4AVOA

Thermobifida fusca cellobiohydrolase cel6b catalytic mutant d274a cocrystallized with cellobiose
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
420
structure length
420
Chain Sequence
EKVDNPFEGAKLYVNPVWSAKAAAEPGGSAVANESTAVWLDRIGAIEGNDSPTTGSMGLRDHLEEAVRQSGGDPLTIQVVIYNLPGRDCAALASNGELGPDELDRYKSEYIDPIADIMWDFADYENLRIVAIIEIASLPNLVTNVGGNGGTELCAYMKQNGGYVNGVGYALRKLGEIPNVYNYIDAAHHGWIGWDSNFGPSVDIFYEAANASGSTVDYVHGFISNTANYSATVEPYLDVNGTVNGQLIRQSKWVDWNQYVDELSFVQDLRQALIAKGFRSDIGMLIDTSRNGWGGPNRPTGPSSSTDLNTYVDESRIDRRIHPGNWCNQAGAGLGERPTVNPAPGVDAYVWVKPPGESDGASEEIPNDEGKGFDRMCDPTYQGNARNGNNPSGALPNAPISGHWFSAQFRELLANAYPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Loop Motions Important to Product Expulsion in the Thermobifida Fusca Glycoside Hydrolase Family 6 Cellobiohydrolase from Structural and Computational Studies.
pubmed doi rcsb
source organism Thermobifida fusca
molecule tags Hydrolase
molecule keywords BETA-1,4-EXOCELLULASE
total genus 157
structure length 420
sequence length 420
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2012-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 4avoA00
1TMLA 4AX7A 2BODX 1HGWA 1OCJA 1OCNA 3ABXA 3VOGA 3VOFA 1QK0A 2BOGX 4AX6A 1OC7A 2BOEX 1HGYA 4A05A 4B4HA 4I5RA 3VOIA 4AVOA 3RU8X 3A64A 4AU0A 1QJWA 1UP3A 1QK2A 1UOZA 1UP2A 3A9BA 2BVWA 2BOFX 4AVNA 3RPTA 1OC6A 4I5UA 1CB2A 4B4FA 3VOHA 1OCBA 1UP0A 3VOJA 1DYSA 1OC5A 1BVWA 1GZ1A
chains in the Genus database with same CATH superfamily
3IAQA 1IZJA 1JI1A 3SRHA 3OVPA 2W27A 5D2VA 5GNZA 1XLKA 3GR7A 3AS3A 4PEEA 1V02A 4TVUA 3A3XA 1DORA 4QNEA 2XINA 3GX9A 3QPZA 3VKAA 4EXBA 4PMXA 5AVHA 3BOLA 2PDNA 4J3VA 1LL7A 2G3NA 3COTA 3W7IA 5F2MA 2P3ZA 3FW6A 5G4WA 4Q6XA 4OBTA 4E2OA 1I2PA 1UD5A 4LY4A 1S39A 2D0FA 3KVLA 3FVDA 3T55A 2J74A 1XHGA 4HA1A 4D71A 3ARRA 3RMEA 4XVEA 5E6YA 3I68A 2H6RA 3M0JA 4FR1A 4HPGA 4YVPA 1J5SA 3GXTA 2VFIA 2WM0A 3WL0A 2W61A 4PCTA 1QAPA 3ZOAA 3AXHA 2QZRA 2DSVA 4JAWA 1G4PA 4UTWC 4JKLA 5AYZA 4FA3A 2FZDA 1BF2A 4J28A 4L6HA 4PUJA 1FXQA 1P1XA 4QTGA 3RCNA 4D6JA 5D8ZA 1P7TB 4RE4A 2EJ1A 4X61A 2ZWZA 5CSRA 1JI2A 3DDMA 1H7NA 1RH9A 1KO0A 3EOEA 4K39A 1OVDA 5EA9A 2Y63A 3Q58A 1TG7A 2QUMA 4KT2A 3G1HA 1DVJA 1NJJA 4IGNA 3B4YA 3GHUA 4MWAE 3HIJA 2XFYA 4EPBC 1T7LA 3SW6A 1KFEA 3WFAA 3O6DA 3NQVA 1HTIA 1T40A 2DP3A 4WVXA 1GYNA 1E43A 3VA8A 3VGHA 1U33A 1HFBA 3WQOA 1H50A 2DIKA 3UXAA 3WLHA 2WNNA 1V3IA 1MXDA 2C19A 4WY0A 1XW8A 5HWJA 5TF0A 4IQEA 4CEUC 3FGCB 2Y24A 2QMKA 2VQTA 1PS9A 5I3JA 4RXGA 2D20A 4QE5A 2XZ9A 2BP1A 3GW3A 3MWAA 3LXAA 1Q3NA 1WNOA 5D33A 1E6ZA 4IMAA 5FJOA 2VDGA 2OSYA 1H1NA 3T42A 3O9NA 5G1YA 1U1HA 1OYAA 3AXXA 2Y8UA 2G50A 2C0AA 1SPQA 5HA7A 1YYAA 4HN8A 2QHAA 1AMYA 4ONVA 4LX4A 2NT0A 1UC4A 2FFIA 4PN2A 3SECA 1F6KA 2YDRA 1TV3A 3VCRA 5C9WA 3PN8A 5DBUA 1T5AA 1DYSA 3LV5A 3CV2A 1X39A 2FVKA 1TJPA 5M03A 2CLOA 5C70A 3WFZA 2CLEA 3W00A 2WKJA 4TOQA 3VI2A 3P80A 3ZWSA 3MSDA 1XIFA 1Q7QA 1BKHA 1VLWA 4IP5A 4U2ZA 2VCBA 2WJDA 1CPUA 1UUQA 3O6YX 1L8PA 3OGRA 3W6LA 1IEIA 2NXGA 3U4AA 4ZE4A 3H55A 3KOXA 1W17A 4L1GA 4F3HA 1IXQA 3AROA 1A0EA 4FLQA 4ZQCA 3KX6A 1DXEA 2X30A 3WKZA 4M5PA 3TLQA 5IBXC 1UWSA 2Q09A 2ZQ0A 4JHMA 4US6A 3LBOA 5E6ZA 3SI9A 4CQDA 4XAYA 7CGTA 3N34A 2EPHA 3VU2A 1EO7A 3NIYA 3GBDA 3U5UA 1F3TA 3LLXA 1PTGA 4XD4A 4M1RA 1KNWA 3A3HA 4MKSA 3DKLA 5KZ6A 1QOQA 1OK4A 5I2UA 3FKRA 2E8YA 4CN6A 3EPOA 3EWXA 3ZLFA 5I03A 1VBJA 4QBXA 3BLIA 2ZXDA 4X3ZA 3GDMA 1A50A 1PX8A 1W9DM 1XLMA 1OBAA 3WSUA 4WOQA 1BSLA 5CGTA 3B8TA 3IRDA 4DAIA 4FOJA 1XDJA 4RV3A 2OX4A 3T78A 2ZA3A 1I2QA 3GK0A 4PMJA 4O16A 3E5PA 3W1XA 1F3XA 3CYVA 3QQWA 3WNNA 2WZEA 1JYNA 3G8RA 3T7VA 5C55A 4WKHA 4UIOA 2UY4A 4K36A 3SEPA 2PWHA 1UH4A 3DFSA 4N7QA 2UZ9A 2PDWA 4IIBA 1WCGA 1WDPA 4BEUA 1NP0A 4QISA 3SUVA 6ENLA 5AC7A 4JN6A 3AMKA 1TRDA 3HTWA 5BU6A 3B9OA 4S3BA 3BCDA 1C29A 4WSKA 3K8KA 4AZHA 4AW7A 4QQ3A 1TTJA 2VM8A 2DQWA 2OMAA 4AZGA 3NO1A 3AO0A 1J0HA 1E40A 3F1QA 4PSPA 3CWHA 2D69A 1WDQA 5TQLA 1J0ZA 3G0SA 1GVOA 2ZC8A 1GVFA 4C7GA 2Z1BA 1U22A 3FA5A 4J3ZA 3P74A 4QS5A 1XIBA 2J6VA 3TC7A 2Z28A 1O5QA 3HU7A 3RU8X 1XKJA 4DJFD 2Z25A 3T0AA 5DF0A 4DJED 1GOOA 3EWDA 5G1MA 3T4CA 1OYCA 5DCDA 3MBDA 3C8NA 2HS8A 3W7GA 1BTCA 2Z0IA 3GBEA 3ABXA 3NQ6A 3QFEA 3WJXA 2G4FA 5BMWA 1RVKA 1JVNA 4LYKA 4LCRA 1Z42A 5HR6A 2X1SA 1NP2A 3JR2A 3LTSA 3BG9A 5JBEA 5IRPA 2DZPA 3NL3A 4AWSA 1VHCA 3SBFA 5HWMA 3ZVHB 3F03K 2W6RA 3GY1A 1PZ3A 1WDDA 1GEHA 2D22A 1RSCA 2VL4A 4K6AA 3SSZA 4KS0A 3VMNA 4QJ3B 4FXJA 4AC1X 4ES4A 4I7VA 3OODA 5AHEA 5D9PA 1G4EA 2R1PA 5AHFA 4PUKA 3CHEA 4KCTA 1FCUA 2X09A 2PU0A 3WBWA 1LOQA 1R2SA 4Z2IA 2GJXB 2QUTA 3PUEA 2WVVA 5LZLA 3UVIA 2BFGA 4GG9A 4FX8A 4IPIA 1DBTA 3AHVA 3UESA 4NNAA 2QDHA 1YMYA 3VINA 2WMGA 1Q6LA 2F8QA 5IXEA 4GNKB 1HKIA 5H6HA 4PEKA 4KKXA 3PP7A 4FALA 2FZ8A 2HVOA 3CLMA 3N18A 3VIFA 3U0HA 1UR1A 4DQWA 3R4IA 3M6YA 3KBNA 1XYLA 3FXGA 3G1SA 2R1MA 2IW0A 1KCLA 1LORA 2BOGX 1W2PA 4DLMA 3B8SA 4HZMA 3FYPA 1H5YA 4JTSA 1DL3A 3PTDA 4D9PA 3QJAA 4Q8NA 3DHDA 1L9WA 2C14A 1U1UA 5A6JA 1XYBA 2GGJA 1HT6A 5MHBA 5K2ZA 3BW2A 3MPGA 4I8YA 3I7QA 4C6PA 2GUUA 3TW7A 3C8FA 2YL9A 5D32A 1EA0A 2GK1B 3W9ZA 3LD5A 1MNZA 1XH1A 3UU0A 3IANA 3KLKA 3P81A 4Z2HA 4DRSA 1TJ1A 1TWZA 3EEGA 2UBPC 1UZHA 6TAAA 1ZJIA 3TXVA 3VKJA 3M46A 3C3NA 1PL9A 2DZUA 3KHDA 1XSIA 3AIRA 2X05A 3N12A 3URBA 1MZRA 2EAWA 5A8GA 2Q8XA 1TO3A 2FPTA 3SUUA 5DEZA 3VKDA 3KP0A 3SGGA 4MJ4A 1K9FA 3W1RA 2BGNE 1PKMA 1L8NA 3QVQA 3P0XA 4HPNA 3MCNA 4DJEC 5ECUA 3C0QA 4O57A 1N82A 4JTIA 1FCQA 2DT0A 1TA3A 4GO8A 3AHYA 1A3XA 4GIYA 2BBFA 2D0GA 4DXVA 5A8MA 2HROA 4PBGA 4JQ3A 1CGUA 1EXBA 4GI9A 4NL1A 4QAIA 3VM7A 2J88A 2QXWA 4IOTA 1SR0A 3HV9A 4FNPA 2AMXA 3HPAA 2WWCA 3W73A 4EACA 1NDWA 2GVJA 9XIMA 3CHFA 5D30A 3NQBA 4UUIA 4UTWA 3NEHA 4IGHA 4GVHA 5GNYA 2VFGA 4N9EA 1W9UA 1IT7A 1BXBA 3PZNA 1EBHA 3VOCA 1LQ0A 1AQFA 1XQLA 1FP9A 3OB8A 5TIMA 2VRQA 4IL0A 4JCMA 3NXLA 3GNPA 1PDYA 3RX3A 3MHUA 1QDSA 1T0OA 1EP3A 5FJTA 2QJGA 1WZLA 3TIMA 2OODA 2IPFA 5K9DA 4J3SA 5D05A 2A3EA 2C0HA 2EQDA 1FWAC 5EU9A 4Z1YA 1EKOA 1XLGA 4ERAA 5HMDA 3CQ0A 1UW9A 1UUMA 4DBWA 4C6CA 4UZUA 3O63A 1VPXA 3M5XA 4GXMA 1KBLA 3FYOA 3IK4A 1QATA 5DMNA 3LU2A 2WANA 1VFMA 3O15A 5A6BA 2D73A 4QP0A 4OOUA 2NQLA 1FTXA 5F2IA 1U5HA 2NXIA 4Y9AA 1F6PA 4ORMA 3T6CA 4LYPA 2CW6A 5JXQA 4S3AA 4ACYA 1KR0A 2OEJA 3GTHA 1BSIA 4RPPA 1Z6KA 3M44A 4EANA 3W22A 2XVNA 1Z69A 1XJBA 2E6AA 3V16A 3WN6A 4GKLA 3SQSA 1FH9A 1MUMA 1F8MA 2CXGA 4RX0A 1BGAA 1ZCCA 3MUXA 4RPQA 4CQ9A 3ZJKA 2VR5A 2ANUA 3PG9A 1EYWA 4S39A 4Z08A 4JN8A 3LMYA 1EQPA 3WNMA 1K70A 1J8VA 2YL5A 3XISA 3MW7A 4PUNA 1T41A 4A6GA 5A2AA 4H6EA 3CS2A 4JFTA 7REQB 2NV9A 4OV9A 1DIOA 1HZYA 2FB3A 1TQJA 3WK2A 4LUYA 1AK5A 2O7SA 2PDJA 1Q6GA 5CJNA 2QV5A 3MTWA 1QCWA 4YTUA 1DV7A 5HANA 1G5AA 3LRMA 4O52A 3IACA 4P7OA 4U4MA 2QDDA 3R79A 1YNYA 4A22A 3C0LA 1FRBA 4XO6A 1KRBC 5D09A 3T2PA 4LNCA 4B3KA 5HMFA 1LLZA 3H23A 3H22A 5LIXX 1HL2A 2RAGA 4K7YA 3WLJA 3STFA 4MY8A 2ABAA 2OGJA 1WXYA 4NJGA 3TSMA 1X1ZA 3W71A 4MWAB 2OLSA 3R58A 4QG6A 1W8SA 3CWOX 3KDNA 4LBUA 4HPHA 3OPSA 3OIHA 2P8BA 4HHHA 1W32A 5BOFA 2WSQA 2QCMA 3OQ8A 3PSWA 1KV8A 3UT0A 4CCCA 4H9XA 1JUEA 3BG5A 4HSOA 1R86A 1JUKA 2WSKA 3IGUA 3OZMA 3G1VA 1DWHM 3VNZA 3TSDA 2EKCA 4H6QA 4GJ1A 1OGGA 2IPGA 2ZZ3A 3HJZA 1RY0A 1KB3A 3S5YA 2CFFA 3FJLA 1H7RA 4OTKA 4L80A 2W67A 3ANYA 4ATWA 5FOOA 4WHBA 5CEWA 4GLEA 3VZZA 2G3MA 3GIQA 1F73A 3DHPA 1DHPA 1XUUA 3A9IA 3FHQA 3AMLA 3BAJA 4MAZA 3V0TA 3D3FA 1GVRA 4GQQA 4CLMA 2C1IA 4OU1A 3WEZA 2A2IA 3AHXA 3C5QA 4UCGA 4PTMA 2VP8A 4QM1A 4NIRA 5CAKA 4UMAA 1XLCA 1TX2A 3MMDA 3S1VA 4AHOA 3NPUA 1TV7A 3WQ6A 1OFEA 2ZRUA 1U2YA 3SCTA 4FXFA 3UWUA 1B4KA 2PTDA 5AHLA 3TYAA 3EKGA 3O3RA 4TTUA 1KWKA 1KCXA 1VEMA 1WKEA 2D2JA 4F0RA 1MQQA 1ZRQA 3K1DA 3LCWA 2XTKA 5DANA 3GH7A 1REQA 3RUBL 5I0DA 3ZWTA 1WZAA 4B5VA 3GR8A 1I4NA 5GJPA 3GAYA 3QHOA 1E6NA 2A3AA 2CZ5A 1A5SA 4DO6A 3TTYA 2UWFA 1UCWA 4R3UA 2ZUVA 3EXTA 3FS2A 3KUMA 1WB0A 1LWJA 2FFCA 2HEJA 2QCHA 4XUGA 2PS2A 2AQOA 3OBAA 2C91A 1K8YA 3AYVA 1V5XA 3UETA 4KFPA 4V1YA 4Z1CA 2DEPA 5REQB 2CEQA 5J5RA 1H2JA 3TZFA 3S1WA 3D3AA 1W1IE 3MBFA 4LS1A 3Q94A 1DJQA 3NQ7A 1VHNA 4LUTA 1IQ8A 2CLIA 2G4JA 4PC8A 4HA0A 5F2GA 3PB2A 1A5AA 1MEWA 3RPTA 1V7AA 2Z1KA 4IFKA 3LBMA 4WX2A 3UJFA 1TIWA 2FYMA 2Q3RA 4G1NA 1UYQA 1I0DA 2R1NA 5LIWX 2X0YA 1V51A 4QDWA 4DIAA 3G0UA 3TWBA 3FGCA 1FDYA 5FJPA 4QCEA 2A3HA 1GQLA 5E9XA 2HDJA 2WSPA 3HGRA 3L68A 1HP4A 3NSXA 4O1AA 1YNPA 2QGYA 5D02A 1VS1A 2Q71A 5JMUA 1BRLB 2E77A 4HVXA 1ESWA 5HDRA 1EOKA 3QZAA 4NNBA 3NZQA 2IQTA 3LGGA 3QGKC 4BF5A 4Z0SA 4CQ8A 2NQZA 3DECA 2F6KA 5J04A 3C3UA 3U2OA 4DO5A 4DWSB 3SY1A 2WC4A 4MB5A 1XR2A 1VYSX 1OJXA 2X1RA 1W37A 4I5RA 1KRMA 1QPQA 1Z44A 4XVDA 4HA3A 4JTUA 1M7OA 1XISA 3M0HA 4DI8A 4PBEA 5D03A 1JDAA 3K2GA 1QW9A 3FAWA 3QGAC 3S5OA 3TMQA 1US0A 2KAUC 2VGIA 1SZFA 3ARYA 3RLVA 3NYZA 3P14A 4YVXA 2DORA 4X2PA 1UIPA 4EXQA 2RDXA 3FK4A 5HATA 2PWGA 3T2OA 3RPMA 3PAJA 2HVMA 4FO4A 3HV8A 3H4WA 3ME3A 4FNSA 3AUOA 2DW7A 4HA4A 4O10A 1H7XA 3OA5A 5TNVA 2OQYA 3W7QA 5ABTA 4PMYA 1XXXA 2DJXA 4ZBCA 3SY5A 2OQLA 1V77A 5GJMA 3RR4A 4KCWA 4KWWA 4O8AA 3TU9A 2YLAA 3FNDA 3V0SA 3N14A 2Y8KA 4IWWA 3BC9A 3PBYA 4ROQA 2ZUNA 5CZKA 3RHGA 1GQKA 1E4MM 2PBOA 4A3YA 3PJTA 1B31A 1QWGA 5J8LA 4DX3A 3WLTA 3E74A 1V6XA 4ZENA 2XN0A 1A5NC 4LAZA 3H12A 4DBEA 4Y9PA 2H8ZA 1OB0A 3QZEA 3A22A 5F4SA 3VNDA 2E1DA 3NGJA 1A4LA 3PG8A 1R3TA 1QVBA 4J2MA 4DELA 1DXIA 3O8AA 3ZYZA 4LFYA 2VZSA 1KKRA 4AD1A 4IG2A 4MG4A 4NAFA 3N6HA 4ML4A 4BEQA 2F2KA 3CJPA 2X7VA 3GDTA 4H9MA 2QJJA 1H49A 4QJ1A 4HJFA 2V3GA 1HVXA 2ALDA 1ALDA 2J25A 4AF0A 1QR7A 4Q4KA 5C2XA 4BK9A 2Y88A 4UTIA 3F2CA 3LK6A 1WX0A 3NZ1A 5D37A 1W1YA 3VOIA 3PZGA 3N29A 1GOMA 2IS7A 4GI6A 1EHNA 4C60A 1K7EA 1J0KA 4JTHA 3W25A 1GONA 3ES8A 3OYXA 3GZAA 1LM1A 2DDXA 1ZL1A 1ADSA 4MOZA 1E4NA 4HK6A 4IPLA 4LBSA 3U8GA 5HINA 4X9SA 4H9TA 1E0VA 4YIWA 1NWTA 2G37A 1A0DA 3UEQA 1YEYA 1F3EA 1PZ1A 3BG3A 3LYEA 4MTVA 4Z2LA 1TVNA 1QUMA 2ZZ5A 2FVMA 1ICPA 3GU9A 3AUJA 1JEZA 2A4AA 5I3GA 4M6PA 2DT2A 3QOMA 4M0XA 1O1HA 1TTQA 3W3OA 2DZWA 3VD9A 5LGZA 2YJQA 3GDKA 3ZJ8A 3MZ2A 1C9WA 2BB0A 2GDUA 2W92A 3RGTA 3OIXA 4GVGA 2VFDA 4GX9A 1R8LA 5CH9A 2FMOA 2V3DA 3SM0A 1EA9C 3LI0A 5E70A 1UC5A 1E15A 3LRKA 4DYKA 3W72A 1JZ6A 1VRDA 4EVZA 4KWVA 1Q85A 3GG0A 4REQB 2D2GA 1CXIA 2RGMA 2F6UA 2GGIA 3PZUA 3PUOA 1EO5A 8CGTA 1UD4A 4F0MA 5FL0A 3MCOA 1A5CA 3STEA 3THCA 3VUSA 2OG9A 3W7PA 1ENUA 1T96A 4QEHA 1K9TA 4UXDA 1W31A 2ZZ2A 4IXHA 2GJXA 2A1YA 3C4UA 3CTTA 3H2OA 2G3JA 1VFHA 4TQTA 4MKVA 3G22A 3EDKA 1VFSA 4L7ZA 3GG8A 1EZ2A 4A35A 3R11A 4ZB5A 4QLLA 1B3VA 3MSRA 1KR1A 3IWPA 3GWQA 2ZOXA 4TX6A 5D4YA 2JF7A 4AZCA 3U3HA 1OT2A 1S38A 5D9NA 2FIQA 3GDBA 2G3IA 4IPNB 4CNTA 2VRKA 1NFPA 3U2EA 3G0XA 1O60A 1UMLA 1CZ1A 1XSJA 5DXYA 2DT3A 2E5DA 2G96A 4UFLA 1DTNA 4E2DA 5AC5A 4RZBA 3OZYA 3W7DA 1TJRA 5C2GA 3E38A 2O56A 1LQAA 4LUTB 1PYFA 2G3FA 4LU0A 4DO4A 1C8XA 3WMSA 1FY6A 4MVAA 5BROA 1J4EA 2Z4GA 5GVJA 4PSRA 2D23A 3TTQA 2YB1A 2ALRA 3ZVIA 1NH6A 1XSKA 4MLJA 1BVNP 4JQ2A 4JYEA 3GC4A 3UG5A 4IL2A 1UR9A 3UGRA 2A7NA 1QJWA 1KQZA 2GPTA 4L6DA 4JQ1A 1TRIA 1CB2A 3T8QA 2VO5A 2PDCA 3CC1A 2HE8A 5AECA 4YVVA 1IWBA 1SMAA 1CX9A 1KFLA 1K77A 4MY9A 4I3GA 3QV7A 2ZBTA 4R9XA 1K8ZA 2Y1HA 5A8QA 2V30A 4XD3A 2EGZA 4JFSA 1NDVA 3UG4A 3P0WA 2PTZA 3O05A 4W7WA 1RBOB 3M41A 2GJLA 2D1ZA 3AAMA 4RDWA 4LCQA 4WGHA 4W84A 7ODCA 3S3GA 1PX3A 2YA2A 3MO7A 4Z1DA 2QPUA 3F2BA 1XX1A 2WPGA 3V0UA 3N17A 3KOYA 1R3WA 2OZ3A 1TMQA 2I1OA 4DWDA 4HOWA 4F79A 3U7VA 5C71A 3DKJA 3IJDA 4GUGA 1AD4A 3AYTA 1W3KA 2V0TA 5LA1A 1OFBA 4GQ0A 3L4WA 1OIFA 4ZQNA 4RL3A 4K2SA 4IZGA 4H7VA 1XRFA 1IEXA 2BX7A 3AIWA 2PCQA 4P8VA 3RRAA 4YTRA 4ORIA 4U33A 3IK2A 1F05A 3IUHA 5HJLA 2XIOA 1PEZA 3HMCA 3UP8A 3QLLA 1W9BM 3W24A 2VEPA 3AIUA 1PKNA 1Y0EA 1AW2A 2WCAA 2WWDA 1OEPA 2AL2B 4KGJA 1J6OA 1D7KA 4E4FA 2DVTA 4NX0A 3QKZA 2HRWA 5JQ9A 4KF1A 1UBSA 5DMYA 4ZXLA 4GWEA 4IJRA 1RBLA 1UKSA 2J9ZA 4DPPA 3NGFA 2WZMA 5HQMA 3GTFA 4LBRA 1WAWA 4ZQOA 4ZEPA 4AB4A 3A3WA 1RD6A 4JTTA 4I7UA 2TPSA 2Y7GA 3CB8A 5KTLA 2TYSA 3QC3A 4WDUA 1Y65A 4D6HA 4DYEA 1EEXA 2VVSA 4K1GA 4HPJA 4AY8A 4GYFA 4PA8A 1MMFA 4G7EB 4EAMA 4LVAA 2J8FA 3WD0A 4B2DD 5AHIA 1Y5XA 3DFNA 3H24A 3WELA 2FJKA 1M7JA 4AVFA 2VOMA 1K8CA 4LPCA 4QRNA 4GIAA 4H9UA 4HSHA 1MUCA 3NQEA 2OSXA 1C9DA 3OLEA 1E0XA 1TV5A 2P0OA 3S2LA 3GVGA 3N4FA 4WK9A 1TVLA 1ZNNA 3G5EA 4M7TA 1NARA 3WDQA 2Q3OA 3QMRA 1OD8A 4Q4OA 1JR1A 3ZT6A 7REQA 1MEHA 3HG4A 2R9RA 2IXUA 1MEIA 3GKAA 3GNNA 1UG6A 2YA1A 4JHZA 3WDJA 2WMIA 2QCNA 3W81A 1JXJA 5CC6A 3WQ4A 2PC4A 4N2YA 2Y7EA 3MO4A 5I79A 3ORWA 4MJZA 4JY9A 3QZ6A 2IKJA 3W27A 1EWEA 3USZA 3O6AA 4CN1A 1I1XA 1W9PA 2XFWA 3DESA 1PTAA 4G6CA 3BCFA 4C91A 3L2MA 5I06A 3VVGA 3PPGA 3LY0A 4S3EA 3WK0A 2ZRVA 2XDFA 4GA8A 2OXNA 1GVEA 3P7YA 1CBGA 4MYXA 1BLIA 5FJJA 2R24A 1OWQA 4LRSA 5FACA 4IM4A 5LGXA 2V82A 3BSHA 2QR6A 3S5SA 1QI2A 1CLVA 3CAQA 1QU4A 3DX5A 4JTQA 1RLCL 4X63A 1XL9A 2EG7A 2YW4A 4XB3A 5B80A 3WIJA 3HQPA 2VX5A 3UWYA 4B90A 1XIJA 4KWOA 3KM8A 3N11A 2JEPA 4W9TA 2VD8A 1UD2A 4O50A 1LG1A 2EKGA 3BGJA 3L4XA 2NX9A 3RCMA 2EPMX 2G97A 1CECA 3PZOA 1AL7A 1V6VA 2PRLA 4P2VA 3CB3A 1C8VA 2J7BA 2YDQA 3YPIA 1R7AA 5BWAA 2A79A 4JCLA 4QG9A 4RNIA 3V35A 2IPWA 1KM1A 4B5UA 3EDJA 3KAOA 4FIQA 4LVGA 2H9AA 2WW5A 3W37A 3GFZA 2E9BA 1HW6A 1GQJA 1VGAA 1QTWA 1QASA 1E6XM 4RUBA 4Q33A 2ZZ4A 2JIEA 3FDKA 4ZOBA 2NLYA 3CZ8A 5AOUA 3BICA 4BF9A 1BGGA 1TCDA 2V5BA 3G3MA 3LPPA 3ZLGA 5G1TA 1HN1A 2ON3A 1QXLA 3L2IA 2BMBA 1H0GA 4C5ZA 1C92A 5CSUA 1CWYA 2QF8A 2WZTA 2QUUA 1PSCA 1XC4A 1TV4A 1W9VA 3TN4A 3REQA 2O9OA 1I9CB 1UR2A 4LRTA 2DQXA 2RDUA 1CDGA 1MW2A 3VCCA 2XH2A 4PRRA 4PMRA 5C9UA 3VDHA 2B7OA 2I9EA 1R3QA 4UFHA 2ZZ7A 3FCPA 4P7LA 4JX5A 4KCUA 5BXRA 4DNMA 1WP6A 4H8UA 2FGBA 4ZOAA 3HPXA 4NP7A 4UTUA 4ZVJA 3IARA 1HO1A 1BRLA 3LXBA 1AFSA 3GHRA 1EXPA 1FH8A 3MB9A 3TN3A 4WOZA 2YKKA 2VDIA 3BZGA 3ITOA 5AFDA 3N2BA 5AN7A 2J77A 3NQCA 3MY9A 2VCAA 5XIAA 2YYTA 4H01A 3W86A 5G2WA 2WHMA 4MY1A 5I77A 4K8GA 1NOWA 3DYMA 5HUOA 1G69A 4TMBA 3HF3A 3LCHA 1PB0A 2VZTA 1KGXA 4UBPC 2POZA 3OG2A 3CU2A 3OLIA 4AZ5A 4FS9A 3VNLA 4WXZA 3ZR5A 3VGEA 2PP1A 4LEQA 4LUIA 2WHJA 1OC6A 3VD7A 4B4FA 2YCIX 4Y9OA 3AXMA 3TKFA 1OCBA 5E5CA 2MNRA 1PHWA 4XSLA 1GQNA 5AY7A 5MKGB 1CXLA 1OX6A 1F76A 2XIJA 3NA8A 1FQ0A 1D8CA 1RA5A 2HTMA 1JUBA 3FA4A 3VABA 4U28A 1BHGA 3LX9A 1RA0A 3QEZA 1Q8AA 4O1EA 4JEJA 1LLOA 1CNVA 1LWHA 1FWSA 1H7OA 1SO3A 3B8UA 3W2LA 4NAEB 4Z17A 1W0MA 3ZR6A 2FGZA 1KTCA 3LBCA 4UQAA 5IM51 1FWJC 1SU5A 3E12A 1V0MA 3RXZA 4I6KA 4X9YA 1ADOA 4AWUA 4KRUA 1S3HA 4FXSA 4I9MA 4O19A 2O55A 5A6BD 1OHLA 1EFZA 3ES7A 1UJQA 3W75A 3A24A 4US5D 3NOEA 5CZ0A 1SM9A 4H6KA 3UQNA 3NL6A 1HGWA 5CLTA 1Z89A 5CKSA 1P48A 4AX6A 2PWFA 1PDZA 4HYWA 4XD5A 2OOGA 4Q8PA 1GVSA 2NVAA 5A95A 3JRKA 3S2NA 4OJYA 2ZZ6A 1GORA 1XLDA 2WM1A 1J0JA 1F7BA 4LAUA 2OWXA 3ID7A 2E1WA 3PZQA 1OFOA 1OGSA 1UA7A 3O16A 3N4EA 3ARSA 2GSHA 4DWSA 3G24A 3UF9A 3TUUA 2EXOA 4LGXA 2E6FA 1H62A 5EY5A 5T8GA 4M51A 3VIJA 3ITVA 4IPJA 3EZ4A 3TAKA 1EJRC 2C71A 3BQ5A 4AXKA 2PWEA 1F74A 4XK2A 2P0IA 4L1XA 4KBXA 1G1YA 1ZAHA 3NQAA 3FHAA 3LCXA 3HPZA 3K5XA 2HPIA 3TSBA 1JZ8A 3GW0A 1ZJAA 3IJ9A 1EJVC 4FNRA 2ICSA 2P53A 3KL3A 5BCAA 1HGYA 1M1BA 4C5YA 1XRTA 1EIBA 5BWFA 3T44A 4PTNA 3TP4A 2Z1VA 2OWWA 2Y5JA 3HPSA 3RM9A 1SR9A 2Z7KA 3EB4A 4UFJA 3CLWA 4PGLA 3TCSA 4YLWA 3A5VA 4GRSA 4AEFA 3UZYA 1M7PA 3ZVHA 3FAXA 3R43A 4JX6A 2X0SA 2C79A 2FH8A 4Y6GA 3NM1A 1IE7C 5AYIA 4H2CA 1CT5A 1JCXA 3GU1A 3WUBA 1XFCA 5FL1A 3W7CA 4B15A 3LNMA 4IXXA 1NWUA 6A3HA 3UWEA 2QPXA 3P82A 1ME7A 1HVQA 1J11A 3AC0A 3RYSA 4ZODA 1VYPX 4PTVA 2Y5EA 3N19B 4JTDA 4IG2B 4NAFB 3C56A 4JTEA 3W28A 4WDWA 1FBAA 2ZRZA 3R13A 4GABA 3LENA 3LLDA 1EB3A 3GXIA 3P62A 3CEPA 2DVUA 3TZNA 1MO0A 2Y61A 4H83A 3WMCA 4J3WA 3AICA 3KE0A 5HAOA 3CZGA 1PIGA 4LUSA 2HE5A 1U30A 5D9OA 4PMZA 5F1UA 2OZTA 2WB5A 1GEQA 1RY8A 1W3JA 3EOUA 1TREA 2GUBA 3ICJA 1EUNA 4PCNA 2WC3A 3WQVA 3LRLA 4XD6A 5CZSA 1K3UA 1QNVA 2DU2A 3B8VA 2OYKA 4JDBA 3FVMA 3PBUA 4JXCA 3AALA 3E49A 3TXZA 3KL5A 3W1UA 4KIRA 5CC7A 1RPKA 4LH8A 2WSRA 3RO8A 4AMAA 2ZE0A 2NQ5A 1SJDA 4FNQA 4UMCA 2VEMA 2PDUA 2XVGA 3VKBA 1XYCA 3G77A 3PBMA 4QJ4B 1QHOA 4MGGA 2Z7GA 3ABOA 2GLKA 1FHLA 1Y7VA 5AB3A 5CGMA 1ZLPA 5EMYA 3TTSA 1O5KA 1VFUA 2PCEA 4WZHA 4IISA 5J5DA 3NAVA 4ZOCA 4W5ZA 1I75A 3WF3A 2WO5A 4F66A 3L4YA 2CKSA 1XBYA 3GO2A 1VJZA 4MFDA 4RE2A 3M64A 3MUZ1 4EP8C 4GIEA 2RKXA 2VUNA 2AAAA 3E2VA 2MUCA 2HXUA 1FHDA 3ARXA 3W2JA 2J7DA 3WNOA 1V6UA 4DBSA 1Q7ZA 3T07A 4NSBA 2BY3A 5BOEA 1CYGA 4F2TA 3H7VA 1U5VA 1SYTA 5BYWA 1DWAM 3I6EA 5AC6A 2NUWA 2BVWA 1BYDA 1AZ2A 1UPPA 3WUEA 3M07A 4FSAA 1EDQA 1ZBWA 1C90A 1HX0A 1BG9A 3STCA 5CJ5A 1A53A 2WCGA 4PTXA 1R0MA 2R6OA 2PLJA 2GVEA 3NDYA 3LERA 2DZSA 2V5LA 2QF7A 4LT9A 4IFOA 3AJXA 4NNCA 3RMJA 5FCZA 3AQUA 2ISDA 2P10A 4OT7A 4W4QA 3BURA 1FKWA 4F2BA 3LI1A 3BE7A 4JOMA 2QEZA 5XIMA 4BCEA 2IUZA 1GZGA 3UWZA 2QVNA 4LUSB 3VC5A 1F5ZA 5DELA 4O8RA 4JTLA 4Z1BA 2YBTA 4MDPA 1VFLA 4L6OA 3M43A 1GGOA 1TZ7A 4J27A 3ITYA 4QDPA 1F3WA 2RGLA 1WBJA 2XSBA 4C6MA 4WKFA 2HVNA 4ATLA 4ILSA 3SCPA 3HG3A 5A3HA 2XZ7A 1KFBA 4EF9A 2DZTA 1IEWA 1P0NA 1E9YB 5DRCA 1XFBA 2BHZA 2F6XA 2HJPA 3KVMA 2X1IA 3VOFA 3OA3A 1XLEA 3TOPA 1E1CA 4MKNA 1TELA 1E55A 1ZUAX 3CL8A 4MNJA 1WZMA 4KQNA 3HQNA 3UXLA 4FOKA 4GYJA 5A8NA 2NT1A 1N7KA 3RNDA 1NEYA 4P61A 3ARPA 3TFXA 2PDFA 1FH7A 2ZUSA 3WK1A 1SZNA 4HSNA 3VUPA 3G1AA 2C8NA 1A5OC 2TAAA 2XN1A 1A4MA 1G9HA 1VCFA 3SUTA 4PUUA 4IIGA 2E28A 3NJ3A 1RJPA 3WZ0E 1I0BA 4AG0A 3H8AA 3GHTA 2J7EA 3S9ZA 4C7DA 3GYEA 5GQBA 3OZOA 3R6IA 1DJIA 1GHRA 3BJFA 1UWTA 3W1LA 3S42A 5AHNA 3JS3A 2BGSA 4PE8A 1RAKA 3D46A 2C1GA 2VR4A 4JIHA 3C2FA 3UZWA 4A2RA 2WMIB 2JK2A 2HCVA 2WV8A 3KP1A 1UBPC 1NELA 3TONA 1XLAA 3O0FA 2CIPA 2GGHA 4UTMA 2VGFA 2WK2A 2Z00A 3DBNA 3WLRA 4LCSA 4DJDD 1W3HA 3ZS4A 1MW1A 4IF2A 4GGHA 1DJWA 2PEVA 2Y89A 2P88A 1S2CA 3WQDA 3OZPA 5DN1A 2WZIA 4K7VA 2QS8A 3UBPC 1GKPA 3E96A 3WLOA 3AIBA 1RK6A 1I8JA 4RV8A 4GOAA 1TJ0A 1S5MA 1BG4A 1W5NA 3MI3A 3VNJA 4UTKA 4R7JA 2ACUA 4G7EA 2GQ8A 4NJJA 9XIAA 4GNJA 3KW3A 4B91A 2YCEA 3DHFA 4GI8A 2ATMA 1WOBA 2I17A 1K4HA 1DIEA 6XIMA 1X6UA 1HP5A 3NPXA 4Y7EA 1Q63A 1PUDA 3NQMA 3NSNA 4W88A 5AC8A 2F7FA 3VKCA 2EBNA 1S2VA 3G8EA 3A6OA 3S1UA 2UY2A 1KXVA 1EYEA 2GVYA 5DCEA 2E5BA 3HFTA 4JQ4A 1V6TA 5DMLA 1V03A 3NCOA 1HJUA 3RN6A 1FKXA 1H11A 3ALFA 3WLKX 2REQA 3OVQA 1E51A 3ZIZA 3QW3A 1QOPA 1TMLA 2ZXBA 4ZXOA 3LMZA 1FCVA 1ZAIA 5D8WA 5FF4A 1AQ0A 1J0YA 4CUCA 4HNCA 2ACQA 3TLLA 1B90A 3GH5A 5BRBA 2QCDB 3W2UA 1C7SA 1KFCA 4FNUA 4LUJA 4AIBA 1SFSA 2J6XA 3G1RA 4UC5A 2PURA 1PX4A 3VD5A 1XD1A 3M0MA 3CZJA 2FTWA 1EC8A 1YHTA 4U31A 3EWUA 3B03A 2HMCA 2QJHA 3W6YA 3K4WA 1JDFA 4BHYA 4JR5A 3GVQA 3W7RA 2VX4A 1JG9A 4YTTA 1GOIA 1GG1A 3GNRA 4GCXA 4MWAC 3ZSSA 1Y5WA 1B54A 1KFJA 2GJRA 1GT8A 1DTUA 1US2A 4Q3MA 4O14A 3MZNA 3M5ZA 4JQAA 1PE1A 1J2WA 2QVHA 1TX0A 2NZLA 5CPNA 5M3WA 4E3TA 2NW0A 4A8RA 2D3LA 3UR8A 3EOOA 5BNKA 3ITXA 1GHSA 1FWEC 4O13A 4G7FA 1JCMP 3R0UA 1ICSA 1WXJA 2V2HA 4QLJA 3SJ3A 2BXYA 4B9ZA 4MB3A 2QGHA 3GD6A 3U4FA 1X8CA 3ALGA 1SO6A 4AFYA 2Y2WA 4QHRA 3VIOA 1NTHA 3URQA 5JU6A 4UFMA 2WMJA 1SFLA 2H3DA 1RVGA 1R9ZA 3POCA 3IVUA 5CPMA 1MXSA 2CBIA 2FHCA 5E1QA 1GJPA 1NQ6A 2CZDA 4J2PA 4GZ7A 1C91A 1EF2A 1X97A 1YDOA 3OP2A 2CBJA 3I6RA 3K13A 4WGXA 4ZQMA 4EAYA 2BLEA 3UYCA 1AH4A 3TYBA 1KXQA 4UTTA 2BVYA 3H4XA 3TYZA 4MJ2A 2BSLA 4IGMA 1VD6A 1AQMA 1Q45A 1P4CA 1BWVA 1HJVA 5ECVA 4LF1A 2J8GA 2J8TA 1XDLA 4OE7A 2VURA 3N25A 4BQ5A 1XC6A 4QITA 2YXOA 1JDEA 3O6CA 3KRSA 3DH7A 1RJQA 3OLDA 3UPBA 1H0IA 5H2ZA 4JY8A 1B5TA 3NVDA 4LY8A 1E5NA 1TB3A 3TVAA 1A3WA 1B3ZA 1JPKA 3V1HA 3T1GA 1B2YA 1S1PA 1J10A 3QPYA 3I65A 3QSTA 2AL1A 4IMEA 1OFAA 3C6CA 4FNTA 3Q4DA 2XIBA 3R10A 4QSHA 1LJYA 4ZSUA 1M7XA 1S2TA 4PODA 4DB7A 2XVPA 4A8LA 4NZ3A 1OT1A 3TJIA 3UJEA 3GNXA 1E1CB 4ZQPA 3T40A 1CGXA 4EXAA 1YQ2A 3N9SA 5MKGA 3KRBA 5FAGA 4N9BA 1ITQA 3WQFA 1MDLA 1UKTA 3WDHA 1JFHA 3W1NA 3GLCA 4LS2A 2I9UA 5C5YA 3OOQA 4DXXA 4ZTXA 1J93A 3R1ZA 4GMEA 4PCSA 1H4PA 2TODA 4OOZA 2I57A 5I3KA 1OX5A 1W54A 1J6PA 1JRCA 3UA4A 4LW7A 5JBDA 3UZXA 1FX6A 2UY5A 3M47A 2GGEA 4L5ZA 5E0CA 1J0IA 1H09A 3B06A 3PBWA 4TMCA 1P0BA 3A12A 1K6AA 3AHZA 1ME8A 1GOKA 1GQIA 3QMSA 3TA6A 4ZA0A 5C9ZA 1H1YA 4GD0A 1I45A 4JPGA 3TQVA 3DG6A 1XG3A 1UA3A 3WBEA 3ZQ9A 4AY1A 4QIUA 1M68A 1EP1A 3U9IA 3WFLA 2WHKA 3WCZA 4ZB2A 2J9YA 1UKQA 3AIVA 5E0FA 5L9FA 2BVDA 3VNYA 3NWRA 1LT8A 1QW8A 3SQMA 4UFKA 1F2JA 3BOFA 4V15A 2ONEA 4CNSA 1OC7A 1TPVA 3S47A 3IAPA 1G4TA 4GINA 2VZOA 3MUY1 3LGDA 3PULA 2E8ZA 3F5KA 1LRTA 1U1JA 2YDSA 2Z26A 4B5WA 1KM5A 2B7QA 3UNTA 2PD5A 4QE4A 1E0WA 4E8CA 3G6LA 1JD7A 1JJKA 1SZRA 3GS6A 3W87A 1UKOA 1WYIA 2BASA 4YHEA 1I2RA 5JIWA 2AQWA 1B57A 3WDRA 3OGVA 5I23A 1JL8A 1UR8A 1TTPA 4NZ5A 5IFPA 2VEKA 4QJ5B 4HIBA 2VOTA 1PJ9A 2QYGA 1IR1A 3FIGA 3I6TA 4GFIA 2W62A 1BQGA 1EGVA 1P0EA 2AQVA 4F4RA 3BMXA 4R53A 5BXTA 3FY1A 1DWJM 5KZMA 4AEOA 2VENA 4K8HA 1IT0A 3GXNA 4KEUA 4JFVA 4X0NA 3IUDA 3VOJA 2ZVIA 4EPDC 1TPFA 4XBJA 2OX1A 1IF2A 4QS6A 4MMWA 4KFOA 2NQ9A 1D3GA 2ZFAA 3FSUA 3UGVA 3GXMA 1X1NA 1SMDA 2H9AB 3TROA 2EEXA 4NU7A 3EA3A 5LXEA 1EOMA 4Z0JA 1Q6RA 5I07A 2AMGA 1RQBA 1Q4WA 4MZ1A 1QI0A 3W88A 1E5JA 6REQB 4LALA 4J35A 1ONRA 1VFOA 3LDVA 4GACA 2Y62A 3KVKA 2E9MA 4TIMA 4I5XA 4WR3A 2ZDSA 1VEPA 3OEXA 2PLCA 4CU7A 2WKGA 5M1TA 3DFPA 7PTDA 1CXHA 3EDEA 1KC7A 1K7XA 4W8LA 3WH8A 5LNUA 4F9DA 1XWYA 2RDWA 2A6LA 4PRWA 3TYEA 4OWGA 3TN5A 3VDGA 1OQFA 1O5RA 1JCLA 1Q6OA 1LRQA 2PGEA 3BJSA 4OBRA 1GPWA 3RAOA 4F48A 3B0UX 3SIMA 2OO0A 5TBOA 1QPKA 1IGWA 5CG7A 2ZXQA 4U2YA 1A5LC 4YMZA 2PGWA 4P8UA 3CL6A 5LIKX 2ZE3A 1SO4A 4CVUA 5CPQA 5AVNA 4C1NB 5I24A 4PB3A 4HJWA 3CAWA 5TD4A 3PZTA 4F40A 3INPA 3TOYA 2W66A 1QFEA 3EX4A 2DGAA 5I7GA 1HNYA 4C1KA 1FWWA 4GHRA 1W1A1 4M19A 4GY1A 1DQUA 1PPIA 3N15A 3LTPA 3WDPP 3WH5A 4NAEA 4IX2A 2PLMA 2XFRA 4XIMA 3RRXA 2DV0A 2BY2A 3LCFA 3C2VA 4E4UA 1AJZA 3W7EA 4CQAA 4JX4A 3FN9A 4CQCA 3N13A 1EZWA 4DJFC 4XZWA 5FEXA 1OINA 2OZ8A 3QQ1A 1Q6DA 1HJXA 2PMQA 2ZADA 3CV7A 2ODOA 1AUSL 3VE9A 2ISWA 4N4PA 5FF2A 2W79A 3NL2A 2Y6ZA 2C16A 4OQVA 1TWWA 2VX7A 2E68A 4R33A 3RM8A 2VGGA 4PB5A 2AGTA 4FHAA 4H8NA 2TRSA 3TC3A 3S0CA 3HGOA 1YXYA 2H8XA 2WMFA 4J4KA 3R0KA 3IRSA 4O54A 2QT3A 2NQHA 3DFQA 1J79A 4O0KA 3WUFA 2ZUMA 5ABFA 3RJXA 4D6DA 1A3HA 1MFVA 1CGYA 1RBAA 2DW6A 1Q6QA 4FXRA 4MWAA 3WJSA 2VZVA 5A2BA 5A1AA 1UR4A 3GFYA 3FJ4A 2VTFA 3SADA 1J96A 2BHYA 3RK8A 2A85A 2GQ3A 3EWCA 4WJ8A 2P5NA 5JIPA 5DCBA 5LNWA 3H2CA 4NT0A 3VDBA 3VYLA 2GDQA 3V4BA 2XVLA 2BVTA 4KEVA 2DT1A 1IEVA 3KBMA 3BAXA 4PUMA 2WLZA 1DQXA 4P8WA 3EPNA 1FWFC 2OO6A 9CGTA 2BZNA 2R1KA 2WNZA 4AHQA 5AKQA 3B9AA 1EJWC 3TA9A 5HQEA 4DZ5A 4YTQA 1K02A 1XF0A 1JPHA 4MPKA 3N6QA 2JKAA 1ECQA 3O0KA 3VDAA 2J13A 4KRZA 1E72M 4L61A 1WXZA 4B5XA 2OGYA 4S3DA 3PBVA 2VVNA 4DI9A 3MVTA 2OT0A 1WOAA 1TQXA 3V5CA 3KTXA 4XAPA 4UOQA 4E8DA 4TUFA 1QPNA 5ABEA 1XQKA 3NNTA 4I6VA 5M2FX 2R91A 2AAMA 2DZVA 5CPLA 1V02E 1PIIA 3PNUA 3W02A 4PL1A 3K46A 3SN1A 4B9YA 4JKKA 3MHFA 3EB3A 3DERA 4Y2WA 3LZ5A 1O1ZA 3TYCA 1UP3A 3GIYA 3UD6A 3TFCA 1V8EA 4M3PA 3L9CA 2P50A 2FH6A 3APTA 3N9RA 4W5UA 1CLKA 2PDHA 3QV8A 2PP0A 5FAJA 1A5KC 3VOGA 4XUYA 1K4GA 5C9RA 1EDTA 4TO8A 4FOUA 4N6FA 4DNHA 4QX4A 1YE6A 3SQLA 4AD4A 4WIWA 1I2OA 4WDTA 2UY3A 3LHZA 2JE8A 3WLIA 3T08A 2Z29A 1YDVA 1C93A 3AWNA 4UQ9A 3EX3A 3L67A 3VD4A 4MZYA 2TSYA 1K03A 3CIXA 1ZS2A 5CJMA 4IQJA 2OR2A 3WUGA 5FF3A 2VWTA 4M6VA 4YL2A 5AZ1A 1PAMA 3PVFA 1LP6A 5ABFB 5C2CA 2XSAA 1E3XA 2E7FA 1SJAA 3LHTA 3B0PA 3IJ7A 2WJZA 4R88A 2WBGA 2AKMA 2Z27A 3JZEA 3I3BA 3CUXA 2I5QA 3V7PA 4NXKA 5M5DA 3AXKA 1H1ZA 2YL8A 3I3EA 1K7FA 4CD8A 1DWIM 2I7GA 4PMVA 1S5TA 1FWIC 4J7RA 3MQTA 3W1QA 4UNLA 3I4KA 4BA0A 5CSYA 2A3LA 3L4ZA 3QKEA 2J7GA 3DOPA 3VXGA 1OC5A 5F4WA 3IVSA 4N42A 4FLRA 4XSMA 5H1WA 4YWSA 2NV1A 4AHPA 2G8ZA 2ZTJA 1KQYA 5FJUA 3RIKA 2E25A 4CNNA 3ARTA 4HN4A 1YXCA 4Y9MA 3IGXA 1JNEA 2BS9A 1IYXA 3EWZA 4HCLA 2CITA 1L0PA 3THAA 2DSKA 4Q7BA 4C6KA 4WDXA 1XIHA 1V3LA 5HOSA 1UJPA 4S1FA 3S1GA 4MUZA 1NQKA 5EMMA 4DHGA 3R8HA 3L0GA 2ZX8A 4E5TA 1E6RA 5CG0A 3P61A 3BW3A 4CCZA 3IV8A 4ZGYA 3KBWA 2PC8A 4RK8A 4JDYA 1NOUA 6ALDA 4FLOA 4QROA 4CKQA 2YA0A 1XGZA 2BHUA 2VEGA 3CPUA 3B04A 4D6GA 3DG7A 4PTWA 2J9XA 4RW5A 4O1DA 3NQGA 1LOLA 2IKGA 3SN4A 2Y85A 5CZTA 3S4TA 1LBMA 2RDTA 4LAMA 2E67A 1VFFA 1PWLA 3C61A 4Y9NA 1QNOA 1XBZA 4RR4A 1UD8A 1MNSA 2YX0A 3RLGA 1AH0A 3EWWA 4DPQA 1XGEA 2UV8G 4L9ZA 4JYDA 1OCNA 4W7VA 3MWCA 2WNWA 4E38A 4HMEA 3H7RA 4UZSA 3PWIA 4IICA 4X22A 1MXGA 3SZ8A 5FESA 3KCJA 1G0CA 1CW2A 3T9PA 3OO2A 3WH6A 2NXHA 1R5YA 3GG7A 3L23A 3SO7A 4HK7A 2YFOA 3NXFA 3MI2A 2DJLA 2C7FA 3TN6A 2J7FA 1EDGA 4AYGA 4NJIA 3WD4A 1NVMA 5FEZA 1UZ1A 3NSMA 2GSEA 4W8AA 2LLEA 4IJCA 1KM6A 3VIHA 4MNLA 2Z1SA 1VYRA 1FA2A 1ZQ5A 4HHLA 1XRVA 4HNVA 5ABHA 4TX8A 3B8WA 4G5DA 4H4IA 1VCGA 2VQUA 3E5BA 4H8VA 2PD9A 1XH0A 5CXPA 3PZIA 3P60A 4H04A 1DIDA 3E0IA 3EXRA 4C65A 4J1OA 1VPQA 1TWDA 5A6TC 2PPGA 4HOZA 4Q8MA 3P67A 1A0CA 3HN3A 5U4NA 4HD5A 1LYXA 2JGYA 1ISXA 5AHMA 2ACRA 3VTRA 3S2JA 4HNLA 3TAOA 1S2WA 3OHMB 2QKFA 1KTBA 2JIWA 3STPA 2JBMA 1V3MA 3GHSA 1BAGA 3BARA 3BQ6A 2Y0FA 1P0DA 1LQ2A 4ZTYA 4KCVA 4JN7A 3MU7A 2ASHA 2PSNA 1MZHA 4A29A 4OVXA 4RLIA 3THDA 1GPFA 3QQ0A 3W7HA 4LYRA 1X8FA 4EWJA 3APGA 4HOXA 2ESCA 1VBUA 3BSMA 3S9YA 3HM7A 3TR9A 4OKDA 4RDYA 4B3LA 3PPHA 5FA5A 3NVTA 4U10A 2EPNA 4AD0A 2HWGA 1O4UA 3BOXA 4FB7A 3E9AA 3GVWA 4ICCX 2WSYA 1UZDA 1HL8A 1H7WA 5IFTA 1US3A 1LZOA 2HSAA 4UTJA 1R3SA 2OEKA 4D2JA 2DUXA 2IKHA 3KS5A 3M0KA 2V5KA 5LNRA 1M41A 4O4VA 3CQIA 4CNOA 3B9NA 2V2CA 3T81A 3LS9A 3R8RA 3HA1A 4H9ZA 4QG8A 4DBDA 1POKA 4P7QA 2OZ0A 3EKLA 4AAJA 2PDBA 1QRQA 3MC5A 4CCDA 4WSJA 3HMJG 5T26A 1IXNA 1TPH1 2VC9A 5LKYA 3SGZA 1BVWA 2ACSA 3CPRA 2L5HA 4I9JA 4ACZB 2J62A 2E3ZA 4UTTC 2FTYA 3CUFA 3EWBX 1EH9A 2QUVA 3EWYA 4N9DA 2X16A 4BI5A 2DH2A 4XISA 2INFA 1PO9A 1RR2A 4A05A 3P5ZA 3V36A 3V5OA 3IVTA 3AMCA 4XIAA 1E1EA 5A94A 1ICQA 3CWNA 5KZEA 1NU5A 3D5HA 1ZALA 2OELA 4DF0A 1J2BA 1EX1A 1TV8A 4Y8FA 1RV8A 3R94A 1AZ1A 1YTKA 1ZTVA 1TZ9A 4AU0A 2XIMA 3VNIA 5FSDC 5U7SA 4IJBA 4IPPA 5LNSA 2GWGA 4UOJA 4GH1A 2JKEA 2WCSA 5CLWA 5HMSA 1G7VA 1E9ZB 4IUOA 1D3CA 1KLYA 3R5EA 4G2DA 4ASTA 1E4IA 1U5JA 4PL2A 3W1TA 5A2CA 3DGRA 2VC6A 1KM3A 3K8MA 3QYSA 1XLHA 3MDWA 1P0KA 1Q13A 1S1RA 3W07A 4Q8WA 2PDMA 1JF5A 1HJSA 4C1NA 1O5XA 3S2CA 4JIPA 5CGQA 2GK1A 3LCGA 3H54A 4GQRA 2ZC1A 1CGVA 3GUGA 3TTEA 3M6DA 3W38A 1FCBA 3F4DA 4E0CA 4LV9A 4HCDA 1M6JA 4BQ3A 1QO2A 4LXFA 4A8NA 5AC4A 4MB4A 4CU6A 6REQA 2EO7A 4RZ4A 2Z1XA 1OFRA 1X6NA 2I14A 3PANA 5EL1A 4C7FA 3NYDA 4XG1A 3W0KA 1AVAA 3PZ9A 1DJZA 1IIGA 2NV2A 4JS3A 4XZBA 3IEBA 4D8ZA 3TQPA 4C1LA 1KRAC 2RJGA 1E6SM 3M5YA 3IJLA 2VRJA 4JTCA 4WF7A 2OQHA 3SFWA 3BAKA 2ISFA 3WBYA 4XTIA 3LSCA 3K1GA 1EIXA 1Q4NX 4UWMA 1JULA 2Y7FA 1R46A 1S46A 1OM0A 3CQKA 1WAUA 5D38A 1H7PA 3LQGA 3B05A 1GKRA 4JNYA 3IJQA 4L4MA 5EKYA 5DO8A 4PUDA 1YKWA 2GVGA 1FDZA 3U2ZA 2NWSA 3IGSA 1RCQA 3E0FA 1K6WA 1EJSC 2A3CA 4ICMA 1NAL1 2BODX 4LV4A 5I00A 3W83A 5D2YA 4MAVA 3DYPA 3HURA 1MVYA 4G9PA 1JIBA 3NDZA 4GIRA 3S8HA 1DJXA 2ISVA 4K8EA 3F5LA 3F4VA 2A7RA 1L6GA 1TA3B 2ZX5A 3OTRA 5KITA 4KWSA 3VFCA 2XGZA 1M5WA 3W74A 2QIWA 3F4NA 4GK8A 1VQTA 2QCCA 5JVLA 3LV6A 1OG6A 2QAFA 1FVPA 4HHPA 2QDEA 2WXDM 4PMOA 2DY3A 3MS8A 2ZA2A 2CKRA 1TUXA 1VR6A 3VK5A 4W93A 3DN5A 2D2OA 3SN0A 3CO4A 3HFYA 4NX5A 2NSOA 4XZNX 4DWSD 5HJXA 1VRXA 1W5PA 5CAHA 4E4PA 4Q22A 4QGCA 2PLKA 2Z2AA 1UWIA 1EJXC 1VEOA 2PAJA 2QUNA 2VX6A 8XIMA 2EJAA 3G18A 4R7OA 2FVLA 1P43A 3A5FA 1W5QA 1KLZA 1HKKA 1SZEA 1QPOA 3WF0A 1XGDA 4A8IA 2FQIA 1SJCA 3B8IA 4Q4MA 1KA9F 1G7UA 2GJPA 3WD2A 4LS0A 3U2CA 3CZLA 3CUJA 1A5MC 3DENA 3CL7A 4LVBA 1Z9AA 1E1FA 2OSWA 5C7VA 2BXVA 1W1ZA 2A6NA 5D2WA 3TJLA 2YR1A 3DAQA 1MRQA 1XYAA 3EMCA 3HGSA 3VZXA 3EA2A 3CGTA 3RLUA 2BV9A 4HTYA 2R82A 3KWXA 3C2YA 3I3DA 2NVCA 1AODA 4IMDA 1SW3A 2ISSA 1TE6A 4AF0B 1CEOA 4IX0A 3DCPA 2XH4A 2WQDA 1DJGA 2CWXA 3DHUA 2O0TA 2IQ0A 2VEIA 5K9CA 5K4XA 3CQHA 3GRIA 2HBVA 1P6BA 1ECEA 1LF1A 3K8LA 4PFMA 2CBUA 4K1WA 3QSRA 2YPIA 1MI3A 3GXPA 2VELA 1R3VA 4P7NA 1PWMA 2W4XA 2ZX7A 4WQ6A 3RFAA 1QHPA 3PPCA 3TV8A 3GDLA 2W9MA 4W7UA 4W89A 1DPMA 2PRHA 3HQ1A 1TPUA 1FWCC 2PGRA 5SWUA 1A5BA 3ITLA 1VBRA 2AL2A 4POCA 5D04C 3AZTA 1D9EA 1QI5A 3PJXA 1QT1A 2ZYFA 2BDQA 3WMBA 1YW1A 3SFKA 1H63A 1QK0A 1RZMA 3P6LA 5DT5A 1OF8A 3KL0A 3M9YA 3VILA 3BLEA 1YTEA 3NQ2A 2F2HA 4HNOA 2IPJA 3UG3A 1YPFA 1AW5A 1JAEA 4O1BA 7TIMA 3POHA 2PA6A 3HZ3A 4RNHA 3WH9A 2VFFA 3S5ZA 3DUGA 1ISYA 2AOSA 3NEVA 3THUA 1JQVA 3SCVA 5DX7A 2X41A 3BLDA 2WKLA 2WBKA 2F9RA 1JGIA 1A80A 3CQJA 4HPXA 3M7SA 5G5IA 3UR2A 1RD5A 5I3HA 1T99A 4JL1A 2JEQA 4CD5A 2WVVB 1MYRA 2ZX9A 4D72A 4GQGA 1EC9A 3KVJA 1P6WA 3MUIA 4O18A 4ROPA 3ABSA 1SO5A 3B40A 3G1FA 3FXYA 3MUAA 4KETA 1BXNA 1EUAA 3WF2A 2NX3A 4V1XA 3RILA 1MW3A 3LUTA 4OV4A 2ZUUA 3DI0A 4YU1A 2CPUA 2Z6JA 1KRCC 2X1UA 4NY2A 1LBLA 3AISA 1UIOA 4FZIA 4NYYA 3VOHA 4MDOA 3BWWA 4M6UA 3BZJA 3ARWA 1H51A 2GDVA 2YSWA 4MM1A 3W84A 3BDKA 4HT3A 1YTDA 4CCEA 1UD3A 3VGGA 3ONCA 2DZAA 4JIEA 4XBSA 3BAWA 4NYUA 2I5GA 2BXZA 1F07A 2H90A 3VO0A 4PH6A 3RJYA 4JHOA 3TE9A 3WMLA 4TX9A 4WUIA 3PZVA 3CIVA 5HK4A 3EKZA 4PCPA 2VKZG 2PZ0A 4HGXA 3W82A 4HNNA 2YCLA 4BQ2A 3CAVA 2XUCA 3UG8A 4IUGA 3MANA 4KPLA 1FDJA 3SIZA 4AZ6A 4AC7C 5I6SA 3Q2DA 3GNDA 5GJNA 1QBBA 3CUGA 3QY8A 2VFEA 4AD5A 3G3DA 1F6YA 1IZCA 1F4AA 1H5VA 1HQTA 2DSWA 1PZ0A 4CVWA 3VCNA 3CMGA 4IIHA 3KCOA 5DXXA 3L5LA 3TC6A 3TX9A 4LTSA 4YYCA 1QI3A 3SDOA 4H19A 3CIWA 3NOYA 3GH4A 1UQZA 1EX5A 2QLYA 2FJUB 1JYWA 1NIUA 3W6MA 1MDRA 4K3ZA 2XWEA 4BR1A 3LCIA 3PTQA 2O4QA 1GOWA 3GTXA 4E8GA 1R87A 1ZGDA 1R2RA 4N02A 1TPC1 5H8PA 3EBVA 4DZAA 3LN3A 4YPJA 1PCKA 3OVGA 1ODUA 5DQPA 1F9CA 4NQ1A 4AZBA 1VKFA 3H2NA 1RLDA 1V7YA 2YB4A 1UH2A 3ZO9A 4R27A 2YGYA 4L1WA 3DFTA 4MSSA 3TCEA 1PV8A 1V6WA 4S3FA 4TR9A 3BLPX 4QEEA 3EX2A 4Q6JA 3OYZA 2HK1A 1E0UA 2YZRA 4X60A 6CGTA 4R5EA 1X7FA 3VIGA 1RXOB 3TK7A 6TIMA 3WL1A 2QCFA 3GXFA 4TTGA 1CGTA 4J5NA 4M8UA 1PIFA 2ATSA 2YL6A 2PWVA 4S3GA 3FFSA 4MADA 1DE5A 4IMCA 4KH2A 2RUSA 3TNOA 4DLFA 5G2IA 4GJJA 4GYPA 2VJXA 2ZVRA 1E9LA 2BOEX 3ERPA 3D47A 4UMBA 3HB9A 2FTPA 3AMDA 3NZGA 3LSBA 1VJIA 3UFYA 1W2VA 1B0IA 3T0BA 1EJTC 2RHGA 1PZ2A 1V93A 1UROA 3ZR4A 3SCOA 1KFWA 3MKKA 4I9TA 2OJPA 3DGBA 2NSXA 3ZT5A 1V08A 2XYLA 5REQA 1JDCA 5BW6A 5IHRA 3EX1A 3WLPA 1O7AA 1GOXA 4DUXA 4HZ8A 1BTMA 3WNPA 2PRMA 4RZ6A 1GCYA 1DE6A 2CZEA 5DLCA 2J7HA 1Q5MA 2PP3A 5A6MA 1A49A 1JRBA 4HQVA 1C7TA 2FKPA 3RCYA 3A4WA 5DY3A 4CEXC 5JH2A 1IHIA 3UCCA 6XIAA 2Z2UA 2OVLA 1ZENA 3GTNA 4ZCWA 3CZEA 2PF0A 5ENLA 4JNMA 4BF7A 4PCFA 4JIIX 1BVZA 5CCZA 3MI6A 3M0ZA 1X7IA 1GJUA 3ANVA 2XIQA 2PGFA 2QJIA 4LOCA 2PUZA 2X2YA 2QCLA 2W3ZA 3ZFHA 4DZIA 8RUCA 3E2SA 1H3GA 4Q8TA 1Q7MA 2HQAA 2V2DA 2WLYA 4XO7A 3QR0A 2NX1A 2PBGA 2H3BA 5FF7A 4KEMA 2C13A 3RX4A 3LCLA 1EBGA 1LLWA 1OYBA 4XBKA 1KM0A 1YIXA 4QSFA 4WSHA 1LG2A 1A5UA 3UXDA 3KOZA 4C6LA 5H8UA 1G67A 5EPDA 3LPOA 3WY1A 4FLSA 3UJ2A 4PMQA 5A6KA 1DXFA 4I7WA 1V79A 5A5WA 4PB4A 2PU1A 1ELSA 4FF7A 4V2XA 1OSEA 1SW7A 3S6OA 1TR1A 1NF7A 1HF6A 3AHTA 3MVIA 4UOZA 3EYPA 3NG3A 4O1FA 5FI8A 5D2XA 4R34A 3VIPA 1GW9A 3CXOA 4C90A 1BD0A 3P84A 3URNA 4YCOA 2Y4SA 1JFXA 1NWSA 3WLSA 1O66A 4GY0A 3JVAA 3WLNA 4U5IA 1XCXA 3MP4A 3K4AA 3CO8A 2JALA 1F8IA 4AISA 1KXTA 5A6AA 1XH2A 4LVFA 1TCMA 5ABGA 2IMRA 1C3FA 3AS2A 3BLOA 3SUWA 4P7RA 4AMCA 1QO5A 1OG0A 1IGSA 4M80A 3PK7A 4XZLX 1R47A 1QI4A 3T05A 3E1F1 1VBGA 3M7WA 2PODA 2JF6A 1AW1A 3B4UA 3AZSA 1FWTA 2ZIDA 2C3ZA 4LB3A 1GKQA 3F7JA 1ZJBA 1O12A 3SR7A 2OCZA 1XP3A 4E3VA 4ZO6A 3DIPA 3E3HA 2WC7A 5H91A 5CZJA 4HB7A 4BY3A 3C52A 3SCQA 5BXPA 1RK5A 4NILA 1N8IA 2EHHA 1HJQA 1LBFA 3ARZA 4IP4A 1WKFA 3LLFA 3VKKA 3Q37A 3WYZA 3NPVA 1AJ0A 4GGBA 3U6WA 4B5TA 3FOKA 2Q02A 4M56A 3UPWA 2GFTA 4W8BA 2PDGA 1X1OA 1JZ4A 3PTMA 4M82A 4ML9A 3MSYA 3CASA 1XI3A 3IIOA 1EEPA 1MWOA 2VYOA 1REQB 5I3IA 3A13A 4F0LA 7XIMA 2GOKA 2V67A 1XD0A 4AWEA 1W3TA 4YXGA 4P5UA 2X2GA 3VX0A 3WJYA 1W3IA 3KHJA 1TFVA 3SCNA 1UH3A 3ELFA 2DPEA 4OFCA 4M7SA 2W91A 3MP5A 8TIMA 3N9KA 1LL4A 4TVDA 3SB0A 2JFEX 2WHLA 2ZWYA 4GC4A 2Z1WA 5CQ1A 4GXPA 4O17A 3QTPA 4OECA 4JYFA 9RUBA 2CCRA 3GVRA 1OX4A 4RDZA 3FX4A 3I7SA 4FP1A 1W91A 1ZB5A 4L4LA 3CUHA 2XVKA 2KX9A 2YCJA 1G4SA 1W3NA 1I1WA 3VPLA 3QGVA 3IV3A 2P1FA 4JICA 1BF6A 2ADAA 4AZCB 3VX1A 3FSTA 4WXYA 1UB3A 3R89A 1E3ZA 5GNXA 4HYRA 1FOBA 4CD6A 4D6IA 2OKOA 4W87A 1TR9A 2RJHA 3F5JA 3R12A 4RXFA 3N2TA 1WDWA 1VAHA 2VFHA 4DAFA 5KMYA 3L7RA 3ITCA 1CLXA 3B97A 3BGAA 2V6AA 4KWUA 1QOXA 2VD9A 3L0NA 3D6NA 3HG5A 2FDSA 5JUVA 1I6NA 3OJGA 1YADA 1PHQA 1ZCOA 5C7HA 3QW4B 4OIFA 4C6BA 1GK8A 1EJ7L 1V4YA 3SCSA 3EOLA 4Y96A 3WG6A 1LROA 2OKTA 3ARUA 3NURA 4TVCA 2E40A 2DUZA 1XIDA 4KEZA 3T09A 5IDZA 4I8DA 4DJDC 1Z41A 3S9IA 2CXEA 2GQAA 1UWUA 5KEZA 1YDNA 1GTHA 3B8DA 4QNWA 3Q67A 3BAIA 1BKSA 3GB6A 5JH1A 4AVOA 1D3HA 2HXTA 1N8WA 5BMXA 1LT7A 2BG5A 5HNRA 3LG3A 4HU3A 1DEDA 4UB9A 3O7UA 2VMFA 3N1AA 4Q8UA 3T0CA 2JQXA 3FJNA 4GNVA 4D6EA 1S2UA 3W7KA 1XYMA 4FF5A 1WDRA 4RNJA 3HG2A 1QPRA 4GX8A 1Q2RA 2V9DA 4YNGA 4MLRA 4GC3A 3OLGA 3PC0A 3MYPA 1OGBA 3A4XA 4Q8OA 3MDUA 4UQBA 4GJIA 1ME9A 5IBXA 1JGMA 3MCMA 4R7WA 4HU8A 5AYYA 5CSSA 4LVDA 3UR5A 3MUCA 4R85A 3VNMA 2G41A 4QE1A 4NJHA 1Q6CA 1OZMA 3A9BA 1SFJA 1XUZA 3UJRA 1OF6A 2J66A 3N2MA 2HS6A 1FFQA 2OU4A 1WO2A 2BNJA 1FHUA 1OIMA 1BYCA 1IXPA 3ATYA 3P5YA 3VIKA 1W1VA 4O53A 5EYWA 3QXBA 1SQ7A 4HP5A 4C6OA 3PSVA 3G6MA 4GYPC 3ARQA 1XRSA 1UR3M 3QFWA 4EOUA 5HBFA 3BV4A 1HO4A 2JKPA 5BOOA 4JEQA 3KBJA 3R2GA 2X8RA 2IXVA 3M0LA 4ICNA 3UJSA 3ARVA 1M9HA 1XYFA 5AYXA 3MMWA 1H41A 3LZ3A 5JBFA 3PHAA 3CMJA 1QNRA 4GUIA 4NF7A 1PCWA 1FWNA 4I5UA 4DM1A 3MA8A 5CPOA 3N3MA 2OWCA 3UXKA 4XZMX 3U48A 3WDIA 4IP7A 3NO5A 1SJBA 3QHNA 3LTYA 4RNFA 2NVDA 2Q8ZA 2PDPA 2J4GA 3TH6A 2VCCA 1CTNA 1M65A 3MP3A 4B2DA 1WDSA 4H7CA 3N6JA 4UQDA 3WEMA 1R9YA 3QH2A 5CPTA 4TXEA 1G94A 4K37A 3W7NA 1QNSA 5C8BB 4DUVA 3AZRA 1YLVA 4DY1A 3NO3A 1FP8A 2X40A 1JPIA 3QTGA 1T8QA 4NUWA 1EPVA 2PDLA 4JTGA 4WD0A 3W7JA 5TAOA 5DRIA 4HMCA 1KCKA 3IPWA 1EHAA 3LGEA 4Q4PA 3AJ7A 1X38A 4X2RA 3AI0A 1JZ2A 3WQPA 4XWUA 4F8XA 1E73M 3SCRA 1JZ7A 3BO9A 4DXKA 2PB1A 3W7MA 1ZZMA 1OZQA 4JBRA 1OK6A 5EGRA 2Z24A 4HU4A 5EMJA 1TZZA 3NTYA 4HYVA 1TUFA 1LUCB 1FFRA 1UP0A 2J75A 3VIMA 1BWKA 3VIIA 4NI8A 1W8GA 1TVPA 1EQCA 2GGGA 3H53A 2YLLA 4PYSA 4G8TA 2X0HA 2QV4A 5RUBA 4AD3A 4IMGA 4UQEA 4W85A 1E70M 4JFWA 1D2KA 5FSEC 2IKIA 2INZA 3BW4A 3P93A 3N2XA 3RX2A 5CC5A 3UCDA 2DIEA 3CV6A 2BY1A 3CMFA 2XGIA 3A64A 3FKKA 2B7PA 5IHSA 2WAGA 3IIXA 2PTYA 3UR7A 3VMPA 4NZCA 3PTKA 3CPGA 5FKYA 1QNPA 4B16A 4MWAD 1FHVA 3FEQA 1FWGC 1SSGA 1AQHA 5HPOA 4MHBA 3BTNA 1NOFA 2QDGA 1UHVA 1V0KA 5KZDA 2CERA 5K3VA 1V3HA 1AMKA 1XG4A 5LA2A 3V1PA 4DO7A 4PMDA 1QNQA 4O28A 2E4TA 4NZJA 3QMTA 5T9BG 3S6TA 1VB9A 1BYBA 1TIMA 1WZKA 2NWRA 3RR1A 3WQEA 4EWND 2XSXA 3CV1A 2C15A 1KV5A 3HGJA 1ADDA 3T2QA 4S23A 4ZO9A 1GG0A 2GL5A 4EX4A 1F4HA 3ZM8A 1XIIA 2BOFX 1JZ3A 3KRUA 4GZEA 3S1XA 4A4AA 3M4HA 5FF0A 5C54A 5BZAA 2WYSA 2OOFA 3E6EA 1XICA 1JQXA 1VZWA 3C2RA 2P76A 1JCYA 5K7JA 3TDFA 2YBUA 1PYMA 3QV9A 4ZZ9A 1XYZA 1RHCA 2Z6IA 2WPBA 2OYLA 3N3TA 5HJYA 3NPWA 1MRAA 3GSMA 4V33A 1IIHA 1XBXA 1AJ2A 3UY7A 5BXSA 7ENLA 4GH3A 3L5MA 4J9JA 3DYOA 3PY2A 4L56A 1W1TA 1GVIA 4Q8VA 1JYXA 2QNEA 1B3XA 4YWIA 3H6OA 1SGJA 1UZ4A 3AIEA 1AH3A 4C6DA 3XIMA 1CXKA 4HCHA 2FHFA 3IJIA 3W1AA 4AQLA 1VP5A 3AFBA 3L5AA 3L4TA 4QCFA 4C6JA 1M53A 3PM6A 3VGFA 2PDQA 4M81A 1M03A 2CHNA 5EBUA 1BXCA 1ZY9A 5D2TA 1ISWA 4JKMA 4U3AA 1CI1A 3B0XA 2FZBA 1YXDA 1HUVA 3KRZA 1IEQA 2PDKA 3MT1A 3WD1A 4HU0A 1KTNA 4JTJA 1SSDA 4RKAA 4YYFA 3KEHA 3OBKA 2FB2A 2PI6A 3VAVA 2XJ7A 4ZR8A 1Q8JA 3L12A 1GJWA 3AS1A 3IIVA 3WH7A 4J3UA 3AXIA 3NQFA 2PDYA 2W0UA 1VBHA 2YXGA 1CXFA 1E9IA 3IGHX 4O15A 4N9CA 3IIZA 4XAGA 2CLMA 1RP9A 4GZIA 1QBAA 1GVYA 2EG6A 3N73A 1BFNA 4B5NA 4GPNA 1OY0A 4JTAA 2B81A 5EFFA 2E5CA 3HQOA 7TAAA 3OHIA 3IJ8A 1FWHC 2QAPA 1Z7AA 2WVUA 3O06A 4RDVA 4QAWA 1W1B1 1NDYA 3NUKA 1KCZA 3T8LA 4MUPA 3FLUA 1ONWA 3SRDA 2AGKA 2B7NA 3EMZA 5HUPA 3E2RA 1DIKA 4DBUA 1QK2A 3MHGA 2CLFA 2G5WA 1XLFA 3B0YA 3USBA 3O07A 4TV6A 5EBAA 4U3CA 1H61A 4JFUA 4BFAA 3DU0A 1IR2A 1G6CA 3SAZA 2G95A 3KCLA 2PTXA 2DIJA 4WEVX 3N2OA 1S3TC 4AVNA 2V69A 2XFFA 2NUXA 5PTDA 4UTHA 1F61A 1ZBVA 4AZ7A 1YRRA 4ZQRA 5F7UA 3XINA 2POTA 3M16A 4I90A 3LPGA 1RQHA 3ITTA 2CHOA 4EPEC 1PXGA 4V27A 3L4UA 4ZFMA 5T91A 5LA0A 3HBLA 8A3HA 5I02A 4MIMA 4ZOEA 4O1CA 4XZIA 1XM3A 5CPSA 4LC8A 4FIRA 1VC4A 2HBXA 3BMVA 2CWNA 5I3DA 4S3CA 3V18A 3TW9A 5CBIA 3UPMA 5C9XA 3MV11 4FEZA 3C2OA 4WKAA 3GVVA 1VENA 4MPQA 3D0CA 4ACZA 1ZBKA 4Z2JA 5BRPA 5I5RA 4BZYA 3URAA 4PMNA 4H9YA 2XM1A 5IDIA 3WD3A 3ZJ7A 3U5YA 5DT7A 5I78A 3WNKA 4FX7A 2D3NA 2V63A 3QF0A 2GQ9A 2FGLA 5A8PA 1XCFA 4QDMA 1N2VA 1UOZA 5EMUA 3H2AA 2HISA 2CLKA 1VJSA 4P8XA 2CZFA 1BWLA 1RPXA 4H1ZA 3W7LA 1VPYA 3T0DA 2C18A 4Z2GA 1I2NA 4CGTA 4QR6A 3GR4A 4CU8A 2CETA 4DM2A 3CHVA 3B0VC 2E6YA 2O7QA 4GCAA 5KETA 1ITXA 3W70A 1I60A 3F2DA 2W5FA 2X1TA 1ZPTA 3QC0A 3QOKA 4Z42C 2PDIA 2Z2BA 1MW0A 3QPEA 3T4WA 3GNOA 2WJEA 3G1YA 2R1LA 2NUYA 3CUZA 1U83A 4HMDA 5T9CE 1YNQA 1TJ2A 1O94A 1QMLA 4L4OA 2GYIA 2CYGA 2D2HA 2WNQA 1JPDX 3FYYA 1WUEA 3VM5A 3LNPA 1RALA 2HPMA 5FEWA 4LAKA 3FDGA 3E0WA 2D0HA 4REQA 4EF8A 3CYJA 1XIMA 2XH0A 4LF2A 2DFAA 2E9LA 2YDAA 3GUWA 3TYUA 1S5VA 4HNTA 3LQLA 3SY8A 3W23A 1X6LA 4WY0B 2YCKX 1TWSA 1XLLA 4J3TA 5K9XA 1UASA 1S2AA 3QHMA 2BGQA 4EK7A 3I10A 4ALDA 2E0PA 1SW0A 2XPKA 2GVLA 3SRKA 3WEOA 3SRFA 3ZJ6A 3TTOA 4XAZA 3PFRA 3P3BA 2FZMA 3S6DA 2EG8A 1NWRA 4IQDA 4MJMA 3SJNA 1C8YA 5A8OA 1RCXB 4URIA 3WQCA 4XTDA 2NQJA 3AU2A 4M29A 4RW3A 4KRTA 4CNUA 4H7ZA 3BLLA 3GIPA 3TJXA 3TNBA 1MUWA 3AS0A 4OUEA 1RCOB 1ODZA 4D1IA 4ENLA 2R8WA 1OFPA 4LYQA 2GUYA 3BL3A 1W5MA 3B3DA 4TV5A 1WBHA 2XGBA 5DBTA 4GBUA 3W2KA 2YCLB 4A3HA 3PPFA 3ABQA 1SVDA 3O1NA 3NL5A 1IT8A 1CGWA 1VIZA 3V3WA 1E6PA 1THFD 5I3FA 4PBFA 4BS0A 1FWBC 1OABA 3OBEA 3ABZA 2ZX6A 2ZXAA 1HKWA 3BLFA 3CNYA 4XZHA 4FK9A 5FIPA 1BQCA 1UKPA 1YPXA 4G1KA 4OHQA 3WBAA 4L65A 4IQLA 3QY6A 5HR7A 3UCQA 2VEFA 1G01A 1WKYA 1RP8A 2XHYA 1ZFJA 4AIEA 1K9EA 2Q6ZA 3KTSA 1OADA 3ZZ1A 2J27A 3OVRA 4DYJA 3L4VA 3UZ5A 4ZO8A 4AYSA 3KZPA 1DJHA 2J7CA 3RPDA 2VC7A 2PF8A 1EGMA 3PJWA 1LTDA 4Q4RA 2WZHA 2V38A 5E9AA 5HMEA 1OD0A 3M0IA 2GWNA 3WQWA 1TPDA 4O12A 3SUSA 1KXHA 5A6LA 3GM8A 4HHMA 3STGA 3WF4A 2O92A 1B3OA 4B4HA 2A5HA 5CC3A 1LDCA 1Q6EA 4U5KA 4F0SA 3WLLA 2FMNA 3L2LA 4LSBA 1LUCA 4CQBA 3JUGA 3RO6A 4A2SA 1UD6A 4W86A 2A0NA 2OYMA 3RG6A 3GXDA 5B7ZA 5DFAA 2Y8VA 4INFA 1AA1B 3R8GA 3F4CA 1NY1A 4DJFA 1TPWA 2SFPA 2JGQA 2CC0A 4XX6A 1KGUA 3QYQA 3U7BA 1YBQB 3EXSA 3S46A 4JIQA 1ZP4A 3LB0A 3QR1A 3WLMA 4J40A 3DEQA 4PULA 4AXNA 3W29A 1EWDA 2ZA1A 3WQ5A 3TWAA 3MJYA 3LHVA 4JTFA 3WJWA 1UR0A 1O95A 2ZRYA 3J7HA 3EA1A 2FZ9A 3PAOA 3TQKA 3TYDA 2WVTA 3DFYA 2VZUA 2MANA 2Y7DA 4E2BA 4H00A 4WRHA 4DUOA 1YPIA 1BPLB 1Y5VA 4IGSA 2F38A 4EIVA 1PVNA 1E56A 3MKCA 4PTDA 3ZXWA 3EEZA 4HKPA 5C6MA 4MB1A 1T6MA 3RLHA 1GYMA 4AX7A 3M1ZA 3CK5A 2BTMA 4IIEA 5CBBA 4KESA 1MFUA 5FEPA 1IZKA 1OFDA 2V5JA 3AIQA 2C1HA 3UXIA 4QLKA 4CD4A 1CCWB 3O2LA 3VFLA 2J79A 1ZHAA 4HBKA 2WMHA 1S5NA 3KFTA 2YOCA 1IWAA 5G4HC 4GZJA 4XKYA 3C86A 3G2GA 3HO8A 2G0WA 3V75A 2F61A 3EOSA 1WPCA 1W3LA 4IFRA 1Q65A 4H2HA 2EPLX 5HNUA 4O0ZA 3W2NA 2CLLA 3NQDA 5G4EA 3MJMA 3K4DA 3W4RA 2QJMA 3GG1A 2XU2A 3UA3A 3QBUA 3N4AA 1K8XA 1UWAA 3U57A 4UNIA 3ABRA 3L65A 2D24A 4F9JA 4FX6M 4A21A 4RE0A 1GYLA 4UR9A 2CLPA 4ZFCA 1UUOA 1V0NA 1YE4A 4AY7A 4GVFA 1OFQA 2OLHA 1N8FA 1GZJA 3GTIA 5GPRA 3LM7A 4AD2A 1KD0A 1ISZA 2PE4A 3PUDA 4GI4A 3DG3A 1PKYA 1DOSA 3FJ6A 4BQ4A 1UP2A 4DWSC 5I09A 3VMOA 4UR8A 1JAKA 3E2QA 3CH0A 4QQUA 4FI4A 2O9TA 4ADTA 1CB7B 2YYUA 2GZXA 3R7MA 3EDDA 4TU1A 5LHEA 1DKWA 1WUFA 3E02A 1OCJA 3AU6A 1Z8AA 4XZ9A 2GJNA 3M0XA 3TEVA 2FLIA 4NXSA 2QCDA 4FAMA 1HKJA 5CBJA 1EGZA 4JIRA 4NVTA 3ITGA 2J47A 3BUVA 2EPOA 3UWWA 2YBVA 1XLJA 1WE5A 3ENLA 2HV5A 3NZPA 4F0KA 4DF1A 3ONBA 3SCWA 2GSJA 3BVJA 4ZE5A 2V8ZA 2CNCA 6PTDA 2QMJA 3UERA 4Q7IA 1B9ZA 3BGGA 2PWDA 3FV9A 1IXOA 1MSSA 4QXIA 1UQYA 3W1PA 3KBVA 3WNLA 3AWOA 3SSJA 4PUEA 1KFKA 1ZAJA 2XG9A 1L6FA 1QWKA 4UNKA 2X42A 4IIFA 4K38A 1KBKA 2DH3A 8XIAA 3H21A 1XPYA 4AH7A 3BV7A 2GOUA 5FJIA 1Q2SA 4GYKA 4UCFA 2HK0A 1CENA 4G56A 4O4WA 2QJNA 3GDRA 3V5FA 3LEPA 3P8JA 4LJ3A 4OGZA 3VE7A 4JTKA 2XH7A 2A3BA 2O9RA 5DMMA 4EE9A 2F84A 1VCVA 2OEMA 1D7FA 2YFNA 3EMQA 2XWDA 4XAFA 4BKNA 1EF3A 4ERIA 3PJUA 3JU2A 1QHZA 3DC0A 4XKMA 4XKYB 4US5A 1XV8A 3GZ3A 4C6FA 1JPMA 3JW7A 1OX4B 3W01A 4L9XA 1GUVA 2REQB 5D9MA 5HPCA 3OG3A 3IS4A 3WBXA 3UW6A 3ECQA 1FUYA 1X98A 3M0YA 3KZSA 4HTBA 2R14A 3EX6A 3UVAA 3UZZA 1B4EA 4ADSA 1M01A 4M24A 1CIUA 3A23A 1H60A 5HULA 3S5NA 2KZHA 1DHKA 2HNEA 4O0QA 2C6QA 3W1MA 2ZDRA 4OUIA 1MQPA 3CHDA 2A21A 1V3KA 4MF4A 1HJWA 3H70A 1BYAA 1HXJA 3CTLA 2VWSA 2CHRA 3GC2A 4IIDA 2HZGA 4D8LA 1AD1A 2HNHA 3RDKA 1NFBA 1DP0A 3H26A 2V68A 2BY0A 3FEMA 1JCTA 4PRTA 1AG1O 4HMNA 3M0VA 1B3YA 4IT1A 2QCGA 2NLIA 1W6TA 3BSGA 4AEEA 1L2UA 4Q4QA 4IH3A 5E0KA 1ZU8A 2FDMA 4PFHA 4OZOA 1KKOA 3Q65A 2XN2A 3BK0A 1TPEA 4H9VA 3APYA 2ZUWA 3L0KA 1ITUA 1NF0A 3B9DA 3HPFA 5LIUX 3NM3A 4PR4A 1ZBCA 3BPWA 4L64A 3AOFA 4LWWA 4H8HA 4KIEA 1DQWA 3CEUA 1TKKA 1UWQA 4M6QA 1DJYA 4BJHA 2IQDA 1GW1A 2OTDA 1UPMB 4V28A 3UNDA 3ANUA 4S3JA 4IFKB 3UY8A 3DC8A 1WKDA 3FA3A 3LHWA 4S2CA 4IMFA 1JCNA 2XISA 3N04A 4UFIA 4GE8A 5E09A 3I7RA 3R0DA 5B7YA 3BJTA 3WENA 3PNZA 1JDDA 3OU8A 1A47A 3GQYA 4YN5A 5LNVA 3G1DA 4H41A 4C6EA 2WVSA 3S83A 4WCJA 2YXXA 1Z32X 3A4AA 4E6MA 3IUIA 3QLDA 4KW2A 4Q32A 2OPJA 1XPGA 4UTFA 1KW1A 1ZSXA 2ZZ1A 2Y70A 4NRSA 3MMUA 4NRRA 1VF8A 1NFGA 5MF5A 3LA4A 4H3DA 1P1MA 4ATDA 3UWVA 1RUSA 4GBDA 3TR2A 2OT1A 3PFMA 4MNMA 3KLLA 4DN1A 3CH9A 4X0VA 3PB0A 2QPSA 1KM2A 5E93A 2Y5SA 3A47A 5DY2A 1O6IA 2DSZA 4NASA 1TE1A 4NZFA 1PKLA 5HWNA 3NQ8A 2FHBA 3W2MA 2VNCA 3KS6A 3JZUA 3G1XA 4CD7A 1TYGA 1WA3A 4F0HA 1J18A 4A3QA 1KWGA 2V5CA 1PTDA 1UMYA 3W76A 3AYRA 3GE7A 4S2BA 4GQBA 2QULA 4FR6A 2PZNA 4NJKA 1XCWA 4R9OA 5HNTA 4S38A 4AIOA 5FJRA 4RE3A 4LEFA 3KTCA 4L4PA 3RM4A 1TPB1 5KSWA 1R85A 2EF9A 3UYIA 3WO8A 1QW7A 3F4WA 4ZL1A 4WLCA 3N2CA 3VD3A 3CM4A 4GY7A 4XV0A 4D6CA 3QRHA 2Q01A 1N55A 1HG3A 4NG3A