4AVZA

Tailspike protein mutant e372q of e. coli bacteriophage hk620
Total Genus 226
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
226
sequence length
598
structure length
598
Chain Sequence
DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAIL SPIKE PROTEIN
publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 226
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4avzA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4avzA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4avzA02
4XMYA 2QX3A 4AVZA 2PECA 1DBOA 1BHEA 4W8SA 1IDJA 2NT6A 3ZPPA 1O8FA 1GQ8A 1OGMX 4XORA 4C2LA 4YELA 4NK8A 1QCXA 2X6XA 1JRGA 5AMVA 1O8IA 2NTPA 2NSTA 4XN3A 2VBEA 4XM3A 2EWEA 1JTAA 1X0CA 3B4NA 2Z8GA 1KCCA 3ZSCA 2O0VA 1O8DA 2INVA 4Z05A 4XOPA 4OJPA 4W8TA 5C1EA 3B90A 4OJ5A 2NTBA 4OJOA 1OOCA 3VMVA 4W8RA 1KCDA 3KRGA 4NK6A 1CZFA 3GQ9A 2VJIA 2O1DA 2NT9A 2UVFA 3T9GA 5C1CA 4YEJA 4OZYA 1H80A 3GQAA 1VBLA 4URRA 2VJJA 2VBKA 4YZQA 1KTWA 4XKWA 1O8HA 3VSVA 3JURA 1HG8A 3UW0A 2O17A 3EQNA 2VBMA 3VSUA 2BSPA 1QJVA 4MR0A 1O88A 1OFLA 1IB4A 2INUA 1O8MA 4XL9A 3SUCA 1PXZA 3WWGA 2O04A 4XR6A 2PYGA 4W8QA 2X6YA 4OJ6A 2QY1A 1EE6A 2X3HA 1O8JA 1IDKA 3B8YA 4XONA 2ODLA 4Z03A 4OJLA 2IQ7A 4PMHA 4OZZA 3FY3A 4XOTA 4YZ0A 4I84A 1O8EA 2X85A 4XLAA 4XNFA 1RU4A 4Z06A 4YZXA 2PYHA 1BN8A 1OFMA 4EW9A 3LMWA 4HWVA 2NTQA 4U4BA 1AIRA 3EQOA 4XQFA 1WMRA 3VSTA 4XLCA 1RWRA 1K5CA 4XLHA 3GQ7A 1OGOX 1PLUA 1XG2A 2NSPA 4U49A 1DBGA 1O8LA 3GQ8A 1NHCA 1PE9A 4XLFA 4XLEA 1IA5A 3VMWA 1O8GA 2QXZA 2X6WA 2O0WA 1O8KA 2NZMA 4XN0A 2UVEA 1RMGA 4MXNA 4YZAA 3GRHA 4XKVA
chains in the Genus database with same CATH superfamily
2HEOA 4P9UA 2R92J 1T08B 1IW7F 3IUOA 2ZFUA 3BH4A 3QYFA 1BHEA 4ZYGA 4XRMA 1Q1HA 3IHUA 4AC9A 2UV1A 3Q5FA 1H42A 2VQGA 4P9FA 4TMTA 3E1YE 5FKLA 1TNTA 3CCRB 4EV0A 2C5BA 5FD6A 4GRIA 3PJRA 1S72I 3H9JA 5DTDA 3S1RJ 2IGKA 4M9XA 1ZLKA 5C4JJ 3GTKJ 4G7OF 2R7XA 2WZPP 3L2WA 3WU2C 5M5WJ 3DEUA 5CYVA 3DTIA 1QPMA 1KU9A 4I0BA 3OKXA 4F92B 2V6CA 4E0FA 2D5VA 4PGHA 2LSOA 3HPHA 4DK1A 2ZXIA 1SC7A 4NB5A 4A3IJ 2Z16A 3TW6A 1TSPA 2IJLA 5EZGA 4NK6A 2CSOA 2E7XA 2X4HA 2EIMH 2BX6A 3HUGA 3MKLA 2B5OA 2NT9A 1X1DA 2PX9A 1M1KD 2ZJQF 2PMZN 2IOUG 3GQAA 1LE8A 2JDIA 1FMVA 5D5VB 4KA4A 1WSRA 4F52A 1VHOA 1VQNB 3OR2C 4HA8A 2W00A 2GJRA 1YHQB 4CXFA 1LDKB 2AQEA 2WA0A 4V02C 3OW7A 3BG9A 2H8RA 3MD2A 3ZXSA 2HPMA 3HSFA 1FJLA 2JJ1A 1EZGA 4OPOA 2IEKA 2W84A 4EJUA 4M3GA 1J0RA 1QNTA 2BOLA 2J5PA 1WDTA 1D5VA 3BR1A 1E3PA 1NHAA 1X1PA 3LSKA 1E3XA 2UUZA 1FNBA 1H8EA 1FY7A 3BTCA 1LLZA 3NWTA 1STZA 1WQ2A 3ZQ7A 5D5XB 4A3MJ 2CQQA 2DMUA 1Y0YA 3G4SB 2QN6A 1V0FA 1K61A 3O8HA 5D8KB 1Z6TA 5JVGF 4NBSA 1EE6A 2G0YA 3FISA 1XCBA 1IDKA 1VFCA 4C2UA 2WAQN 2E1BA 4FX0A 1TLLA 1B9NA 2KIMA 4WF2A 1X2NA 1XGNA 3VYRB 3OP1A 3Q6RA 4BPRA 1W5CC 1XX5A 2VFNA 5JVTA 1QA2A 3ZGKA 2CK3A 3S14J 2HQRA 2ZNYA 2EFOA 1WI9A 1R5ID 5IYDJ 2VFMA 1MNDA 2NOGA 2P8TA 3G1LA 4CYDA 3HOSA 3A3GA 2BXYA 3ZBUA 1MH3A 2D9RA 2EQRA 3KZZA 3H35A 4CUGA 2FD5A 2N8GA 3LAJA 2RNJA 2V9PA 2F2EA 4MQ9F 4AYBN 3MZHA 3BG7A 1D8JA 1FOWA 1SKQA 2D74A 2XZLA 2Y30A 2BEOA 2OA4A 4BBSJ 2ID3A 3AL0C 2GQQA 1R5NA 1FTZA 2QE7A 4K1XA 5FNZA 4XLEA 3CD6I 2COBA 1PYVA 3VSLA 2DA6A 4N9IA 4R79A 5JR3A 1VQKI 2X1CA 4A3GJ 3JCUC 1ERDA 4M1KA 1K8FA 2BY1A 2HOEA 2Y9ZA 1V0EA 1K8AD 4QIWN 4ZYDA 1A36A 2B0LA 2OC6A 2QBYA 3CJQB 4XKVA 5DV5A 1HA8A 4P3IA 2IVMA 2IBDA 3F8BA 1CGPA 3EYYA 1VQLB 4OPWA 1D0ZA 1SFEA 2P81A 4ENNA 3KFWX 2VC0A 3SEZA 1E17A 5LRRA 4UAJA 4YIRX 1ZR4A 5F4MA 1EH6A 4BQOA 1RZ4A 2ETHA 1GJRA 3WNBA 2VNIA 1QBJA 1IC8A 1CQTA 2XAFA 2CJJA 1EFRA 1JT6A 4GFBA 4WQMA 2O03A 2NSTA 1ZG1A 4XD7A 1BIBA 2RAEA 2BW3B 3KP6A 1ETXA 5EGOB 3ZR8X 1LEBA 4MGRA 3B8HA 1ZHFA 3ZQLA 4RD3A 1MNMC 4G94A 2Z8GA 3QU3A 1KCCA 3CCMI 1FLIA 1TTYA 1RC9A 4LFUA 2WV0A 3BCDA 4EM1A 4JX6A 1UFMA 2NS0A 5B5EC 1VQMI 4HF0A 1KK0A 2ELHA 4C3IJ 1XSVA 2JSCA 3HRUA 3OJWA 3SJMA 4QSHA 1MKMA 3NEUA 3VPRA 4WZTA 2F3LA 4BEHB 1N07A 3F72A 4LMYA 4LJZF 4RM0A 2A05A 3MKYB 1H80A 3CMAI 4F55A 4BNCA 3B82A 2CFXA 3LSJA 5FJ8J 3IP4B 3F9KA 4AIDA 1IDZA 1JI8A 3WODF 5DS0A 4B4CA 4YZQA 3IKVA 3SJZA 2G7UA 3ASOH 1M90D 2DMQA 2M30A 2HI3A 2B7EA 2KLOA 1L3LA 2H1LA 3DPUA 4GO1A 5L46A 4ZYHA 1ELOA 1R22A 3T1BA 1TWAJ 2QWWA 3PL8A 1FTTA 1K78B 4MR0A 4P9SA 2Z2SB 3OL4A 4L8JA 2VC1A 3CCSI 4L0ZB 3SUCA 1D1AA 4XR6A 3L2VA 4OJ6A 2EILH 2O61A 3BQZA 3Q6QA 4G7XA 3RQ4A 3OYNA 1EXMA 4XONA 1FRQA 4FT8A 1AOYA 2BXZA 2XEXA 2MFZA 1OR7A 2R7QA 2F5CA 4BQQA 4UUVA 2ECBA 2JSPA 2AS5F 3K4MA 1VQ4B 3V42A 4LBYA 2X85A 4FQGA 3VYSB 3T51B 2JWTA 1OR7C 1BN8A 5F4JA 1YRNA 1QQIA 1Y6IA 2DTZA 2DJIA 2K9NA 2L02A 5E8IA 2VYQA 2LBFA 5CKTA 4ZTJA 4A3CJ 4PC2A 3ISXA 3CCJB 1HSTA 2XPWA 3ZMVA 4HNVA 2JUCA 1O4XA 3GLLA 3EQOA 4C2MJ 2EV6A 3ZP5A 5E8GA 1PJ7A 3F22A 1RI7A 2R7OA 1F60A 4RLZA 1K28D 4ZH4F 2L7ZA 1W0KA 5EG0B 4KJZA 1OYYA 3OYAA 3M8FA 4PJLA 3NQOA 2RGVA 2W6JA 3RI4A 1UMKA 2VBTA 4X6AJ 1Y0UA 4PDKA 5HLIA 1PUFB 1T8IA 2B7BA 1TP4A 4J00A 1S8NA 3U21A 4CCNA 2UVEA 2QA4B 1S3JA 5ED4A 2V7WA 4XKBA 3LQQA 1JJ2B 3ZMTA 1QGZA 2CF4A 3BJ6A 3AFHA 3WTVC 2A69F 2QSFX 5F04A 2A6HF 2K02A 3TEDA 2JRMA 1I7PA 3CCUB 2V9VA 2BY3A 4FXUA 3OAAA 5FFXA 2O5RA 1J75A 4WZLA 2E1MC 3PUMA 5TGTA 1TW3A 2XGDA 3E0JB 3Q3SA 2WJYA 2MLGA 3ASNH 3W3CA 2O6WA 2BM6A 2E34A 4RS8A 1W7PB 3IRQA 3KLNA 1B8IB 1HW2A 3PIPF 2VT2A 4Z2YA 2OD5A 2RKHA 2LNBA 3CTAA 2PJRA 1UAAA 4OIOF 4U9UA 1G7SA 3MKWB 3IAM2 4W97A 4Y13A 2YU3A 2CV1A 1VLYA 5HDKA 1RUOA 3NAWA 2WTEA 5EYRA 2W82A 2EFGA 4OIQF 3KP7A 3HBLA 5FFZA 4W8TA 5E3MA 2L01A 1E79A 1YHQI 4AIKA 1E64A 1B4AA 4RPDA 5DCFA 2D3NA 2P3MA 3W6VA 3EQLF 3ESWB 1UCRA 4OZYA 5K7FA 4Z4VA 1LKXA 1WSUA 2OBSA 4DNTB 1T0FC 4Z4YA 2FU4A 5KW9A 3AG4H 3KZIC 2M9HA 3KYLA 4LITA 2HU9A 3OYMA 5KAFC 2XV4S 3G6EI 2NVYJ 3OPOA 3S2WA 3HYIA 1I8DA 2FOWA 5LRSA 2WSSA 2O7OA 3R61A 4X06A 3KEOA 1U5TA 3KP2A 3FXKA 1K6YA 1Z3XA 2FE3A 3QAHA 1W0UA 2HTJA 1C0WA 1FX0A 3F8CA 4M73A 3MZ8A 3OMYA 1FP2A 4LG0A 4BJ5C 2MH2A 3W2FA 1U5TC 2EA4A 3WGIA 2A07F 2CRGA 4HLXA 5LD2C 1TYVA 3D0SA 4OMYA 5CVIA 2A61A 2MC4A 4IKFA 1KK1A 3OS0A 1XPXA 1T56A 1QVFB 1WJFA 4M9ZA 3CC7B 4ANJA 2ECCA 5BQTA 1HDDC 2JA7J 3OYDA 3RY8A 3AGQA 2PMHA 1FRNA 4UVAA 2O3FA 1IB0A 1PJ6A 2XROA 4KDPA 3M8JA 3CF2A 4M6YA 1RWRA 2LF7A 1MMAA 1NB0A 3K70C 1G7CA 4YALA 1W36D 3PFYA 1G7TA 1Y8RB 3DXJF 1DGWY 4NDLA 1UD4A 3S3MA 4O3MA 2FVGA 3DV8A 4XRFA 1LVKA 3WTSC 3KEYA 1QZZA 1MNEA 1R7JA 1FSEA 2OF7A 3ZIAA 3VFZA 5GAEJ 2V7XA 4FWTA 1VQLI 2IPQX 3W6KB 1LFPA 2L7KA 4U87A 4Y33A 4OWRB 3JRIA 1DG1G 2F5FA 1MSFC 3FBNB 2ZKZA 2DCUA 2E36A 1HW1A 2LZJA 1HF2A 1QUFA 2JVHA 3CMYA 1X58A 3M4OJ 1HZEA 3CJTB 3DLAA 3WTUC 4KFCA 4E70A 2QX3A 1LDJA 3WTTC 1JKRC 5J3LA 5FLMJ 5H5JA 2VNJA 3ZPPA 1H9TA 1O57A 1UD6A 2GM4A 1J5YA 2O8XA 2E1RA 4A69C 2D2WA 2BSAA 5AMVA 4KN4X 3JAMK 1P4AA 3PO3J 2KRHA 2E7WA 2GAUA 2JJ7A 2O6GE 2CNDA 3SLDA 5BSYA 2L9NA 5ICGA 3IV5A 1GAQA 3ZZ0A 4EM0B 2E5NA 1YX2A 1U0JA 2M45A 1WU8A 1QRYA 4FN5A 4ACBA 1ENHA 3BJAA 2XOKA 1TBXA 4BY1J 3CC4B 4RBOA 4HNTA 4M53A 3J81Z 4D1QA 2BBYA 3VMVA 2ZFWA 4ZGQB 1IAWA 1GAWA 4BUPA 3BP8A 4MLOA 5IPAA 3H3UA 3TBIA 3AL0B 4OOIA 5FLXK 2J8IA 2LF8A 3LL7A 2Q8KA 2ZZEA 4KITB 4ESFA 2HOTA 2VBKA 2XNCA 4M3FA 1QHGA 1IRFA 3VDXA 3ABTA 1WH5A 4X05A 1WH7A 3CB4A 5A88A 1EA0A 3A03A 2L2OA 4CCOA 3GVLA 3ASQA 4CCMA 3QOEA 5DDGA 4Y15A 2HDCA 3SKBA 1B1BA 2DDAA 1E3HA 4ZV4A 3ERED 2DU9A 2LC2A 3NRVA 1GO2A 2Y0SN 2X51A 3A0HC 3L9FA 4MTDA 3ULQB 5JLWA 3SXYA 2E1OA 1PXZA 1ZK8A 2V7VA 4Y9RA 3MZYA 1IF1A 1VQ4I 3HOYJ 4BL0B 4PGOA 2F6CA 2ZSHB 4RM3A 3M3YJ 3GTGJ 4H4KC 1ZGWA 3KETA 3GTOJ 3GZ5A 3JRAA 2W48A 4P55A 4PMHA 1RETA 3FBIB 4HW0A 4I0AA 2ZJPF 4H0EA 4AIJA 1MJBA 4Z06A 4ESJA 2A5YB 1IN5A 3DTKA 4OIRF 1PJ5A 3N97A 1WTHD 5J1UA 3UNGC 1IJWC 2EV0A 2M34A 4NQWB 1IN4A 2XAJA 4UB6C 2EJRA 4U4BA 1MBKA 4HQMA 2W57A 1KQ0A 4XQFA 5L3GA 1DDIA 4WWVA 1T2KA 5C4XJ 4RD1A 1O3QA 1TTTA 1FNNA 1N05A 3RYPA 3JSOA 4UVBA 1BJAA 2QA4I 5KVRA 3WG7H 5L3BA 4V19K 4OPVA 4OAZA 5CPRB 5GV8A 2BW3A 1OQYA 5LEKA 5F64A 4I02A 4XN0A 2C6YA 3QSYA 1E0EA 3E3VA 2XAHA 5AIQA 2OTJB 2CUJA 1MJ9A 1YYVA 4XMYA 4RLFA 3OYFA 5IOZA 1HVXA 1WOPA 4MYUA 2VNHA 4RD0A 3M8EA 4CYCA 1ETWA 4RM2A 2XASA 2X0KA 2K40A 4XORA 3RKYA 3BCFA 1MBFA 1T95A 1JGSA 4BEHA 4NK8A 3ZQQA 1CQXA 2PEXA 5L3CA 1UHSA 3ASRA 5F0FA 3SQVA 1FOXA 3OOPA 5IP9J 2DA7A 3VMFA 5DN6A 3QFTA 2G9WA 1FBSA 3OS1A 3QFSA 1MJAA 3CO6C 3HG9A 1H89C 1VQ6I 1WVRA 2VT3A 4YFNF 4XIDA 2B7CA 1KU2A 4CH7A 3CCEB 5A8AA 5ERIA 4A6EA 4HV5A 2BV6A 3ZQFA 4TN1A 3TP0A 1R49A 4P12A 3G2BA 1ZKGA 3WGHA 4QVJA 2X3UA 3VR6A 5JLVC 2KP6A 1UD3A 1K6OA 1GR1A 5FKKA 3W2VA 2BM5A 3OOCA 1K78A 3IWFA 3NE5B 1D3YA 2CGPA 1YI2I 4M72A 1OLTA 1ZM9A 3QFRA 2KZVA 1XDSA 2QMUA 2QCOA 1X19A 1ZGAA 5M3FJ 3I0TA 1REPC 4G6QA 4MQVA 4P6VF 1TNSA 4P2NA 4YAFA 2BM0A 3QFCA 5HXBA 1KTWA 3A8IA 3SZGA 4U0WA 3WWGA 1GLNA 3CPXA 1B72B 2DPDA 1QG0A 3VYUB 1XB4A 3ML6A 1RNLA 3OS2A 2VBXA 5THXA 2X1DA 3Q3AA 3EDPA 1QJVA 2A68F 2E1MB 4DJAA 5LEJA 2R7UA 2IP2A 5JHFA 4A6DA 1OFLA 3MCZA 3CMEI 3IH3A 1QA6A 2AO9A 1IXSB 2FMLA 3GMEA 5JLXA 4EVIA 1YJNI 1XQBA 5EF6A 3O2PE 2DCEA 5TJJA 2R0QC 1ZN2A 5TR9A 2P5VA 4M6VA 5B66C 3VEPA 1UD8A 3AG2H 5EG0A 3SHFA 1VF7A 4R1HA 4ZTFA 1X2MA 3ZUGA 2CH0A 2R7DA 1QO0D 4QPOA 3CC7I 1IRGA 2VASA 3IWZA 3PVDA 4Z1MA 3G3ZA 4WK8F 4DK0A 4OJLA 4BQNA 3IRRA 2PJRB 1PUFA 1FNMA 3FXOA 4ACAA 4KN7X 2OV7A 3FMSA 2CV0A 3U9GA 3LA7A 1SMYF 3LQRA 3BY2A 3ZBTA 1DU6A 2JPBA 4EATA 2XTXA 2EPFA 1YG2A 1H0MA 1WORA 3A4CA 2A5WA 3CZ6A 1P2FA 1WJCA 4A0ZA 1UB9A 1Z21A 2D1VA 2ELKA 1AIRA 3OWTA 2A3SA 2NNNA 1Z9CA 2JT1A 4L9JA 4F93B 2R7VA 5LFAA 2O8KA 4U49A 5BPDA 2RN7A 1NHCA 4DBRA 1GVHA 1XCVA 4QLCU 4BDYA 5J8CA 2PE3A 4JP0A 1NTCA 5BNGA 3DTEA 1B8IA 3MN2A 4NC8A 1YW9A 3O8GA 2NVXJ 1BOAA 3ZN0A 1TWCJ 3HHGA 4MFEA 2FXAA 2H09A 4MXNA 1MBHA 4BHBA 1VNDA 3DBHB 2JA8J 1J09A 2FRHA 2R5YB 5CQGA 1E43A 1B23P 4EM2A 1U5TB 3W2GA 1V55H 3TOBA 4YHBA 5JHUA 3AVUA 2G0EA 2X1EA 1XGSA 1IDJA 3JRBA 4N3NA 4A0XA 4LG0B 1ONVA 1OJLA 2QSHX 1G3SA 3OYJA 1TWHJ 2VOPA 1OCCH 1ON2A 1RR8C 2HOAA 1Z77A 2V1DA 5IT9Z 2LH9A 2WWYA 4K2EA 3UR3C 4C43A 2JA6J 1OFCX 3VSKA 3HZJA 1TWGJ 3DWLE 1GVJA 5H59A 2IGNA 1K4TA 3TH0A 3ZSCA 4CDGA 2EWNA 3D5LA 3HRSA 3D5RC 2AHOA 4ZDOA 1IJEA 4JX4A 4LD5A 2GK7A 4LBWA 2DMTA 3KE2A 1QA3A 1OOCA 2DT6A 3OZWA 1QRBA 2ACJA 1V3FA 1MDMB 3I4NJ 4Q47A 3T9GA 4WX9A 4Y7CA 2E35A 4G6DA 1BJKA 5HLHA 1IV6A 3H3VK 3OIOA 4L9TA 1EP2B 2ZZGA 3AK5A 2P5KA 2K85A 1ON1A 2JVGA 2HOSA 2Q1ZB 4JOMA 2AHQA 3FMQA 4RDJA 3KYDB 1VF9A 2XHKA 1I6HJ 4X0GA 2QGUA 2H6CA 2QQAA 3BNWA 1QRCA 5K7HA 1BW5A 5E1WA 1VQPI 3CJRB 3V7RA 1ZGJA 2RQQA 4XK4A 1VTNC 3CDLA 1XB2A 1QZYA 2MH9A 1OCPA 1XMKA 1MMGA 5D6EA 1JKOC 2MD0A 1BOBA 1QH0A 3ASPA 3LYCA 4PJJA 2GLOA 1UD2A 1IB4A 3HOXJ 1NBMA 3ELKA 2Z6BD 4XL9A 3PNTA 4II3A 4B47A 4ETSA 3OYIA 4HDVA 2IT0A 1W35A 2MA3A 2C77A 4YAWA 3MMPA 1VZ0A 2NAZA 4HNUA 1I27A 5IYQA 2X3HA 4DYCA 3Q0WA 3H5RA 4XBFA 4KNYA 4GYGA 2LDUA 2KDZA 1DARA 4HOBA 4E4HA 3L2RA 5FLVA 1BMFA 2ZSIB 2IQ7A 1XFOA 1ZQ3P 4IOAF 2FSWA 2DY1A 3FY3A 2XIGA 2MW8A 3ZC3A 5ILUA 5D5WB 4XLAA 5HS9A 2F4NA 4IHVA 1F1ZA 5F1RA 3VODA 2ZBVA 4Z6YA 3F8FA 3F8NA 4CSWA 4KMFA 1XMXA 1U9NA 2ICWG 4I09A 1WGXA 4IHYA 2CS3A 4Q7JB 4QFMA 3QE2A 3E5UA 2WJVA 4EJVA 2Q2EB 1PLUA 1P7IA 2Y75A 4C2TA 1JA1A 1IRXA 2DFHA 2QVOA 2PMDA 1ZYRF 2X48A 3MMYB 1QA1A 3FKSA 2EINH 2OTJI 3R6SA 3OYGA 1U9OA 2DOEA 1T38A 2VQLA 2O0WA 4TV7A 1J2XA 2HQNA 2COMA 4UY8I 3OZVA 3I56B 4KIFA 2H1KA 3DFGA 3Q0VA 4XKCA 4RGUA 2YU9J 3GFIA 2ISYA 2FX0A 4QPQA 1E62A 2VN2A 1O3RA 1L1IA 1N0VC 5EMNA 4W8SA 5BS6A 2OQGA 2DETA 4OOXA 1KJZA 4OINF 3ZCOA 4XLPF 1O8FA 4N4NB 3E5XA 2DDBA 3FK6A 1FDRA 3SY2A 1UHMA 1YX5A 4AD9A 1FEXA 2OBPA 2NRAC 1MBEA 1WP6A 3OYLA 1FC3A 1QVGB 2KDOA 4RAYA 1TQIA 3VYTB 1DU0A 4C3JJ 3E6DA 5BOXA 1RRJA 2CQKA 1O7FA 3PSFA 3Q0UA 3G73A 4CZZA 1RKWA 4I76A 1GT0C 1CF7B 1GHCA 4LGWA 1BX0A 3S3OA 4UV9A 1Y0RA 5IYWA 4Z05A 3AVWA 4IQJA 2QTLA 4PC6A 3RQIA 5IP6A 2WZNA 1IN7A 2QM3A 3BC8A 2YPRA 4PC7A 1FBQA 2OCCH 3RKWA 3MQ0A 2VKDA 4UNOA 4YEJA 1S6LA 2K9QA 2R4GA 3KCCA 2LKXA 1X1CA 2KZGA 4OIPF 3DU6A 3H9NA 2HQAA 2QUFA 1A6QA 5J3OA 1RIOH 4KKTA 2OK8A 1KQSB 2OTLB 2W7ZA 1DPUA 2PI0A 3BPVA 2M0CA 4NCNA 1VI0A 3KX2A 5IK2A 3DPLC 3GTLJ 3CXCB 5KCMA 1K4SA 1TC3C 4RPBA 1WKMA 3I3LA 2K4JA 4HAMA 3E20A 3K1PA 3LSHA 3CCQI 4CQJA 2QENA 3LSIA 3CCLB 2ME0A 2QQBA 2VI6A 2R7FA 5FKNA 1P4MA 1DP7P 1O88A 3K4BA 3J7ZI 2IA1A 4BDZA 4NQWA 4CYCB 2DAOA 1D5YA 3GTMJ 3PETA 3I4PA 4FK8A 3HL2A 2C5HA 4J0QA 4AF7A 3X2QH 1FOKA 3C7JA 4IEJA 1HCRA 3CCVB 1N8RD 3HTUA 5TV2A 3BR3A 3H92A 2LY9A 2JIZA 5JBQA 2YX4A 4MTEA 4RJLA 1FIPA 3N90A 1YW7A 3ZN1A 2RC5A 3LJYA 3R60A 4A12A 2ZB9A 3OIQA 4QWQA 2LY1A 1A35A 1IUYA 4XSZF 1PUEE 4E7SA 1O8EA 1KQ8A 2RV8A 2QF7A 1JUPA 3HOUJ 3L00A 3OOUA 4G6TB 3RTRA 4ASUA 2DK5A 2QLZA 4IQ4A 2DFIA 3BCAA 1OFMA 1G6NA 2D45A 1UD5A 3A0BC 1MMSA 1J59A 4TMWA 4D5CA 1WMRA 2QYUA 1P92A 1I1SA 3VSTA 2F1LA 4HQEA 4TMXA 4UUSA 5D6FA 3ZMSA 2BHZA 3ROUA 1XG2A 2KIQA 4S0HB 3GSIA 5FIUA 1X4PA 1DBGA 2MLKA 3K4JA 1B2RA 1SVOA 1TWFJ 3TP3A 2BGJA 2IS2A 1S7AA 3KLOA 4M71A 2R7ZJ 3PQKA 4LBZA 1TLHB 4JBAA 4RDKA 2DERA 2HTSA 1MBGA 3DLLF 1D1CA 4TMZA 3CUOA 2L9VA 4PJMA 4TT3A 3CC2B 2BM4A 4YZAA 4OU0A 3J7AY 1A31A 1PVEA 3U1KA 4ZJZA 5GAHJ 4L9VA 3G05A 4YIFA 3BQYA 3WY9A 1YJ9B 2B63J 1XN7A 2ZL7A 1WOSA 1OGMX 2DJNA 2OBRA 3HSEA 2XB5A 2ESHA 4L5IA 3AVXA 2VBWA 3DF8A 2V9KA 3A1PA 4B3FX 5IYNA 1JRGA 2R93J 1O8IA 3FF5A 2NTPA 2IW5A 4BE1A 1V54H 3LQ6A 4XM3A 2NYXA 2H94A 3RCOA 2EWEA 3WGGA 1BA5A 1SFXA 3U6BA 1EKEA 2KPMA 2ME6A 5F1JA 4P1WA 1DQUA 3A3BA 1XGOA 3KPHA 1Y1VJ 2XF5A 3OYKA 1B72A 2XNJA 3FDYA 1VQKB 1BI3A 3S17J 3BR6A 1HW5A 4YAOA 1OFEA 4DQLA 4FCYA 5CVVA 2NPFA 3N05A 4U88A 2A6TA 3CCRI 3P9CA 5FA6A 1BM9A 2XRLA 1JUMA 1RKTA 2MSYA 1S7EA 1USTA 3V4GA 3I5UA 5CVRA 4G8XA 4WZKA 4A3BJ 3NB2A 3GYHX 4MHGA 3IL2A 4HYEA 2KMUA 2XB0X 2XDVA 1XD7A 2V79A 2BHYA 3GUDA 4IJAA 2EFNA 2LVSA 2XGXA 1ZG5A 4TSFA 1Z0XA 4RAGA 1EA3A 1ULYA 2M87A 2VFPA 2HLDA 1V5FA 3BTJA 2DA3A 1FBUA 4V2GA 3UW0A 2NVUB 3EQNA 4OAYA 1XG1A 2DQLA 1QGAA 2YWGA 4RA2A 2QYOA 9ANTA 3CMMA 1D8TA 4A3LJ 3Q38A 3K1MA 5IYRA 4HSRA 4PJNA 3BY1A 3WXMA 4ABZA 1T0FA 3HGGA 1VQNI 3OEEA 2WV1A 5HLGA 2CW8A 2WYRA 3KP3A 4HX4A 3SZTA 1KK2A 3DPTA 2F5EA 2LP0A 3K9TA 1O8JA 1U78A 3MHPA 2Y0SA 5H6RA 4ZZDA 2XSDC 4RAZA 4U7BA 1EV7A 2DXIA 2IA2A 2L9RA 1NRKA 4A3KJ 1OGJA 1ETKA 1T6ZA 1OB5A 1F43A 3CLOA 4N4OB 4B3GA 5IY5H 4HF2A 4LLGF 5IT3A 3P27A 4BHPA 3JSPA 4X1EA 3G4SI 1UZCA 1WPKA 4Y7NJ 2R5YA 4G1VA 4CZCA 3ABUA 2HMAA 2NTQA 2ZTGA 2GXBA 5DEQA 1TL8A 3A8KA 3HIFA 3HOZJ 2VJ5A 1SD4A 1WPCA 5HDNA 1D1BA 2XKOA 4YFXF 1JGGA 1N06A 2ZO4A 4XICA 3IC7A 1HKSA 4XLFA 2R9VA 3CESA 3F6OA 5D4SA 3W6JB 3WNCA 2L7MP 2STWA 4B44A 3E5QA 1FYMA 1BJZA 5B3SH 3SDBA 1QVUA 4Y52J 2QXZA 2X6WA 4N3GA 4E7HA 1YIJB 4CHUA 3B78A 3MKZA 2VIXA 2PBIA 1IDYA 2HQ5A 1M1EB 2K4BA 4LIVA 4RB2C 4IO9F 4G7ZF 1T5EA 1LDDA 4AVZA 1EP1B 4G1BA 4QVAA 4IRHA 2E2HJ 2XGJA 2VFOA 3GTJJ 4JX5A 3S32A 2EZIA 1W36C 1VQ7B 3ASSA 4KICA 2CW5A 1MDMA 1LFBA 2GZWA 1QPIA 3HM5A 1OGIA 2XGEA 2A6EF 4IHWA 1OB2A 4CCJA 4E7LA 5HZBA 4RB0A 5FKOA 2Z1DA 1R5GA 3WQZA 4FE7A 2EFQA 3PUFA 3M1CA 5ICCA 1SFKA 1BL0A 2LTPA 2ZMEC 4RB1A 2DOGA 2ZJ2A 2DODA 2F1MA 1SD6A 4DIQA 2W4SA 4PABA 1YO5C 5KAIC 1KGSA 2EK5A 3PA2A 3AVVA 4OJPA 3E7LA 1PP7U 2WAEA 5CVUA 1BQEA 1U6GA 2CW7A 3DQVC 3ZPNA 1W0TA 3KRGA 4ZCMA 3RDIA 1COWA 2O1DA 3BT9A 4B09A 1XSDA 5LGUA 1BR1A 1VBLA 2Y48A 5BPIA 4PK4A 2VKHA 5FRMA 2XZOA 3LA3A 3JURA 2DK8A 2E1CA 1ETYA 2WY7Q 2W1OA 5CJ9A 3ZQGA 2VL8A 1KQ9A 1MRZA 2FJ1A 3CCVI 1R5OA 4M2LA 4BJ6C 4P1VA 3I4MJ 1XDUA 2VPRA 1X1AA 4S04A 1JA0A 3NARA 1NK3P 3N6ZA 3TO6A 5GTIC 2G7HA 3PQJA 2I5UA 2Z33A 3ECOA 2WR8A 1O8MA 2W7NA 2Q2EA 3GO5A 3J80K 3H1CA 3OYCA 5F08A 1LNWA 4QHYA 5FKMA 3P4GA 3TW7A 1F9NA 1POGA 5TISC 3RSNA 3FXJA 3LMMA 3PNVA 5FRNA 2V7QA 3A35A 2CFOA 2DMNA 1LFUP 2R7RA 3RZOJ 4NUBA 2C4TA 2VBVA 1YITB 3JTHA 2L3DA 3ZQIA 3JRGA 4A0YA 4DGWB 5TRDA 4HX7A 2FEZA 1VJSA 1RU4A 2MG4A 3B73A 2WY8Q 2XF6A 5CLSA 1G2HA 3BR5A 3SYTA 2PJPA 1OKRA 1YS6A 2GA1A 3RPUD 2CBXA 3HC7A 2E2JJ 5LHIA 3H0DA 4PAAA 1Z67A 5L3FA 4XLCA 1WOOA 5H20A 2ZNZA 3JRDA 3I64A 1IGNA 2XTYA 1KA8A 3JAMZ 2NSPA 2GWRA 1ZARA 3E6BA 3Q39A 1TZLA 1QGYA 2B0RA 1N25A 3CUQA 3FHNA 4B3AA 3CC2I 2DW4A 3GFLA 3C18A 1YTYA 3GVJA 2HS5A 2K27A 2CMPA 2M4KA 3BROA 4ZCLA 1TQMA 1IA5A 4YFOA 3FX3A 1BI2A 2ELJA 2VLAA 1U2WA 5J6XA 2RREA 2XKPA 3CUQC 4RGSA 3CCJI 3BR2A 1ZH5A 1TVCA 3KIOA 2FNAA 1S72B 2M3AA 5ICEA 4MEYF 4P96A 3GVKA 3U6KA 1ETVA 1CF7A 4D5FA 2VZLA 1BBYA 3OSGA 1PP8F 4YC5A 5CVJA 5FLXZ 3L09A 4L0YB 2DA1A 2VONA 3GBGA 1F20A 4ZDLA 3DKXA 1V5EA 2L4AA 2RNGA 5DD8A 2HNHA 4YAUA 3VOEA 4B8XA 3FXRA 1QZEA 1SVMA 2XGCA 2HYGD 5E3LA 1MZBA 5LLQA 3FHZA 1SFUA 2FF4A 3CDIA 1NK2P 2DT7B 4XN3A 3QWLA 1WZ2A 2L0KA 2HDWA 4AM3A 4I6ZA 1YLFA 3GLXA 3S2HJ 3K69A 1R58A 4HX8A 3CCUI 4M3DA 2M7AA 3M9AA 1SD7A 4OP7A 4UUTA 1NH3A 1Q82D 2INVA 4G9YA 3ZMDA 2HZDA 4FX4A 2RQPA 4LB6B 4PJ0C 2XZPA 4M0LA 3ONQA 4OJ5A 2FUG2 2VQCA 3QYBA 2EBIA 2Z5UA 2QKMB 3EPZA 2F5VA 3SZPA 4UUSB 3IKTA 4LBVA 1IV8A 2NV4A 3JTGA 1GXPA 3H3ZA 3BQJA 4F7DA 5IP7J 2BM7A 2P7CB 4DOZA 4M9SA 2DI3A 4XRSG 2OQRA 3LNQA 1WRJA 1HF0A 2R7TA 2EFPA 3PSZA 3HTSB 5J47A 1YLOA 3VSVA 1XGMA 2J8KA 4ENMA 2FNPA 5B6IA 2TCTA 3G71B 3BTIA 3AAFA 4WZEA 3SJPA 2MGQA 3AG3H 1ORKA 1AIPA 1QQ1A 5EEGA 3S2DJ 5KK1A 2LK2A 4II2A 1SAUA 3WTWC 2GJKA 3VSUA 1NG6A 2V31A 3A02A 2M0MA 4BXUA 3FIWA 1OCRH 3BY6A 3WHCA 5J1RA 3A2KA 1J9IA 4KISA 1ZAOA 3T8TA 4AVPA 2DYRH 4G12A 2FQ4A 2BN4A 1BX1A 3FJOA 4FTHA 1EH8A 3K0LA 4V2FA 2XVCA 2VNKA 2GBYA 4CCKA 2OCEA 3OZUA 2XAQA 1MBJA 5DUKA 2CO5A 1ZM2A 1EH7A 3GZ6A 1WCMJ 4R8HA 2JMWA 4KYWA 2ISZA 1IG7A 4YCQA 3CF5F 1W87A 4PGGA 3U2RA 2E1NA 1B59A 1QVTA 1LM1A 4EW9A 3PSIA 1YFHA 3JQQA 1S9HA 1I6XA 3IH2A 4PFPA 1ITYA 4BU2A 4IOCF 4G7WA 2HYFA 1YOVB 1ETQA 1K5CA 2H6BA 3QPLA 5D8LB 1E2XA 3M1EA 1AU7A 2QKLB 2P7VB 1Y39A 4GQNA 1WJEA 3BG3A 1O8LA 5L3EA 5A2QK 1SANA 3RJPA 3W5VA 4JK1X 1KU3A 4F91B 3JQRA 4QUZA 2Q6KA 2C78A 2QGGA 2LY2A 4Z4RA 2PFBA 4DZPA 2F4IA 1HXDA 2DTRA 3TMOA 1VQ7I 1KU7A 4NC7A 4A3FJ 1IXCA 3CLQA 5HDGA 1S0UA 1EFUA 5IOYA 1KZHA 1GUUA 3GVAA 3WE3A 1RUNA 3J7AO 3BZ6A 2OBTA 4LOCA 4HZFA 1DBOA 3GX4X 2NT6A 3BH6B 1NB9A 1YW8A 1Z7LA 1I3QJ 4ENJA 5DS9A 1GQ8A 2AXLA 4AUXA 4AWXB 1R36A 1X3UA 3JRHA 3OYBA 1VQMB 2WB1A 1ZRDA 4M3EA 2CG4A 4LLLA 4B48A 3QPTA 1T98A 1LEAA 1J9ZA 4OPSA 3PUNA 1JTXA 3BG5A 4HSTA 2D3LA 2HCJB 1XTAA 1NJID 5DSZA 2X0LA 3PIOF 2NXNB 4FHTA 5DCMB 3BJOA 2K86A 1TUIA 1Y1WJ 1FYKA 1ZTRA 2F4OB 1MABA 1RESA 2KT0A 5ILSA 4BYYA 1K79A 2CWEA 2BV3A 5HNFA 4YIIA 5C1EA 3MVPA 4OJOA 4Q5SF 1ZREA 1FNCA 4A2UA 3M07A 2MBFA 3TDUC 2BPOA 4F7ZA 3G1MA 2VJIA 2M5SA 5C1CA 3OYEA 1WJDA 3JRFA 3K6GA 3ES9A 2EIKH 3P9KA 4UXNA 1FP1D 1LQ1A 2R5ZA 3LOCA 2VJJA 4NBQA 1SM4A 5A89A 1NG7A 3SFIA 5GPCA 5HKKA 3CCSB 3VNVA 1O8HA 2F4MB 3OV8A 3DDYA 3CC4I 5HODA 4JMQA 1OMIA 4JYKA 3PUBA 3RIQA 2O17A 3VO2A 1QFJA 2VBZA 4ENKA 2GOMA 1ACIA 4BH9A 3OE7A 2BSPA 1W7PD 4EMSA 4PC1A 2C2WA 1MIJA 4XLNF 2IS6A 2NVQJ 3QPHA 3ZOBA 4B1RA 3AGPA 3RKQA 1YITI 3DP7A 2VBYA 4W8QA 2X6YA 3G1OA 4EQQA 2HYJA 1W1WE 2GXAA 2V7FA 2OZUA 2NOJB 2ZMEB 4PZJA 4UVCA 5B1AH 2ODLA 2ZXJA 4IW3B 3ZZTA 4DNCA 4OZZA 4BACA 5E18F 1H8HA 1IO2A 4RD6A 1S5LC 4RCYA 1ZELA 2ID6A 3BC9A 1D0YA 1K4ZA 4YZXA 1A5JA 2PIAA 2K9MA 3I59B 2M1BA 3A1YA 4GXOA 5LGNA 4H9GA 3U2QA 3R6KA 1AMOA 1Z6RA 3EETA 3RIRA 4A3JJ 1OYWA 5HOOA 4IXAA 5AN9A 2DN0A 3E6CC 4L18B 3PM1A 3PSSA 3GFJA 4X07A 2V26A 2STTA 4BKXA 3L2CA 3V76A 4QV2A 1TYWA 4LC0A 3LSTA 2XAUA 5J1YA 1DABA 2XUBA 4IHSA 4RD2A 2GA2A 5E3OA 3HPGA 1ZRFA 1KMHA 3F8MA 2DA4A 4I98B 5FO5A 4M3BA 1JJ8C 3WYAA 2EIJH 3S8PA 4ZC3A 2XF7A 4KKUA 3WBKA 1CLWA 2YUHA 3CCYA 2XT2A 1RR7A 1EP3B 1W0JA 3FM3A 2GIVA 1MD0A 1FMWA 4YFKF 1W34A 5J35A 2OPTA 2DLLA 4PCQA 4R71A 4EJWA 3MFKA 2Y2ZA 1QX4A 1QCXA 1VLOA 2J7KA 4MFDA 4FE4A 4YXWA 4BBRJ 5DNSA 4TKOB 2K9SA 1X3WB 5AIPA 5F27A 1HKQA 1R1TA 3M7GA 5DD4A 1JXSA 1DP3A 3W5HA 4P5OA 3FM5A 3A8JA 2HWVA 4DNRB 2P6SA 2MD5A 3SYJA 1KC8D 1JT0A 4BJTA 3QODA 4G6IA 1B6AA 4X8IA 4YDTA 1R6RA 3RKXA 2CRVA 4A3EJ 3ML3A 1P7JA 1H9GA 3HRTA 3Q9VA 3AKZA 2K9LA 2WB1N 2YX7A 1AWCA 3G6EB 4HV6A 1JNYA 4AF6A 1Y8QB 4UB8C 5GTHC 4BXXJ 1I5ZA 2CQ7A 3C2HA 3WU0A 1CZFA 2EB7A 3GQ9A 2EFWA 2D1HA 3Q9SA 2LD5A 3LVBA 2RDPA 5E3NA 1K73D 2DPUA 3G71I 2DA5A 1JJ6C 3CCEI 1TW2A 1A8PA 1WSVA 3KL9A 4PC3A 1XE1A 3CUQB 1YIOA 1FZPB 1DGRM 3ZRGA 4RAFA 4URRA 1KQ5A 2LRDA 3OEHA 4Z4TA 3K4LA 2HXOA 4HG2A 2EZKA 5FO1A 3W2IA 2GQFA 1WJ5A 2ZTNA 3UKGA 4NHJA 5FROA 3RZDJ 5F4OA 4DQKA 3EUHA 2LMDA 3I54A 3DBRB 3PFIA 3CJNA 3T5XA 2OK7A 2VBMA 1LPQA 3V7SA 1ZM4A 2P5LC 1F5TA 3FXQA 2GK6A 4WXHA 4UZFA 1FT9A 2VFQA 3HEFA 2QQ8A 2X53S 3EUHC 1UELB 4KT6A 2KISA 1JE8A 2MC3A 4FETA 2HKXA 2ZL5A 5DUIA 1W2BB 1YX3A 1SD5A 3FZVA 5F0HA 2PLFA 3IH4A 5EJCA 5LBQA 1P9QC 2M8EA 4L9NA 4ON0A 3W2HA 1GXQA 1MMNA 2JA2A 1P4XA 3I53A 4C3HJ 2QSGX 3GEZA 4KKSA 1HC8A 1U3EM 2JPCA 3H5NA 3WE2A 2JN6A 4KH3A 2WBMA 3O6BB 5K5RA 2JRTA 4YZ0A 2ZJRF 2KJCA 1P4WA 3GW2A 4IL6C 4U0YA 3DEWA 2JZYA 2KJBA 2VE9A 1FSHA 5JI6A 1S7OA 1TT5B 2XPUA 5AONA 1PKVA 4PSWA 1A04A 2V4DA 1U2RA 2P6TA 5E20A 2ESNA 2X6OA 4PFOA 1NDHA 2DOFA 2XSJC 2NS8A 1T6YA 2FX3A 4A93J 1A6IA 3CRZA 3DKYA 1E63A 5CDFA 4E6KG 1PE9A 2V4JC 3ABLH 3DBLB 4E7IA 1Q81D 4WCGA 2Z99A 3FPKA 3OJXA 1I18A 2Y9YA 5D5UB 1IN6A 1FOYA 3E97A 1JTYA 3T0YA 2EZHA 1YQAA 1BIAA 4N9HA 4KMUX 1R4MB 2ZCWA 4MO7A 4I01A 4EJOA 2NZMA 3V8JA 4AC0A 4M74A 1OPCA 4RD4A 1V5VA 2KVOA 3H0GJ 3ISPA 1LLWA 3A01B 4Y4RA 2DT5A 1O3TA 2L5QA 2E71A 1B9MA 1FWZA 3S93A 2JQ7A 5K7ZA 4W1UA 2DFFA 1R1UA 4O5VA 1E1RA 3BH7B 1G4DA 3HKZA 2O9LA 4PSXA 2HGCA 3RPQA 2EV5A 2E60A 3E6MA 4IF4A 4YELA 4YEIA 4S05A 2YS9A 5J8FA 5ICFA 3W2AA 1SKYB 2CQNA 3GF2A 2X6XA 1EJ9A 1BPLA 3K4CA 2PG4A 2PQ8A 1IJFA 1Q86D 2ZZQA 1USSA 1GV2A 5IYBJ 1R5BA 4QTRA 3FXLA 2DQRA 3VB2A 4ESBA 3B4NA 4I99C 3I55B 1X3ZB 2BVMA 3KZYA 1QHHD 5E1XA 2FOKA 2Z9OA 3QOPA 4NC6A 4HIZA 1W5SA 2FBIA 3ERMA 3FK7A 3K4KA 2QZ8A 2XC7A 4OMZA 5M3MJ 2IAIA 5DM7F 2E2IJ 3HXLA 4PUSA 3OSFA 2HDDA 1VQOB 4TMVA 1Z1DA 1KCDA 4W8RA 4HE5A 3V8LA 1VQ5B 2EA2A 3EUAA 2L54A 3V7CA 5DM6F 4MNUA 3B6AA 3O3KA 3ZMZA 1WI3A 1I39A 2AQFA 3KP5A 1MSEC 2V1XA 3ZMUA 3ECHA 1X4OA 5GADJ 1XMAA 2DEUA 4OOVA 4Y17A 5HZAA 3WNDA 4DQ2A 1XC5A 1G3WA 2NNYA 3LSMA 3GXOA 1HG8A 4HBLA 1ZRCA 3P26A 5E1ZB 3VWBA 3TGNA 3CPWB 1TQPA 3KP4A 2B9SA 1D2EA 5M5XJ 3P7NA 2NS7A 2TRTA 3TO9A 3W2WA 2BVNA 3W2EA 1FPQA 2HR3A 3TL4X 1BR4A 3ZPLA 1VHEA 3MCAA 4I84A 3H5AA 1UJ8A 1XSXA 5ILVA 1K7AA 4IRGA 2BYVE 4JRAC 4HE6A 4CICA 3ABMH 4UZUA 4BGDA 4Q48A 3OR1C 3FPPA 2JA5J 2HPIA 1AA7A 1JUSA 1Y0NA 5HNHA 6PAXA 1L0OC 1MH4A 3J7YJ 1UMQA 1FYLA 2JJ2A 2R6HA 5FL7A 3S15J 3CQZJ 2VE8A 1PJRA 1R71A 2W24A 2YWEA 3GIRA 3VO1A 5IYPA 3BOQA 4IHTA 5TY0A 4M6XA 5K1YA 2V1UA 2VUMJ 4X7FA 4HF1A 2YWHA 2V7TA 1T33A 3LA2A 1BC7C 3QU6A 5E79C 2ZZFA 4GGGA 1XS9A 2AXTC 4XSXF 1JKQC 3WG9A 1V4RA 3K2ZA 1AKHB 1Q1VA 1N75A 3BWGA 2WAFA 2DYSH 5J4VA 4LK1F 1HOMA 1RQRA 1OGOX 3HSRA 2CUZA 2QZAA 2M7BA 5EZHA 2BY0A 3GQ8A 2Y0MA 5JFRA 1Z7UA 3OIPA 3TDZC 1VQ8B 1E3ZA 3FXMA 3I58A 1N08A 2R5ZB 4ZGNB 4X7CA 1KZLA 2ZC2A 4HPQA 2HZTA 5FD5A 2ZXHA 1O8KA 1QU3A 3QYEA 3K10A 3HHHA 5DCMA 4WXDA 3OW2B 2H27A 1VQ6B 1T39A 2VXZA 1EWYA 1ZLJA 2I8DA 4BAYA 4EEFG 2GREA 1R1VA 2GOXB 3HAGA 4BY7J 1DDNA 1G3TA 3LSGA 5HLTA 3PO2J 4OOSA 4RDLA 2JN9A 4LIUA 1SMTA 5GPAA 1HSJA 4Y3OA 2BZTA 5HVQC 2DYIA 3L2QA 1BR2A 1YI2B 1CNFA 1K9MD 2MYSA 2OUMA 4FISA 1QUEA 4C0SA 2YUSA 3I56I 2VBEA 4EGYA 3SLNA 3PNYA 1SAXA 3ABKH 1JTAA 1X0CA 2XPVA 2ZL6A 1QGPA 2P0WA 1GVDA 3OL3A 3HKZN 2KRFA 4G5GA 2O0VA 4D9JA 2CUFA 2VKVA 2GPJA 1JB9A 3P5JA 4XOPA 2JK3A 1G8XA 4KIBA 2J5OA 3B90A 2DMPA 1OCTC 1OCOH 1FNDA 2DIEA 4RCZA 1KD1D 1SVLA 2Q6IA 3QP5A 3FWEA 3CMEB 2BE5F 1YJNB 2ZMEA 1JKPC 2IA0A 1G3YA 4N0BA 5EEHA 3KEQA 4UHTA 1BC8C 3DKWA 4L5EA 1FIAA 2HXIA 2BGIA 2IGOA 2CC2A 2HDNB 1T6XA 2CYYA 1O3SA 5BMZA 3B6CA 3T56B 3I59A 3V7AA 3K4NA 1KONA 2HVSA 4J19A 1DPRA 3I1FA 5FB2A 5KSWB 2V7UA 1S29A 3PENA 3H9QA 1BI0A 5FGMA 2OTLI 2INUA 2F5DA 3HUGB 5EEAA 3HOWJ 1IUFA 3B02A 3J81K 3ONUA 2VXDA 2IXSA 4AIHA 1LE8B 1JHHA 3K70D 3D1NI 2UZKA 3CCLI 2OU2A 3OFNA 4Z03A 1U8BA 2V5IA 3S1QJ 1IRZA 1RPWA 2W25A 3ZQHA 2BVLA 2F48A 2Q0OA 5HS8A 1I3AA 3KEWA 1I1GA 4MEXF 2PYHA 1OHHA 4D7NA 2QQ9A 4LLNA 3EUKL 5D4RA 1BW6A 1R23A 3F21A 4RGXA 1W5TA 1RQPA 4BE0A 4P22A 4D0PA 2LFBA 4UV8A 3WTXC 2GJPA 3LO8A 5LMZA 2QEXB 3HB9A 4XLHA 1ZR2A 3IAS2 5GV7A 3GQBA 5J40A 3U1DA 4RLQA 3GTQJ 3RPUA 3SQNA 4BE2A 1APLC 1MGTA 1WHUA 3LFUA 4IZZA 2BGCA 2KHMA 2FQ3A 3ZZUA 2CV2A 4WXCA 4BS9A 3K1NA 3H09A 3BDDA 3E1SA 2LKSA 2BMWA 3JRCA 4G7HF 1ZM3A 2OYNA 1X1BA 3HRMA 3T8RA 3F23A 2VKEA 4IX7A 4Y9UA 1IHMA 2HFHA 1K83J 2DFEA 2PMUA 2PECA 1ETOA 1WJBA 3FMRA 5KHDA 2KRCA 2YWFA 1YJWB 1VQ9B 1WXRA 3LQEA 1WWXA 3I71A 3I9V2 3QP6A 1Q7YD 5JMCB 4C2LA 3F3XA 1ODDA 3I55I 4M4SA 4B4DA 3BLYA 2M8GX 1OFDA 5F0CA 2BM1A 5CQEA 3JU4A 4EGZA 3JX8A 3N4MA 1OCZH 3VNUA 3MEXA 2GIZA 2JUGA 3L1PA 2DO7A 4A5MA 2EZLA 2M5WA 1VQOI 2FBHA 1UG0A 1GDTA 1TT0A 2NVTJ 4L5JA 1YJ9I 4DZJA 3HGYA 1AHDP 1N78A 2W6IA 1VQ5I 3R4KA 3COAC 3NWSA 2QBYB 4E7KA 2HVQA 4E7JA 2RC4A 1E1QA 4NNJA 3WU1B 1HDPA 5GAGJ 3JW4A 3J80Z 2NTBA 2PLYA 2WADA 4GYIA 1VQPB 4O6JA 2E5ZA 2KQRA 3JR9A 2X9DA 2P4WA 1P6RA 3BCBA 2RVCA 5BSXA 2HKOA 1HLVA 4KIGA 2Q6OA 4OM9A 4XRSA 2M2EA 1EFTA 4DYRA 1BN5A 2HVRA 1R4NB 1HQCA 4BQAA 2QDXA 2VBUA 3CO7C 2L7FP 1D8KA 2KKOA 2LYCA 3SZEA 2JTVA 4A3DJ 4A5NA 4I2OA 2DA2A 4ZZLA 4MYTA 1G7RA 2Q6LA 2ZITA 3HOVJ 2BY2A 3QRFF 4U0VA 1Z05A 1SFOJ 2QTZA 3LNNA 1KRHA 4Z4WA 3MWMA 4BHCA 5HS7A 5K5QA 2UWMA 3AVYA 1D0XA 2XT4A 2WPDA 4CGZA 2R3SA 1G59A 3JQPA 1SEUA 2RC6A 3PA1A 2ZBKA 3BZCA 3GFMA 3BG6A 2Y69H 4MIMA 3GCMA 1KYWA 1OISA 5LHGA 1IZ1A 5EDNA 3FXUA 1WFXA 3GZNB 4ZYAA 2XTWA 1F4KA 2QY1A 2BF4A 5IYCJ 3B8YA 5M5YJ 5EGOA 3HJEA 2CUEA 2K3FA 3H36A 2K7LA 4DW6A 1QFZA 2KFDA 2UXNA 1I50J 1BLIA 4IPAA 2VPLA 3D5SC 4XNFA 2R7WA 1S4MA 3C3WA 3ASTA 4Q4ZF 1HKTA 2UXXA 3OYHA 3A01A 5B1BH 3GWZA 4P25A 2Y31A 4HLYA 4J01A 4LK0F 5C3EJ 1VQ8I 4HWVA 3QQAA 3R0AA 4CCLA 2FBKA 1YE9A 4EH1A 4AU7A 4CA0A 2LR8A 1H8AC 4Z4ZA 3TKYA 4HDUA 1QFYA 3GQ7A 2Z3YA 3R0JA 4LG3A 2CW0F 1R5HA 5FO0A 4D7MA 2YR2A 2K5CA 2L9SA 2MABA 1DDGA 3NAUA 2VB6A 2IS1A 1U8RA 1D1NA 1LUJB 1KTVA 3HOTA 1O8GA 3VMWA 2VBSA 1TYXA 3ZQCA 1FX7A 3LFKA 3GTPJ 3LSRA 4P26A 1DUXC 4JQFA 2L4MA 2CU7A 4X7DA 2I10A 2YSRA 4RGRA 3DCFA 5H6QA 4DBQA 4ZYEA 1YRNB 4IHXA 4LB5A 4X0CA 3GRHA 1Y56A 2LBFB 3S3NA 3CD6B 4U7DA 5GP9A 4P3YA 4WWCA 3T53B 4ZDPA 4YRVA 4RMNA 4GDFA 1J7KA 1LVAA 4ASNA 1WJAA 1E3OC 4ROXA 4DYQA 3BTLA 2FA5A 2F43A 2KIUA 1CNEA 1R00A 1ZG3A 2DOAA 3R6JA 1YIJI 5F6FA 4P6YA 4CO8A 1HA3A 2M4GA 3HDDA 4ITVA 1Z91A 1O7LA 3F0CA 3J81k 5E17F 2OZ6A 4F3QA 1LB2A 2PMZA 3MAJA 4ZCIA 1O8DA 1UG2A 3BR0A 1N0UA 1IXRC 1OYIA 4C9YA 2LREA 3F6VA 3H9GA 3WHBA 2IRFG 3S16J 2IS4A 2C4UA 2XAGA 3CCQB 1HBXG 3CCMB 1N77A 3TQNA 2XC1A 2I1LA 1KK3A 2UVFA 3L7WA 1H88C 3WTZA 1JHFA 2GXGA 4HRIA 2O0YA 4Z4UA 1R9TJ 3S1NJ 2EH3A 1V5GA 4BXFA 1MMDA 2ZXWH 3C2GA 3V8KA 3WTYC 3JREA 4XKWA 2R7SA 2KIFA 5L3DA 3OY9A 1BI1A 5IT9K 3LSPA 2LKPA 2TDXA 2VQHA 2XRNA 2LOOA 5C44J 3CMAB 1EFCA 5DYMA 1W4MA 2PN6A 2WAQA 3BPXA 3RYRA 4FASD 5E6TA 1LJ9A 5LHHA 3SEJA 4HEA2 1KYZA 2CQXA 2E19A 5K5OA 2WC2A 2LG4A 1AKHA 2XNDA 2OJED 1H85A 5A2QZ 2V6EA 3AVTA 1T6SA 1Z3YA 2EIXA 2O04A 2PYGA 1W9XA 1IN8A 3SEQA 2X8KA 1F36A 2DBBA 2H8WA 1EF4A 4KUMA 1W7PA 3D26A 3K2AA 3TOAA 4YG2F 4GCVA 3L2UA 1OB0A 2W85A 3ONYA 3DU1X 4RDUA 4AYBA 3W5UA 4X7EA 4XOTA 2QEXI 2ADUA 2V1NA 1YS7A 1Q9SA 5KNLA 4KT5C 1GV5A 1ZUNB 1UHWA 2LLKA 4IRIA 3LMWA 2OAZA 4Z4SA 3KYCB 1PDNC 3P9IA 1TYUA 3LWFA 4IVNA 4B3XA 3H94A 4EJTA 3CW2A 2K3PA 3QPSA 2VJ4A 4C30A 3SFZA 5H2FC 2IGMA 3K7AJ 5J4YA 3C2BA 3CP2A 3DEEA 2VOOA 3S1MJ 3C1DA 2ZBUA 2FMYA 3WBJA 3FKIJ 2VODA 3REOA 3CP8A 5LGTA 3AG1H 2KL4A 3SDGA 3CDHA 3LAPA 4RB3C 4E7ZA 4UZEA 3BZKA 1YJWI 1VQ9I 3TO7A 1RMGA 1MW7A 3EYIA 4B43A 4I7HA 3FKJA 3DU5A
chains in the Genus database with same CATH topology
4Y4RA 2CUJA 2L5QA 4XMYA 4RLFA 4LIVA 3OYFA 1HVXA 3IUOA 3S93A 1T5EA 2ZFUA 4AVZA 2XGJA 1E1RA 3QYFA 3BH4A 1BHEA 4RM2A 3S32A 1W36C 3HKZA 4XORA 4PSXA 2UV1A 3BCFA 2E60A 4YELA 1T95A 2VQGA 3W2AA 4BEHA 4NK8A 3ZQQA 1SKYB 2X6XA 1BPLA 3K4CA 4GRIA 3PJRA 5DN6A 4CCJA 2ZZQA 3OS1A 4E7LA 3H9JA 2WZPP 2IGKA 3HG9A 2Z1DA 2R7XA 3WQZA 3L2WA 3B4NA 4CH7A 3M1CA 2BVMA 4HIZA 1QHHD 1SFKA 3DTIA 3K4KA 3G2BA 4F92B 2XC7A 4E0FA 2F1MA 4DIQA 3VR6A 3HPHA 2KP6A 2W4SA 2ZXIA 3HXLA 4PUSA 1UD3A 4DK1A 3W2VA 4OJPA 3OOCA 2WAEA 3NE5B 2Z16A 2CW7A 3DQVC 3ZPNA 4W8RA 1OLTA 1KCDA 2KZVA 3KRGA 4NK6A 3EUAA 2O1DA 1COWA 2NT9A 1X19A 1X1DA 2AQFA 3GQAA 1BR1A 2JDIA 1FMVA 4F52A 1X4OA 1VBLA 3OR2C 1KTWA 2GJRA 2W00A 3SZGA 1LDKB 2AQEA 2VKHA 2WA0A 4PK4A 5FRMA 2XZOA 1GLNA 3OW7A 3JURA 3LSMA 3MD2A 3ZXSA 2HPMA 2JJ1A 1HG8A 2WY7Q 2W1OA 2VL8A 3VYUB 3OS2A 2BOLA 3W2WA 4BJ6C 2X1DA 1QJVA 3TL4X 2E1MB 1BR4A 4DJAA 1X1AA 2R7UA 3LSKA 1E3XA 2UUZA 5JHFA 1H8EA 1OFLA 3H5AA 3NWTA 1O8MA 2DCEA 2W7NA 1V0FA 4UZUA 3OYCA 4BGDA 1UD8A 3OR1C 3FPPA 2HPIA 1AA7A 1VF7A 1EE6A 4ZTFA 5HNHA 1IDKA 3RSNA 2CH0A 4C2UA 3LMMA 3PNVA 4QPOA 5FRNA 2VASA 2CFOA 2E1BA 2V7QA 2JJ2A 2R7RA 3A35A 3VYRB 4NUBA 5FL7A 4DK0A 4BQNA 4OJLA 1PJRA 2PJRB 3ZGKA 2CK3A 2OV7A 2CV0A 4DGWB 1VJSA 1RU4A 2WY8Q 2XF6A 1MNDA 4EATA 3SYTA 3HOSA 3A3GA 3A4CA 2A5WA 3CZ6A 3RPUD 1WJCA 2ZZFA 1Z21A 3HC7A 3H0DA 1AIRA 3OWTA 4XLCA 4CUGA 3H35A 1N75A 2WAFA 4F93B 2R7VA 2XZLA 5LFAA 3BG7A 1OGOX 2CUZA 2NSPA 2M7BA 4U49A 1TZLA 3GQ8A 1NHCA 4DBRA 3OIPA 3FHNA 4BDYA 1E3ZA 3GVJA 3AL0C 1KZLA 2QE7A 2CMPA 2M4KA 4HPQA 4XLEA 3DTEA 1IA5A 3VSLA 1PYVA 2ELJA 2ZXHA 4NC8A 4R79A 2RREA 2VLAA 2X1CA 3VWBA 1ERDA 1QU3A 1O8KA 3QYEA 4MXNA 1V0EA 2M3AA 3K10A 3GVKA 2OC6A 3CJQB 4XKVA 1HA8A 1J09A 2VXZA 5CQGA 1E43A 2I8DA 2GOXB 1D0ZA 3HAGA 2X1EA 3LSGA 5HLTA 1IDJA 3GBGA 3SEZA 4LIUA 4ZDLA 3DKXA 1V5EA 3OYJA 2RNGA 4BQOA 4Y3OA 2HNHA 5HVQC 3L2QA 1BR2A 2MYSA 2OUMA 1EFRA 2NSTA 2DT7B 2LH9A 4XN3A 3UR3C 2VBEA 4XD7A 3PNYA 2BW3B 1JTAA 3VSKA 1X0CA 2HDWA 3ZR8X 3DWLE 2P0WA 3OL3A 2IGNA 2Z8GA 1KCCA 2M7AA 3ZSCA 2O0VA 4D9JA 2INVA 3BCDA 3D5LA 3D5RC 2HZDA 4ZDOA 4XOPA 2GK7A 1G8XA 2XZPA 3ONQA 3B90A 4OJ5A 2FUG2 2VQCA 3QYBA 1OOCA 2DT6A 3EPZA 2QKMB 2F5VA 4BEHB 3T9GA 2DIEA 4DOZA 3MKYB 1H80A 4F55A 2ZZGA 2R7TA 3IP4B 3F9KA 4YZQA 1JI8A 2JVGA 3VSVA 2Q1ZB 4JOMA 2KLOA 4X0GA 3DPUA 2IGOA 3CJRB 4II2A 1SAUA 2RQQA 2GJKA 3T56B 1NG6A 2V31A 3VSUA 3PL8A 2M0MA 1MMGA 3K4NA 1KONA 2HVSA 4MR0A 2MD0A 1BOBA 3A2KA 4KISA 3H9QA 4PJJA 2Z2SB 3OL4A 1UD2A 1IB4A 1NBMA 2INUA 3HUGB 4L8JA 2Z6BD 4XL9A 3SUCA 3PNTA 4II3A 1D1AA 4XR6A 4B47A 2VXDA 3OYIA 3L2VA 4OJ6A 2IXSA 1VZ0A 4CCKA 4HNUA 2X3HA 4G7XA 3K70D 3RQ4A 3OYNA 3H5RA 4XONA 4E4HA 2MFZA 3L2RA 1BMFA 2R7QA 3OFNA 2ZSIB 4Z03A 4BQQA 2IQ7A 2JSPA 3FY3A 3K4MA 2BVLA 3V42A 2X85A 4XLAA 3VYSB 3T51B 3KEWA 2PYHA 1OR7C 1BN8A 1OHHA 1Y6IA 2DJIA 4EW9A 3PSIA 4CSWA 2LBFA 3EUKL 5CKTA 4ZTJA 1S9HA 4BE0A 4P22A 2CS3A 4PFPA 2GJPA 3EQOA 4BU2A 2WJVA 4G7WA 2Q2EB 1K5CA 2R7OA 4XLHA 1PLUA 3IAS2 1K28D 1W0KA 4C2TA 2QKLB 4KJZA 1IRXA 3GQBA 4GQNA 1WJEA 1O8LA 3OYAA 4PJLA 4RLQA 3MMYB 3FKSA 4BE2A 4F91B 2W6JA 3OYGA 3LFUA 2LY2A 4IZZA 2KHMA 2F4IA 2CV2A 2VQLA 4BS9A 2O0WA 4J00A 3TMOA 3E1SA 3U21A 4NC7A 4CCNA 2UVEA 1X1BA 4XKBA 4IX7A 4XKCA 4QPQA 3AFHA 2PECA 1DBOA 1WJBA 5KHDA 4W8SA 2NT6A 2KRCA 1Z7LA 3ZCOA 4FXUA 1O8FA 3I9V2 1GQ8A 4N4NB 4C2LA 2O5RA 2E1MC 1YX5A 3BLYA 3OYBA 5TGTA 2WB1A 5CQEA 1WP6A 3OYLA 3JU4A 3E0JB 4B48A 3W3CA 2WJYA 2KDOA 2JUGA 3VYTB 2D3LA 4HSTA 1UG0A 1TT0A 2PJRA 1UAAA 1N78A 3PSFA 3MKWB 3IAM2 2W6IA 2CV1A 1VLYA 3NWSA 4E7KA 2HVQA 3S3OA 4E7JA 1MABA 1E1QA 4Z05A 4NNJA 2W82A 4IQJA 5HNFA 4W8TA 5C1EA 2NTBA 4OJOA 1E79A 3BC8A 2WADA 2VJIA 2D3NA 2E5ZA 2KQRA 2M5SA 5C1CA 2VKDA 3OYEA 4YEJA 3BCBA 2R4GA 4OZYA 1WJDA 1LKXA 1X1CA 3K6GA 3DU6A 4DNTB 1T0FC 2HQAA 4KKTA 2VJJA 3KYLA 1NG7A 2HVRA 5HKKA 4LITA 1O8HA 2HU9A 3KX2A 3OYMA 5IK2A 2LYCA 3DDYA 3DPLC 5KCMA 4JMQA 3OPOA 3I3LA 3PUBA 1I8DA 2O17A 3LSHA 3LNNA 3LSIA 2WSSA 2GOMA 2UWMA 3OE7A 2BSPA 1D0XA 1O88A 3K4BA 2WPDA 1K6YA 1Z3XA 4BDZA 1FX0A 1G59A 2IS6A 3HL2A 3OMYA 4BJ5C 3BG6A 4W8QA 2X6YA 1WFXA 2JIZA 4ZYAA 5LD2C 2QY1A 2V7FA 3B8YA 2NOJB 2ODLA 3OIQA 2LY1A 4OZZA 2MC4A 4BACA 1H8HA 4IKFA 1ZELA 1BLIA 4I84A 4E7SA 3OS0A 3D5SC 4XNFA 2R7WA 1WJFA 1D0YA 2VPLA 3BC9A 1O8EA 4YZXA 3OOUA 4G6TB 3RTRA 4ANJA 4ASUA 3OYHA 2K9MA 4IQ4A 3OYDA 3A1YA 3BCAA 1OFMA 1UD5A 4J01A 4HWVA 5HOOA 4CCLA 1WMRA 3VSTA 1YE9A 3M8JA 3CF2A 1RWRA 4AU7A 4CA0A 1MMAA 3GQ7A 2V26A 1XG2A 3K70C 4LG3A 1X4PA 1W36D 3PFYA 1DBGA 3K4JA 1DGWY 2K5CA 2L9SA 2MABA 2XAUA 3S3MA 1UD4A 2VB6A 2IS1A 2IS2A 1LVKA 3KEYA 1MNEA 3HPGA 1KMHA 3ZIAA 3HOTA 1O8GA 3VMWA 1LFPA 2L7KA 4U87A 4Y33A 4OWRB 3S8PA 4ZC3A 2XF7A 3FBNB 4JQFA 4KKUA 1D1CA 2LZJA 4PJMA 4TT3A 4YZAA 3GRHA 4DBQA 3J7AY 2JVHA 1Y56A 2LBFB 4ZJZA 3S3NA 1HZEA 1W0JA 3DLAA 3G05A 2QX3A 1FMWA 3T53B 3ZPPA 4ZDPA 4YRVA 4RMNA 1OGMX 1UD6A 1WJAA 2F43A 2DOAA 1QCXA 4B3FX 2V9KA 1JRGA 4YXWA 5AMVA 1O8IA 4TKOB 2NTPA 2KRHA 4BE1A 2M4GA 4XM3A 3RCOA 1DP3A 2EWEA 4ITVA 2L9NA 4P5OA 2KPMA 4DNRB 4P1WA 1DQUA 4G6IA 4BJTA 3QODA 3A3BA 2XF5A 2E5NA 4F3QA 3OYKA 3FDYA 2PMZA 1U0JA 1R6RA 1O8DA 3AKZA 2K9LA 2XOKA 3N05A 2A6TA 4C9YA 2LREA 3H9GA 4HNTA 2IS4A 4D1QA 3VMVA 3C2HA 1CZFA 3GQ9A 4BUPA 4MLOA 1N77A 3AL0B 3TBIA 2UVFA 3LL7A 4HRIA 2ZZEA 2KMUA 3OAAA 2XDVA 1V5GA 4BXFA 1MMDA 4KITB 3C2GA 4TSFA 1DGRM 3ZRGA 4URRA 2VBKA 4Z1MA 4XKWA 2R7SA 1EA3A 2LRDA 1QHGA 3K4LA 3VDXA 4HG2A 3OEHA 2HLDA 1V5FA 3OY9A 1WJ5A 2ZTNA 5FROA 2VQHA 2L2OA 2LOOA 4CCOA 3UW0A 3GVLA 4CCMA 3QOEA 2VBMA 4OAYA 3EQNA 2WAQA 2GK6A 4FASD 2LC2A 2X51A 2X53S 3CMMA 4HEA2 3EUHC 1UELB 4KT6A 4HSRA 4PJNA 4FETA 3OEEA 2LG4A 2XNDA 1PXZA 2CW8A 2V6EA 1YX3A 1Z3YA 2O04A 2PYGA 3WWGA 1W9XA 3SEQA 2X8KA 3DPTA 4BL0B 1P9QC 2F6CA 2ZSHB 4RM3A 1O8JA 1MMNA 2JA2A 2Y0SA 4H4KC 4U7BA 2DXIA 4KKSA 3L2UA 1OB0A 4PMHA 1NRKA 3H5NA 3FBIB 4AYBA 2WBMA 4XOTA 4N4OB 2V1NA 4B3GA 4YZ0A 4Z06A 5KNLA 3DTKA 1WTHD 3LMWA 1PKVA 3UNGC 4PSWA 4CZCA 4NQWB 2V4DA 4B3XA 3H94A 2NTQA 4U4BA 2ZTGA 2K3PA 4XQFA 2VJ4A 4C30A 4PFOA 2IGMA 2VJ5A 1WPCA 2XSJC 1D1BA 3CP2A 3DEEA 3DKYA 5CDFA 4E6KG 1PE9A 2V4JC 4XLFA 4E7IA 2R9VA 1I18A 3CESA 4OAZA 5CPRB 3CP8A 4B44A 2KL4A 2BW3A 3SDBA 2QXZA 2X6WA 4E7ZA 4E7HA 2NZMA 4XN0A 1RMGA 3MKZA 2VIXA 1E0EA 1MW7A 4B43A 2KVOA 3FKJA 3DU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XMY A;  2QX3 A;  4AVZ A;  2PEC A;  1DBO A;  1BHE A;  4W8S A;  1IDJ A;  2NT6 A;  3ZPP A;  1O8F A;  1GQ8 A;  1OGM X;  4XOR A;  4C2L A;  4YEL A;  4NK8 A;  1QCX A;  2X6X A;  1JRG A;  5AMV A;  1O8I A;  2NTP A;  2NST A;  4XN3 A;  2VBE A;  4XM3 A;  2EWE A;  1JTA A;  1X0C A;  3B4N A;  2Z8G A;  1KCC A;  3ZSC A;  2O0V A;  1O8D A;  2INV A;  4Z05 A;  4XOP A;  4OJP A;  4W8T A;  5C1E A;  3B90 A;  4OJ5 A;  2NTB A;  4OJO A;  1OOC A;  3VMV A;  4W8R A;  1KCD A;  3KRG A;  4NK6 A;  1CZF A;  3GQ9 A;  2VJI A;  2O1D A;  2NT9 A;  2UVF A;  3T9G A;  5C1C A;  4YEJ A;  4OZY A;  1H80 A;  3GQA A;  1VBL A;  4URR A;  2VJJ A;  2VBK A;  4YZQ A;  1KTW A;  4XKW A;  1O8H A;  3VSV A;  3JUR A;  1HG8 A;  3UW0 A;  2O17 A;  3EQN A;  2VBM A;  3VSU A;  2BSP A;  1QJV A;  4MR0 A;  1O88 A;  1OFL A;  1IB4 A;  2INU A;  1O8M A;  4XL9 A;  3SUC A;  1PXZ A;  3WWG A;  2O04 A;  4XR6 A;  2PYG A;  4W8Q A;  2X6Y A;  4OJ6 A;  2QY1 A;  1EE6 A;  2X3H A;  1O8J A;  1IDK A;  3B8Y A;  4XON A;  2ODL A;  4Z03 A;  4OJL A;  2IQ7 A;  4PMH A;  4OZZ A;  3FY3 A;  4XOT A;  4YZ0 A;  4I84 A;  1O8E A;  2X85 A;  4XLA A;  4XNF A;  1RU4 A;  4Z06 A;  4YZX A;  2PYH A;  1BN8 A;  1OFM A;  4EW9 A;  3LMW A;  4HWV A;  2NTQ A;  4U4B A;  1AIR A;  3EQO A;  4XQF A;  1WMR A;  3VST A;  4XLC A;  1RWR A;  1K5C A;  4XLH A;  3GQ7 A;  1OGO X;  1PLU A;  1XG2 A;  2NSP A;  4U49 A;  1DBG A;  1O8L A;  3GQ8 A;  1NHC A;  1PE9 A;  4XLF A;  4XLE A;  1IA5 A;  3VMW A;  1O8G A;  2QXZ A;  2X6W A;  2O0W A;  1O8K A;  2NZM A;  4XN0 A;  2UVE A;  1RMG A;  4MXN A;  4YZA A;  3GRH A;  4XKV A; 
#chains in the Genus database with same CATH topology
 2HEO A;  4P9U A;  2R92 J;  1T08 B;  1IW7 F;  3IUO A;  2ZFU A;  3BH4 A;  3QYF A;  1BHE A;  4ZYG A;  4XRM A;  1Q1H A;  3IHU A;  4AC9 A;  2UV1 A;  3Q5F A;  1H42 A;  2VQG A;  4P9F A;  4TMT A;  3E1Y E;  5FKL A;  1TNT A;  3CCR B;  4EV0 A;  2C5B A;  5FD6 A;  4GRI A;  3PJR A;  1S72 I;  3H9J A;  5DTD A;  3S1R J;  2IGK A;  4M9X A;  1ZLK A;  5C4J J;  3GTK J;  4G7O F;  2R7X A;  2WZP P;  3L2W A;  3WU2 C;  5M5W J;  3DEU A;  5CYV A;  3DTI A;  1QPM A;  1KU9 A;  4I0B A;  3OKX A;  4F92 B;  2V6C A;  4E0F A;  2D5V A;  4PGH A;  2LSO A;  3HPH A;  4DK1 A;  2ZXI A;  1SC7 A;  4NB5 A;  4A3I J;  2Z16 A;  3TW6 A;  1TSP A;  2IJL A;  5EZG A;  4NK6 A;  2CSO A;  2E7X A;  2X4H A;  2EIM H;  2BX6 A;  3HUG A;  3MKL A;  2B5O A;  2NT9 A;  1X1D A;  2PX9 A;  1M1K D;  2ZJQ F;  2PMZ N;  2IOU G;  3GQA A;  1LE8 A;  2JDI A;  1FMV A;  5D5V B;  4KA4 A;  1WSR A;  4F52 A;  1VHO A;  1VQN B;  3OR2 C;  4HA8 A;  2W00 A;  2GJR A;  1YHQ B;  4CXF A;  1LDK B;  2AQE A;  2WA0 A;  4V02 C;  3OW7 A;  3BG9 A;  2H8R A;  3MD2 A;  3ZXS A;  2HPM A;  3HSF A;  1FJL A;  2JJ1 A;  1EZG A;  4OPO A;  2IEK A;  2W84 A;  4EJU A;  4M3G A;  1J0R A;  1QNT A;  2BOL A;  2J5P A;  1WDT A;  1D5V A;  3BR1 A;  1E3P A;  1NHA A;  1X1P A;  3LSK A;  1E3X A;  2UUZ A;  1FNB A;  1H8E A;  1FY7 A;  3BTC A;  1LLZ A;  3NWT A;  1STZ A;  1WQ2 A;  3ZQ7 A;  5D5X B;  4A3M J;  2CQQ A;  2DMU A;  1Y0Y A;  3G4S B;  2QN6 A;  1V0F A;  1K61 A;  3O8H A;  5D8K B;  1Z6T A;  5JVG F;  4NBS A;  1EE6 A;  2G0Y A;  3FIS A;  1XCB A;  1IDK A;  1VFC A;  4C2U A;  2WAQ N;  2E1B A;  4FX0 A;  1TLL A;  1B9N A;  2KIM A;  4WF2 A;  1X2N A;  1XGN A;  3VYR B;  3OP1 A;  3Q6R A;  4BPR A;  1W5C C;  1XX5 A;  2VFN A;  5JVT A;  1QA2 A;  3ZGK A;  2CK3 A;  3S14 J;  2HQR A;  2ZNY A;  2EFO A;  1WI9 A;  1R5I D;  5IYD J;  2VFM A;  1MND A;  2NOG A;  2P8T A;  3G1L A;  4CYD A;  3HOS A;  3A3G A;  2BXY A;  3ZBU A;  1MH3 A;  2D9R A;  2EQR A;  3KZZ A;  3H35 A;  4CUG A;  2FD5 A;  2N8G A;  3LAJ A;  2RNJ A;  2V9P A;  2F2E A;  4MQ9 F;  4AYB N;  3MZH A;  3BG7 A;  1D8J A;  1FOW A;  1SKQ A;  2D74 A;  2XZL A;  2Y30 A;  2BEO A;  2OA4 A;  4BBS J;  2ID3 A;  3AL0 C;  2GQQ A;  1R5N A;  1FTZ A;  2QE7 A;  4K1X A;  5FNZ A;  4XLE A;  3CD6 I;  2COB A;  1PYV A;  3VSL A;  2DA6 A;  4N9I A;  4R79 A;  5JR3 A;  1VQK I;  2X1C A;  4A3G J;  3JCU C;  1ERD A;  4M1K A;  1K8F A;  2BY1 A;  2HOE A;  2Y9Z A;  1V0E A;  1K8A D;  4QIW N;  4ZYD A;  1A36 A;  2B0L A;  2OC6 A;  2QBY A;  3CJQ B;  4XKV A;  5DV5 A;  1HA8 A;  4P3I A;  2IVM A;  2IBD A;  3F8B A;  1CGP A;  3EYY A;  1VQL B;  4OPW A;  1D0Z A;  1SFE A;  2P81 A;  4ENN A;  3KFW X;  2VC0 A;  3SEZ A;  1E17 A;  5LRR A;  4UAJ A;  4YIR X;  1ZR4 A;  5F4M A;  1EH6 A;  4BQO A;  1RZ4 A;  2ETH A;  1GJR A;  3WNB A;  2VNI A;  1QBJ A;  1IC8 A;  1CQT A;  2XAF A;  2CJJ A;  1EFR A;  1JT6 A;  4GFB A;  4WQM A;  2O03 A;  2NST A;  1ZG1 A;  4XD7 A;  1BIB A;  2RAE A;  2BW3 B;  3KP6 A;  1ETX A;  5EGO B;  3ZR8 X;  1LEB A;  4MGR A;  3B8H A;  1ZHF A;  3ZQL A;  4RD3 A;  1MNM C;  4G94 A;  2Z8G A;  3QU3 A;  1KCC A;  3CCM I;  1FLI A;  1TTY A;  1RC9 A;  4LFU A;  2WV0 A;  3BCD A;  4EM1 A;  4JX6 A;  1UFM A;  2NS0 A;  5B5E C;  1VQM I;  4HF0 A;  1KK0 A;  2ELH A;  4C3I J;  1XSV A;  2JSC A;  3HRU A;  3OJW A;  3SJM A;  4QSH A;  1MKM A;  3NEU A;  3VPR A;  4WZT A;  2F3L A;  4BEH B;  1N07 A;  3F72 A;  4LMY A;  4LJZ F;  4RM0 A;  2A05 A;  3MKY B;  1H80 A;  3CMA I;  4F55 A;  4BNC A;  3B82 A;  2CFX A;  3LSJ A;  5FJ8 J;  3IP4 B;  3F9K A;  4AID A;  1IDZ A;  1JI8 A;  3WOD F;  5DS0 A;  4B4C A;  4YZQ A;  3IKV A;  3SJZ A;  2G7U A;  3ASO H;  1M90 D;  2DMQ A;  2M30 A;  2HI3 A;  2B7E A;  2KLO A;  1L3L A;  2H1L A;  3DPU A;  4GO1 A;  5L46 A;  4ZYH A;  1ELO A;  1R22 A;  3T1B A;  1TWA J;  2QWW A;  3PL8 A;  1FTT A;  1K78 B;  4MR0 A;  4P9S A;  2Z2S B;  3OL4 A;  4L8J A;  2VC1 A;  3CCS I;  4L0Z B;  3SUC A;  1D1A A;  4XR6 A;  3L2V A;  4OJ6 A;  2EIL H;  2O61 A;  3BQZ A;  3Q6Q A;  4G7X A;  3RQ4 A;  3OYN A;  1EXM A;  4XON A;  1FRQ A;  4FT8 A;  1AOY A;  2BXZ A;  2XEX A;  2MFZ A;  1OR7 A;  2R7Q A;  2F5C A;  4BQQ A;  4UUV A;  2ECB A;  2JSP A;  2AS5 F;  3K4M A;  1VQ4 B;  3V42 A;  4LBY A;  2X85 A;  4FQG A;  3VYS B;  3T51 B;  2JWT A;  1OR7 C;  1BN8 A;  5F4J A;  1YRN A;  1QQI A;  1Y6I A;  2DTZ A;  2DJI A;  2K9N A;  2L02 A;  5E8I A;  2VYQ A;  2LBF A;  5CKT A;  4ZTJ A;  4A3C J;  4PC2 A;  3ISX A;  3CCJ B;  1HST A;  2XPW A;  3ZMV A;  4HNV A;  2JUC A;  1O4X A;  3GLL A;  3EQO A;  4C2M J;  2EV6 A;  3ZP5 A;  5E8G A;  1PJ7 A;  3F22 A;  1RI7 A;  2R7O A;  1F60 A;  4RLZ A;  1K28 D;  4ZH4 F;  2L7Z A;  1W0K A;  5EG0 B;  4KJZ A;  1OYY A;  3OYA A;  3M8F A;  4PJL A;  3NQO A;  2RGV A;  2W6J A;  3RI4 A;  1UMK A;  2VBT A;  4X6A J;  1Y0U A;  4PDK A;  5HLI A;  1PUF B;  1T8I A;  2B7B A;  1TP4 A;  4J00 A;  1S8N A;  3U21 A;  4CCN A;  2UVE A;  2QA4 B;  1S3J A;  5ED4 A;  2V7W A;  4XKB A;  3LQQ A;  1JJ2 B;  3ZMT A;  1QGZ A;  2CF4 A;  3BJ6 A;  3AFH A;  3WTV C;  2A69 F;  2QSF X;  5F04 A;  2A6H F;  2K02 A;  3TED A;  2JRM A;  1I7P A;  3CCU B;  2V9V A;  2BY3 A;  4FXU A;  3OAA A;  5FFX A;  2O5R A;  1J75 A;  4WZL A;  2E1M C;  3PUM A;  5TGT A;  1TW3 A;  2XGD A;  3E0J B;  3Q3S A;  2WJY A;  2MLG A;  3ASN H;  3W3C A;  2O6W A;  2BM6 A;  2E34 A;  4RS8 A;  1W7P B;  3IRQ A;  3KLN A;  1B8I B;  1HW2 A;  3PIP F;  2VT2 A;  4Z2Y A;  2OD5 A;  2RKH A;  2LNB A;  3CTA A;  2PJR A;  1UAA A;  4OIO F;  4U9U A;  1G7S A;  3MKW B;  3IAM 2;  4W97 A;  4Y13 A;  2YU3 A;  2CV1 A;  1VLY A;  5HDK A;  1RUO A;  3NAW A;  2WTE A;  5EYR A;  2W82 A;  2EFG A;  4OIQ F;  3KP7 A;  3HBL A;  5FFZ A;  4W8T A;  5E3M A;  2L01 A;  1E79 A;  1YHQ I;  4AIK A;  1E64 A;  1B4A A;  4RPD A;  5DCF A;  2D3N A;  2P3M A;  3W6V A;  3EQL F;  3ESW B;  1UCR A;  4OZY A;  5K7F A;  4Z4V A;  1LKX A;  1WSU A;  2OBS A;  4DNT B;  1T0F C;  4Z4Y A;  2FU4 A;  5KW9 A;  3AG4 H;  3KZI C;  2M9H A;  3KYL A;  4LIT A;  2HU9 A;  3OYM A;  5KAF C;  2XV4 S;  3G6E I;  2NVY J;  3OPO A;  3S2W A;  3HYI A;  1I8D A;  2FOW A;  5LRS A;  2WSS A;  2O7O A;  3R61 A;  4X06 A;  3KEO A;  1U5T A;  3KP2 A;  3FXK A;  1K6Y A;  1Z3X A;  2FE3 A;  3QAH A;  1W0U A;  2HTJ A;  1C0W A;  1FX0 A;  3F8C A;  4M73 A;  3MZ8 A;  3OMY A;  1FP2 A;  4LG0 A;  4BJ5 C;  2MH2 A;  3W2F A;  1U5T C;  2EA4 A;  3WGI A;  2A07 F;  2CRG A;  4HLX A;  5LD2 C;  1TYV A;  3D0S A;  4OMY A;  5CVI A;  2A61 A;  2MC4 A;  4IKF A;  1KK1 A;  3OS0 A;  1XPX A;  1T56 A;  1QVF B;  1WJF A;  4M9Z A;  3CC7 B;  4ANJ A;  2ECC A;  5BQT A;  1HDD C;  2JA7 J;  3OYD A;  3RY8 A;  3AGQ A;  2PMH A;  1FRN A;  4UVA A;  2O3F A;  1IB0 A;  1PJ6 A;  2XRO A;  4KDP A;  3M8J A;  3CF2 A;  4M6Y A;  1RWR A;  2LF7 A;  1MMA A;  1NB0 A;  3K70 C;  1G7C A;  4YAL A;  1W36 D;  3PFY A;  1G7T A;  1Y8R B;  3DXJ F;  1DGW Y;  4NDL A;  1UD4 A;  3S3M A;  4O3M A;  2FVG A;  3DV8 A;  4XRF A;  1LVK A;  3WTS C;  3KEY A;  1QZZ A;  1MNE A;  1R7J A;  1FSE A;  2OF7 A;  3ZIA A;  3VFZ A;  5GAE J;  2V7X A;  4FWT A;  1VQL I;  2IPQ X;  3W6K B;  1LFP A;  2L7K A;  4U87 A;  4Y33 A;  4OWR B;  3JRI A;  1DG1 G;  2F5F A;  1MSF C;  3FBN B;  2ZKZ A;  2DCU A;  2E36 A;  1HW1 A;  2LZJ A;  1HF2 A;  1QUF A;  2JVH A;  3CMY A;  1X58 A;  3M4O J;  1HZE A;  3CJT B;  3DLA A;  3WTU C;  4KFC A;  4E70 A;  2QX3 A;  1LDJ A;  3WTT C;  1JKR C;  5J3L A;  5FLM J;  5H5J A;  2VNJ A;  3ZPP A;  1H9T A;  1O57 A;  1UD6 A;  2GM4 A;  1J5Y A;  2O8X A;  2E1R A;  4A69 C;  2D2W A;  2BSA A;  5AMV A;  4KN4 X;  3JAM K;  1P4A A;  3PO3 J;  2KRH A;  2E7W A;  2GAU A;  2JJ7 A;  2O6G E;  2CND A;  3SLD A;  5BSY A;  2L9N A;  5ICG A;  3IV5 A;  1GAQ A;  3ZZ0 A;  4EM0 B;  2E5N A;  1YX2 A;  1U0J A;  2M45 A;  1WU8 A;  1QRY A;  4FN5 A;  4ACB A;  1ENH A;  3BJA A;  2XOK A;  1TBX A;  4BY1 J;  3CC4 B;  4RBO A;  4HNT A;  4M53 A;  3J81 Z;  4D1Q A;  2BBY A;  3VMV A;  2ZFW A;  4ZGQ B;  1IAW A;  1GAW A;  4BUP A;  3BP8 A;  4MLO A;  5IPA A;  3H3U A;  3TBI A;  3AL0 B;  4OOI A;  5FLX K;  2J8I A;  2LF8 A;  3LL7 A;  2Q8K A;  2ZZE A;  4KIT B;  4ESF A;  2HOT A;  2VBK A;  2XNC A;  4M3F A;  1QHG A;  1IRF A;  3VDX A;  3ABT A;  1WH5 A;  4X05 A;  1WH7 A;  3CB4 A;  5A88 A;  1EA0 A;  3A03 A;  2L2O A;  4CCO A;  3GVL A;  3ASQ A;  4CCM A;  3QOE A;  5DDG A;  4Y15 A;  2HDC A;  3SKB A;  1B1B A;  2DDA A;  1E3H A;  4ZV4 A;  3ERE D;  2DU9 A;  2LC2 A;  3NRV A;  1GO2 A;  2Y0S N;  2X51 A;  3A0H C;  3L9F A;  4MTD A;  3ULQ B;  5JLW A;  3SXY A;  2E1O A;  1PXZ A;  1ZK8 A;  2V7V A;  4Y9R A;  3MZY A;  1IF1 A;  1VQ4 I;  3HOY J;  4BL0 B;  4PGO A;  2F6C A;  2ZSH B;  4RM3 A;  3M3Y J;  3GTG J;  4H4K C;  1ZGW A;  3KET A;  3GTO J;  3GZ5 A;  3JRA A;  2W48 A;  4P55 A;  4PMH A;  1RET A;  3FBI B;  4HW0 A;  4I0A A;  2ZJP F;  4H0E A;  4AIJ A;  1MJB A;  4Z06 A;  4ESJ A;  2A5Y B;  1IN5 A;  3DTK A;  4OIR F;  1PJ5 A;  3N97 A;  1WTH D;  5J1U A;  3UNG C;  1IJW C;  2EV0 A;  2M34 A;  4NQW B;  1IN4 A;  2XAJ A;  4UB6 C;  2EJR A;  4U4B A;  1MBK A;  4HQM A;  2W57 A;  1KQ0 A;  4XQF A;  5L3G A;  1DDI A;  4WWV A;  1T2K A;  5C4X J;  4RD1 A;  1O3Q A;  1TTT A;  1FNN A;  1N05 A;  3RYP A;  3JSO A;  4UVB A;  1BJA A;  2QA4 I;  5KVR A;  3WG7 H;  5L3B A;  4V19 K;  4OPV A;  4OAZ A;  5CPR B;  5GV8 A;  2BW3 A;  1OQY A;  5LEK A;  5F64 A;  4I02 A;  4XN0 A;  2C6Y A;  3QSY A;  1E0E A;  3E3V A;  2XAH A;  5AIQ A;  2OTJ B;  2CUJ A;  1MJ9 A;  1YYV A;  4XMY A;  4RLF A;  3OYF A;  5IOZ A;  1HVX A;  1WOP A;  4MYU A;  2VNH A;  4RD0 A;  3M8E A;  4CYC A;  1ETW A;  4RM2 A;  2XAS A;  2X0K A;  2K40 A;  4XOR A;  3RKY A;  3BCF A;  1MBF A;  1T95 A;  1JGS A;  4BEH A;  4NK8 A;  3ZQQ A;  1CQX A;  2PEX A;  5L3C A;  1UHS A;  3ASR A;  5F0F A;  3SQV A;  1FOX A;  3OOP A;  5IP9 J;  2DA7 A;  3VMF A;  5DN6 A;  3QFT A;  2G9W A;  1FBS A;  3OS1 A;  3QFS A;  1MJA A;  3CO6 C;  3HG9 A;  1H89 C;  1VQ6 I;  1WVR A;  2VT3 A;  4YFN F;  4XID A;  2B7C A;  1KU2 A;  4CH7 A;  3CCE B;  5A8A A;  5ERI A;  4A6E A;  4HV5 A;  2BV6 A;  3ZQF A;  4TN1 A;  3TP0 A;  1R49 A;  4P12 A;  3G2B A;  1ZKG A;  3WGH A;  4QVJ A;  2X3U A;  3VR6 A;  5JLV C;  2KP6 A;  1UD3 A;  1K6O A;  1GR1 A;  5FKK A;  3W2V A;  2BM5 A;  3OOC A;  1K78 A;  3IWF A;  3NE5 B;  1D3Y A;  2CGP A;  1YI2 I;  4M72 A;  1OLT A;  1ZM9 A;  3QFR A;  2KZV A;  1XDS A;  2QMU A;  2QCO A;  1X19 A;  1ZGA A;  5M3F J;  3I0T A;  1REP C;  4G6Q A;  4MQV A;  4P6V F;  1TNS A;  4P2N A;  4YAF A;  2BM0 A;  3QFC A;  5HXB A;  1KTW A;  3A8I A;  3SZG A;  4U0W A;  3WWG A;  1GLN A;  3CPX A;  1B72 B;  2DPD A;  1QG0 A;  3VYU B;  1XB4 A;  3ML6 A;  1RNL A;  3OS2 A;  2VBX A;  5THX A;  2X1D A;  3Q3A A;  3EDP A;  1QJV A;  2A68 F;  2E1M B;  4DJA A;  5LEJ A;  2R7U A;  2IP2 A;  5JHF A;  4A6D A;  1OFL A;  3MCZ A;  3CME I;  3IH3 A;  1QA6 A;  2AO9 A;  1IXS B;  2FML A;  3GME A;  5JLX A;  4EVI A;  1YJN I;  1XQB A;  5EF6 A;  3O2P E;  2DCE A;  5TJJ A;  2R0Q C;  1ZN2 A;  5TR9 A;  2P5V A;  4M6V A;  5B66 C;  3VEP A;  1UD8 A;  3AG2 H;  5EG0 A;  3SHF A;  1VF7 A;  4R1H A;  4ZTF A;  1X2M A;  3ZUG A;  2CH0 A;  2R7D A;  1QO0 D;  4QPO A;  3CC7 I;  1IRG A;  2VAS A;  3IWZ A;  3PVD A;  4Z1M A;  3G3Z A;  4WK8 F;  4DK0 A;  4OJL A;  4BQN A;  3IRR A;  2PJR B;  1PUF A;  1FNM A;  3FXO A;  4ACA A;  4KN7 X;  2OV7 A;  3FMS A;  2CV0 A;  3U9G A;  3LA7 A;  1SMY F;  3LQR A;  3BY2 A;  3ZBT A;  1DU6 A;  2JPB A;  4EAT A;  2XTX A;  2EPF A;  1YG2 A;  1H0M A;  1WOR A;  3A4C A;  2A5W A;  3CZ6 A;  1P2F A;  1WJC A;  4A0Z A;  1UB9 A;  1Z21 A;  2D1V A;  2ELK A;  1AIR A;  3OWT A;  2A3S A;  2NNN A;  1Z9C A;  2JT1 A;  4L9J A;  4F93 B;  2R7V A;  5LFA A;  2O8K A;  4U49 A;  5BPD A;  2RN7 A;  1NHC A;  4DBR A;  1GVH A;  1XCV A;  4QLC U;  4BDY A;  5J8C A;  2PE3 A;  4JP0 A;  1NTC A;  5BNG A;  3DTE A;  1B8I A;  3MN2 A;  4NC8 A;  1YW9 A;  3O8G A;  2NVX J;  1BOA A;  3ZN0 A;  1TWC J;  3HHG A;  4MFE A;  2FXA A;  2H09 A;  4MXN A;  1MBH A;  4BHB A;  1VND A;  3DBH B;  2JA8 J;  1J09 A;  2FRH A;  2R5Y B;  5CQG A;  1E43 A;  1B23 P;  4EM2 A;  1U5T B;  3W2G A;  1V55 H;  3TOB A;  4YHB A;  5JHU A;  3AVU A;  2G0E A;  2X1E A;  1XGS A;  1IDJ A;  3JRB A;  4N3N A;  4A0X A;  4LG0 B;  1ONV A;  1OJL A;  2QSH X;  1G3S A;  3OYJ A;  1TWH J;  2VOP A;  1OCC H;  1ON2 A;  1RR8 C;  2HOA A;  1Z77 A;  2V1D A;  5IT9 Z;  2LH9 A;  2WWY A;  4K2E A;  3UR3 C;  4C43 A;  2JA6 J;  1OFC X;  3VSK A;  3HZJ A;  1TWG J;  3DWL E;  1GVJ A;  5H59 A;  2IGN A;  1K4T A;  3TH0 A;  3ZSC A;  4CDG A;  2EWN A;  3D5L A;  3HRS A;  3D5R C;  2AHO A;  4ZDO A;  1IJE A;  4JX4 A;  4LD5 A;  2GK7 A;  4LBW A;  2DMT A;  3KE2 A;  1QA3 A;  1OOC A;  2DT6 A;  3OZW A;  1QRB A;  2ACJ A;  1V3F A;  1MDM B;  3I4N J;  4Q47 A;  3T9G A;  4WX9 A;  4Y7C A;  2E35 A;  4G6D A;  1BJK A;  5HLH A;  1IV6 A;  3H3V K;  3OIO A;  4L9T A;  1EP2 B;  2ZZG A;  3AK5 A;  2P5K A;  2K85 A;  1ON1 A;  2JVG A;  2HOS A;  2Q1Z B;  4JOM A;  2AHQ A;  3FMQ A;  4RDJ A;  3KYD B;  1VF9 A;  2XHK A;  1I6H J;  4X0G A;  2QGU A;  2H6C A;  2QQA A;  3BNW A;  1QRC A;  5K7H A;  1BW5 A;  5E1W A;  1VQP I;  3CJR B;  3V7R A;  1ZGJ A;  2RQQ A;  4XK4 A;  1VTN C;  3CDL A;  1XB2 A;  1QZY A;  2MH9 A;  1OCP A;  1XMK A;  1MMG A;  5D6E A;  1JKO C;  2MD0 A;  1BOB A;  1QH0 A;  3ASP A;  3LYC A;  4PJJ A;  2GLO A;  1UD2 A;  1IB4 A;  3HOX J;  1NBM A;  3ELK A;  2Z6B D;  4XL9 A;  3PNT A;  4II3 A;  4B47 A;  4ETS A;  3OYI A;  4HDV A;  2IT0 A;  1W35 A;  2MA3 A;  2C77 A;  4YAW A;  3MMP A;  1VZ0 A;  2NAZ A;  4HNU A;  1I27 A;  5IYQ A;  2X3H A;  4DYC A;  3Q0W A;  3H5R A;  4XBF A;  4KNY A;  4GYG A;  2LDU A;  2KDZ A;  1DAR A;  4HOB A;  4E4H A;  3L2R A;  5FLV A;  1BMF A;  2ZSI B;  2IQ7 A;  1XFO A;  1ZQ3 P;  4IOA F;  2FSW A;  2DY1 A;  3FY3 A;  2XIG A;  2MW8 A;  3ZC3 A;  5ILU A;  5D5W B;  4XLA A;  5HS9 A;  2F4N A;  4IHV A;  1F1Z A;  5F1R A;  3VOD A;  2ZBV A;  4Z6Y A;  3F8F A;  3F8N A;  4CSW A;  4KMF A;  1XMX A;  1U9N A;  2ICW G;  4I09 A;  1WGX A;  4IHY A;  2CS3 A;  4Q7J B;  4QFM A;  3QE2 A;  3E5U A;  2WJV A;  4EJV A;  2Q2E B;  1PLU A;  1P7I A;  2Y75 A;  4C2T A;  1JA1 A;  1IRX A;  2DFH A;  2QVO A;  2PMD A;  1ZYR F;  2X48 A;  3MMY B;  1QA1 A;  3FKS A;  2EIN H;  2OTJ I;  3R6S A;  3OYG A;  1U9O A;  2DOE A;  1T38 A;  2VQL A;  2O0W A;  4TV7 A;  1J2X A;  2HQN A;  2COM A;  4UY8 I;  3OZV A;  3I56 B;  4KIF A;  2H1K A;  3DFG A;  3Q0V A;  4XKC A;  4RGU A;  2YU9 J;  3GFI A;  2ISY A;  2FX0 A;  4QPQ A;  1E62 A;  2VN2 A;  1O3R A;  1L1I A;  1N0V C;  5EMN A;  4W8S A;  5BS6 A;  2OQG A;  2DET A;  4OOX A;  1KJZ A;  4OIN F;  3ZCO A;  4XLP F;  1O8F A;  4N4N B;  3E5X A;  2DDB A;  3FK6 A;  1FDR A;  3SY2 A;  1UHM A;  1YX5 A;  4AD9 A;  1FEX A;  2OBP A;  2NRA C;  1MBE A;  1WP6 A;  3OYL A;  1FC3 A;  1QVG B;  2KDO A;  4RAY A;  1TQI A;  3VYT B;  1DU0 A;  4C3J J;  3E6D A;  5BOX A;  1RRJ A;  2CQK A;  1O7F A;  3PSF A;  3Q0U A;  3G73 A;  4CZZ A;  1RKW A;  4I76 A;  1GT0 C;  1CF7 B;  1GHC A;  4LGW A;  1BX0 A;  3S3O A;  4UV9 A;  1Y0R A;  5IYW A;  4Z05 A;  3AVW A;  4IQJ A;  2QTL A;  4PC6 A;  3RQI A;  5IP6 A;  2WZN A;  1IN7 A;  2QM3 A;  3BC8 A;  2YPR A;  4PC7 A;  1FBQ A;  2OCC H;  3RKW A;  3MQ0 A;  2VKD A;  4UNO A;  4YEJ A;  1S6L A;  2K9Q A;  2R4G A;  3KCC A;  2LKX A;  1X1C A;  2KZG A;  4OIP F;  3DU6 A;  3H9N A;  2HQA A;  2QUF A;  1A6Q A;  5J3O A;  1RIO H;  4KKT A;  2OK8 A;  1KQS B;  2OTL B;  2W7Z A;  1DPU A;  2PI0 A;  3BPV A;  2M0C A;  4NCN A;  1VI0 A;  3KX2 A;  5IK2 A;  3DPL C;  3GTL J;  3CXC B;  5KCM A;  1K4S A;  1TC3 C;  4RPB A;  1WKM A;  3I3L A;  2K4J A;  4HAM A;  3E20 A;  3K1P A;  3LSH A;  3CCQ I;  4CQJ A;  2QEN A;  3LSI A;  3CCL B;  2ME0 A;  2QQB A;  2VI6 A;  2R7F A;  5FKN A;  1P4M A;  1DP7 P;  1O88 A;  3K4B A;  3J7Z I;  2IA1 A;  4BDZ A;  4NQW A;  4CYC B;  2DAO A;  1D5Y A;  3GTM J;  3PET A;  3I4P A;  4FK8 A;  3HL2 A;  2C5H A;  4J0Q A;  4AF7 A;  3X2Q H;  1FOK A;  3C7J A;  4IEJ A;  1HCR A;  3CCV B;  1N8R D;  3HTU A;  5TV2 A;  3BR3 A;  3H92 A;  2LY9 A;  2JIZ A;  5JBQ A;  2YX4 A;  4MTE A;  4RJL A;  1FIP A;  3N90 A;  1YW7 A;  3ZN1 A;  2RC5 A;  3LJY A;  3R60 A;  4A12 A;  2ZB9 A;  3OIQ A;  4QWQ A;  2LY1 A;  1A35 A;  1IUY A;  4XSZ F;  1PUE E;  4E7S A;  1O8E A;  1KQ8 A;  2RV8 A;  2QF7 A;  1JUP A;  3HOU J;  3L00 A;  3OOU A;  4G6T B;  3RTR A;  4ASU A;  2DK5 A;  2QLZ A;  4IQ4 A;  2DFI A;  3BCA A;  1OFM A;  1G6N A;  2D45 A;  1UD5 A;  3A0B C;  1MMS A;  1J59 A;  4TMW A;  4D5C A;  1WMR A;  2QYU A;  1P92 A;  1I1S A;  3VST A;  2F1L A;  4HQE A;  4TMX A;  4UUS A;  5D6F A;  3ZMS A;  2BHZ A;  3ROU A;  1XG2 A;  2KIQ A;  4S0H B;  3GSI A;  5FIU A;  1X4P A;  1DBG A;  2MLK A;  3K4J A;  1B2R A;  1SVO A;  1TWF J;  3TP3 A;  2BGJ A;  2IS2 A;  1S7A A;  3KLO A;  4M71 A;  2R7Z J;  3PQK A;  4LBZ A;  1TLH B;  4JBA A;  4RDK A;  2DER A;  2HTS A;  1MBG A;  3DLL F;  1D1C A;  4TMZ A;  3CUO A;  2L9V A;  4PJM A;  4TT3 A;  3CC2 B;  2BM4 A;  4YZA A;  4OU0 A;  3J7A Y;  1A31 A;  1PVE A;  3U1K A;  4ZJZ A;  5GAH J;  4L9V A;  3G05 A;  4YIF A;  3BQY A;  3WY9 A;  1YJ9 B;  2B63 J;  1XN7 A;  2ZL7 A;  1WOS A;  1OGM X;  2DJN A;  2OBR A;  3HSE A;  2XB5 A;  2ESH A;  4L5I A;  3AVX A;  2VBW A;  3DF8 A;  2V9K A;  3A1P A;  4B3F X;  5IYN A;  1JRG A;  2R93 J;  1O8I A;  3FF5 A;  2NTP A;  2IW5 A;  4BE1 A;  1V54 H;  3LQ6 A;  4XM3 A;  2NYX A;  2H94 A;  3RCO A;  2EWE A;  3WGG A;  1BA5 A;  1SFX A;  3U6B A;  1EKE A;  2KPM A;  2ME6 A;  5F1J A;  4P1W A;  1DQU A;  3A3B A;  1XGO A;  3KPH A;  1Y1V J;  2XF5 A;  3OYK A;  1B72 A;  2XNJ A;  3FDY A;  1VQK B;  1BI3 A;  3S17 J;  3BR6 A;  1HW5 A;  4YAO A;  1OFE A;  4DQL A;  4FCY A;  5CVV A;  2NPF A;  3N05 A;  4U88 A;  2A6T A;  3CCR I;  3P9C A;  5FA6 A;  1BM9 A;  2XRL A;  1JUM A;  1RKT A;  2MSY A;  1S7E A;  1UST A;  3V4G A;  3I5U A;  5CVR A;  4G8X A;  4WZK A;  4A3B J;  3NB2 A;  3GYH X;  4MHG A;  3IL2 A;  4HYE A;  2KMU A;  2XB0 X;  2XDV A;  1XD7 A;  2V79 A;  2BHY A;  3GUD A;  4IJA A;  2EFN A;  2LVS A;  2XGX A;  1ZG5 A;  4TSF A;  1Z0X A;  4RAG A;  1EA3 A;  1ULY A;  2M87 A;  2VFP A;  2HLD A;  1V5F A;  3BTJ A;  2DA3 A;  1FBU A;  4V2G A;  3UW0 A;  2NVU B;  3EQN A;  4OAY A;  1XG1 A;  2DQL A;  1QGA A;  2YWG A;  4RA2 A;  2QYO A;  9ANT A;  3CMM A;  1D8T A;  4A3L J;  3Q38 A;  3K1M A;  5IYR A;  4HSR A;  4PJN A;  3BY1 A;  3WXM A;  4ABZ A;  1T0F A;  3HGG A;  1VQN I;  3OEE A;  2WV1 A;  5HLG A;  2CW8 A;  2WYR A;  3KP3 A;  4HX4 A;  3SZT A;  1KK2 A;  3DPT A;  2F5E A;  2LP0 A;  3K9T A;  1O8J A;  1U78 A;  3MHP A;  2Y0S A;  5H6R A;  4ZZD A;  2XSD C;  4RAZ A;  4U7B A;  1EV7 A;  2DXI A;  2IA2 A;  2L9R A;  1NRK A;  4A3K J;  1OGJ A;  1ETK A;  1T6Z A;  1OB5 A;  1F43 A;  3CLO A;  4N4O B;  4B3G A;  5IY5 H;  4HF2 A;  4LLG F;  5IT3 A;  3P27 A;  4BHP A;  3JSP A;  4X1E A;  3G4S I;  1UZC A;  1WPK A;  4Y7N J;  2R5Y A;  4G1V A;  4CZC A;  3ABU A;  2HMA A;  2NTQ A;  2ZTG A;  2GXB A;  5DEQ A;  1TL8 A;  3A8K A;  3HIF A;  3HOZ J;  2VJ5 A;  1SD4 A;  1WPC A;  5HDN A;  1D1B A;  2XKO A;  4YFX F;  1JGG A;  1N06 A;  2ZO4 A;  4XIC A;  3IC7 A;  1HKS A;  4XLF A;  2R9V A;  3CES A;  3F6O A;  5D4S A;  3W6J B;  3WNC A;  2L7M P;  2STW A;  4B44 A;  3E5Q A;  1FYM A;  1BJZ A;  5B3S H;  3SDB A;  1QVU A;  4Y52 J;  2QXZ A;  2X6W A;  4N3G A;  4E7H A;  1YIJ B;  4CHU A;  3B78 A;  3MKZ A;  2VIX A;  2PBI A;  1IDY A;  2HQ5 A;  1M1E B;  2K4B A;  4LIV A;  4RB2 C;  4IO9 F;  4G7Z F;  1T5E A;  1LDD A;  4AVZ A;  1EP1 B;  4G1B A;  4QVA A;  4IRH A;  2E2H J;  2XGJ A;  2VFO A;  3GTJ J;  4JX5 A;  3S32 A;  2EZI A;  1W36 C;  1VQ7 B;  3ASS A;  4KIC A;  2CW5 A;  1MDM A;  1LFB A;  2GZW A;  1QPI A;  3HM5 A;  1OGI A;  2XGE A;  2A6E F;  4IHW A;  1OB2 A;  4CCJ A;  4E7L A;  5HZB A;  4RB0 A;  5FKO A;  2Z1D A;  1R5G A;  3WQZ A;  4FE7 A;  2EFQ A;  3PUF A;  3M1C A;  5ICC A;  1SFK A;  1BL0 A;  2LTP A;  2ZME C;  4RB1 A;  2DOG A;  2ZJ2 A;  2DOD A;  2F1M A;  1SD6 A;  4DIQ A;  2W4S A;  4PAB A;  1YO5 C;  5KAI C;  1KGS A;  2EK5 A;  3PA2 A;  3AVV A;  4OJP A;  3E7L A;  1PP7 U;  2WAE A;  5CVU A;  1BQE A;  1U6G A;  2CW7 A;  3DQV C;  3ZPN A;  1W0T A;  3KRG A;  4ZCM A;  3RDI A;  1COW A;  2O1D A;  3BT9 A;  4B09 A;  1XSD A;  5LGU A;  1BR1 A;  1VBL A;  2Y48 A;  5BPI A;  4PK4 A;  2VKH A;  5FRM A;  2XZO A;  3LA3 A;  3JUR A;  2DK8 A;  2E1C A;  1ETY A;  2WY7 Q;  2W1O A;  5CJ9 A;  3ZQG A;  2VL8 A;  1KQ9 A;  1MRZ A;  2FJ1 A;  3CCV I;  1R5O A;  4M2L A;  4BJ6 C;  4P1V A;  3I4M J;  1XDU A;  2VPR A;  1X1A A;  4S04 A;  1JA0 A;  3NAR A;  1NK3 P;  3N6Z A;  3TO6 A;  5GTI C;  2G7H A;  3PQJ A;  2I5U A;  2Z33 A;  3ECO A;  2WR8 A;  1O8M A;  2W7N A;  2Q2E A;  3GO5 A;  3J80 K;  3H1C A;  3OYC A;  5F08 A;  1LNW A;  4QHY A;  5FKM A;  3P4G A;  3TW7 A;  1F9N A;  1POG A;  5TIS C;  3RSN A;  3FXJ A;  3LMM A;  3PNV A;  5FRN A;  2V7Q A;  3A35 A;  2CFO A;  2DMN A;  1LFU P;  2R7R A;  3RZO J;  4NUB A;  2C4T A;  2VBV A;  1YIT B;  3JTH A;  2L3D A;  3ZQI A;  3JRG A;  4A0Y A;  4DGW B;  5TRD A;  4HX7 A;  2FEZ A;  1VJS A;  1RU4 A;  2MG4 A;  3B73 A;  2WY8 Q;  2XF6 A;  5CLS A;  1G2H A;  3BR5 A;  3SYT A;  2PJP A;  1OKR A;  1YS6 A;  2GA1 A;  3RPU D;  2CBX A;  3HC7 A;  2E2J J;  5LHI A;  3H0D A;  4PAA A;  1Z67 A;  5L3F A;  4XLC A;  1WOO A;  5H20 A;  2ZNZ A;  3JRD A;  3I64 A;  1IGN A;  2XTY A;  1KA8 A;  3JAM Z;  2NSP A;  2GWR A;  1ZAR A;  3E6B A;  3Q39 A;  1TZL A;  1QGY A;  2B0R A;  1N25 A;  3CUQ A;  3FHN A;  4B3A A;  3CC2 I;  2DW4 A;  3GFL A;  3C18 A;  1YTY A;  3GVJ A;  2HS5 A;  2K27 A;  2CMP A;  2M4K A;  3BRO A;  4ZCL A;  1TQM A;  1IA5 A;  4YFO A;  3FX3 A;  1BI2 A;  2ELJ A;  2VLA A;  1U2W A;  5J6X A;  2RRE A;  2XKP A;  3CUQ C;  4RGS A;  3CCJ I;  3BR2 A;  1ZH5 A;  1TVC A;  3KIO A;  2FNA A;  1S72 B;  2M3A A;  5ICE A;  4MEY F;  4P96 A;  3GVK A;  3U6K A;  1ETV A;  1CF7 A;  4D5F A;  2VZL A;  1BBY A;  3OSG A;  1PP8 F;  4YC5 A;  5CVJ A;  5FLX Z;  3L09 A;  4L0Y B;  2DA1 A;  2VON A;  3GBG A;  1F20 A;  4ZDL A;  3DKX A;  1V5E A;  2L4A A;  2RNG A;  5DD8 A;  2HNH A;  4YAU A;  3VOE A;  4B8X A;  3FXR A;  1QZE A;  1SVM A;  2XGC A;  2HYG D;  5E3L A;  1MZB A;  5LLQ A;  3FHZ A;  1SFU A;  2FF4 A;  3CDI A;  1NK2 P;  2DT7 B;  4XN3 A;  3QWL A;  1WZ2 A;  2L0K A;  2HDW A;  4AM3 A;  4I6Z A;  1YLF A;  3GLX A;  3S2H J;  3K69 A;  1R58 A;  4HX8 A;  3CCU I;  4M3D A;  2M7A A;  3M9A A;  1SD7 A;  4OP7 A;  4UUT A;  1NH3 A;  1Q82 D;  2INV A;  4G9Y A;  3ZMD A;  2HZD A;  4FX4 A;  2RQP A;  4LB6 B;  4PJ0 C;  2XZP A;  4M0L A;  3ONQ A;  4OJ5 A;  2FUG 2;  2VQC A;  3QYB A;  2EBI A;  2Z5U A;  2QKM B;  3EPZ A;  2F5V A;  3SZP A;  4UUS B;  3IKT A;  4LBV A;  1IV8 A;  2NV4 A;  3JTG A;  1GXP A;  3H3Z A;  3BQJ A;  4F7D A;  5IP7 J;  2BM7 A;  2P7C B;  4DOZ A;  4M9S A;  2DI3 A;  4XRS G;  2OQR A;  3LNQ A;  1WRJ A;  1HF0 A;  2R7T A;  2EFP A;  3PSZ A;  3HTS B;  5J47 A;  1YLO A;  3VSV A;  1XGM A;  2J8K A;  4ENM A;  2FNP A;  5B6I A;  2TCT A;  3G71 B;  3BTI A;  3AAF A;  4WZE A;  3SJP A;  2MGQ A;  3AG3 H;  1ORK A;  1AIP A;  1QQ1 A;  5EEG A;  3S2D J;  5KK1 A;  2LK2 A;  4II2 A;  1SAU A;  3WTW C;  2GJK A;  3VSU A;  1NG6 A;  2V31 A;  3A02 A;  2M0M A;  4BXU A;  3FIW A;  1OCR H;  3BY6 A;  3WHC A;  5J1R A;  3A2K A;  1J9I A;  4KIS A;  1ZAO A;  3T8T A;  4AVP A;  2DYR H;  4G12 A;  2FQ4 A;  2BN4 A;  1BX1 A;  3FJO A;  4FTH A;  1EH8 A;  3K0L A;  4V2F A;  2XVC A;  2VNK A;  2GBY A;  4CCK A;  2OCE A;  3OZU A;  2XAQ A;  1MBJ A;  5DUK A;  2CO5 A;  1ZM2 A;  1EH7 A;  3GZ6 A;  1WCM J;  4R8H A;  2JMW A;  4KYW A;  2ISZ A;  1IG7 A;  4YCQ A;  3CF5 F;  1W87 A;  4PGG A;  3U2R A;  2E1N A;  1B59 A;  1QVT A;  1LM1 A;  4EW9 A;  3PSI A;  1YFH A;  3JQQ A;  1S9H A;  1I6X A;  3IH2 A;  4PFP A;  1ITY A;  4BU2 A;  4IOC F;  4G7W A;  2HYF A;  1YOV B;  1ETQ A;  1K5C A;  2H6B A;  3QPL A;  5D8L B;  1E2X A;  3M1E A;  1AU7 A;  2QKL B;  2P7V B;  1Y39 A;  4GQN A;  1WJE A;  3BG3 A;  1O8L A;  5L3E A;  5A2Q K;  1SAN A;  3RJP A;  3W5V A;  4JK1 X;  1KU3 A;  4F91 B;  3JQR A;  4QUZ A;  2Q6K A;  2C78 A;  2QGG A;  2LY2 A;  4Z4R A;  2PFB A;  4DZP A;  2F4I A;  1HXD A;  2DTR A;  3TMO A;  1VQ7 I;  1KU7 A;  4NC7 A;  4A3F J;  1IXC A;  3CLQ A;  5HDG A;  1S0U A;  1EFU A;  5IOY A;  1KZH A;  1GUU A;  3GVA A;  3WE3 A;  1RUN A;  3J7A O;  3BZ6 A;  2OBT A;  4LOC A;  4HZF A;  1DBO A;  3GX4 X;  2NT6 A;  3BH6 B;  1NB9 A;  1YW8 A;  1Z7L A;  1I3Q J;  4ENJ A;  5DS9 A;  1GQ8 A;  2AXL A;  4AUX A;  4AWX B;  1R36 A;  1X3U A;  3JRH A;  3OYB A;  1VQM B;  2WB1 A;  1ZRD A;  4M3E A;  2CG4 A;  4LLL A;  4B48 A;  3QPT A;  1T98 A;  1LEA A;  1J9Z A;  4OPS A;  3PUN A;  1JTX A;  3BG5 A;  4HST A;  2D3L A;  2HCJ B;  1XTA A;  1NJI D;  5DSZ A;  2X0L A;  3PIO F;  2NXN B;  4FHT A;  5DCM B;  3BJO A;  2K86 A;  1TUI A;  1Y1W J;  1FYK A;  1ZTR A;  2F4O B;  1MAB A;  1RES A;  2KT0 A;  5ILS A;  4BYY A;  1K79 A;  2CWE A;  2BV3 A;  5HNF A;  4YII A;  5C1E A;  3MVP A;  4OJO A;  4Q5S F;  1ZRE A;  1FNC A;  4A2U A;  3M07 A;  2MBF A;  3TDU C;  2BPO A;  4F7Z A;  3G1M A;  2VJI A;  2M5S A;  5C1C A;  3OYE A;  1WJD A;  3JRF A;  3K6G A;  3ES9 A;  2EIK H;  3P9K A;  4UXN A;  1FP1 D;  1LQ1 A;  2R5Z A;  3LOC A;  2VJJ A;  4NBQ A;  1SM4 A;  5A89 A;  1NG7 A;  3SFI A;  5GPC A;  5HKK A;  3CCS B;  3VNV A;  1O8H A;  2F4M B;  3OV8 A;  3DDY A;  3CC4 I;  5HOD A;  4JMQ A;  1OMI A;  4JYK A;  3PUB A;  3RIQ A;  2O17 A;  3VO2 A;  1QFJ A;  2VBZ A;  4ENK A;  2GOM A;  1ACI A;  4BH9 A;  3OE7 A;  2BSP A;  1W7P D;  4EMS A;  4PC1 A;  2C2W A;  1MIJ A;  4XLN F;  2IS6 A;  2NVQ J;  3QPH A;  3ZOB A;  4B1R A;  3AGP A;  3RKQ A;  1YIT I;  3DP7 A;  2VBY A;  4W8Q A;  2X6Y A;  3G1O A;  4EQQ A;  2HYJ A;  1W1W E;  2GXA A;  2V7F A;  2OZU A;  2NOJ B;  2ZME B;  4PZJ A;  4UVC A;  5B1A H;  2ODL A;  2ZXJ A;  4IW3 B;  3ZZT A;  4DNC A;  4OZZ A;  4BAC A;  5E18 F;  1H8H A;  1IO2 A;  4RD6 A;  1S5L C;  4RCY A;  1ZEL A;  2ID6 A;  3BC9 A;  1D0Y A;  1K4Z A;  4YZX A;  1A5J A;  2PIA A;  2K9M A;  3I59 B;  2M1B A;  3A1Y A;  4GXO A;  5LGN A;  4H9G A;  3U2Q A;  3R6K A;  1AMO A;  1Z6R A;  3EET A;  3RIR A;  4A3J J;  1OYW A;  5HOO A;  4IXA A;  5AN9 A;  2DN0 A;  3E6C C;  4L18 B;  3PM1 A;  3PSS A;  3GFJ A;  4X07 A;  2V26 A;  2STT A;  4BKX A;  3L2C A;  3V76 A;  4QV2 A;  1TYW A;  4LC0 A;  3LST A;  2XAU A;  5J1Y A;  1DAB A;  2XUB A;  4IHS A;  4RD2 A;  2GA2 A;  5E3O A;  3HPG A;  1ZRF A;  1KMH A;  3F8M A;  2DA4 A;  4I98 B;  5FO5 A;  4M3B A;  1JJ8 C;  3WYA A;  2EIJ H;  3S8P A;  4ZC3 A;  2XF7 A;  4KKU A;  3WBK A;  1CLW A;  2YUH A;  3CCY A;  2XT2 A;  1RR7 A;  1EP3 B;  1W0J A;  3FM3 A;  2GIV A;  1MD0 A;  1FMW A;  4YFK F;  1W34 A;  5J35 A;  2OPT A;  2DLL A;  4PCQ A;  4R71 A;  4EJW A;  3MFK A;  2Y2Z A;  1QX4 A;  1QCX A;  1VLO A;  2J7K A;  4MFD A;  4FE4 A;  4YXW A;  4BBR J;  5DNS A;  4TKO B;  2K9S A;  1X3W B;  5AIP A;  5F27 A;  1HKQ A;  1R1T A;  3M7G A;  5DD4 A;  1JXS A;  1DP3 A;  3W5H A;  4P5O A;  3FM5 A;  3A8J A;  2HWV A;  4DNR B;  2P6S A;  2MD5 A;  3SYJ A;  1KC8 D;  1JT0 A;  4BJT A;  3QOD A;  4G6I A;  1B6A A;  4X8I A;  4YDT A;  1R6R A;  3RKX A;  2CRV A;  4A3E J;  3ML3 A;  1P7J A;  1H9G A;  3HRT A;  3Q9V A;  3AKZ A;  2K9L A;  2WB1 N;  2YX7 A;  1AWC A;  3G6E B;  4HV6 A;  1JNY A;  4AF6 A;  1Y8Q B;  4UB8 C;  5GTH C;  4BXX J;  1I5Z A;  2CQ7 A;  3C2H A;  3WU0 A;  1CZF A;  2EB7 A;  3GQ9 A;  2EFW A;  2D1H A;  3Q9S A;  2LD5 A;  3LVB A;  2RDP A;  5E3N A;  1K73 D;  2DPU A;  3G71 I;  2DA5 A;  1JJ6 C;  3CCE I;  1TW2 A;  1A8P A;  1WSV A;  3KL9 A;  4PC3 A;  1XE1 A;  3CUQ B;  1YIO A;  1FZP B;  1DGR M;  3ZRG A;  4RAF A;  4URR A;  1KQ5 A;  2LRD A;  3OEH A;  4Z4T A;  3K4L A;  2HXO A;  4HG2 A;  2EZK A;  5FO1 A;  3W2I A;  2GQF A;  1WJ5 A;  2ZTN A;  3UKG A;  4NHJ A;  5FRO A;  3RZD J;  5F4O A;  4DQK A;  3EUH A;  2LMD A;  3I54 A;  3DBR B;  3PFI A;  3CJN A;  3T5X A;  2OK7 A;  2VBM A;  1LPQ A;  3V7S A;  1ZM4 A;  2P5L C;  1F5T A;  3FXQ A;  2GK6 A;  4WXH A;  4UZF A;  1FT9 A;  2VFQ A;  3HEF A;  2QQ8 A;  2X53 S;  3EUH C;  1UEL B;  4KT6 A;  2KIS A;  1JE8 A;  2MC3 A;  4FET A;  2HKX A;  2ZL5 A;  5DUI A;  1W2B B;  1YX3 A;  1SD5 A;  3FZV A;  5F0H A;  2PLF A;  3IH4 A;  5EJC A;  5LBQ A;  1P9Q C;  2M8E A;  4L9N A;  4ON0 A;  3W2H A;  1GXQ A;  1MMN A;  2JA2 A;  1P4X A;  3I53 A;  4C3H J;  2QSG X;  3GEZ A;  4KKS A;  1HC8 A;  1U3E M;  2JPC A;  3H5N A;  3WE2 A;  2JN6 A;  4KH3 A;  2WBM A;  3O6B B;  5K5R A;  2JRT A;  4YZ0 A;  2ZJR F;  2KJC A;  1P4W A;  3GW2 A;  4IL6 C;  4U0Y A;  3DEW A;  2JZY A;  2KJB A;  2VE9 A;  1FSH A;  5JI6 A;  1S7O A;  1TT5 B;  2XPU A;  5AON A;  1PKV A;  4PSW A;  1A04 A;  2V4D A;  1U2R A;  2P6T A;  5E20 A;  2ESN A;  2X6O A;  4PFO A;  1NDH A;  2DOF A;  2XSJ C;  2NS8 A;  1T6Y A;  2FX3 A;  4A93 J;  1A6I A;  3CRZ A;  3DKY A;  1E63 A;  5CDF A;  4E6K G;  1PE9 A;  2V4J C;  3ABL H;  3DBL B;  4E7I A;  1Q81 D;  4WCG A;  2Z99 A;  3FPK A;  3OJX A;  1I18 A;  2Y9Y A;  5D5U B;  1IN6 A;  1FOY A;  3E97 A;  1JTY A;  3T0Y A;  2EZH A;  1YQA A;  1BIA A;  4N9H A;  4KMU X;  1R4M B;  2ZCW A;  4MO7 A;  4I01 A;  4EJO A;  2NZM A;  3V8J A;  4AC0 A;  4M74 A;  1OPC A;  4RD4 A;  1V5V A;  2KVO A;  3H0G J;  3ISP A;  1LLW A;  3A01 B;  4Y4R A;  2DT5 A;  1O3T A;  2L5Q A;  2E71 A;  1B9M A;  1FWZ A;  3S93 A;  2JQ7 A;  5K7Z A;  4W1U A;  2DFF A;  1R1U A;  4O5V A;  1E1R A;  3BH7 B;  1G4D A;  3HKZ A;  2O9L A;  4PSX A;  2HGC A;  3RPQ A;  2EV5 A;  2E60 A;  3E6M A;  4IF4 A;  4YEL A;  4YEI A;  4S05 A;  2YS9 A;  5J8F A;  5ICF A;  3W2A A;  1SKY B;  2CQN A;  3GF2 A;  2X6X A;  1EJ9 A;  1BPL A;  3K4C A;  2PG4 A;  2PQ8 A;  1IJF A;  1Q86 D;  2ZZQ A;  1USS A;  1GV2 A;  5IYB J;  1R5B A;  4QTR A;  3FXL A;  2DQR A;  3VB2 A;  4ESB A;  3B4N A;  4I99 C;  3I55 B;  1X3Z B;  2BVM A;  3KZY A;  1QHH D;  5E1X A;  2FOK A;  2Z9O A;  3QOP A;  4NC6 A;  4HIZ A;  1W5S A;  2FBI A;  3ERM A;  3FK7 A;  3K4K A;  2QZ8 A;  2XC7 A;  4OMZ A;  5M3M J;  2IAI A;  5DM7 F;  2E2I J;  3HXL A;  4PUS A;  3OSF A;  2HDD A;  1VQO B;  4TMV A;  1Z1D A;  1KCD A;  4W8R A;  4HE5 A;  3V8L A;  1VQ5 B;  2EA2 A;  3EUA A;  2L54 A;  3V7C A;  5DM6 F;  4MNU A;  3B6A A;  3O3K A;  3ZMZ A;  1WI3 A;  1I39 A;  2AQF A;  3KP5 A;  1MSE C;  2V1X A;  3ZMU A;  3ECH A;  1X4O A;  5GAD J;  1XMA A;  2DEU A;  4OOV A;  4Y17 A;  5HZA A;  3WND A;  4DQ2 A;  1XC5 A;  1G3W A;  2NNY A;  3LSM A;  3GXO A;  1HG8 A;  4HBL A;  1ZRC A;  3P26 A;  5E1Z B;  3VWB A;  3TGN A;  3CPW B;  1TQP A;  3KP4 A;  2B9S A;  1D2E A;  5M5X J;  3P7N A;  2NS7 A;  2TRT A;  3TO9 A;  3W2W A;  2BVN A;  3W2E A;  1FPQ A;  2HR3 A;  3TL4 X;  1BR4 A;  3ZPL A;  1VHE A;  3MCA A;  4I84 A;  3H5A A;  1UJ8 A;  1XSX A;  5ILV A;  1K7A A;  4IRG A;  2BYV E;  4JRA C;  4HE6 A;  4CIC A;  3ABM H;  4UZU A;  4BGD A;  4Q48 A;  3OR1 C;  3FPP A;  2JA5 J;  2HPI A;  1AA7 A;  1JUS A;  1Y0N A;  5HNH A;  6PAX A;  1L0O C;  1MH4 A;  3J7Y J;  1UMQ A;  1FYL A;  2JJ2 A;  2R6H A;  5FL7 A;  3S15 J;  3CQZ J;  2VE8 A;  1PJR A;  1R71 A;  2W24 A;  2YWE A;  3GIR A;  3VO1 A;  5IYP A;  3BOQ A;  4IHT A;  5TY0 A;  4M6X A;  5K1Y A;  2V1U A;  2VUM J;  4X7F A;  4HF1 A;  2YWH A;  2V7T A;  1T33 A;  3LA2 A;  1BC7 C;  3QU6 A;  5E79 C;  2ZZF A;  4GGG A;  1XS9 A;  2AXT C;  4XSX F;  1JKQ C;  3WG9 A;  1V4R A;  3K2Z A;  1AKH B;  1Q1V A;  1N75 A;  3BWG A;  2WAF A;  2DYS H;  5J4V A;  4LK1 F;  1HOM A;  1RQR A;  1OGO X;  3HSR A;  2CUZ A;  2QZA A;  2M7B A;  5EZH A;  2BY0 A;  3GQ8 A;  2Y0M A;  5JFR A;  1Z7U A;  3OIP A;  3TDZ C;  1VQ8 B;  1E3Z A;  3FXM A;  3I58 A;  1N08 A;  2R5Z B;  4ZGN B;  4X7C A;  1KZL A;  2ZC2 A;  4HPQ A;  2HZT A;  5FD5 A;  2ZXH A;  1O8K A;  1QU3 A;  3QYE A;  3K10 A;  3HHH A;  5DCM A;  4WXD A;  3OW2 B;  2H27 A;  1VQ6 B;  1T39 A;  2VXZ A;  1EWY A;  1ZLJ A;  2I8D A;  4BAY A;  4EEF G;  2GRE A;  1R1V A;  2GOX B;  3HAG A;  4BY7 J;  1DDN A;  1G3T A;  3LSG A;  5HLT A;  3PO2 J;  4OOS A;  4RDL A;  2JN9 A;  4LIU A;  1SMT A;  5GPA A;  1HSJ A;  4Y3O A;  2BZT A;  5HVQ C;  2DYI A;  3L2Q A;  1BR2 A;  1YI2 B;  1CNF A;  1K9M D;  2MYS A;  2OUM A;  4FIS A;  1QUE A;  4C0S A;  2YUS A;  3I56 I;  2VBE A;  4EGY A;  3SLN A;  3PNY A;  1SAX A;  3ABK H;  1JTA A;  1X0C A;  2XPV A;  2ZL6 A;  1QGP A;  2P0W A;  1GVD A;  3OL3 A;  3HKZ N;  2KRF A;  4G5G A;  2O0V A;  4D9J A;  2CUF A;  2VKV A;  2GPJ A;  1JB9 A;  3P5J A;  4XOP A;  2JK3 A;  1G8X A;  4KIB A;  2J5O A;  3B90 A;  2DMP A;  1OCT C;  1OCO H;  1FND A;  2DIE A;  4RCZ A;  1KD1 D;  1SVL A;  2Q6I A;  3QP5 A;  3FWE A;  3CME B;  2BE5 F;  1YJN B;  2ZME A;  1JKP C;  2IA0 A;  1G3Y A;  4N0B A;  5EEH A;  3KEQ A;  4UHT A;  1BC8 C;  3DKW A;  4L5E A;  1FIA A;  2HXI A;  2BGI A;  2IGO A;  2CC2 A;  2HDN B;  1T6X A;  2CYY A;  1O3S A;  5BMZ A;  3B6C A;  3T56 B;  3I59 A;  3V7A A;  3K4N A;  1KON A;  2HVS A;  4J19 A;  1DPR A;  3I1F A;  5FB2 A;  5KSW B;  2V7U A;  1S29 A;  3PEN A;  3H9Q A;  1BI0 A;  5FGM A;  2OTL I;  2INU A;  2F5D A;  3HUG B;  5EEA A;  3HOW J;  1IUF A;  3B02 A;  3J81 K;  3ONU A;  2VXD A;  2IXS A;  4AIH A;  1LE8 B;  1JHH A;  3K70 D;  3D1N I;  2UZK A;  3CCL I;  2OU2 A;  3OFN A;  4Z03 A;  1U8B A;  2V5I A;  3S1Q J;  1IRZ A;  1RPW A;  2W25 A;  3ZQH A;  2BVL A;  2F48 A;  2Q0O A;  5HS8 A;  1I3A A;  3KEW A;  1I1G A;  4MEX F;  2PYH A;  1OHH A;  4D7N A;  2QQ9 A;  4LLN A;  3EUK L;  5D4R A;  1BW6 A;  1R23 A;  3F21 A;  4RGX A;  1W5T A;  1RQP A;  4BE0 A;  4P22 A;  4D0P A;  2LFB A;  4UV8 A;  3WTX C;  2GJP A;  3LO8 A;  5LMZ A;  2QEX B;  3HB9 A;  4XLH A;  1ZR2 A;  3IAS 2;  5GV7 A;  3GQB A;  5J40 A;  3U1D A;  4RLQ A;  3GTQ J;  3RPU A;  3SQN A;  4BE2 A;  1APL C;  1MGT A;  1WHU A;  3LFU A;  4IZZ A;  2BGC A;  2KHM A;  2FQ3 A;  3ZZU A;  2CV2 A;  4WXC A;  4BS9 A;  3K1N A;  3H09 A;  3BDD A;  3E1S A;  2LKS A;  2BMW A;  3JRC A;  4G7H F;  1ZM3 A;  2OYN A;  1X1B A;  3HRM A;  3T8R A;  3F23 A;  2VKE A;  4IX7 A;  4Y9U A;  1IHM A;  2HFH A;  1K83 J;  2DFE A;  2PMU A;  2PEC A;  1ETO A;  1WJB A;  3FMR A;  5KHD A;  2KRC A;  2YWF A;  1YJW B;  1VQ9 B;  1WXR A;  3LQE A;  1WWX A;  3I71 A;  3I9V 2;  3QP6 A;  1Q7Y D;  5JMC B;  4C2L A;  3F3X A;  1ODD A;  3I55 I;  4M4S A;  4B4D A;  3BLY A;  2M8G X;  1OFD A;  5F0C A;  2BM1 A;  5CQE A;  3JU4 A;  4EGZ A;  3JX8 A;  3N4M A;  1OCZ H;  3VNU A;  3MEX A;  2GIZ A;  2JUG A;  3L1P A;  2DO7 A;  4A5M A;  2EZL A;  2M5W A;  1VQO I;  2FBH A;  1UG0 A;  1GDT A;  1TT0 A;  2NVT J;  4L5J A;  1YJ9 I;  4DZJ A;  3HGY A;  1AHD P;  1N78 A;  2W6I A;  1VQ5 I;  3R4K A;  3COA C;  3NWS A;  2QBY B;  4E7K A;  2HVQ A;  4E7J A;  2RC4 A;  1E1Q A;  4NNJ A;  3WU1 B;  1HDP A;  5GAG J;  3JW4 A;  3J80 Z;  2NTB A;  2PLY A;  2WAD A;  4GYI A;  1VQP B;  4O6J A;  2E5Z A;  2KQR A;  3JR9 A;  2X9D A;  2P4W A;  1P6R A;  3BCB A;  2RVC A;  5BSX A;  2HKO A;  1HLV A;  4KIG A;  2Q6O A;  4OM9 A;  4XRS A;  2M2E A;  1EFT A;  4DYR A;  1BN5 A;  2HVR A;  1R4N B;  1HQC A;  4BQA A;  2QDX A;  2VBU A;  3CO7 C;  2L7F P;  1D8K A;  2KKO A;  2LYC A;  3SZE A;  2JTV A;  4A3D J;  4A5N A;  4I2O A;  2DA2 A;  4ZZL A;  4MYT A;  1G7R A;  2Q6L A;  2ZIT A;  3HOV J;  2BY2 A;  3QRF F;  4U0V A;  1Z05 A;  1SFO J;  2QTZ A;  3LNN A;  1KRH A;  4Z4W A;  3MWM A;  4BHC A;  5HS7 A;  5K5Q A;  2UWM A;  3AVY A;  1D0X A;  2XT4 A;  2WPD A;  4CGZ A;  2R3S A;  1G59 A;  3JQP A;  1SEU A;  2RC6 A;  3PA1 A;  2ZBK A;  3BZC A;  3GFM A;  3BG6 A;  2Y69 H;  4MIM A;  3GCM A;  1KYW A;  1OIS A;  5LHG A;  1IZ1 A;  5EDN A;  3FXU A;  1WFX A;  3GZN B;  4ZYA A;  2XTW A;  1F4K A;  2QY1 A;  2BF4 A;  5IYC J;  3B8Y A;  5M5Y J;  5EGO A;  3HJE A;  2CUE A;  2K3F A;  3H36 A;  2K7L A;  4DW6 A;  1QFZ A;  2KFD A;  2UXN A;  1I50 J;  1BLI A;  4IPA A;  2VPL A;  3D5S C;  4XNF A;  2R7W A;  1S4M A;  3C3W A;  3AST A;  4Q4Z F;  1HKT A;  2UXX A;  3OYH A;  3A01 A;  5B1B H;  3GWZ A;  4P25 A;  2Y31 A;  4HLY A;  4J01 A;  4LK0 F;  5C3E J;  1VQ8 I;  4HWV A;  3QQA A;  3R0A A;  4CCL A;  2FBK A;  1YE9 A;  4EH1 A;  4AU7 A;  4CA0 A;  2LR8 A;  1H8A C;  4Z4Z A;  3TKY A;  4HDU A;  1QFY A;  3GQ7 A;  2Z3Y A;  3R0J A;  4LG3 A;  2CW0 F;  1R5H A;  5FO0 A;  4D7M A;  2YR2 A;  2K5C A;  2L9S A;  2MAB A;  1DDG A;  3NAU A;  2VB6 A;  2IS1 A;  1U8R A;  1D1N A;  1LUJ B;  1KTV A;  3HOT A;  1O8G A;  3VMW A;  2VBS A;  1TYX A;  3ZQC A;  1FX7 A;  3LFK A;  3GTP J;  3LSR A;  4P26 A;  1DUX C;  4JQF A;  2L4M A;  2CU7 A;  4X7D A;  2I10 A;  2YSR A;  4RGR A;  3DCF A;  5H6Q A;  4DBQ A;  4ZYE A;  1YRN B;  4IHX A;  4LB5 A;  4X0C A;  3GRH A;  1Y56 A;  2LBF B;  3S3N A;  3CD6 B;  4U7D A;  5GP9 A;  4P3Y A;  4WWC A;  3T53 B;  4ZDP A;  4YRV A;  4RMN A;  4GDF A;  1J7K A;  1LVA A;  4ASN A;  1WJA A;  1E3O C;  4ROX A;  4DYQ A;  3BTL A;  2FA5 A;  2F43 A;  2KIU A;  1CNE A;  1R00 A;  1ZG3 A;  2DOA A;  3R6J A;  1YIJ I;  5F6F A;  4P6Y A;  4CO8 A;  1HA3 A;  2M4G A;  3HDD A;  4ITV A;  1Z91 A;  1O7L A;  3F0C A;  3J81 k;  5E17 F;  2OZ6 A;  4F3Q A;  1LB2 A;  2PMZ A;  3MAJ A;  4ZCI A;  1O8D A;  1UG2 A;  3BR0 A;  1N0U A;  1IXR C;  1OYI A;  4C9Y A;  2LRE A;  3F6V A;  3H9G A;  3WHB A;  2IRF G;  3S16 J;  2IS4 A;  2C4U A;  2XAG A;  3CCQ B;  1HBX G;  3CCM B;  1N77 A;  3TQN A;  2XC1 A;  2I1L A;  1KK3 A;  2UVF A;  3L7W A;  1H88 C;  3WTZ A;  1JHF A;  2GXG A;  4HRI A;  2O0Y A;  4Z4U A;  1R9T J;  3S1N J;  2EH3 A;  1V5G A;  4BXF A;  1MMD A;  2ZXW H;  3C2G A;  3V8K A;  3WTY C;  3JRE A;  4XKW A;  2R7S A;  2KIF A;  5L3D A;  3OY9 A;  1BI1 A;  5IT9 K;  3LSP A;  2LKP A;  2TDX A;  2VQH A;  2XRN A;  2LOO A;  5C44 J;  3CMA B;  1EFC A;  5DYM A;  1W4M A;  2PN6 A;  2WAQ A;  3BPX A;  3RYR A;  4FAS D;  5E6T A;  1LJ9 A;  5LHH A;  3SEJ A;  4HEA 2;  1KYZ A;  2CQX A;  2E19 A;  5K5O A;  2WC2 A;  2LG4 A;  1AKH A;  2XND A;  2OJE D;  1H85 A;  5A2Q Z;  2V6E A;  3AVT A;  1T6S A;  1Z3Y A;  2EIX A;  2O04 A;  2PYG A;  1W9X A;  1IN8 A;  3SEQ A;  2X8K A;  1F36 A;  2DBB A;  2H8W A;  1EF4 A;  4KUM A;  1W7P A;  3D26 A;  3K2A A;  3TOA A;  4YG2 F;  4GCV A;  3L2U A;  1OB0 A;  2W85 A;  3ONY A;  3DU1 X;  4RDU A;  4AYB A;  3W5U A;  4X7E A;  4XOT A;  2QEX I;  2ADU A;  2V1N A;  1YS7 A;  1Q9S A;  5KNL A;  4KT5 C;  1GV5 A;  1ZUN B;  1UHW A;  2LLK A;  4IRI A;  3LMW A;  2OAZ A;  4Z4S A;  3KYC B;  1PDN C;  3P9I A;  1TYU A;  3LWF A;  4IVN A;  4B3X A;  3H94 A;  4EJT A;  3CW2 A;  2K3P A;  3QPS A;  2VJ4 A;  4C30 A;  3SFZ A;  5H2F C;  2IGM A;  3K7A J;  5J4Y A;  3C2B A;  3CP2 A;  3DEE A;  2VOO A;  3S1M J;  3C1D A;  2ZBU A;  2FMY A;  3WBJ A;  3FKI J;  2VOD A;  3REO A;  3CP8 A;  5LGT A;  3AG1 H;  2KL4 A;  3SDG A;  3CDH A;  3LAP A;  4RB3 C;  4E7Z A;  4UZE A;  3BZK A;  1YJW I;  1VQ9 I;  3TO7 A;  1RMG A;  1MW7 A;  3EYI A;  4B43 A;  4I7H A;  3FKJ A;  3DU5 A; 
#chains in the Genus database with same CATH homology
 4Y4R A;  2CUJ A;  2L5Q A;  4XMY A;  4RLF A;  4LIV A;  3OYF A;  1HVX A;  3IUO A;  3S93 A;  1T5E A;  2ZFU A;  4AVZ A;  2XGJ A;  1E1R A;  3QYF A;  3BH4 A;  1BHE A;  4RM2 A;  3S32 A;  1W36 C;  3HKZ A;  4XOR A;  4PSX A;  2UV1 A;  3BCF A;  2E60 A;  4YEL A;  1T95 A;  2VQG A;  3W2A A;  4BEH A;  4NK8 A;  3ZQQ A;  1SKY B;  2X6X A;  1BPL A;  3K4C A;  4GRI A;  3PJR A;  5DN6 A;  4CCJ A;  2ZZQ A;  3OS1 A;  4E7L A;  3H9J A;  2WZP P;  2IGK A;  3HG9 A;  2Z1D A;  2R7X A;  3WQZ A;  3L2W A;  3B4N A;  4CH7 A;  3M1C A;  2BVM A;  4HIZ A;  1QHH D;  1SFK A;  3DTI A;  3K4K A;  3G2B A;  4F92 B;  2XC7 A;  4E0F A;  2F1M A;  4DIQ A;  3VR6 A;  3HPH A;  2KP6 A;  2W4S A;  2ZXI A;  3HXL A;  4PUS A;  1UD3 A;  4DK1 A;  3W2V A;  4OJP A;  3OOC A;  2WAE A;  3NE5 B;  2Z16 A;  2CW7 A;  3DQV C;  3ZPN A;  4W8R A;  1OLT A;  1KCD A;  2KZV A;  3KRG A;  4NK6 A;  3EUA A;  2O1D A;  1COW A;  2NT9 A;  1X19 A;  1X1D A;  2AQF A;  3GQA A;  1BR1 A;  2JDI A;  1FMV A;  4F52 A;  1X4O A;  1VBL A;  3OR2 C;  1KTW A;  2GJR A;  2W00 A;  3SZG A;  1LDK B;  2AQE A;  2VKH A;  2WA0 A;  4PK4 A;  5FRM A;  2XZO A;  1GLN A;  3OW7 A;  3JUR A;  3LSM A;  3MD2 A;  3ZXS A;  2HPM A;  2JJ1 A;  1HG8 A;  2WY7 Q;  2W1O A;  2VL8 A;  3VYU B;  3OS2 A;  2BOL A;  3W2W A;  4BJ6 C;  2X1D A;  1QJV A;  3TL4 X;  2E1M B;  1BR4 A;  4DJA A;  1X1A A;  2R7U A;  3LSK A;  1E3X A;  2UUZ A;  5JHF A;  1H8E A;  1OFL A;  3H5A A;  3NWT A;  1O8M A;  2DCE A;  2W7N A;  1V0F A;  4UZU A;  3OYC A;  4BGD A;  1UD8 A;  3OR1 C;  3FPP A;  2HPI A;  1AA7 A;  1VF7 A;  1EE6 A;  4ZTF A;  5HNH A;  1IDK A;  3RSN A;  2CH0 A;  4C2U A;  3LMM A;  3PNV A;  4QPO A;  5FRN A;  2VAS A;  2CFO A;  2E1B A;  2V7Q A;  2JJ2 A;  2R7R A;  3A35 A;  3VYR B;  4NUB A;  5FL7 A;  4DK0 A;  4BQN A;  4OJL A;  1PJR A;  2PJR B;  3ZGK A;  2CK3 A;  2OV7 A;  2CV0 A;  4DGW B;  1VJS A;  1RU4 A;  2WY8 Q;  2XF6 A;  1MND A;  4EAT A;  3SYT A;  3HOS A;  3A3G A;  3A4C A;  2A5W A;  3CZ6 A;  3RPU D;  1WJC A;  2ZZF A;  1Z21 A;  3HC7 A;  3H0D A;  1AIR A;  3OWT A;  4XLC A;  4CUG A;  3H35 A;  1N75 A;  2WAF A;  4F93 B;  2R7V A;  2XZL A;  5LFA A;  3BG7 A;  1OGO X;  2CUZ A;  2NSP A;  2M7B A;  4U49 A;  1TZL A;  3GQ8 A;  1NHC A;  4DBR A;  3OIP A;  3FHN A;  4BDY A;  1E3Z A;  3GVJ A;  3AL0 C;  1KZL A;  2QE7 A;  2CMP A;  2M4K A;  4HPQ A;  4XLE A;  3DTE A;  1IA5 A;  3VSL A;  1PYV A;  2ELJ A;  2ZXH A;  4NC8 A;  4R79 A;  2RRE A;  2VLA A;  2X1C A;  3VWB A;  1ERD A;  1QU3 A;  1O8K A;  3QYE A;  4MXN A;  1V0E A;  2M3A A;  3K10 A;  3GVK A;  2OC6 A;  3CJQ B;  4XKV A;  1HA8 A;  1J09 A;  2VXZ A;  5CQG A;  1E43 A;  2I8D A;  2GOX B;  1D0Z A;  3HAG A;  2X1E A;  3LSG A;  5HLT A;  1IDJ A;  3GBG A;  3SEZ A;  4LIU A;  4ZDL A;  3DKX A;  1V5E A;  3OYJ A;  2RNG A;  4BQO A;  4Y3O A;  2HNH A;  5HVQ C;  3L2Q A;  1BR2 A;  2MYS A;  2OUM A;  1EFR A;  2NST A;  2DT7 B;  2LH9 A;  4XN3 A;  3UR3 C;  2VBE A;  4XD7 A;  3PNY A;  2BW3 B;  1JTA A;  3VSK A;  1X0C A;  2HDW A;  3ZR8 X;  3DWL E;  2P0W A;  3OL3 A;  2IGN A;  2Z8G A;  1KCC A;  2M7A A;  3ZSC A;  2O0V A;  4D9J A;  2INV A;  3BCD A;  3D5L A;  3D5R C;  2HZD A;  4ZDO A;  4XOP A;  2GK7 A;  1G8X A;  2XZP A;  3ONQ A;  3B90 A;  4OJ5 A;  2FUG 2;  2VQC A;  3QYB A;  1OOC A;  2DT6 A;  3EPZ A;  2QKM B;  2F5V A;  4BEH B;  3T9G A;  2DIE A;  4DOZ A;  3MKY B;  1H80 A;  4F55 A;  2ZZG A;  2R7T A;  3IP4 B;  3F9K A;  4YZQ A;  1JI8 A;  2JVG A;  3VSV A;  2Q1Z B;  4JOM A;  2KLO A;  4X0G A;  3DPU A;  2IGO A;  3CJR B;  4II2 A;  1SAU A;  2RQQ A;  2GJK A;  3T56 B;  1NG6 A;  2V31 A;  3VSU A;  3PL8 A;  2M0M A;  1MMG A;  3K4N A;  1KON A;  2HVS A;  4MR0 A;  2MD0 A;  1BOB A;  3A2K A;  4KIS A;  3H9Q A;  4PJJ A;  2Z2S B;  3OL4 A;  1UD2 A;  1IB4 A;  1NBM A;  2INU A;  3HUG B;  4L8J A;  2Z6B D;  4XL9 A;  3SUC A;  3PNT A;  4II3 A;  1D1A A;  4XR6 A;  4B47 A;  2VXD A;  3OYI A;  3L2V A;  4OJ6 A;  2IXS A;  1VZ0 A;  4CCK A;  4HNU A;  2X3H A;  4G7X A;  3K70 D;  3RQ4 A;  3OYN A;  3H5R A;  4XON A;  4E4H A;  2MFZ A;  3L2R A;  1BMF A;  2R7Q A;  3OFN A;  2ZSI B;  4Z03 A;  4BQQ A;  2IQ7 A;  2JSP A;  3FY3 A;  3K4M A;  2BVL A;  3V42 A;  2X85 A;  4XLA A;  3VYS B;  3T51 B;  3KEW A;  2PYH A;  1OR7 C;  1BN8 A;  1OHH A;  1Y6I A;  2DJI A;  4EW9 A;  3PSI A;  4CSW A;  2LBF A;  3EUK L;  5CKT A;  4ZTJ A;  1S9H A;  4BE0 A;  4P22 A;  2CS3 A;  4PFP A;  2GJP A;  3EQO A;  4BU2 A;  2WJV A;  4G7W A;  2Q2E B;  1K5C A;  2R7O A;  4XLH A;  1PLU A;  3IAS 2;  1K28 D;  1W0K A;  4C2T A;  2QKL B;  4KJZ A;  1IRX A;  3GQB A;  4GQN A;  1WJE A;  1O8L A;  3OYA A;  4PJL A;  4RLQ A;  3MMY B;  3FKS A;  4BE2 A;  4F91 B;  2W6J A;  3OYG A;  3LFU A;  2LY2 A;  4IZZ A;  2KHM A;  2F4I A;  2CV2 A;  2VQL A;  4BS9 A;  2O0W A;  4J00 A;  3TMO A;  3E1S A;  3U21 A;  4NC7 A;  4CCN A;  2UVE A;  1X1B A;  4XKB A;  4IX7 A;  4XKC A;  4QPQ A;  3AFH A;  2PEC A;  1DBO A;  1WJB A;  5KHD A;  4W8S A;  2NT6 A;  2KRC A;  1Z7L A;  3ZCO A;  4FXU A;  1O8F A;  3I9V 2;  1GQ8 A;  4N4N B;  4C2L A;  2O5R A;  2E1M C;  1YX5 A;  3BLY A;  3OYB A;  5TGT A;  2WB1 A;  5CQE A;  1WP6 A;  3OYL A;  3JU4 A;  3E0J B;  4B48 A;  3W3C A;  2WJY A;  2KDO A;  2JUG A;  3VYT B;  2D3L A;  4HST A;  1UG0 A;  1TT0 A;  2PJR A;  1UAA A;  1N78 A;  3PSF A;  3MKW B;  3IAM 2;  2W6I A;  2CV1 A;  1VLY A;  3NWS A;  4E7K A;  2HVQ A;  3S3O A;  4E7J A;  1MAB A;  1E1Q A;  4Z05 A;  4NNJ A;  2W82 A;  4IQJ A;  5HNF A;  4W8T A;  5C1E A;  2NTB A;  4OJO A;  1E79 A;  3BC8 A;  2WAD A;  2VJI A;  2D3N A;  2E5Z A;  2KQR A;  2M5S A;  5C1C A;  2VKD A;  3OYE A;  4YEJ A;  3BCB A;  2R4G A;  4OZY A;  1WJD A;  1LKX A;  1X1C A;  3K6G A;  3DU6 A;  4DNT B;  1T0F C;  2HQA A;  4KKT A;  2VJJ A;  3KYL A;  1NG7 A;  2HVR A;  5HKK A;  4LIT A;  1O8H A;  2HU9 A;  3KX2 A;  3OYM A;  5IK2 A;  2LYC A;  3DDY A;  3DPL C;  5KCM A;  4JMQ A;  3OPO A;  3I3L A;  3PUB A;  1I8D A;  2O17 A;  3LSH A;  3LNN A;  3LSI A;  2WSS A;  2GOM A;  2UWM A;  3OE7 A;  2BSP A;  1D0X A;  1O88 A;  3K4B A;  2WPD A;  1K6Y A;  1Z3X A;  4BDZ A;  1FX0 A;  1G59 A;  2IS6 A;  3HL2 A;  3OMY A;  4BJ5 C;  3BG6 A;  4W8Q A;  2X6Y A;  1WFX A;  2JIZ A;  4ZYA A;  5LD2 C;  2QY1 A;  2V7F A;  3B8Y A;  2NOJ B;  2ODL A;  3OIQ A;  2LY1 A;  4OZZ A;  2MC4 A;  4BAC A;  1H8H A;  4IKF A;  1ZEL A;  1BLI A;  4I84 A;  4E7S A;  3OS0 A;  3D5S C;  4XNF A;  2R7W A;  1WJF A;  1D0Y A;  2VPL A;  3BC9 A;  1O8E A;  4YZX A;  3OOU A;  4G6T B;  3RTR A;  4ANJ A;  4ASU A;  3OYH A;  2K9M A;  4IQ4 A;  3OYD A;  3A1Y A;  3BCA A;  1OFM A;  1UD5 A;  4J01 A;  4HWV A;  5HOO A;  4CCL A;  1WMR A;  3VST A;  1YE9 A;  3M8J A;  3CF2 A;  1RWR A;  4AU7 A;  4CA0 A;  1MMA A;  3GQ7 A;  2V26 A;  1XG2 A;  3K70 C;  4LG3 A;  1X4P A;  1W36 D;  3PFY A;  1DBG A;  3K4J A;  1DGW Y;  2K5C A;  2L9S A;  2MAB A;  2XAU A;  3S3M A;  1UD4 A;  2VB6 A;  2IS1 A;  2IS2 A;  1LVK A;  3KEY A;  1MNE A;  3HPG A;  1KMH A;  3ZIA A;  3HOT A;  1O8G A;  3VMW A;  1LFP A;  2L7K A;  4U87 A;  4Y33 A;  4OWR B;  3S8P A;  4ZC3 A;  2XF7 A;  3FBN B;  4JQF A;  4KKU A;  1D1C A;  2LZJ A;  4PJM A;  4TT3 A;  4YZA A;  3GRH A;  4DBQ A;  3J7A Y;  2JVH A;  1Y56 A;  2LBF B;  4ZJZ A;  3S3N A;  1HZE A;  1W0J A;  3DLA A;  3G05 A;  2QX3 A;  1FMW A;  3T53 B;  3ZPP A;  4ZDP A;  4YRV A;  4RMN A;  1OGM X;  1UD6 A;  1WJA A;  2F43 A;  2DOA A;  1QCX A;  4B3F X;  2V9K A;  1JRG A;  4YXW A;  5AMV A;  1O8I A;  4TKO B;  2NTP A;  2KRH A;  4BE1 A;  2M4G A;  4XM3 A;  3RCO A;  1DP3 A;  2EWE A;  4ITV A;  2L9N A;  4P5O A;  2KPM A;  4DNR B;  4P1W A;  1DQU A;  4G6I A;  4BJT A;  3QOD A;  3A3B A;  2XF5 A;  2E5N A;  4F3Q A;  3OYK A;  3FDY A;  2PMZ A;  1U0J A;  1R6R A;  1O8D A;  3AKZ A;  2K9L A;  2XOK A;  3N05 A;  2A6T A;  4C9Y A;  2LRE A;  3H9G A;  4HNT A;  2IS4 A;  4D1Q A;  3VMV A;  3C2H A;  1CZF A;  3GQ9 A;  4BUP A;  4MLO A;  1N77 A;  3AL0 B;  3TBI A;  2UVF A;  3LL7 A;  4HRI A;  2ZZE A;  2KMU A;  3OAA A;  2XDV A;  1V5G A;  4BXF A;  1MMD A;  4KIT B;  3C2G A;  4TSF A;  1DGR M;  3ZRG A;  4URR A;  2VBK A;  4Z1M A;  4XKW A;  2R7S A;  1EA3 A;  2LRD A;  1QHG A;  3K4L A;  3VDX A;  4HG2 A;  3OEH A;  2HLD A;  1V5F A;  3OY9 A;  1WJ5 A;  2ZTN A;  5FRO A;  2VQH A;  2L2O A;  2LOO A;  4CCO A;  3UW0 A;  3GVL A;  4CCM A;  3QOE A;  2VBM A;  4OAY A;  3EQN A;  2WAQ A;  2GK6 A;  4FAS D;  2LC2 A;  2X51 A;  2X53 S;  3CMM A;  4HEA 2;  3EUH C;  1UEL B;  4KT6 A;  4HSR A;  4PJN A;  4FET A;  3OEE A;  2LG4 A;  2XND A;  1PXZ A;  2CW8 A;  2V6E A;  1YX3 A;  1Z3Y A;  2O04 A;  2PYG A;  3WWG A;  1W9X A;  3SEQ A;  2X8K A;  3DPT A;  4BL0 B;  1P9Q C;  2F6C A;  2ZSH B;  4RM3 A;  1O8J A;  1MMN A;  2JA2 A;  2Y0S A;  4H4K C;  4U7B A;  2DXI A;  4KKS A;  3L2U A;  1OB0 A;  4PMH A;  1NRK A;  3H5N A;  3FBI B;  4AYB A;  2WBM A;  4XOT A;  4N4O B;  2V1N A;  4B3G A;  4YZ0 A;  4Z06 A;  5KNL A;  3DTK A;  1WTH D;  3LMW A;  1PKV A;  3UNG C;  4PSW A;  4CZC A;  4NQW B;  2V4D A;  4B3X A;  3H94 A;  2NTQ A;  4U4B A;  2ZTG A;  2K3P A;  4XQF A;  2VJ4 A;  4C30 A;  4PFO A;  2IGM A;  2VJ5 A;  1WPC A;  2XSJ C;  1D1B A;  3CP2 A;  3DEE A;  3DKY A;  5CDF A;  4E6K G;  1PE9 A;  2V4J C;  4XLF A;  4E7I A;  2R9V A;  1I18 A;  3CES A;  4OAZ A;  5CPR B;  3CP8 A;  4B44 A;  2KL4 A;  2BW3 A;  3SDB A;  2QXZ A;  2X6W A;  4E7Z A;  4E7H A;  2NZM A;  4XN0 A;  1RMG A;  3MKZ A;  2VIX A;  1E0E A;  1MW7 A;  4B43 A;  2KVO A;  3FKJ A;  3DU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...