4AVMA

Crystal structure of the n-bar domain of human bridging integrator 2.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
230
structure length
230
Chain Sequence
KQVQKKFSRAQEKVLQKLGKAVETKDERFEQSASNFYQQQAEGHKLYKDLKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHEELKAIVWNNDLLWEDYEEKLADQAVRTMEIYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKAQTVFEDLNQELLEELPILYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKLERQHSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BRIDGING INTEGRATOR 2
publication title Crystal Structure of the N-Bar Domain of Human Bridging Integrator 2.
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 110
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2012-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 4avmA00
2X3XA 4AKVA 3OK8A 3Q0KA 4NQIA 1WDZA 2D4CA 2Z0VA 3HAJA 4DCNC 2Q12A 2Z0OA 4AVMA 2ELBA 2RAKA 3DYTA 1ZWWA 2V0OA 4FZSA 4ATMA 2Q13A 4DYLA 2EFLA 3ABHA 4H8SA 1I4TA 3I2WA 3LLLA 1I4DA 4BNEA 5C5BA 3SOGA 3HAHA 4NSWA 4WPCA 3G9GA 1X04A 2RAJA 2X3VA 3QE6A 2RAIA 1URUA 3ACOA 5C5BB 3Q84A 2Z0NA 4WPEA 3QWEA 2X3WA 2D1LA 2EFKA 3CAZA 2C08A 1I4LA 3PLTA 4I1QA 2FICA 2YKTA 3HAIA 1X03A 3SYVA 3QNIA 1I49A 1Y2OA 3M3WA
chains in the Genus database with same CATH superfamily
2D4CA 2ND0A 1GNTA 4IWOA 1R34A 3DX2A 3DX4A 3DDGA 3DX0A 3Q84A 4JWEA 4UDYX 4IWQA 2OW6A 2C08A 3SYVA 1I49A 1Y2OA 4EZPA 2YL5A 2Z0VA 2WINM 4AZBA 2YI8A 1X04A 3BUDA 2YLAA 2EFKA 3PLTA 4E3CA 2YKTA 4JWIA 1U00A 2MI7A 2YLLA 3BVXA 3M3WA 3BUQA 4R5JA 3HAJA 2Z0OA 1SU6A 4FZOA 3A98A 1O7DC 2QXLA 1OA0A 2PMRA 4AZIA 3I39X 1I4LA 2YL6A 3EJPA 1JQKA 4IM2A 4EZZA 4IW0A 1HWWA 1WDZA 1OA1A 3O3MB 4H8SA 3EJQA 4BNEA 2PY6A 4HY9A 2LXYA 3EJSA 1O7DB 1YWMA 3CV5A 4PO2A 3KAVA 4EZQA 5KBPA 1DKZA 5FIGA 4DCNC 4FZSA 3ER9B 2Q13A 4F01A 4JN4A 1DKYA 4EZYA 3I2WA 4EZOA 3BVTA 2WYIA 3ACOA 4EZNA 4JL9A 3L3OM 4AZ6A 4R5KA 3C7NA 3QNIA 3RPMA 1R5EA 4NQIA 2OZNB 4AVMA 2ELBA 3O3NB 1R33A 1TQSA 3LLLA 4NSWA 4R5GA 2N3KA 2F18A 5C5BB 2Z0NA 4KIKB 2JNKA 3T47A 1SUFA 2F1BA 4FM3A 3OK8A 3BUPA 2Q12A 1HXKA 1LQ7A 3ERCC 1W9MA 1DKXA 3BUBA 2RAJA 3RV1A 2GAFD 1URUA 3EJRA 4I1QA 3LVTA 1E2UA 4UDXX 3DPOA 1ZYLA 1ZWWA 3DDFA 3ABHA 3CZNA 3EJTA 2ZXQA 3B53X 4EZVA 3QA8A 2OBMA 3QWEA 2QKWA 2EX3B 1OAOA 4D8JA 2ALWA 2LM0A 2F1AA 2WYHA 3T46A 2KHOA 2JNSA 4F00A 1UPXA 2YL9A 3VEBA 3GI7A 3BLBA 3G9GA 3T49A 3D2EA 3QE6A 3BVWA 3EJUA 4M0MA 4R5IA 5FLEX 1E1DA 2X3XA 4E81A 3Q0KA 2F7QA 3DPPA 1TQUA 2RAKA 4AZ5A 3D52A 3CZSA 4HR1A 3SOGA 4IM3A 4EZSA 4WPCA 2F7RA 2RAIA 4HR1B 3DX3A 2Z8YA 3BVVA 2F7OA 3B51X 3HAIA 4DYLA 3BUIA 1TQWA 2YIBA 5C5BA 4KIKA 1GNLA 2RT6A 4JLCA 1TQTA 3FD9A 4R5LA 3VEAA 3I01A 4G6QA 2OO2A 1TQVA 3QNJA 4EZWA 3B52X 2V0OA 3T48A 2NCZA 1I4DA 1SU7A 3D2FA 2O0I1 3F7WA 2OBLA 2FICA 4EZUA 3ZEDA 2FYVA 2OW7A 2X5CA 4AKVA 3I04A 4AZCA 2GF4A 4JNEA 4HYBA 4AZCB 4IWPA 3D4YA 2X3WA 3D51A 3KDRA 4AZHA 4NPHA 3L3PA 1GN9A 1QWUA 3CVRA 4FZPA 3RV0A 4JNFA 4IM0A 2YIVX 2EFLA 3VKHA 1I4TA 1PS3A 3D50A 4JWCA 4WPEA 5TKYA 2GA9D 3O3OB 2ND1A 4B9QA 3ER8C 4H6IA 3DPQA 3OHXM 4EZXA 4ATMA 5E84A 2YI9A 3BVUA 4EZTA 4AZ7A 2YL8A 4EZRA 1HTYA 4H6HA 3T4AG 2D1LA 1MJGA 3D4ZA 1QX1A 2QFFA 3DYTA 2F7PA 4JWDA 1SU8A 4AZGA 3HAHA 2YIAA 1E9VA 2X3VA 3UITA 3CKDA 3DX1A 3KAWA 3CAZA 3OWGA 2EWFA 3LMFA 1X03A 1QWNA
chains in the Genus database with same CATH topology
2X3XA 4AKVA 3OK8A 3Q0KA 4NQIA 1WDZA 2D4CA 2Z0VA 3HAJA 4DCNC 2Q12A 2Z0OA 4AVMA 2ELBA 2RAKA 3DYTA 1ZWWA 2V0OA 4FZSA 4ATMA 2Q13A 4DYLA 2EFLA 3ABHA 4H8SA 1I4TA 3I2WA 3LLLA 1I4DA 4BNEA 5C5BA 3SOGA 3HAHA 4NSWA 4WPCA 3G9GA 1X04A 2RAJA 2X3VA 3QE6A 2RAIA 1URUA 3ACOA 5C5BB 3Q84A 2Z0NA 4WPEA 3QWEA 2X3WA 2D1LA 2EFKA 3CAZA 2C08A 1I4LA 3PLTA 4I1QA 2FICA 2YKTA 3HAIA 1X03A 3SYVA 3QNIA 1I49A 1Y2OA 3M3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3X A;  4AKV A;  3OK8 A;  3Q0K A;  4NQI A;  1WDZ A;  2D4C A;  2Z0V A;  3HAJ A;  4DCN C;  2Q12 A;  2Z0O A;  4AVM A;  2ELB A;  2RAK A;  3DYT A;  1ZWW A;  2V0O A;  4FZS A;  4ATM A;  2Q13 A;  4DYL A;  2EFL A;  3ABH A;  4H8S A;  1I4T A;  3I2W A;  3LLL A;  1I4D A;  4BNE A;  5C5B A;  3SOG A;  3HAH A;  4NSW A;  4WPC A;  3G9G A;  1X04 A;  2RAJ A;  2X3V A;  3QE6 A;  2RAI A;  1URU A;  3ACO A;  5C5B B;  3Q84 A;  2Z0N A;  4WPE A;  3QWE A;  2X3W A;  2D1L A;  2EFK A;  3CAZ A;  2C08 A;  1I4L A;  3PLT A;  4I1Q A;  2FIC A;  2YKT A;  3HAI A;  1X03 A;  3SYV A;  3QNI A;  1I49 A;  1Y2O A;  3M3W A; 
#chains in the Genus database with same CATH topology
 2D4C A;  2ND0 A;  1GNT A;  4IWO A;  1R34 A;  3DX2 A;  3DX4 A;  3DDG A;  3DX0 A;  3Q84 A;  4JWE A;  4UDY X;  4IWQ A;  2OW6 A;  2C08 A;  3SYV A;  1I49 A;  1Y2O A;  4EZP A;  2YL5 A;  2Z0V A;  2WIN M;  4AZB A;  2YI8 A;  1X04 A;  3BUD A;  2YLA A;  2EFK A;  3PLT A;  4E3C A;  2YKT A;  4JWI A;  1U00 A;  2MI7 A;  2YLL A;  3BVX A;  3M3W A;  3BUQ A;  4R5J A;  3HAJ A;  2Z0O A;  1SU6 A;  4FZO A;  3A98 A;  1O7D C;  2QXL A;  1OA0 A;  2PMR A;  4AZI A;  3I39 X;  1I4L A;  2YL6 A;  3EJP A;  1JQK A;  4IM2 A;  4EZZ A;  4IW0 A;  1HWW A;  1WDZ A;  1OA1 A;  3O3M B;  4H8S A;  3EJQ A;  4BNE A;  2PY6 A;  4HY9 A;  2LXY A;  3EJS A;  1O7D B;  1YWM A;  3CV5 A;  4PO2 A;  3KAV A;  4EZQ A;  5KBP A;  1DKZ A;  5FIG A;  4DCN C;  4FZS A;  3ER9 B;  2Q13 A;  4F01 A;  4JN4 A;  1DKY A;  4EZY A;  3I2W A;  4EZO A;  3BVT A;  2WYI A;  3ACO A;  4EZN A;  4JL9 A;  3L3O M;  4AZ6 A;  4R5K A;  3C7N A;  3QNI A;  3RPM A;  1R5E A;  4NQI A;  2OZN B;  4AVM A;  2ELB A;  3O3N B;  1R33 A;  1TQS A;  3LLL A;  4NSW A;  4R5G A;  2N3K A;  2F18 A;  5C5B B;  2Z0N A;  4KIK B;  2JNK A;  3T47 A;  1SUF A;  2F1B A;  4FM3 A;  3OK8 A;  3BUP A;  2Q12 A;  1HXK A;  1LQ7 A;  3ERC C;  1W9M A;  1DKX A;  3BUB A;  2RAJ A;  3RV1 A;  2GAF D;  1URU A;  3EJR A;  4I1Q A;  3LVT A;  1E2U A;  4UDX X;  3DPO A;  1ZYL A;  1ZWW A;  3DDF A;  3ABH A;  3CZN A;  3EJT A;  2ZXQ A;  3B53 X;  4EZV A;  3QA8 A;  2OBM A;  3QWE A;  2QKW A;  2EX3 B;  1OAO A;  4D8J A;  2ALW A;  2LM0 A;  2F1A A;  2WYH A;  3T46 A;  2KHO A;  2JNS A;  4F00 A;  1UPX A;  2YL9 A;  3VEB A;  3GI7 A;  3BLB A;  3G9G A;  3T49 A;  3D2E A;  3QE6 A;  3BVW A;  3EJU A;  4M0M A;  4R5I A;  5FLE X;  1E1D A;  2X3X A;  4E81 A;  3Q0K A;  2F7Q A;  3DPP A;  1TQU A;  2RAK A;  4AZ5 A;  3D52 A;  3CZS A;  4HR1 A;  3SOG A;  4IM3 A;  4EZS A;  4WPC A;  2F7R A;  2RAI A;  4HR1 B;  3DX3 A;  2Z8Y A;  3BVV A;  2F7O A;  3B51 X;  3HAI A;  4DYL A;  3BUI A;  1TQW A;  2YIB A;  5C5B A;  4KIK A;  1GNL A;  2RT6 A;  4JLC A;  1TQT A;  3FD9 A;  4R5L A;  3VEA A;  3I01 A;  4G6Q A;  2OO2 A;  1TQV A;  3QNJ A;  4EZW A;  3B52 X;  2V0O A;  3T48 A;  2NCZ A;  1I4D A;  1SU7 A;  3D2F A;  2O0I 1;  3F7W A;  2OBL A;  2FIC A;  4EZU A;  3ZED A;  2FYV A;  2OW7 A;  2X5C A;  4AKV A;  3I04 A;  4AZC A;  2GF4 A;  4JNE A;  4HYB A;  4AZC B;  4IWP A;  3D4Y A;  2X3W A;  3D51 A;  3KDR A;  4AZH A;  4NPH A;  3L3P A;  1GN9 A;  1QWU A;  3CVR A;  4FZP A;  3RV0 A;  4JNF A;  4IM0 A;  2YIV X;  2EFL A;  3VKH A;  1I4T A;  1PS3 A;  3D50 A;  4JWC A;  4WPE A;  5TKY A;  2GA9 D;  3O3O B;  2ND1 A;  4B9Q A;  3ER8 C;  4H6I A;  3DPQ A;  3OHX M;  4EZX A;  4ATM A;  5E84 A;  2YI9 A;  3BVU A;  4EZT A;  4AZ7 A;  2YL8 A;  4EZR A;  1HTY A;  4H6H A;  3T4A G;  2D1L A;  1MJG A;  3D4Z A;  1QX1 A;  2QFF A;  3DYT A;  2F7P A;  4JWD A;  1SU8 A;  4AZG A;  3HAH A;  2YIA A;  1E9V A;  2X3V A;  3UIT A;  3CKD A;  3DX1 A;  3KAW A;  3CAZ A;  3OWG A;  2EWF A;  3LMF A;  1X03 A;  1QWN A; 
#chains in the Genus database with same CATH homology
 2X3X A;  4AKV A;  3OK8 A;  3Q0K A;  4NQI A;  1WDZ A;  2D4C A;  2Z0V A;  3HAJ A;  4DCN C;  2Q12 A;  2Z0O A;  4AVM A;  2ELB A;  2RAK A;  3DYT A;  1ZWW A;  2V0O A;  4FZS A;  4ATM A;  2Q13 A;  4DYL A;  2EFL A;  3ABH A;  4H8S A;  1I4T A;  3I2W A;  3LLL A;  1I4D A;  4BNE A;  5C5B A;  3SOG A;  3HAH A;  4NSW A;  4WPC A;  3G9G A;  1X04 A;  2RAJ A;  2X3V A;  3QE6 A;  2RAI A;  1URU A;  3ACO A;  5C5B B;  3Q84 A;  2Z0N A;  4WPE A;  3QWE A;  2X3W A;  2D1L A;  2EFK A;  3CAZ A;  2C08 A;  1I4L A;  3PLT A;  4I1Q A;  2FIC A;  2YKT A;  3HAI A;  1X03 A;  3SYV A;  3QNI A;  1I49 A;  1Y2O A;  3M3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...