A 1CC3A 3S5LA 1IAOA 3ULSB 3HS0C 4H0HB 4MMZB 4IIQB 3BO8A 2M26A 3CFCL 1RZIB 3DXAD 3BWAB 4J23A 1KCVH 1FFQA 3QJSB 1XGZA 2J6EH 1HYSC 2LAGB 2WQWA 4BH8B 5KW9H 2VB5A 2OTUA 2FQEA 2YAEA 3JV0A 4OM1L 3RWGA 4CU7A 3ARGA 1YPZF 4FF9A 4HEPA 2WUCL 2WLLA 3RY5A 3QXWA 4FN0A 4KRPB 3G08B 4YE0A 2O5ZL 3BVTA 2JKXA 2W1NA 1FORL 1IJ9A 2OQJA 3CDYA 4DUXA 3WTTA 2W88A 4EPSA 3DX8A 3GQFA 2NY3C 4OFIA 2K6YA 4HP5A 3ZE1B 5H2BA 2DKSA 3QFJE 2NY5L 1FL3A 3MQIA 4B96A 5M95B 5CJXA 1ZVSB 1PKQB 3MVSA 1FH5H 4X99B 4Z7IA 1CTMA 1A8ZA 2UWEF 3MJWA 1H8SA 4K15A 3TBYB 3ULVH 5B39A 3MGTB 2AAVA 1P84J 4E0RA 2VR7A 4JHVA 4FYQA 1U8KA 1E4KC 5EIVA 2QJDA 4IOSD 3N40P 3V9EA 3AC0A 5F9JB 4ZQKA 2IGFL 4U0QB 4XP1L 3Q06A 5FA3A 2EC9U 2GIYA 4IK7A 5IG7A 4IMKA 4KOCA 1KEMH 4PY8I 5IFAH 2WZPD 3VFGH 1FI8C 3DV4B 4H8WH 2X0WA 2ZX8A 1OALA 4L3AA 4HV8A 4LQFH 5GGRA 2BSCA 2DQHH 2A74B 4F37K 1JPTH 1H5BA 3FU0A 3FU8A 4F7PB 4OCRH 3HC2A 5B3NA 3EYQD 4NQDE 5EORH 4LHQB 1AKPA 5E6ZA 1YRKA 1BMZA 2TAAA 4AE0A 5DUBA 2IDTA 2ZOOA 2WXOA 1FSKB 1AE6L 1EA9C 4ZO8A 5ECJE 3LEYL 1Q9WB 2L7QA 5I8OH 4G8FA 3TESA 1NMCC 1TQWA 2H26B 4FQXB 2GSGA 3CAFA 1PZ5B 5HBBA 1UD2A 2WZPA 3ZPDA 2OV0A 1GGIL 1BZ9B 3MV8B 3PWLA 2AQTA 4X7DC 2C9XA 1IGTA 1YNLH 2IMMA 4P5RA 1DJIA 3QAZB 2D0FA 3MRDA 1AC6A 1NCBL 4JM4L 1XHHA 1X5KA 3PL6C 2E9JA 1FCCA 4FL4B 1MEXH 4OD2B 1KENL 1PG7W 4EVNA 2M2DA 3EBAA 3LZRA 3WEBA 4JN1H 4LLUB 3B6SB 3AWGA 1HCFX 4W9GC 4XI5D 4NBYB 4CKVX 4L8SA 2OKMA 4OZIE 4RETB 4X8JB 4LSUH 1U3YA 1XV8A 4ANXA 1U8CB 1YAIA 1Z1WA 2C4XA 1WZMA 4KI5D 3T2NH 4URTB 1I3UA 1CYWA 4XVSL 3FFDB 3CIAA 4XPHL 1I7RB 4XP6H 3LS5L 1B0GB 3JTSB 4HUNB 3UZEA 3RUGA 2E75C 1KTKE 1EANA 4WEEA 3IFNH 3KLSA 2R0WL 1SBSL 2CIIA 3N43F 4AK2A 2WXJA 1MG3C 1RERA 2OMTB 4ERSL 2FEDC 1EZUA 1INEH 1HCYA 1SDDB 4MDIB 1NANI 2ZWYA 4HS8L 1OVZA 3I6SA 5E23A 4NZ8A 5I6LA 2V3EA 4Z0XB 3L4VA 2GUOA 2AQSA 5F7FA 1FHGA 4PRHB 5DVMA 5IQMA 3GZKA 1ZHKA 1NAMA 1UZGA 2W5PA 4FX5A 1JGIA 5IB5B 3F7KA 1PQZB 1HT6A 1DJWA 2VLKE 1ZHBA 4XX1E 2NY7L 1QATA 2BIPA 3BSZH 5C6WH 4LLVA 1OHQA 4URKA 1WFOA 5BQ7A 4PJBA 4V1DA 3QZWA 3GS7A 1ZWIB 3SE3A 4EN2A 1DCLA 1ID2A 5LBSL 4KK8D 1CD8A 1PX4A 1UYWL 2Z0UA 4FG6C 4ECNA 4G6KH 3VW3H 1AMYA 1FP5A 1Y07A 2R69H 3LPOA 1KDJA 4GQ9H 2HFEA 2WYIA 3S3DB 2BVPA 2BVOB 4JFFB 5KN5B 3V4VH 4HCGA 1N70A 1G6RA 3GMLA 5C6PB 1M2VA 4A2MA 3UGXA 3MRJB 4HLZG 1FLRL 3WFDL 4JFHD 2EDFA 2V2WB 3S8GB 3IKKA 2CGRH 2DQTH 4BGLA 4NZFA 3X13A 1S7TB 1QRNB 5L9DL 4ZXBD 5FYKE 4FFVD 3HG1B 1E4WL 2AJUL 4LCYA 1K8DB 1OB1A 1RK7A 3CZFA 2H3KA 3L1GA 2HTKD 4K7FA 4XOBA 5E8PB 4K94C 1KGUA 2O6DA 1USZA 1E6JH 1MXGA 1CK0H 2VJ0A 2L04A 1WA1X 3ASWA 1ZS2A 4G1EB 3O8XC 3AREC 1QLFA 2OTPA 2QGEA 4A6YL 4Z7UE 3VGBA 5B4MC 3QXAB 3FQTA 4R26H 2XZCL 2OFQA 1A0QH 4LSQL 3ILQC 1WBYA 1ECZA 4N6QA 5I1KH 4QD2E 3STLA 5I74C 3WS6A 3VFMA 2AZAA 5I17B 2ZCHL 1T03H 1AQDB 5DZLA 3QR2A 3I9AA 1MCKA 3QEUB 4HGKC 5ILTH 2K3TA 4C4BA 1A21A 2PW2A 1IVLA 4AM0A 3DX9A 1H3PL 2R2BA 3TJEH 1XEUA 3IFOA 3P02A 1BEYL 3V52L 2XN0A 1S4IA 5D1ZI 3TPUB 3ALWA 3ZR5A 4NC1C 5FHBH 5BUAA 3L3HB 1U3HC 4MAUL 1X5JA 4IKLA 2ZXQA 5K33A 1KYOJ 2JKSA 3FXIC 5IJDC 3D09A 4PJGA 2UV3A 5EU6A 5T1LB 4AT6A 1E5ZA 4M5SA 3A6OA 4PJ8A 2XQBH 4DP5X 3BPLB 4YBQC 1T2XA 4XC3L 4M43L 4XNZC 5IEHA 4QXUL 4MQXC 3UCQA 1QQDB 1XH0A 4JHZA 2PYFB 1J9CT 1CDCA 1LD9B 2CG9X 4WW2F 2DQIL 1MLBA 3GEFA 4MZ3A 4DN4H 3GMPA 5IREA 2FUTA 5BXFA 2APFA 5BCAA 1U4FA 3GKWL 4MB4A 4PUBL 1S5IL 4OCNC 3RL1B 2P5WB 4X5LA 4OI7A 4XN1A 3BWUF 2KL6A 2EXWD 9PCYA 5IVXE 1YJDC 1OAYL 1OQXA 2FD6L 3CV5A 4GSXA 2ZOKA 4LLDB 4HF5L 1XIWC 4FQIL 5IHUL 2BHYA 4ZTPL 1L9PA 1UZ8B 1T66D 3HC0B 5F1OB 3LRHA 5T1KA 5AB0A 1AY1L 3CN3A 3PXJA 4PJEA 1SQMA 5I5JA 3FH7A 2TRYA 1I7UA 1UATA 4PJFA 1AKJA 4F5CE 1SDAB 4B53A 4TRPL 3GLZA 2CPUA 4BFIB 1U95A 2ICEA 3W11C 4OCMC 4KROC 4MSWB 1BLIA 4ELKA 2EDEA 2H0JA 3AXIA 2ZG2A 4JY5H 4UILL 3QIBB 5D7LB 3H9SA 3X1NA 3ZVVA 5L7XL 1Q9LB 1UASA 1A4JB 4Y7MA 3Q9QA 4ZFZB 2AJVH 2BP8A 1S3KH 4IBYA 2DI8A 5DHMC 3G5VB 3GJFB 1MJ7H 3LKOB 4HK3N 3ARGC 4JJ5A 4NQCE 3VTTA 1SJMA 2BOCA 3OZKA 1QW8A 2VDKB 2OJEB 3GM8A 2VIRA 3FQWA 1HXMA 3HJEA 3TS8A 2DDQH 3D9AH 1UD8A 4LPYA 3QRGH 1SVZA 1NFAA 4MNGB 2YBRB 4S0HA 1WZ1H 3P0GB 4O00A 1BOGB 3TEWA 4JW3A 3GYRA 1TDQA 5FYJD 3IRCA 2XTJD 5GGVL 5CJXC 2GT9A 1Y1UA 3G5ZB 4XN8A 2QKIB 4D8PB 2IH1B 2HT4D 1DEEA 4EOWL 3QWOA 5AZ2L 2BXYA 1VKXA 4CGTA 4QRPA 1JD7A 4QCIB 2ISDA 2WQUA 1PLGH 4LEXH 1KWGA 2FE0A 3Q5OA 4X7EC 3VI4B 3T0DA 2MNJB 4XZ4A 2YPKB 1LO5B 4KV5F 2WYZA 4JUSA 4WTXA 1F41A 4FNSA 2BSTA 2Q7AA 3ELAT 4RGOH 3VFWB 2JK5A 4Q9RH 1KGCD 3K2KA 4PBDA 4LFHD 1RLWA 4RFEA 2DL9A 1BMGA 1JPFA 1P7KB 4EDWH 1V7NL 1IILE 1H5BC 3L2LA 2ZSWB 4F20A 4HJ0D 1OF0A 1Y0LA 5J9PB 4ZDHA 3D12B 2YOAA 5MEPA 1TTBA 3TO4A 4IRZH 4GRMB 5CIPH 2CJSA 5I1LB 1TJIH 1WJ3A 4LPUA 1SFHA 5DD0H 1H6TA 3MOBL 4FJ6A 1CQKA 4TNFA 5HGDB 3DMMD 5BQDA 3RL2B 2QADB 5GSRA 2NMSA 3DROA 5I0DA 3VG9C 4F9LA 4HUVB 1MFNA 2XWJA 3H8NA 3CDZB 3LHPH 1X6NA 1QSED 1G6RL 5EWIH 3A67H 1DE4A 1DZ0A 4PHZA 1WFMA 4UMSA 3Q6FB 3VXRB 4LNVA 4TYUA 5KTEH 3TNMB 3V6FB 2ZP0T 1KV7A 2Z93A 5IB4A 1UENA 3WJJA 3LKNA 4W9CC 3NA9L 1FFPB 2YEVB 3EYQC 4N0YL 3HG2A 4AEHL 1Q8MA 4DP2X 3G7TA 4PREA 3MA7B 1KC5H 1NBQA 4M6AA 4U7KA 1KCRH 4PLKC 1I9JL 4N9OB 5J11B 1EVUA 4C4KO 4IM8A 2ERJB 3TT3H 4G7VH 4L8SC 2J25A 2YARA 1LNUA 1O5DT 2Q8BH 4OLWH 1DUZA 3T6QC 2P1YA 3VFPA 1TF4A 2EZ0D 4UM8A 3VRLE 2M83A 3THML 2JMRA 5GGSB 4YL9A 5B3JF 4A7SA 2BNQD 2WWMD 4N2MA 2Y3AA 4BQBA 3DXAB 3G5YB 4GAGL 3UZEC 4IRSA 3E8UH 3F7RA 3QIWA 2DLFH 3KPSE 2BNUB 3BDXA 1X4ZA 3MCKB 3QT2A 2A9MH 1J8HA 4RBPK 5EO9B 3FUIA 1NCOA 4YSSA 4JFQA 3DIFA 4TLKA 4HD9A 3HZVA 1OF2B 2YHGA 4NUJA 4RRPG 3AY4A 4MXWH 1HHJB 3BLBA 4N0CC 3CXDL 4XI5C 1XWVA 1NJ9B 1KTJA 1RSFA 1BQRA 3KXFB 4Z7WE 3HHSA 4TUJB 1XGYL 4P4KD 5T3XL 3ZDXE 3SZKC 4RFNC 3LKQA 2BNQA 3MCG1 5MENE 4N8CH 5J1AA 4NKDA 1I9RL 1WIOA 1A9EA 4MYPA 5GQBA 4ZYKA 1MIEL 3OHXB 2ZKMX 5F96H 3SE3C 1NMBH 3EO0B 3M8OL 1CFBA 1TQSA 1ZIBA 2Y36H 1F4YH 2YXWA 2ZKHL 3VDCA 2FEJA 2FSEB 1JZ3A 4OAWB 5C08B 4KKRA 5MEOB 2VWEC 2WWKT 4Y5VB 1G43A 3D51A 4HT1L 3QQ9D 3VFTA 4AH2B 5M7QA 3PWPE 2Q7YA 3HLAB 1GR7A 1S7QA 1QD0A 5C2BL 4JRLA 1U92B 1JGDA 1MWAA 2VR8A 2F7QA 3UGUA 5D4QA 1BX2B 4G6ML 2GJZA 1MVFA 2NY4C 1DN2A 5C9KA 3FB6A 3SQRA 2VW6A 2NRDA 4YXLH 5AWNH 1DBJL 1IEBA 1L0XA 1UADC 2F54E 3IJSB 5EO0B 5FF6B 2Z7YA 4KK8C 4QXTB 1K72A 3PAYA 3TV3L 1HXKA 1EHNA 4MX7B 3EJZD 4IOIB 5C8JA 5EBWA 2E9IA 2AV1B 3VH8A 2HPOA 1DHKA 3QCUL 1RD6A 2GG1A 1A7BA 2WP3O 2I5YH 4GO9A 1JNLL 1N5AA 1RZFL 1NLDL 2ARWA 2DOCA 4H4NA 4RQQB 5C0AB 2AP2A 2EDDA 5CWSB 4DKTA 3PWVB 3IMWA 2R8SH 3OJMB 2MPAH 4ZFOL 5A6LA 1E6OH 2WZ0A 5I16B 4XO9A 5EEUA 3IGUA 5D2NC 4OQTH 2HJKA 5JXAH 1XD1A 5F6HI 2NNAA 2X2UA 1RFDH 4NRZA 1YEHL 5TH2A 2QV4A 1RUKH 4K7PY 1VEPA 4U1MA 5C0CA 1ASQA 5BRZA 1UD6A 3T5WA 5DC4B 2WBJA 2P42B 3B9KA 1LO4L 5CILH 1NFIA 4IDLA 5I9QB 2KT6A 1URZA 1UFUA 4CMMA 4LRNL 2V2TB 1ZV2A 4X4ME 4B6ZA 4PRPB 4NQUA 2Q6WA 4PJDE 4UIKL 1DL7H 1MHEB 3QPXH 2VXUH 4PJ8C 1B0RB 1KB5L 1RHHA 3ETBF 1WIPA 2ATPB 2R2EA 3OXRB 5ESVA 5L6YH 4NRXA 1EEQA 1EUUA 2VDRL 3MJ7B 3WFHA 5FM8A 2VISA 2J20A 3VXQA 3CLEH 5HJGA 1EIBA 1RU9L 3ARFB 3FO0L 4S0SD 3IS1X 4P9HC 1HEJC 3WUZA 5GRJL 4KXAA 5DD6B 3MNMA 5T3ZE 1HXYB 3PUUA 1TVHA 3CVIH 4FFZH 2A1WH 4TOYH 2ICCA 3FB5B 1DBKL 1NLBL 5AYUL 5ANMA 2IAMA 5C0GA 3WCYA 2JI1A 5HYJA 3HAEH 2GJPA 3CDFA 1XGTB 2COVD 4L5FH 3P4OB 4KTYA 2HLFD 1U42A 4JO2H 1TIUA 2ICEC 4NYLA 1HJBC 2IO5A 3NFNA 2QKSA 3OLEA 2Z35B 2XXFA 3UBXA 2NDGA 3MRGB 4NCC2 2XZAL 4L05A 1LE9B 3NZ8B 5INCA 35C8H 4NPYA 3OD3A 8FABA 5F6IB 1HN1A 3QDHA 4HMDA 4RX4D 5E4OA 4ZXBB 1T66C 3T4AA 1N0LB 4LASL 5AVUB 4I4WB 4NO0B 4ELDA 5I71B 1MFBL 3MRBA 3TZVD 4M00A 5ID1A 2AABH 4RMQA 4JKLA 1JGEA 3IJHB 1GW6A 32C2A 2IQAB 3RIFF 5I1AA 3WSQH 1FNEA 2OMWB 3LRSA 1YNKL 1THCA 1TNNA 3TC9A 3MFGB 5BVJB 3ZDZE 5E7FA 3WD5L 2ZWSA 3FO1A 4KK9C 4DZBA 2AC0A 2IGLA 5EU3B 5I1IH 3NZSA 3V4PL 4M1CD 2DQDL 3VE0B 2HJFB 4TPRL 2UWEE 3MUHL 4YBLC 5EUOB 1BREA 1FN4B 1HZHH 3HE7B 3LS4L 1E2ZA 3TZVA 1GTFA 1IB5A 4IKKA 1THAA 1ITBB 1IV8A 1VJSA 2CRZA 4LVNB 1Z5HA 4WKXA 5C0ND 5SWZD 5HVHB 3SJVE 4KXZI 4PJ6A 4N68A 1F4HA 3WIFA 1T1ZA 5CLXA 4C4UA 4EUPG 4HOZA 4OGZA 1HSAB 4ZFFB 1KCUL 2A6KA 4N8VG 2GC7C 4JB9H 5AVZB 1OEZW 1R3IL 1T1XA 2XA8H 1EAQA 1F4WL 1M3IA 5DYOB 5C07A 4WIQA 3CH1B 4XNUL 2VE6A 4LP5A 4ODVL 4MB5A 2HVJA 1MHPL 1CFNA 3U0PB 4HWZB 3TO4C 5DHVB 1IKFL 5SX4H 1S9YB 1MFDH 3MZTA 3S6CA 1NUGA 4K8RD 5SWZA 4PWGA 4PJ5D 4Z8FH 2WXIA 4HS3B 2X4NB 4YC2B 1YEEH 2WXGA 3MBXH 4F9LC 3SKNB 1JWSB 1VZHA 1KJ3L 2C1PA 4O2CA 3LEXB 1GZQA 1MWAL 4WW2A 1Z3RA 4FYRA 5JO5A 3VYPA 3ZKND 1B6DA 5FGCE 1YEFL 3WJJC 1H0DB 1JVKA 5FWQA 4CSPA 4N90D 5CBEB 3IF1A 1O9VA 3WS3A 2B15A 4XMTA 3ATAA 3ZYZA 5PCYA 1GCYA 3FO2B 1YEJH 1H6FA 1KELL 4BXVA 1IGMH 5DLML 4Q4EA 5E51A 3RPIA 3HZYB 5KBKA 4I0PA 4TSCH 3U9PH 4ETYA 5DWPA 5LG6A 2JELL 3DMMC 4G8EB 1NC4D 2ADIB 4LBEA 4LEOA 1TR7A 3GBNH 4HG4J 3BFQG 4NNPH 1A66A 3ISYA 3UYRL 1T22A 4MNQE 4JE4B 1RZJH 4CVWA 1TQBC 4DETA 1YG9A 2DN7A 5KYWA 3HZMA 5FO9B 1FNLA 1FIGL 1N7ML 4ODSH 1P7BA 4HMCA 7FABH 2ZOUA 2W0FB 4NERA 3N85L 4IRSC 1IAMA 3QIWC 2FO4A 2V9TA 1F2QA 5F7UA 1GL4B 3DBSA 3TVMA 5IR1B 2DS4A 3FF7A 5FDWB 3RZCD 5GGTA 2BJMH 5JW4R 1CS6A 2VDQB 3MRIA 1AGBA 4U6VL 4ZMYA 4FKEA 4FA7B 4N85A 1SJXA 3AY4C 5SWQB 3DVNA 1FFNB 1U6AL 2Y3NA 2UXVA 3BVVA 2IAND 5AW1B 4MB1A 3A47A 4NKIL 4U6TA 7CGTA 5JHDE 1RIHH 1HE7A 5D72H 2FJFB 2A77L 5CD3B 3IN0A 2X3BA 2XTJB 2WWMC 1Q9OA 3W5NA 2AQPA 4X6CE 3W37A 1H15B 1GS7A 4MJHA 2BRRH 2FQFA 3U7WL 2AI0L 2BS9A 1E4XH 1GS6X 3EOYG 4N5ED 5F0PB 3VI3F 4AE1A 3FT9A 1PBYA 4HQQH 4AYDC 3U0WH 3U0TA 4UM9D 3O2DA 1EJOL 1DJGA 4LBAA 1SFDA 1CLYH 3ET9F 5CLTA 4XCFL 4CVZB 2IANA 4OU3A 3CIQA 4H40A 4DCQB 3CFKA 3VYOA 4TN9A 2HFGH 4Z7VB 2H0PA 5D71L 4P4KC 1JF5A 2C7UA 3ZMNA 4G2AA 4I8DA 2C3XA 4ABWA 4P05A 1Z9OA 3NFSL 1LO2L 1ND0B 1BGXL 3M07A 5F3FA 3UC0L 2MCAA 3FPXA 1G0YR 1BBJA 2ZSVB 4Z18A 3TGXA 4MRCA 3T2OA 12E8L 1PZ2A 3ASOB 3JWDH 1CDJA 3QDGE 5FUCC 4BH8A 1YZZA 3F00A 5DZPA 5AVYB 2ICES 4U05A 1KF9B 2ZX7A 3MV11 2WCSA 3U7YL 4UM9A 5DK3A 2RAMA 5DJZA 4OFYA 1L6ZA 3WNKA 3IU3A 1NFDB 5BS0D 3G08A 1KBPA 3QQ9C 2MWCA 4XVTH 5H94A 3RVVD 3KVQA 1OARL 1FL6B 2YAPA 3BP6B 2E27H 3PNWB 4TNWF 2YD0A 4MA3B 4PRBB 3SZ6A 5DMKB 3IDJA 1MIML 3CZKA 1JK9B 3TYFA 3MLVH 2LW3A 5L88L 5DUML 1BVZA 2YR3A 3FL7A 4JFWA 4R7VA 4B27A 4XMLH 1D6EB 2X2JA 3N50A 3C09B 1XF2A 2X1WL 2WB1A 1R47A 1XQ4A 2B16A 4FXKA 2ALWA 2MH4A 4L3EE 3OG4B 4GUPB 3HS9A 4X99A 5CINH 4R8WL 5BV7L 2FWOA 3L8QA 4FNLL 4RISH 1T0NB 4XPAL 4AJYV 4KU1A 3IDNA 1UD3A 1WBXB 2NY2C 5EZIL 5BS0A 3GO1H 2WBJC 4TQIA 3C5ZB 3B9KC 4CMHB 2X28A 4UQ2B 3NZHH 1KPVB 3LNGA 1ET8A 1FGVL 2NYKA 3KJ6L 5ESQA 4DVBB 4F9PA 3T8MA 3PY9A 2FQGA 2P7TB 4OB5L 1DYZA 3QWNA 4L1SA 1KN4H 3RWEA 3QP3A 5E99H 2X12A 3HS8A 3OX8A 2Q3AA 2F74B 4JN2B 4JZJB 2JIXD 1NCNA 2ZUQC 2EE0A 1TZOA 4GSQA 4OT1H 4H7VA 4Q6IA 1OAXH 5ACZA 1A3RL 1QFWL 1RVFL 1PZUB 4E5XB 5D7KE 4WHDA 1OAQH 2ZWKA 2KMWA 4A2LA 4XO4A 4LARL 2DL2A 4YHKH 2K7QA 4NZTH 4G80B 1ADQH 3NCCB 2ZCZA 5IQ7H 4J2XA 4G5ZH 1E5CA 4YFLF 3QHTC 1ORSB 2VN5A 4JDTL 3X3GL 4YBHA 3K71B 5D7HA 2YFNA 5JLZB 2V37A 2WGXA 2IAMC 2DRUA 1UXWB 4NKQB 1N2RA 4LLUA 1BAFL 1ETZB 3ZDWA 4XCCL 1RJCA 1J0KA 3CFCH 4JRXD 5IMKB 3DK2A 1MHCB 5IW1B 4YSOA 1KOAA 3EH5B 4X8JA 3VJ6B 5L4JA 1MCDA 1U8CA 5JHBA 1WA2X 1S9KC 3N55A 1W0WB 4KNUA 3QZPA 1C1EL 3RLSA 1XO8A 2WUCH 5JQIB 3ULUF 1N4XL 4QHKI 2E9GA 1D5RA 3G6JE 4PSRA 3S3BB 2OBGA 4LF3A 3NTCH 1FORH 4OTXL 3JTSA 3LAFA 3T4AC 5KS9B 4Y19A 2M1KA 3E0GA 3MUY1 5EF0A 2DQFB 5EEYA 5GRWA 1QUNB 4PAZA 2ZCKL 5BOPA 1SDDA 2NY5H 3BH4A 3UO1L 3J27A 4DOHB 1AIFA 1D7DA 4QHNB 1RK1A 2HLFC 4M61A 3X3FL 4BWUA 4PP1D 2OMXA 4WFGD 3HPJB 1IUZA 4ACPA 2I9LB 4RFOL 4M5TA 2G0LA 5IB5A 3VX1A 3ZDYE 5KWYC 2VW4A 2F9BT 3VWKA 2VZTA 4XBGA 5SV3A 4I3SL 2IGFH 1Q72L 4XP1H 4XR8C 3J8F7 5DUPL 3L3IB 5A2KH 3PJNA 1JZHA 3NSJA 1XFPA 3EGDA 3WO4C 1CBVL 4R7XA 3TZVC 2VDML 1TJHL 2ADFH 3C9NB 3GBEA 4PB9L 2F0CA 2WLKA 4JKPL 3O4LB 1NGYB 4KPHL 4RESB 3O6FB 5I18H 1AD0A 3C60D 4Y1AD 5IVZB 1XCWA 3LQMA 1ZA6B 1IC5H 4GB9A 2ITFA 2F15A 1M3JA 1LQBC 1RURL 3LPWA 1KLGB 4GT7A 1CG9B 3T6WA 5D96C 3AXLB 1GC1L 3LEYH 4OCYL 4PIRF 3LDBC 4P46D 4Z78A 1HH6B 2R1YB 4U6XA 3SOTA 3MLTA 3P3SA 3HNTL 1PW3A 4DPCX 2ZXDA 3CN0A 5JZ7C 1GGIH 5C0NC 3S7GA 4MVBC 3LNDA 4JPWL 1A7NL 1K8DA 5JQHC 1C08B 3NFPB 3W3BA 4JM4H 1NSNL 4N3UA 2ZQKA 4W1TA 3OJDA 5CU9A 4KKCD 3B43A 3F12B 4YEEA 1ZV9A 1KENH 2EXYC 3ZE1E 4EI6A 3IGAA 3K6NA 4M7ZB 5JPNB 1D7BA 2W38A 3PUCA 3BUQA 3RY6C 4HCRL 4G43B 4CA4A 4Y89A 1I3VA 3PWNB 3QULB 5LG1A 4HIIB 4HX1A 1M6UA 3W5MA 1W8EA 4G8GD 3F01A 5D1QE 4Y8DC 5FW6A 2CKBB 1OSZB 1IBDA 1N0XL 4R7DA 4I0PC 3PHSA 1J7VR 1Q0YL 2OMYB 2QQQA 3EO1B 5D70L 2AK4B 3PHAA 2IPTL 4F7CB 4UBDC 4XVSH 4XPHH 4K9JA 1IEHA 1SMAA 3GSXB 3D4ZA 3US0A 5HJ3B 3REWB 3V8CA 4MMXA 1PIFA 2R0WH 3NOIA 4YK4C 4EDXA 5D9SB 5JA8B 3QJHB 5A7BA 3GXFA 3OHMB 4ERSH 2VAAA 4D0CB 4KDVA 1JZEA 4HWNA 3T6XA 3GMRA 3GSRB 4HS8H 5FGBA 2DMHA 1HE8A 3LOWA 3UADA 1FDLL 1TPXB 1BVKA 4X0NA 3HN3A 4G8GA 2YD8A 3TVMC 1A1NB 1XGQA 5JNYB 4YGAB 4GQPH 4PTUB 4RA3A 1PD6A 1KIQB 3BMVA 3RI5F 4ENZA 1QQDA 4F7MB 2PYFA 1KXQE 2ZUWA 1IVTA 4B9PA 3MV8E 3A3YB 3JT0A 2XY2A 2J8OA 4JE0A 3DX7B 1A6WH 4DF9A 1P7QD 2FB4L 3O0RL 4RIRA 5E5MB 3O2VH 3IJYA 5LBSH 4PJHB 4N2NA 3WLBA 4Y2LA 1UYWH 2XFGB 4KO6A 4P5TB 4UAOC 1HWGB 1KJ2H 4Z3GA 3T9WA 1MFAL 3IN2A 1F3JB 1JUFB 3SY0B 3RZCC 3LN4A 2H2SD 1AXSB 1B2WL 3D69B 4RWYL 4UV7L 2QR0A 3HC0A 4G42A 3D34A 4OGQC 3V6ZB 4DP0X 1OGAD 4F7EB 2WKLA 1IIIA 4DERA 1FLRH 1U8IA 2Z7UA 2VMFA 3QPQD 3WFDH 4PU2A 2Q5BA 3IPFA 5DMGD 5HYQA 3UXFA 5B22A 5I6MA 2MNWA 1JV2B 4HGMA 5LGYA 4N0UE 3DECA 4K23L 4E9RA 5L9DH 2G3XA 4U1HB 3T77B 2XN9D 1BHGA 1P7QA 1E4WH 2AJUH 3LVTA 2IWEA 5D7LA 1JHLL 1FNSL 2UYLB 1ONQB 5FGRA 2ZKYA 3QA3B 5JXEA 1Y6NR 4J3XA 4I3RL 1UB5A 4ZFZA 4YZFF 4IQHA 3PQYA 1DQJB 4AIZB 25C8L 4A6YH 2YPVL 4HK3J 5L2KE 1OHZA 3E38A 3M86A 5SWSE 4L4VB 1PZSA 2XZCH 3CC1A 3PGDB 4PRHE 3ABKB 2OMZB 1C12B 4M9PA 3IK2A 3GBLA 1HDMB 1HHGB 2X4UA 2ZCHH 4BRJA 2CH8A 3BIAX 2YBRA 2DY2A 1MCBA 3C75A 1SGKA 1V05A 3VU2A 2NY6B 1KY7A 2G2PA 5F89A 5JORA 3O81A 4FXKC 1H3PH 2VZSA 3TN0D 2ITCA 5I5RA 3GSQA 4QOKA 1BEYH 3V52H 1SY6L 1K8IA 2IQ9L 4WHTB 3C8DA 5FO7B 3SY6A 5AALA 3V0DA 4BKLB 2Y1VA 4MAUH 2XIDA 1YNTA 3AU1A 4HBQA 4FLOA 2JI2A 4AYMC 2YPKA 1G9MC 1LO5A 3DV6B 3RVVC 5BMFL 1HKLL 1U8JB 3LSOB 3KGSA 4Z7VF 1BZ8A 3WU1A 3QGVA 4F9PC 1RH8A 1EMTL 2CHDA 3K72B 1J18A 3D4CA 4FQLL 4XC3H 4M43H 4N86A 3F7PC 3FUNA 1U8OB 2ZUVA 4QXUH 2VLJB 4E9XA 2FIKB 2WQSA 3L3GB 4FLSA 5CHNA 5ICXA 1QRNE 2DQIH 2CGZA 3GZPA 4OFPA 2XFXA 2WNGA 3FHQA 4HIPA 1KULA 3HG1E 2YXMA 4PUBH 4XCYB 2ENPA 3EAKA 4GAAA 4OD3L 3BZ5A 2PP7A 5I1LA 1NFDF 4Q6IC 3TFBA 4NHUB 2G3NA 4J39A 3SDYL 3MLRL 5D1XB 1OAYH 4JMXA 2FD6H 4I0CC 4Z7QB 2IPKB 5DGRA 1LK3L 4FQIH 5T1JA 5IHUH 1MHHB 1LLAA 1UT1A 2PMZA 1H8NA 5CJOL 3NSFA 1AY1H 3UJIL 4FFYA 4RMRA 3V6FA 5K9KB 5H35A 3ZHFA 4QHUA 3S96B 2VXQL 4IKNA 5E0QA 4H13C 4TRPH 5JW5B 5EZJB 2CDGB 4RRPA 1HJCA 2XWDA 1J05B 1KPUB 1NA8A 1DBBL 2XC8A 4IOFD 2R1WB 4JZNA 2FHCA 3VI3A 3LNIA 4K3JL 5L7XH 5DA0B 5EO1B 4UOZA 2WVVB 2CPCA 1WD9A 3UTPE 2WUBL 5C2UB 1NDGB 2JJSA 2X4SB 5L8JB 2H32A 4AK1A 5ABDE 1RQ5A 4G9FB 3MGOB 4FQ1L 1SN2A 3LH9A 3L4XA 3JBG7 3U25A 5GGSA 1UKQA 2LU7A 5FGSA 3RWDB 1AO7B 4X6EB 2PUQT 4WW1A 3SD2A 3SPIA 3MCLH 3G5YA 5D7IB 3RTQD 4UQBA 3MX0A 4C55A 3RE0A 5HXMA 3ATFA 4ZOCA 4ZUVA 4PGCB 3U4AA 1DQMH 4AY0A 4BSWB 1EFXA 1JZ7A 3FCGA 3ZYIA 2W0PA 3ILDA 2Z31B 1YYML 5GGVH 4DGWC 4L1DA 4ABQA 1WH0A 2WSDA 1PX3A 1BVNP 2GBUA 2P5WE 2XHNA 1WSST 4QRRD 1HYRC 5AZ2H 1CVSC 3KXFA 2WYTA 5CLYA 1AHMA 3IE4A 3VWKC 1EK3A 2WLNA 4E9VA 5JTWA 2CCLA 1O6SB 2R4RL 4XNMB 4POZD 1JWUB 2EYSA 2IFGA 3T0XA 3UZVA 4LCCA 4XB8A 1X5FA 2QSQA 5FA4B 5CSGA 3ZR6A 1QBBA 3H7LA 3GEWB 1H3VA 3M17A 5DRNA 4YSAA 2OP4L 4Y2DD 1TQUA 5HGHB 1HQRA 5HP5A 4XWOD 5EF3A 5KVGE 3V4LA 3KMDA 1TMQA 5DJYA 2BC4A 1HEZB 3H3BC 1NIAA 2YUWA 2I7OA 1MCLA 4PH8A 3WMSA 1U92A 1EV2E 3VRJB 3B2VL 4GXFA 1L6XA 2EYTA 2JJTA 4YSRA 5FYKU 2HFFB 2WXFA 2GQHA 1PX8A 2E7MA 5DWUL 4AYBA 3QUZD 4GP4B 4O2FB 5AW6B 5HJDA 4XE5B 2JIXB 3VTAA 4FEMA 4MMYB 4TTDD 3UTSD 2XBTA 1BLNA 1G6RH 3QZNA 4L3CA 3BRDA 1FAKT 1RLBA 1G1KA 4AMWA 3LIZA 2F53B 4Y2DA 4B97A 1OK8A 1NOLA 3ZRFC 2K8QA 4PJ7A 2FWSA 3FCSB 2PWEA 1IGJB 2EDWA 5I82A 1UVQB 3CSGA 3JXAA 5AW5B 5KVGL 4IOIA 5DS8A 1HOCB 2AV1A 1Z32X 4XVUD 1I9JH 3FHEA 4ADIA 4F2FA 4I48B 3E2HC 5HDRA 3MJGX 4OSUH 3GSUB 4R4FL 5CUSL 1KZYA 1HSBB 4XX5A 5CWSA 4AV4A 5HVFB 3PWVA 5G4MA 1J1XH 3VI4E 3F83A 1H3GA 4QEGA 1S46A 1ANUA 2F68X 2X89D 5DEGA 1E7VA 2B20A 2VDKL 2EXSA 4NO2A 3C08L 4JRXB 4LPTA 4GAGH 1WBZA 2W92A 5JPMC 2UZYB 2YMXL 4FGMA 4OJCA 1MJ8L 4MMXC 3D4GA 4PRAA 4IIZA 1A4AA 2JJUA 3QHFL 4P99A 5E00B 1OT1A 3TYGL 1B4TA 1J48A 3DRQA 4NAQA 5FGBC 3W57A 2V2TA 1QR1B 3OR7B 2Y1AA 3CXDH 4U1IA 3VXNA 3O2WL 3IFPB 4TLTA 1PAZA 2V5YA 3EO9H 3JTTA 2FZ3A 3TH3T 1XGYH 2AV7A 5T3XH 1CF1A 4WY7H 4LGRB 2X89A 2B2XL 1ZTXL 1SNRA 4ODWB 1LGVA 4BH7B 5LVEA 5D4HA 1I9RH 4WNJA 3NPSC 2UXFA 1MIEH 3SKMA 1XZWA 3I2CL 1U2HA 5I0ZA 1S78D 1AZBA 1NC2B 1EBPA 1FF5A 1VSCA 2P8PB 3LV3A 2NYYD 1DQDL 3VGEA 4CW1B 5FO8A 2YUVA 5HYSG 3OB0H 4IRJD 1A1OA 1Q0EA 3CNKA 5AG9A 3B3BA 4HT1H 4PGJA 1KBVA 1HXYA 3OL2A 2CRMA 5E8OB 5C2BH 2NNCA 3B8SA 1YEWA 4P9HH 3KVDD 4G6MH 4RVBA 3TF4A 1Q90A 3R0NA 1U2CA 3P4OA 3C60B 4Y1AB 2LTQC 5MI0C 1GXEA 4PJAF 1RUQL 2CNYA 5I23A 3EG9B 1C7SA 4JREC 5T1MB 3DXAE 1PNDA 3TV3H 1CXIA 1UT9A 3NZ8A 5JXEC 3QDJD 4QRSA 1QVOA 2NXZD 3P77B 4MXVE 4P46B 3FT1A 4G8IA 2H2SC 4KNSA 4LKXB 1BG9A 4B3EA 3RG1C 3ESOA 5CR1A 3QCUH 4IJ3C 1LE5B 3W81A 1YEGH 1JAEA 3NRPA 4EUPA 1GZPB 1NGWB 1LDPL 3PNRB 1JNLH 1RZFH 3GSOA 1NLDH 3QPQC 4N8VA 3DSNB 4IK6A 1ZANL 3KBEA 5DMGC 2PTTB 3K0YA 2OMUB 5BVJA 1YEHH 4KBPA 3FTGA 4OCXL