4AVMA

Crystal structure of the n-bar domain of human bridging integrator 2.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
230
structure length
230
Chain Sequence
KQVQKKFSRAQEKVLQKLGKAVETKDERFEQSASNFYQQQAEGHKLYKDLKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHEELKAIVWNNDLLWEDYEEKLADQAVRTMEIYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKAQTVFEDLNQELLEELPILYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKLERQHSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BRIDGING INTEGRATOR 2
publication title Crystal Structure of the N-Bar Domain of Human Bridging Integrator 2.
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 110
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2012-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 4avmA00
4DYLA 1X03A 2Q13A 2X3VA 2D1LA 2ELBA 3G9GA 2RAKA 1URUA 2EFLA 1X04A 3QNIA 4WPCA 2Z0VA 1I4TA 3DYTA 3SOGA 3PLTA 4WPEA 4FZSA 3QWEA 3HAJA 3QE6A 4AVMA 1I4LA 2EFKA 2FICA 2V0OA 1WDZA 3Q84A 4I1QA 4NSWA 2Z0OA 2YKTA 4AKVA 2RAJA 2X3XA 3M3WA 3HAHA 4H8SA 3I2WA 3OK8A 1ZWWA 4NQIA 2C08A 1Y2OA 1I4DA 3Q0KA 3HAIA 3ABHA 5C5BB 1I49A 5C5BA 2Q12A 4ATMA 2Z0NA 3CAZA 4BNEA 3LLLA 2D4CA 3SYVA 3ACOA 2X3WA 4DCNC 2RAIA
chains in the Genus database with same CATH superfamily
4G6QA 4JL9A 2ELBA 4R5KA 4E3CA 2OW6A 3F7WA 1DKYA 1QWNA 3ER8C 4JWIA 3T47A 1GNTA 4B9QA 1HTYA 2LXYA 3HAJA 4AZCA 3DX4A 3DX2A 2LM0A 2KHOA 2X3XA 3LVTA 3L3OM 4JLCA 2F18A 3KAVA 2Z8YA 1DKZA 4HY9A 2YI8A 2YIVX 1PS3A 4EZYA 3EJRA 5KBPA 3DPQA 2YL9A 1R34A 3HAIA 3ABHA 3VKHA 4JWEA 3OWGA 3DPPA 4UDYX 2YLLA 3GI7A 1O7DB 4FZSA 1E1DA 3T46A 4FM3A 3BVTA 3DX1A 3BVUA 5FLEX 4H8SA 4AZ7A 3I04A 2C08A 3O3MB 4R5IA 4EZUA 2F1AA 2RAIA 2F7QA 1URUA 1SUFA 2ALWA 4WPCA 2WYIA 3DX3A 4WPEA 2O0I1 3C7NA 3RPMA 3O3OB 3DDFA 2YKTA 3RV1A 4EZVA 3L3PA 1QX1A 1I4DA 5C5BA 4BNEA 2OBMA 1SU8A 4EZZA 4KIKA 2X3VA 2ND0A 2NCZA 1E9VA 4FZOA 3BUPA 3ERCC 1GN9A 4FZPA 1I49A 3BVVA 1OAOA 4DCNC 1W9MA 2QXLA 2YL5A 4HR1A 2GAFD 3QE6A 3B51X 1UPXA 2EFKA 2OBLA 3VEAA 3D4ZA 1TQSA 4D8JA 2F1BA 1HXKA 2OW7A 2ZXQA 3ACOA 4M0MA 4AVMA 1QWUA 5FIGA 4NSWA 2Z0OA 5TKYA 2OO2A 3I2WA 3Q0KA 2YIAA 4F00A 4EZNA 1HWWA 3QNIA 2FICA 4EZWA 1ZYLA 4F01A 2YLAA 4AZHA 3BVWA 3CZNA 4AZIA 3HAHA 3D4YA 4R5GA 1OA0A 1E2UA 4NPHA 3SYVA 2YL6A 4E81A 3EJUA 1X04A 4EZTA 1I4TA 4R5LA 3PLTA 1TQTA 3I39X 4AZ6A 1SU6A 3M3WA 3OHXM 2YI9A 4AZ5A 4IM3A 2YL8A 2F7PA 3CAZA 3BUQA 2D4CA 4EZQA 1X03A 2Q13A 4H6HA 2YIBA 2F7OA 4EZOA 4HR1B 3D51A 2Z0VA 3T4AG 2FYVA 4AZCB 1MJGA 3T49A 2JNKA 3CZSA 2MI7A 1DKXA 3KAWA 4ATMA 4JNFA 2X5CA 4JWCA 3O3NB 4EZXA 1JQKA 3B52X 3QWEA 3UITA 4IWPA 1WDZA 1R33A 2F7RA 3A98A 4AKVA 2QFFA 2WYHA 3QNJA 3OK8A 4NQIA 3VEBA 4EZPA 3KDRA 4PO2A 3CVRA 4IM0A 2D1LA 1GNLA 3D2EA 1TQVA 1YWMA 2QKWA 3BLBA 4IM2A 3BUDA 4JN4A 1O7DC 3D2FA 3FD9A 5E84A 3DDGA 1LQ7A 2RAJA 1TQWA 3EJTA 2GF4A 3BUBA 2WINM 2EFLA 2V0OA 3DX0A 3QA8A 2PY6A 4AZGA 5C5BB 4UDXX 2Q12A 1OA1A 2Z0NA 4KIKB 4R5JA 2OZNB 2JNSA 3T48A 3DYTA 2ND1A 4AZBA 3I01A 4I1QA 4HYBA 4IWQA 2RT6A 3EJSA 3CKDA 4DYLA 1SU7A 4JWDA 4IW0A 4JNEA 2EX3B 2N3KA 3ZEDA 2EWFA 1TQUA 1ZWWA 4H6IA 3LMFA 3B53X 3CV5A 2X3WA 1U00A 4EZSA 3D50A 3BVXA 3G9GA 2RAKA 3D52A 3SOGA 3EJQA 1R5EA 2GA9D 1I4LA 3DPOA 3Q84A 4EZRA 3ER9B 3EJPA 3BUIA 1Y2OA 2PMRA 4IWOA 3LLLA 3RV0A
chains in the Genus database with same CATH topology
4DYLA 1X03A 2Q13A 2X3VA 2D1LA 2ELBA 3G9GA 2RAKA 1URUA 2EFLA 1X04A 3QNIA 4WPCA 2Z0VA 1I4TA 3DYTA 3SOGA 3PLTA 4WPEA 4FZSA 3QWEA 3HAJA 3QE6A 4AVMA 1I4LA 2EFKA 2FICA 2V0OA 1WDZA 3Q84A 4I1QA 4NSWA 2Z0OA 2YKTA 4AKVA 2RAJA 2X3XA 3M3WA 3HAHA 4H8SA 3I2WA 3OK8A 1ZWWA 4NQIA 2C08A 1Y2OA 1I4DA 3Q0KA 3HAIA 3ABHA 5C5BB 1I49A 5C5BA 2Q12A 4ATMA 2Z0NA 3CAZA 4BNEA 3LLLA 2D4CA 3SYVA 3ACOA 2X3WA 4DCNC 2RAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DYL A;  1X03 A;  2Q13 A;  2X3V A;  2D1L A;  2ELB A;  3G9G A;  2RAK A;  1URU A;  2EFL A;  1X04 A;  3QNI A;  4WPC A;  2Z0V A;  1I4T A;  3DYT A;  3SOG A;  3PLT A;  4WPE A;  4FZS A;  3QWE A;  3HAJ A;  3QE6 A;  4AVM A;  1I4L A;  2EFK A;  2FIC A;  2V0O A;  1WDZ A;  3Q84 A;  4I1Q A;  4NSW A;  2Z0O A;  2YKT A;  4AKV A;  2RAJ A;  2X3X A;  3M3W A;  3HAH A;  4H8S A;  3I2W A;  3OK8 A;  1ZWW A;  4NQI A;  2C08 A;  1Y2O A;  1I4D A;  3Q0K A;  3HAI A;  3ABH A;  5C5B B;  1I49 A;  5C5B A;  2Q12 A;  4ATM A;  2Z0N A;  3CAZ A;  4BNE A;  3LLL A;  2D4C A;  3SYV A;  3ACO A;  2X3W A;  4DCN C;  2RAI A; 
#chains in the Genus database with same CATH topology
 4G6Q A;  4JL9 A;  2ELB A;  4R5K A;  4E3C A;  2OW6 A;  3F7W A;  1DKY A;  1QWN A;  3ER8 C;  4JWI A;  3T47 A;  1GNT A;  4B9Q A;  1HTY A;  2LXY A;  3HAJ A;  4AZC A;  3DX4 A;  3DX2 A;  2LM0 A;  2KHO A;  2X3X A;  3LVT A;  3L3O M;  4JLC A;  2F18 A;  3KAV A;  2Z8Y A;  1DKZ A;  4HY9 A;  2YI8 A;  2YIV X;  1PS3 A;  4EZY A;  3EJR A;  5KBP A;  3DPQ A;  2YL9 A;  1R34 A;  3HAI A;  3ABH A;  3VKH A;  4JWE A;  3OWG A;  3DPP A;  4UDY X;  2YLL A;  3GI7 A;  1O7D B;  4FZS A;  1E1D A;  3T46 A;  4FM3 A;  3BVT A;  3DX1 A;  3BVU A;  5FLE X;  4H8S A;  4AZ7 A;  3I04 A;  2C08 A;  3O3M B;  4R5I A;  4EZU A;  2F1A A;  2RAI A;  2F7Q A;  1URU A;  1SUF A;  2ALW A;  4WPC A;  2WYI A;  3DX3 A;  4WPE A;  2O0I 1;  3C7N A;  3RPM A;  3O3O B;  3DDF A;  2YKT A;  3RV1 A;  4EZV A;  3L3P A;  1QX1 A;  1I4D A;  5C5B A;  4BNE A;  2OBM A;  1SU8 A;  4EZZ A;  4KIK A;  2X3V A;  2ND0 A;  2NCZ A;  1E9V A;  4FZO A;  3BUP A;  3ERC C;  1GN9 A;  4FZP A;  1I49 A;  3BVV A;  1OAO A;  4DCN C;  1W9M A;  2QXL A;  2YL5 A;  4HR1 A;  2GAF D;  3QE6 A;  3B51 X;  1UPX A;  2EFK A;  2OBL A;  3VEA A;  3D4Z A;  1TQS A;  4D8J A;  2F1B A;  1HXK A;  2OW7 A;  2ZXQ A;  3ACO A;  4M0M A;  4AVM A;  1QWU A;  5FIG A;  4NSW A;  2Z0O A;  5TKY A;  2OO2 A;  3I2W A;  3Q0K A;  2YIA A;  4F00 A;  4EZN A;  1HWW A;  3QNI A;  2FIC A;  4EZW A;  1ZYL A;  4F01 A;  2YLA A;  4AZH A;  3BVW A;  3CZN A;  4AZI A;  3HAH A;  3D4Y A;  4R5G A;  1OA0 A;  1E2U A;  4NPH A;  3SYV A;  2YL6 A;  4E81 A;  3EJU A;  1X04 A;  4EZT A;  1I4T A;  4R5L A;  3PLT A;  1TQT A;  3I39 X;  4AZ6 A;  1SU6 A;  3M3W A;  3OHX M;  2YI9 A;  4AZ5 A;  4IM3 A;  2YL8 A;  2F7P A;  3CAZ A;  3BUQ A;  2D4C A;  4EZQ A;  1X03 A;  2Q13 A;  4H6H A;  2YIB A;  2F7O A;  4EZO A;  4HR1 B;  3D51 A;  2Z0V A;  3T4A G;  2FYV A;  4AZC B;  1MJG A;  3T49 A;  2JNK A;  3CZS A;  2MI7 A;  1DKX A;  3KAW A;  4ATM A;  4JNF A;  2X5C A;  4JWC A;  3O3N B;  4EZX A;  1JQK A;  3B52 X;  3QWE A;  3UIT A;  4IWP A;  1WDZ A;  1R33 A;  2F7R A;  3A98 A;  4AKV A;  2QFF A;  2WYH A;  3QNJ A;  3OK8 A;  4NQI A;  3VEB A;  4EZP A;  3KDR A;  4PO2 A;  3CVR A;  4IM0 A;  2D1L A;  1GNL A;  3D2E A;  1TQV A;  1YWM A;  2QKW A;  3BLB A;  4IM2 A;  3BUD A;  4JN4 A;  1O7D C;  3D2F A;  3FD9 A;  5E84 A;  3DDG A;  1LQ7 A;  2RAJ A;  1TQW A;  3EJT A;  2GF4 A;  3BUB A;  2WIN M;  2EFL A;  2V0O A;  3DX0 A;  3QA8 A;  2PY6 A;  4AZG A;  5C5B B;  4UDX X;  2Q12 A;  1OA1 A;  2Z0N A;  4KIK B;  4R5J A;  2OZN B;  2JNS A;  3T48 A;  3DYT A;  2ND1 A;  4AZB A;  3I01 A;  4I1Q A;  4HYB A;  4IWQ A;  2RT6 A;  3EJS A;  3CKD A;  4DYL A;  1SU7 A;  4JWD A;  4IW0 A;  4JNE A;  2EX3 B;  2N3K A;  3ZED A;  2EWF A;  1TQU A;  1ZWW A;  4H6I A;  3LMF A;  3B53 X;  3CV5 A;  2X3W A;  1U00 A;  4EZS A;  3D50 A;  3BVX A;  3G9G A;  2RAK A;  3D52 A;  3SOG A;  3EJQ A;  1R5E A;  2GA9 D;  1I4L A;  3DPO A;  3Q84 A;  4EZR A;  3ER9 B;  3EJP A;  3BUI A;  1Y2O A;  2PMR A;  4IWO A;  3LLL A;  3RV0 A; 
#chains in the Genus database with same CATH homology
 4DYL A;  1X03 A;  2Q13 A;  2X3V A;  2D1L A;  2ELB A;  3G9G A;  2RAK A;  1URU A;  2EFL A;  1X04 A;  3QNI A;  4WPC A;  2Z0V A;  1I4T A;  3DYT A;  3SOG A;  3PLT A;  4WPE A;  4FZS A;  3QWE A;  3HAJ A;  3QE6 A;  4AVM A;  1I4L A;  2EFK A;  2FIC A;  2V0O A;  1WDZ A;  3Q84 A;  4I1Q A;  4NSW A;  2Z0O A;  2YKT A;  4AKV A;  2RAJ A;  2X3X A;  3M3W A;  3HAH A;  4H8S A;  3I2W A;  3OK8 A;  1ZWW A;  4NQI A;  2C08 A;  1Y2O A;  1I4D A;  3Q0K A;  3HAI A;  3ABH A;  5C5B B;  1I49 A;  5C5B A;  2Q12 A;  4ATM A;  2Z0N A;  3CAZ A;  4BNE A;  3LLL A;  2D4C A;  3SYV A;  3ACO A;  2X3W A;  4DCN C;  2RAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...