4AVZA

Tailspike protein mutant e372q of e. coli bacteriophage hk620
Total Genus 226
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
226
sequence length
598
structure length
598
Chain Sequence
DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords TAIL SPIKE PROTEIN
total genus 226
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4avzA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4avzA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4avzA02
5C1CA 3EQNA 1X0CA 4XKWA 2NZMA 2QY1A 3GQ8A 2NTBA 1DBOA 2X6XA 4XM3A 1VBLA 4W8SA 4U49A 1O8DA 1CZFA 3VSTA 3JURA 2VBEA 4XL9A 1IDJA 3B8YA 5C1EA 4EW9A 1O8KA 1O8HA 4OJOA 2IQ7A 2O17A 4W8RA 1O8LA 2Z8GA 2X6YA 4XN3A 2QXZA 4XLAA 3VMWA 4OJ5A 1BN8A 2NT6A 4XLEA 4XONA 1AIRA 2VBMA 3B90A 2UVFA 3UW0A 1WMRA 2VJJA 2PYGA 1PXZA 4XMYA 2X3HA 1O8IA 2PYHA 4XORA 1O8MA 2NT9A 1NHCA 1HG8A 2X85A 3VSVA 1OFLA 4AVZA 1OOCA 2PECA 3WWGA 4OJPA 4URRA 4YZQA 1OFMA 4PMHA 3GRHA 4YZAA 4OJLA 2EWEA 4XKVA 3T9GA 4Z06A 4XN0A 3FY3A 1RWRA 1BHEA 2O0WA 4XLCA 2INUA 2VJIA 2INVA 1QJVA 1EE6A 3SUCA 1KCDA 4YZXA 1IA5A 4XOPA 2NSPA 1RMGA 1IDKA 1GQ8A 4MXNA 1OGMX 3VSUA 1O88A 4W8QA 1O8JA 2O04A 3GQ7A 2O0VA 4Z03A 3VMVA 3ZSCA 3ZPPA 4YZ0A 3B4NA 4OJ6A 1H80A 2NSTA 4MR0A 2X6WA 1O8FA 4XLHA 4Z05A 1O8GA 4U4BA 4W8TA 1O8EA 4YEJA 4XR6A 1DBGA 5AMVA 2VBKA 4NK8A 2NTQA 1KCCA 2NTPA 4XQFA 2UVEA 1KTWA 1JRGA 4OZYA 4OZZA 4C2LA 1QCXA 1XG2A 2O1DA 1IB4A 4HWVA 4XLFA 3EQOA 2QX3A 4NK6A 1PE9A 2ODLA 1PLUA 1K5CA 1RU4A 3LMWA 4XOTA 3KRGA 3GQAA 4I84A 1JTAA 3GQ9A 4YELA 1OGOX 2BSPA 4XNFA
chains in the Genus database with same CATH superfamily
1UFMA 3BP8A 4D5CA 4ABZA 1YITI 5FO0A 4XKWA 1ZAOA 4HDUA 1S0UA 1OCCH 3AK5A 2AHQA 4R1HA 3Q39A 2PI0A 4CQJA 1EFTA 1K28D 4KUMA 1Z0XA 3VSTA 4M53A 3B78A 3ABKH 4BE1A 2PJRB 3A4CA 4M72A 4PC7A 4X7FA 3B8YA 2VPLA 4UVBA 1ZKGA 1ZHFA 3CMMA 4NC8A 4LBZA 2HZTA 2EV5A 2ACJA 2LKPA 2PBIA 3M8EA 3TP3A 3SEZA 1BR2A 4YIRX 1D8KA 4CZCA 5K1YA 4X0GA 3UW0A 1IF1A 3O8GA 5K5OA 3V8KA 2RQPA 4BBRJ 5DM6F 4UZFA 4X0CA 1NBMA 3AGPA 4Q48A 4G5GA 2EFGA 1O8IA 1IRFA 4GDFA 2R7TA 1WH7A 5THXA 2K85A 2LSOA 3FM5A 5KHDA 3OYIA 1TC3C 4XD7A 2P5LC 3PJRA 5BQTA 1ZTRA 3K4KA 4II3A 5DM7F 4XRSG 5HOOA 1OCTC 1VQLB 1OCZH 2V26A 3GBGA 2ZJ2A 4RDUA 1HOMA 3A1YA 3GW2A 4M3FA 1IRGA 1B4AA 5JMCB 3PFYA 4GFBA 1ZGWA 3ZCOA 3A3BA 4BJ5C 4M1KA 4AU7A 4AIKA 2CW0F 2ZCWA 9ANTA 2VE9A 1GHCA 5JVGF 4A69C 1K4SA 3KIOA 1O4XA 3RDIA 4ZYGA 4DOZA 3J7ZI 2NSPA 5BNGA 1USSA 2CV1A 3FBIB 4W97A 1KK2A 4RB3C 3SDBA 4H9GA 2VKVA 3H5AA 2FOKA 4ASUA 3G2BA 4ZZLA 2LK2A 1XMXA 4RM3A 4G8XA 2A6EF 1NK3P 3WTXC 4IL6C 2VKHA 2XUBA 1B9NA 3ZPPA 2ZB9A 3SYJA 3NRVA 3JQQA 2HOAA 4B43A 1QNTA 3QOEA 5JVTA 1FY7A 2NVTJ 3DTEA 4LLLA 4PC3A 1WSRA 3WGHA 2JDIA 5M5YJ 1XG1A 2M8EA 5EF6A 3GFJA 3IKVA 1YI2I 4IRHA 4L18B 3CXCB 1YW7A 1D1CA 1JE8A 1JTXA 2AO9A 2F5EA 2KQRA 2Y30A 4OWRB 3H9NA 4DQKA 3K7AJ 3A03A 1AKHB 4OZYA 1WORA 5IYCJ 4ON0A 4S04A 3Q3AA 4NDLA 2V7UA 4OOIA 2IXSA 4UUSA 2BE5F 3J81k 2VFQA 4KITB 3V8LA 1VFCA 3BC9A 4QUZA 3CJRB 4RD6A 1FJLA 2W6IA 3E20A 2CQQA 2EZHA 3B73A 1BI1A 3A3GA 4OMZA 4DNTB 3TP0A 4L9JA 3RKXA 3K70C 4TMZA 3FMSA 3PENA 3DKWA 3VODA 5ICCA 5LLQA 4S05A 1T6ZA 4Q7JB 3K2AA 1IW7F 3QE2A 2K3FA 4IHYA 3F8MA 1B72B 2X4HA 5IOZA 2DQRA 2R7FA 2PEXA 2WAQA 5B1AH 3FISA 5EYRA 2D3NA 2BSPA 4A3DJ 4A3LJ 2FVGA 1JHFA 2EA2A 3H9QA 2XAUA 1FZPB 2BY0A 1XSDA 5FO1A 3AVTA 4ZDLA 4RCYA 4YALA 2DDAA 4JOMA 3OYNA 3JRDA 4Q5SF 4HX4A 2VQHA 1T2KA 2VNHA 1YFHA 3VSKA 1B2RA 4UNOA 2CNDA 5J1YA 5DDGA 2AQFA 3I59B 2VLAA 1R49A 2G0YA 3LJYA 2KL4A 1TL8A 3VR6A 4OJOA 2WAEA 5E1ZB 1OHHA 1W1WE 1ZARA 4FQGA 1E62A 4L9NA 1XDUA 3DQVC 3BH4A 4LG0B 1M1KD 1MKMA 3JQRA 2C6YA 2QXZA 4OU0A 4OJ5A 4LBVA 1KMHA 1BA5A 1XSXA 3PETA 2M2EA 3LOCA 4A3GJ 1ETXA 5IT3A 1B59A 1U9OA 4Y7NJ 5J8CA 3HGYA 1YS6A 2DYSH 1LDDA 3LNNA 3AAFA 1OCRH 1Z21A 3HZJA 5FLXZ 3WWGA 1GXPA 1RQRA 2KDOA 2JJ7A 1KQ5A 3K10A 3S2WA 1G3TA 2EBIA 1P7IA 3ZMZA 3P27A 3U6BA 2M30A 4RM0A 1QPMA 1O3RA 4LIUA 3ZXSA 4YFKF 2VOOA 3ZQGA 1ZLJA 3CD6B 3N05A 3KEQA 1J59A 3C2HA 1ZRFA 4XN0A 4LBYA 1TYVA 3ZQIA 3BDDA 4DQ2A 2PJPA 3PQJA 3GTMJ 2V4DA 1SKQA 3C3WA 4A3MJ 3DKXA 2E1NA 2KIQA 4YHBA 3MQ0A 2AQEA 3FMRA 2MABA 2DEUA 2HYFA 2CG4A 1OGMX 1FNNA 1KQ0A 3NQOA 4N9IA 1YTYA 3S1NJ 3JW4A 1IJFA 3ULQB 1BJZA 4ZCLA 2OTLB 4G1BA 3ZQFA 5D8KB 1EFRA 3SFIA 4ZYHA 5HLIA 3H9GA 3JREA 5EDNA 2MC4A 2M9HA 5E3NA 5A89A 2E1MC 4BXUA 4WZEA 2Y0SA 1C0WA 1OR7A 3N4MA 3OYHA 1I1SA 1KK1A 3ASRA 4C3HJ 5E3MA 5AMVA 4X7CA 3HSEA 2VODA 3S1RJ 4KFCA 4OAYA 3W2WA 1W4MA 4Y17A 4ZTFA 1H0MA 3E6MA 3QPLA 4PDKA 3PO2J 2EV6A 4HDVA 1K4ZA 4G6TB 1F20A 2WTEA 2YSRA 3A0HC 4HWVA 5B66C 3R6JA 2OZUA 4A0YA 4CDGA 3BR2A 1EZGA 2LZJA 4YC5A 4W1UA 4K1XA 1BX0A 4UB6C 3FBNB 3EETA 3GYHX 1GT0C 2NPFA 3ML3A 4B3FX 2K40A 2PMZN 2M8GX 1N25A 3ZMVA 4A0ZA 1Q82D 4PK4A 2HTJA 3GTKJ 1IXCA 1K61A 1R7JA 4PFOA 1BBYA 3K1NA 2FX3A 1UHSA 2VBSA 1Z77A 1FNCA 1U6GA 4Y9RA 2L9VA 3GSIA 3GTQJ 4GQNA 1WQ2A 3EYIA 4I2OA 4M9XA 1TP4A 3J80K 3T51B 1I18A 1N8RD 5GTHC 2QCOA 4MHGA 2NZMA 4X07A 4AC9A 2YWHA 4V2FA 3S2HJ 2CS3A 4ZTJA 1TWFJ 3K4BA 3OIQA 1XE1A 1W5SA 1TYUA 1VQPB 2P6SA 1ZK8A 1MZBA 3MD2A 2FMYA 3E5QA 1I50J 1ZREA 1V5VA 5F4MA 1T39A 1QZEA 1KU7A 5J3OA 2FD5A 1POGA 3BY6A 2V1NA 4W8RA 5DUKA 4OMYA 2LKSA 4PCQA 1R5OA 3GQBA 4L9TA 5IY5H 2VJ4A 3LSTA 1SAXA 3MKLA 3ZMUA 3I53A 1WH5A 3CUQA 2L7ZA 3ESWB 5E3OA 3CMAB 2NT6A 2W1OA 2HWVA 4BNCA 2PYGA 2XKPA 1FOKA 4Z4RA 1S9HA 4XMYA 1E3XA 2HQNA 1OB5A 2BN4A 3ZP5A 2FBIA 3BQZA 3OYDA 1K4TA 2ETHA 2JSPA 3AG3H 3S1MJ 1OFLA 4YFOA 4BPRA 4XK4A 1G59A 1NB9A 2BBYA 2V6CA 3CQZJ 4BQAA 3F8BA 1OFEA 4XRSA 4XRMA 1SFEA 4H0EA 4U0WA 2OZ6A 3FDYA 5HS7A 4WWCA 3LQQA 1LE8A 4PMHA 2VC0A 1LNWA 2V7FA 2WADA 1WP6A 1COWA 2VFMA 3FWEA 3PUNA 3BJ6A 4P6VF 4QPOA 3I3LA 2V7QA 2WBMA 1IA5A 1K9MD 1AWCA 1GUUA 2GWRA 1UB9A 5JI6A 3WGIA 1GVJA 3E1SA 4I98B 4RMNA 2EZIA 1MRZA 1XQBA 2O03A 1BIAA 1OQYA 3ZGKA 2NS8A 3PNTA 4P12A 4HQEA 4QFMA 5F4OA 2E7XA 2A07F 3VMVA 3CLOA 1FPQA 1PVEA 3VFZA 1YG2A 4UVCA 3KP6A 3RKQA 5D5XB 1U5TB 4ZH4F 4RB1A 1VQLI 2DA6A 2Z33A 1X58A 3FPPA 5D8LB 2ZZFA 3QFSA 2EILH 1O8FA 1QRCA 1H8AC 1SKYB 3NWTA 2WY8Q 2QVOA 5F6FA 1UHMA 4XR6A 3H9JA 5LEKA 2GM4A 5F0HA 1XGOA 3LSMA 2W82A 2QDXA 2BV3A 2M1BA 2JPCA 1G8XA 1BI2A 4X1EA 1JJ8C 2Q6KA 4ENJA 4BHCA 3P4GA 1A31A 1TUIA 2Q6OA 2LOOA 4RGRA 2RQQA 3VMFA 3EQOA 4CCOA 1XN7A 2GXAA 2WZPP 1Y8RB 3JAMK 2B7CA 2EPFA 2L4AA 4M4SA 2ODLA 4M6VA 5HLGA 1YX5A 3H1CA 4XLNF 3UNGC 2F4MB 4HNUA 1HC8A 2K27A 2H27A 3HRSA 1W9XA 3Q38A 2M5WA 1Z7LA 3B6AA 2KDZA 3LQRA 5E20A 1MSFC 4X7EA 5FKMA 1MD0A 4Y4RA 2H8WA 3IWZA 1D2EA 1R6RA 4DW6A 1RZ4A 5CVUA 2KRHA 1P2FA 4XICA 1XSVA 4IEJA 3SJZA 1IDYA 1TQIA 2HYJA 3K2ZA 4IPAA 3WTZA 3I59A 3CCQI 2VONA 3TO7A 5CJ9A 5HNHA 4MO7A 5DCFA 2VQLA 1WTHD 2PG4A 1ZGJA 2VQGA 1LUJB 4O5VA 4KMFA 4HEA2 1S3JA 2ZL5A 3A01B 4BE0A 1U78A 3ASQA 1FBSA 2DYIA 3DLAA 4KIFA 2XPUA 4HNTA 4C2TA 3DV8A 2G0EA 3B90A 4XONA 1BM9A 2XTYA 2IA0A 4I02A 1Q81D 2TCTA 3FKJA 4PJMA 2OTJI 2WY7Q 1KZHA 2F1MA 3OIPA 3R0AA 2PYHA 5BS6A 2O5RA 5H20A 1SVOA 1HG8A 3R60A 3HM5A 3MEXA 3W6JB 4DK1A 2DO7A 2CQXA 4GRIA 1G2HA 3RKYA 1YJ9B 1ZQ3P 1S5LC 1WSUA 1R58A 1FNDA 4CCMA 1ETKA 3Q6QA 3AVWA 3HL2A 4C2MJ 2HOEA 1MMNA 3JTGA 1BC8C 1DGWY 2B7EA 3HRMA 3WHCA 4MNUA 2EWEA 3AG4H 4RAZA 1IGNA 3HOZJ 2OBTA 3JU4A 2FBHA 1BHEA 4AUXA 1VQ5I 1KGSA 2FA5A 2N8GA 2O7OA 5CVVA 5F1RA 3EUKL 4GYGA 5GPCA 1PJ5A 1ULYA 2D3LA 3G6EB 3AL0C 2IGMA 4HQMA 4M73A 2O61A 3OFNA 1X1BA 4B4CA 4BHPA 1E43A 1GQ8A 1V0FA 2C78A 5KW9A 3AVYA 4TMXA 1B6AA 4IHVA 2LNBA 4G9YA 5H5JA 3BTLA 1WHUA 1F60A 4UZUA 1BOBA 3BZKA 3BCFA 5F0CA 2BGCA 2R7QA 4YAWA 1TLHB 3QPHA 2GAUA 3FKSA 5LGUA 2R5YB 5LBQA 1WZ2A 2XC1A 1YX3A 3I56I 4BXFA 3J7AO 1D8JA 2OBPA 2DBBA 4ZGNB 1UHWA 3EYYA 4CHUA 2IBDA 2VT3A 2QE7A 2IA1A 4DIQA 2AHOA 2NTQA 2XGDA 2Z3YA 4U0YA 1S6LA 4LLNA 1KCCA 2M34A 2UVEA 1IAWA 3TW7A 3ZZ0A 4OZZA 3MFKA 3H0GJ 2IRFG 1DQUA 2X1CA 1BW6A 2CC2A 5LRRA 3EDPA 1IB4A 4FX0A 3VO1A 5IYWA 1IV8A 1SMTA 2O6WA 2ID6A 3F3XA 2QKMB 4YFNF 4LFUA 4A3JJ 3HKZA 3CMEB 1QA1A 1UZCA 1MW7A 4FISA 3OJXA 3WBKA 4JYKA 2HFHA 2DERA 4R79A 3BNWA 1R5NA 1K5CA 3HBLA 3DEWA 3WE3A 1T5EA 2OBSA 1ZELA 4DK0A 1R1TA 1R5HA 3CC4I 1B1BA 1MBEA 1UD5A 3PUMA 5JLXA 3TQNA 3CCRI 1YIJB 3BC8A 1RRJA 4OOSA 3VSLA 3PSIA 1ZG3A 4Z4ZA 3QU3A 4E4HA 2GOXB 2CV0A 3CO6C 3LVBA 1B23P 1KU3A 3I9V2 1NHAA 4IQJA 2OF7A 3IH4A 3ZZTA 2E34A 2CW8A 1WI3A 2GBYA 1V54H 3SDGA 3DF8A 2ZZEA 3KYLA 1KA8A 2ZBKA 1TVCA 5ICEA 3QFRA 2VBEA 3JURA 3HTSB 1FIAA 2DAOA 2M4GA 1WU8A 1Z6TA 3G1OA 3L2QA 4BKXA 3J7AY 4KKSA 4RD0A 2G9WA 5E6TA 4HNVA 1QQIA 4J01A 2QKLB 2R7SA 4FTHA 2QYUA 2ISYA 1S7AA 2JUGA 4B4DA 5D4SA 1STZA 3ES9A 2HQRA 3AL0B 3BG7A 3BWGA 2OTLI 3VMWA 3PIOF 1H9TA 2YPRA 4MIMA 1ENHA 1QPIA 1KRHA 4E6KG 4OPOA 2JN6A 3O2PE 2LKXA 1K78A 2XDVA 5KAIC 2OUMA 3TDZC 5EJCA 1A36A 4BJTA 2HKXA 2KFDA 4CO8A 3L2UA 2GIVA 2HXOA 4HA8A 2WZNA 2OV7A 1PUFB 2K4JA 4MTDA 2DA5A 2Y48A 2XZPA 1CLWA 1SVMA 1CGPA 2BM1A 4A2UA 4OJPA 4XSZF 2Z99A 3IKTA 5IYNA 3F8FA 3KLOA 2LTPA 4O3MA 4IHXA 1NG7A 2P7CB 4G1VA 1BI3A 3TBIA 1GV2A 4YXWA 3RIQA 3BY1A 3ECHA 4I0BA 3OEHA 2H09A 4NQWA 5DV5A 4N3GA 2F48A 1QA2A 4CZZA 4Z4SA 2GJKA 3AG1H 4YZXA 1RKTA 1LFPA 4NC7A 3OE7A 3WTWC 3EUAA 2YX4A 1IDKA 3VSUA 1TTYA 1HW1A 5IK2A 1NTCA 2VFPA 4JX4A 4TMWA 4WZTA 2KRCA 4LB5A 4FE4A 5IYRA 5FKOA 4IVNA 4MQVA 1IN6A 1D1BA 2P4WA 3CJTB 1J9ZA 3OR1C 3V7AA 3DEEA 3LFKA 3MKYB 2KVOA 2W7ZA 1WWXA 3CCYA 2NRAC 1UCRA 1QFZA 4OJ6A 1EP1B 1OISA 2F6CA 5AONA 2CU7A 4Y9UA 3CCVB 1QA6A 1OYWA 3BR6A 3P9KA 5LHGA 3OZVA 1XPXA 3EUHA 4F55A 2C5BA 1EH8A 2DK5A 4DYQA 5FLXK 3ZRGA 5LHHA 2OK7A 3ECOA 3DKYA 4KICA 3A2KA 4GGGA 1V4RA 3ZQLA 1FX7A 4RD3A 3IRQA 1IB0A 1QVUA 4HLYA 1G7TA 3A35A 1L1IA 5J47A 3W5VA 3W2AA 1HW5A 2BW3B 3CO7C 3LSJA 2DPDA 4E70A 1Y0NA 3BTCA 3K9TA 2QYOA 3MMPA 3C1DA 4CCKA 2YWFA 1PLUA 3OSGA 3ZMSA 2JSCA 2L7FP 3BG5A 2V1UA 2R93J 1RNLA 2BF4A 2RDPA 4ZCIA 3HOWJ 1Y1VJ 1UD3A 3F6OA 2JA5J 1ETOA 1TWGJ 3SEQA 2QSHX 4ZV4A 3H3VK 4A3IJ 1XMAA 2VBUA 1WJEA 3VYUB 3F22A 3ONYA 5IYDJ 5K7FA 2X0KA 4Y7CA 3BQYA 5DSZA 2V7VA 3GVAA 1T98A 1Y39A 4LB6B 4ZYDA 4EH1A 3V8JA 1DG1G 5DYMA 2RVCA 1F4KA 1U5TC 2OQRA 3A0BC 2LVSA 1R1UA 2FQ3A 3CC2B 1ZGAA 4HLXA 4EQQA 2CRVA 2O17A 1O7LA 1MMGA 2ME0A 1R36A 3DFGA 2B0LA 2PMZA 2R7OA 3DU5A 1SAUA 1N06A 2Q8KA 2HDCA 3K4MA 4KH3A 3LAJA 2ZTNA 2KPMA 2Q2EA 4CCNA 1T6XA 3FXRA 1AIRA 2LG4A 3TGNA 4CICA 1F9NA 2OQGA 2XB0X 4KN7X 3ZQCA 2A68F 3GTJJ 3G71I 5B6IA 1BJAA 1ON2A 3CRZA 1E63A 3TW6A 4F3QA 5C4XJ 3DPTA 3OEEA 1OOCA 5B1BH 1RR8C 3ZPLA 3MVPA 3IC7A 4HIZA 5JLWA 1LKXA 4RAYA 3SHFA 3M9AA 1ZM9A 4ZDOA 4F7ZA 2XSJC 2F5DA 4M6YA 3KZIC 1JT0A 4CGZA 2UWMA 5FIUA 4AIHA 2A6TA 4F93B 1OFMA 2VBZA 3LFUA 3U9GA 3L2VA 2MC3A 1WOPA 3DP7A 2BXYA 5F27A 2INUA 3JRGA 2BHYA 4BUPA 4WWVA 4G12A 2XVCA 1KCDA 1J7KA 1Z3YA 3QYEA 3TMOA 3UKGA 1MBJA 3JRAA 1TNTA 4F52A 3M4OJ 3DBRB 3KP4A 4RAGA 4HE6A 1DARA 4MEYF 1Z1DA 2OAZA 3GQ7A 2EB7A 4PZJA 5LEJA 1PUFA 1YJ9I 2Y31A 2CUJA 3DU6A 1U8BA 2IS4A 2J5OA 4Y15A 2XGEA 4PUSA 1CQXA 4TN1A 3B02A 1EA0A 3N6ZA 4BY7J 1PJRA 3CUQC 5TGTA 5L3CA 5EZHA 3PFIA 3ZQ7A 4NUBA 1SM4A 1VF7A 4JX5A 2FF4A 4L9VA 3W5UA 3KZZA 3HTUA 1U3EM 3V4GA 1VQ4I 1O7FA 1KU9A 2LR8A 4FN5A 3R61A 5IYPA 4QWQA 1NJID 3AVXA 1E3ZA 5HXBA 2NYXA 1LDJA 3LMMA 4LITA 2QGGA 4RS8A 3SZTA 1HA8A 4KKUA 2R92J 4TMTA 3ZR8X 4L5IA 1EWYA 1ZRCA 4RB0A 3JRHA 3ZMDA 2X51A 3DPLC 4YG2F 2L7MP 1YRNB 4CSWA 4M3DA 1EXMA 3SEJA 1U2WA 2WB1A 2PLFA 3MHPA 2UV1A 1JI8A 1KU2A 1JGGA 2EFNA 4BS9A 5FJ8J 4KA4A 4ZDPA 2LDUA 1FOXA 1IUYA 5E79C 3CB4A 4X06A 2R7WA 3I4PA 5DD4A 1EJ9A 2KKOA 4XNFA 3IH2A 5A8AA 4EMSA 2NS0A 2KIUA 4MFDA 3HGGA 3OS2A 1QH0A 2EWNA 4XM3A 1PDNC 3ASTA 1VBLA 4W8SA 1FYKA 2GLOA 1SD5A 1D5VA 4WZKA 3CCMB 1O8DA 3ZN0A 5FL7A 3S17J 3FXUA 2P5VA 5DCMA 2F2EA 2OK8A 2IQ7A 4PSWA 5CPRB 1X3ZB 1VQ7B 4U9UA 4RLZA 4U87A 4G7OF 2HLDA 4EGYA 3G73A 5J1UA 5DNSA 1TW3A 1YYVA 4XLAA 1JKPC 1WOOA 3U6KA 3KZYA 1EA3A 2YWEA 3P5JA 3VDXA 1YX2A 5F4JA 1OCOH 2O9LA 4E0FA 2CSOA 3WG7H 2QSFX 1I1GA 1KQ9A 3I5UA 1OR7C 1W34A 2H6BA 2C4UA 3BROA 2L0KA 2LY9A 1NHCA 2RGVA 2YS9A 3ZQHA 4PGOA 3VO2A 2XZLA 1DGRM 2AXLA 2X0LA 4ZGQB 3CCSB 1YLFA 1IJWC 2HMAA 4PC2A 3ZIAA 1YJNI 4M71A 1KZLA 5AN9A 1BIBA 2IJLA 3GF2A 2IVMA 1SFKA 3LSPA 1RETA 4N9HA 2JJ1A 4UZEA 2COBA 1GDTA 2VNKA 1OGIA 3LAPA 3B8HA 2VKDA 3K70D 1UMKA 5HDKA 3H36A 2IW5A 2Y0MA 1BI0A 5AIPA 2D5VA 4HRIA 5FLVA 1JA0A 3ZUGA 5HZAA 1RWRA 3PSSA 3H3UA 3TL4X 2OCCH 2Z2SB 5EGOA 3OYFA 2XOKA 2DFIA 3GVKA 4QVJA 1QJVA 3JRIA 1DUXC 2L01A 3G1LA 2D9RA 4Z4WA 3MWMA 4DZJA 1VTNC 4X6AJ 4E7SA 1LFBA 1K8AD 2L02A 2XHKA 6PAXA 3SZEA 1G3SA 5BPIA 1N75A 5CVIA 2M45A 5D4RA 1E64A 3S32A 3T0YA 5IYQA 2HNHA 2XTXA 1MSEC 3PUFA 3F23A 2E60A 1YW8A 4RB2C 4FE7A 3GTLJ 4IHTA 1XGMA 4ENKA 4CXFA 2VXZA 2BM6A 5JBQA 3PNVA 4W8TA 1GO2A 1JKOC 2A6HF 2KJBA 2YU3A 1Y6IA 2J8KA 2HDNB 2HQAA 1RI7A 5FKKA 3J81Z 4PGHA 2V9KA 5HVQC 2IGOA 4LLGF 3OZWA 1TT5B 5LD2C 4EJOA 2XF6A 3DLLF 1JKRC 1DPUA 2HR3A 1TBXA 2DU9A 4NK6A 2VL8A 4HV5A 3K1PA 4UVAA 1OJLA 2VYQA 4ROXA 3BTJA 2PMHA 4YEIA 3KRGA 3WTTC 5HKKA 2I10A 3TEDA 5TV2A 3O8HA 2ZMEB 3OSFA 1B72A 3I4MJ 5EGOB 2WC2A 4YELA 2BY3A 3HUGA 5F08A 4IOCF 1YS7A 4ASNA 2W84A 2DMPA 2W00A 3DBLB 4A6DA 3EQNA 2CWEA 2MG4A 2QZ8A 4A5NA 4IJAA 3CPWB 2KLOA 1EP3B 1DBOA 3LSRA 1CF7A 1YO5C 3AVVA 3OWTA 2V9VA 5BMZA 4X8IA 1IN7A 2L4MA 2X6OA 3OOPA 4WK8F 1R1VA 2BHZA 2ELJA 4ZYEA 3OAAA 4RDLA 1O8LA 2VFOA 2P3MA 3JSOA 5FFXA 1T95A 2JA2A 4LD5A 1H88C 1SC7A 2D45A 3OW7A 4CYCA 3BCBA 3H3ZA 2DETA 3DU1X 5J3LA 4G7HF 1EFCA 3RI4A 3WE2A 1UELB 4YAOA 1W2BB 2JA6J 2DA1A 1Q9SA 4J19A 1IV6A 3DTKA 2M0MA 5IPAA 1W87A 4EATA 3M8FA 4AVZA 2BY1A 3L7WA 4GXOA 3CCJI 2PJRA 3REOA 1KQSB 2LY1A 3K6GA 5EEGA 2P81A 2X53S 3CLQA 5CKTA 3SJPA 1NB0A 3BQJA 1APLC 1WJCA 2EZLA 2CUFA 2L9RA 2A5WA 2BZTA 4MFEA 1WGXA 1VQ8B 1YQAA 3ISXA 5E1WA 3MKWB 3CC4B 1ZLKA 4ZC3A 3WGGA 1BQEA 5FB2A 1YI2B 5FRNA 5L3BA 1SMYF 1N07A 3FXLA 3TH0A 4KT6A 2KP6A 3OYAA 3BZCA 3QFTA 4XOPA 1GVHA 4XRFA 1R71A 5A2QZ 1LQ1A 1BOAA 1O57A 1PYVA 3G71B 2EINH 5E8IA 1VHOA 3KP3A 1DU6A 4HX8A 2HVQA 3PUBA 3M07A 2L5QA 5ILSA 2HDDA 2HS5A 4P1VA 2VT2A 2XTWA 5EG0B 3QODA 1Y56A 2XF7A 2NSTA 1FX0A 3JRCA 1QUFA 3M8JA 4KKTA 3CCJB 2E2HJ 2W48A 3TOAA 3G4SI 1LEBA 4C3IJ 1QUEA 4FT8A 3BR5A 4JQFA 4P25A 1Z67A 4A3CJ 1JJ2B 2EIJH 1H42A 3SLNA 4LC0A 1OFCX 1LVAA 2XKOA 4WXHA 2NOGA 2JIZA 3LL7A 4QHYA 2ZSIB 1IO2A 1FMVA 1UJ8A 1TZLA 4K2EA 1FSHA 4P5OA 4BQOA 3D1NI 4Q4ZF 4YFXF 1FTTA 3OS1A 2EFWA 2F1LA 1FP2A 3PL8A 5GP9A 1QBJA 4X05A 2DT7B 3CCLB 5CVJA 3LMWA 1ETYA 4XOTA 1BN5A 4AF7A 3IAS2 2LREA 4BDZA 1TWCJ 1N0VC 3ZBTA 1ZG1A 1OGOX 1W36C 2R0QC 5BOXA 1HXDA 2GQQA 2PMDA 3K4JA 1I8DA 1FBUA 2B5OA 5C1CA 4RD2A 2BGJA 2L2OA 2DK8A 2FX0A 3W2IA 3CCMI 3W2FA 1NH3A 1HA3A 1MIJA 5D5VB 5CQEA 4HX7A 5JLVC 2CQ7A 4EJWA 3CCEI 5F1JA 1FYLA 2AS5F 2R7ZJ 4XL9A 3LNQA 2ZL6A 2VJ5A 3WU2C 1Q1VA 2M7AA 3OYMA 2RNJA 1MGTA 3L2WA 1K8FA 1TYXA 1QA3A 3ZQQA 2DODA 2WWYA 5E18F 2BM7A 2V7XA 1X1CA 2R5ZA 4OPSA 2CRGA 1YJWI 3GTPJ 1WFXA 5J1RA 2VBMA 2VC1A 1YJNB 2GZWA 1WMRA 5FFZA 4AWXB 1V5GA 2RKHA 4Z6YA 3NARA 3ISPA 4PFPA 3OYJA 4KIGA 2EJRA 1WPCA 2Z6BD 1UD6A 4XKBA 4CA0A 1NRKA 3AGQA 4AYBA 1VQNI 4ZYAA 5GAHJ 1V0EA 3KP2A 2GK7A 4UAJA 2WPDA 1LPQA 3V7SA 2ZXHA 4URRA 1FLIA 1G7SA 1H8EA 3I4NJ 2Y9ZA 2R7DA 1BW5A 4HF2A 2DQLA 4Y52J 1YITB 5FKLA 2E5NA 1LLZA 4XIDA 4RBOA 1W5TA 2NS7A 2GJPA 3H94A 3SKBA 1T0FC 4DNCA 3M1EA 2JZYA 3ZOBA 1EE6A 4UHTA 3R0JA 3WTUC 3FHZA 1JGSA 2E1MB 4LK0F 2QMUA 3LSHA 3A1PA 1E79A 2JJ2A 3RSNA 1U8RA 4MYUA 1N78A 3F6VA 1MBGA 4AIDA 3C2GA 3CCRB 4I01A 5DS0A 3DEUA 1AIPA 2DW4A 2ZTGA 4JX6A 4M2LA 4RD4A 1SD7A 2XGXA 4Z2YA 3GX4X 3VEPA 2L54A 2FJ1A 1X19A 2EH3A 2HDWA 2K9LA 2VI6A 2J7KA 4MR0A 2C4TA 1SANA 3TOBA 5FO5A 4IKFA 3OPOA 5HDNA 2WR8A 2HPIA 2ZXWH 1I39A 4LG0A 2H1KA 1X3WB 4UB8C 4OIRF 3TDUC 3LQEA 3CJQB 1RPWA 2JQ7A 4NK8A 1BPLA 5EMNA 2W25A 5KAFC 4ENNA 4RGXA 1FMWA 3VB2A 1IJEA 5HS9A 2DMNA 5ERIA 2GREA 2HCJB 2OD5A 1KYZA 1FNMA 2O1DA 3E6DA 3SQNA 3W2EA 4XLFA 4TV7A 3CCUB 4CCJA 1YRNA 2DT6A 3GEZA 2BX6A 1K79A 2M4KA 1TW2A 3OYEA 1JT6A 3B82A 3PA2A 4PJNA 2K5CA 1I27A 3HPGA 3OYLA 2XB5A 4RGUA 1QGYA 1X1DA 3K1MA 5J8FA 2W6JA 5M5WJ 3G05A 1VQ9B 1RU4A 3OYCA 4BXXJ 2LF8A 3GZNB 4NBSA 2R5ZB 3CDLA 2GJRA 4QSHA 5K5RA 1IXSB 1YIJI 2EA4A 3GQ9A 1MMSA 2FEZA 3ONUA 1BJKA 2G7UA 1U2RA 2JRTA 1UMQA 1KONA 2HXIA 2XIGA 1LFUP 1MBKA 2VBXA 3SLDA 5EG0A 2NTBA 1KTVA 1T6SA 3JTHA 3WODF 1GLNA 3GCMA 2BY2A 1SFXA 1T08B 1CNFA 3A8IA 3BH6B 1I3QJ 5FROA 1K83J 5HDGA 2DTRA 1IDJA 2KIMA 3BCDA 3HOVJ 1MBHA 1VQKI 2V1XA 1JJ6C 1FSEA 5F0FA 4OIOF 2VBVA 5C3EJ 1R5GA 3GZ5A 2L9SA 2VIXA 4LK1F 1FBQA 2W57A 1MDMA 3DWLE 2CMPA 3S16J 3E0JB 2VJJA 4HAMA 1XC5A 1R5ID 1W7PD 2Y75A 4U0VA 1WJAA 4WX9A 3T56B 1Y8QB 2XSDC 3I1FA 1O8MA 3QU6A 2IS2A 1Z91A 1IC8A 2JPBA 2NAZA 4B1RA 1HCRA 2FE3A 3CDHA 1SD4A 1E1RA 1EP2B 2KJCA 3EPZA 1X2MA 2H6CA 1J75A 2OU2A 1EV7A 5GV7A 1TNSA 4OJLA 3FF5A 1RESA 2JWTA 4JMQA 3HOTA 1E3OC 4ZJZA 2DFHA 4H4KC 1OGJA 2MH2A 4NQWB 3PVDA 1Z9CA 1KK0A 1VQ4B 1VQKB 4G6DA 2KRFA 1G7RA 1Y1WJ 4Z4YA 2IPQX 2MD0A 3DBHB 2DMUA 4EGZA 2ZITA 2X3UA 4P6YA 2YWGA 3OS0A 1B9MA 3CJNA 1G7CA 1HBXG 3S2DJ 2R6HA 2Q6IA 5A88A 2ZZQA 2HPMA 3KPHA 3CP8A 4P9SA 1R23A 1ERDA 2A61A 1J2XA 3HYIA 1SFOJ 1A5JA 3BJOA 3AFHA 5CYVA 1Y0YA 2LLKA 2I1LA 4WXDA 5DD8A 3S14J 3L00A 3CC7I 2COMA 2E2IJ 4U4BA 1XCVA 1U9NA 3BY2A 1VQPI 3ROUA 3V7RA 1UD4A 3KEYA 4Y33A 4DYRA 1W0TA 1MH3A 1MNEA 2WA0A 2V1DA 4NNJA 3ZN1A 2VBKA 5ILUA 3H09A 3IWFA 5K5QA 2OCEA 4A0XA 4OAZA 2HEOA 1YW9A 1JUMA 2EV0A 3E5XA 3OKXA 4M0LA 5J4YA 5IP7J 1OFDA 1W0JA 4IXAA 1VQMI 1QRYA 3FJOA 2BW3A 2XF5A 2RC4A 3SY2A 3X2QH 3JQPA 2BM4A 2P8TA 3MCZA 4B3AA 2R9VA 2XGCA 1DABA 4HYEA 1ZM3A 1VQ5B 2GIZA 1JTAA 5HS8A 1B8IB 2LH9A 1NK2P 4HBLA 4AYBN 1QGAA 3WNCA 3W2VA 4IZZA 4OP7A 5K7HA 3HOSA 1EF4A 1JA1A 2KIFA 4AC0A 1T56A 3TO6A 2MA3A 3G3ZA 4LMYA 2DOFA 2DY1A 2WV0A 1P7JA 4WCGA 4IOAF 1FOYA 1MJ9A 2K02A 4P3YA 1CF7B 2XAQA 2D2WA 4ANJA 4YRVA 4U49A 2GXGA 4IRGA 3ERED 4PJLA 2BGIA 1VQOB 4FK8A 2H94A 1S4MA 2B0RA 5H2FC 4M9SA 5CQGA 1ZM2A 4ESJA 2BXZA 1OYIA 4RM2A 4BQQA 1A04A 4FCYA 3S3OA 3HSFA 3I55B 4NHJA 1XFOA 2XNJA 1AU7A 3IV5A 4P3IA 1MH4A 5H6QA 1R4NB 1UAAA 2IOUG 4PAAA 4I7HA 3GLXA 4ENMA 2PLYA 2A05A 4A3EJ 1H89C 2DMQA 1QG0A 2R5YA 1KQ8A 2BVLA 2MFZA 1YHQI 5BSXA 5H6RA 2YUHA 3H5RA 4PABA 2NT9A 2DI3A 4FXUA 4P1WA 3WYAA 3L2RA 4UV8A 4MYTA 2R7XA 5M3MJ 2R7VA 5L3EA 2CQKA 1QVFB 2NXNB 4RLFA 2CV2A 1QZYA 3KLNA 4EM2A 4NBQA 1H9GA 1PJ6A 4YZQA 1CNEA 3C2BA 4LOCA 3W5HA 2XAHA 4ZZDA 1TTTA 1G4DA 5EEHA 1I7PA 2R3SA 2W85A 3IRRA 3HKZN 1F1ZA 1O3QA 5L3GA 1K78B 4LBWA 2VJIA 5JHUA 1X1AA 4RPDA 3LQ6A 3HB9A 4FHTA 4BGDA 3E1YE 3W2HA 5J6XA 3T53B 2EK5A 3Q3SA 2RC5A 2DT5A 4HW0A 3LO8A 3KX2A 1O88A 4B3GA 4MTEA 1D0YA 1REPC 5CDFA 4W8QA 3SFZA 2K9MA 4M3BA 4CYDA 3KYCB 4C2UA 3ZSCA 2OPTA 3S8PA 3B4NA 3QSYA 1TQMA 1GXQA 4UUTA 3GXOA 5L3FA 4MGRA 3RPQA 5LHIA 4AF6A 2V31A 1DPRA 2MLGA 2BVMA 2EQRA 2XV4S 3WHBA 2LC2A 2ZFUA 1P92A 3EUHC 2XNDA 4BHBA 1DBGA 3COAC 4M3EA 2XZOA 5GAEJ 1JXSA 2XRLA 3Q0UA 1E2XA 1S72B 1WOSA 2GA2A 2QA4I 5AIQA 1D0ZA 4QPQA 4TMVA 4ACBA 1XG2A 3GFIA 1FEXA 3B6CA 1U5TA 2WV1A 3VOEA 2JVHA 1LM1A 1O3SA 2ZC2A 2ESNA 2LY2A 2ZKZA 4B09A 4EM0B 3GTOJ 4NC6A 1R5BA 2V5IA 2X48A 4A93J 1ACIA 3E7LA 3MKZA 3SYTA 1A35A 2NVQJ 1QGZA 1DP3A 4X7DA 3HC7A 1AMOA 2XROA 3L2CA 4B48A 2DYRH 2E7WA 2F3LA 4I84A 1LJ9A 4BACA 1ZYRF 2QUFA 2JA8J 4P2NA 2PIAA 5DS9A 3ABTA 3G1MA 1N0UA 1ETQA 1ZR4A 1FC3A 3BOQA 4B3XA 3OL3A 4L5EA 1G3WA 3TKYA 2DOEA 2QSGX 5DCMB 3HJEA 2E35A 2QWWA 1ETVA 3Q9SA 3HOXJ 1VQ6I 2DA2A 1V5FA 2KZGA 2UXXA 2UZKA 4E7JA 2LP0A 1OKRA 4E7IA 2HGCA 5GPAA 2X6XA 3QFCA 1LB2A 2XT2A 2C5HA 1KJZA 4G7XA 2JRMA 1V5EA 2LFBA 2ZXJA 2QGUA 1FTZA 4C30A 2ADUA 1OYYA 1ZN2A 2ICWG 2M7BA 3VYRB 3DTIA 2M87A 3PQKA 2V6EA 3HOYJ 4OIQF 1F43A 4KYWA 1FWZA 2Z8GA 4L5JA 1TYWA 2Z16A 4D5FA 3JAMZ 2E2JJ 3RTRA 3FK7A 1L3LA 2QF7A 2WSSA 2NV4A 5FD5A 3KYDB 1BN8A 3CUQB 3CP2A 4A5MA 3NE5B 3FX3A 1VQOI 1XGNA 2VASA 1WXRA 2X1DA 3L09A 3KP5A 5KK1A 3HG9A 2GXBA 5JFRA 4LGWA 2HU9A 1Q1HA 2EIMH 1OB0A 3T8TA 2ZZGA 2M3AA 2CFXA 1T8IA 2KMUA 3GLLA 2QEXB 1OB2A 5M5XJ 4FWTA 1VQ6B 3PSFA 4YAUA 1WPKA 4OOVA 1VF9A 5J40A 4A12A 3KP7A 3FM3A 1Z6RA 5E1XA 4DJAA 1E1QA 4YZAA 3CDIA 2BPOA 4HF0A 1IZ1A 4O6JA 1MDMB 3CPXA 2FNPA 1IUFA 2K86A 3SUCA 2YR2A 3LA2A 5DN6A 3GFMA 1RR7A 4E7HA 3D0SA 4S0HB 4LIVA 4GYIA 4P9UA 2ZXIA 2GPJA 2JT1A 2RAEA 1BR4A 2K3PA 2RNGA 1I5ZA 3BPVA 3CF2A 1R9TJ 2YX7A 2CGPA 1J09A 1DDNA 2I8DA 1O8JA 3D5RC 3QAHA 1VNDA 5IT9Z 3FHNA 3QOPA 3PO3J 2W24A 3OZUA 2MLKA 3H0DA 3NB2A 4Z03A 4BE2A 4UUVA 1X4OA 2VXDA 4BH9A 3OY9A 2BSAA 3ZMTA 1TSPA 1Z7UA 1Q7YD 2DJNA 4RDJA 1GVDA 4XLHA 4OOXA 2FRHA 2DCUA 3ZC3A 1O8EA 4DQLA 1UD8A 5H59A 2ECBA 3IP4B 2O0YA 3K4CA 2D74A 2D1VA 2EFPA 2EZKA 4L0YB 2CBXA 5IT9K 1RC9A 2NTPA 4XQFA 3CMAI 2WYRA 3S15J 3M1CA 1JRGA 2CW5A 1XTAA 2YUSA 4B44A 1D1AA 3ERMA 4XBFA 2MSYA 4C0SA 2QQ9A 1D8TA 5LGTA 2Q6LA 3QPSA 3HHGA 1KD1D 3D5SC 2CUEA 1JTYA 1D5YA 5M3FJ 4KMUX 1Y0RA 3CCEB 3H92A 3C18A 4D9JA 3JSPA 2B63J 1Z05A 4HOBA 3L1PA 1T0FA 2DN0A 2VE8A 1E17A 1A8PA 1PJ7A 2CK3A 3HRUA 3RIRA 4MEXF 5E17F 4PC1A 2ECCA 2DCEA 1X4PA 4JP0A 3RZDJ 4BY1J 2JK3A 1LVKA 1BC7C 4UXNA 3OYBA 3E6CC 5ICFA 1W0KA 2NVUB 5FRMA 2UUZA 1H8HA 4PJJA 1F5TA 2E5ZA 3FPKA 4BU2A 2B7BA 1BLIA 1A6IA 3ASOH 4B8XA 1HVXA 1MJBA 2Q1ZB 1X1PA 4ESBA 1IG7A 1W35A 3H5NA 2EFOA 5CVRA 1I6XA 2P5KA 3JR9A 2ZJPF 2ZFWA 4QLCU 1WDTA 2K7LA 5GAGJ 4N0BA 2G7HA 3LSGA 1N08A 4P55A 1HSJA 2VZLA 3CUOA 4CCLA 4P26A 1ZH5A 2STTA 4C43A 1P4XA 3OIOA 5GADJ 4BBSJ 3OV8A 4XN3A 3T8RA 2X8KA 3KCCA 3QYBA 2NVYJ 1GV5A 2YU9J 3MAJA 3M3YJ 3RCOA 1NG6A 4EJUA 2JMWA 1S7OA 2OA4A 1PUEE 3U21A 2O3FA 4BL0B 1HSTA 4HE5A 1MMDA 3LSKA 1VZ0A 2E1OA 3P9CA 1N77A 1IRZA 1HLVA 1HDDC 3VSVA 1HZEA 1N05A 1T33A 4IF4A 3QP5A 4EM1A 3T5XA 1YE9A 1MMAA 4II2A 3WQZA 4EEFG 1FDRA 3IUOA 1IN5A 2NVXJ 3E5UA 4PGGA 4KDPA 1V3FA 3BTIA 5LMZA 1VLOA 5IYBJ 2R4GA 3MMYB 2C2WA 3GWZA 1JHHA 1S7EA 3HEFA 1QQ1A 5F64A 4C9YA 3KFWX 3DPUA 1P4WA 4I09A 4XKVA 1VJSA 3RPUA 1WSVA 2QN6A 2STWA 3KL9A 5BSYA 2WB1N 3RY8A 4XKCA 4M74A 2O8XA 2O0WA 4I99C 2O8KA 2BVNA 2K9SA 2QQAA 3A02A 3QYFA 3PM1A 2BOLA 5KVRA 1RMGA 1R4MB 3OYGA 4NB5A 4MLOA 3LYCA 1YHQB 4MXNA 1TWAJ 4YIFA 2FQ4A 1G3YA 3SZGA 4Z4VA 2XNCA 3VYTB 3GUDA 3AVUA 4DBQA 4OPVA 3M7GA 3F9KA 1JUSA 1WVRA 1LLWA 2NOJB 3LWFA 1E0EA 2OBRA 4EV0A 1VQ7I 2JN9A 1XS9A 5JR3A 1PP8F 4TSFA 2CQNA 2X6WA 3SQVA 2HVSA 5D6FA 3ABLH 3CZ6A 4LJZF 4KT5C 3FIWA 4TT3A 1YIOA 3Q0VA 2JTVA 1QHGA 4NCNA 3P26A 2F4IA 1P4AA 1TLLA 2QTZA 3G6EI 2ME6A 5ED4A 1YOVB 3BR3A 1R22A 5HLHA 1ZRDA 1IHMA 2QTLA 4LG3A 3DDYA 1KTWA 1BR1A 4L8JA 2QQ8A 3NWSA 4KISA 3J80Z 1WCMJ 2BV6A 3J7YJ 3GVJA 5HNFA 1Y0UA 1WJBA 2XAGA 3CD6I 3KEWA 1TT0A 1QVGB 4ZCMA 4C3JJ 2W7NA 4OM9A 4RGSA 3OMYA 3CCLI 3BR0A 2DOGA 2HI3A 4E7KA 2CW7A 2A69F 3OOUA 5ILVA 3KETA 3J81K 3T1BA 4Z1MA 1MABA 2BM0A 5LFAA 4B47A 4TKOB 3W3CA 3VYSB 4R71A 2DOAA 3O6BB 3CMEI 5GTIC 2DFEA 1E3HA 1IN4A 2ZNYA 4HSRA 1ZG5A 5F04A 1KK3A 3VPRA 1E3PA 3Q6RA 5EEAA 1AA7A 1EKEA 1S72I 2E19A 3F8NA 2QY1A 2KZVA 3K69A 4KNYA 3V42A 1HKQA 4M9ZA 2ISZA 3HOUJ 1FOWA 5C4JJ 4WQMA 3JX8A 3WTVC 4UV9A 2GK6A 4IW3B 3L9FA 3F0CA 2VBWA 1M1EB 2IEKA 1J0RA 3ML6A 2HOTA 3UR3C 2V7TA 2RN7A 2VB6A 4JBAA 2E1RA 1MJAA 1FYMA 1SVLA 3DCFA 3U1KA 3ASSA 1QVTA 1ODDA 1S29A 1UG2A 3DXJF 4G94A 2DIEA 3WNBA 3WG9A 3WU1B 2CF4A 4XLEA 2IGNA 3CCSI 3BZ6A 2FUG2 2QM3A 3RQIA 1QRBA 4Q47A 3LSIA 3SXYA 5LGNA 2J5PA 2V9PA 2OJED 2VBYA 4PSXA 2IP2A 4BQNA 2D1HA 1W0UA 1WJFA 4N4OB 1ON1A 5L46A 1VI0A 5D5WB 3BPXA 4G7ZF 1SFUA 2KISA 1QX4A 3CW2A 1T38A 2DTZA 2XPVA 3HDDA 1XMKA 2QENA 1FRQA 2L7KA 2K4BA 5KNLA 3V7CA 1F36A 2QA4B 2MYSA 2XGJA 5FLMJ 4ITVA 2Y2ZA 2M5SA 5JHFA 1H85A 3FY3A 1J5YA 5L3DA 4XLCA 1P6RA 2E71A 2RREA 1AKHA 1GJRA 4RA2A 5LRSA 4ESFA 3A01A 4DZPA 3CC2I 3U2RA 4ETSA 2AXTC 1XDSA 4BEHB 4M6XA 1VQ8I 1QFYA 4PJ0C 1U0JA 3HPHA 3RKWA 2CYYA 4D0PA 3MZHA 1JB9A 2MD5A 4IX7A 2LD5A 4QTRA 4Y13A 3U2QA 1WJ5A 4RD1A 2OYNA 3FXOA 2DDBA 2MW8A 4YZ0A 4I0AA 4QIWN 2DFFA 2DA7A 4GO1A 3W6VA 3PNYA 5J4VA 3MN2A 2FXAA 4RPBA 3ZBUA 2OC6A 1GAQA 1ETWA 3BG9A 1O8GA 2FBKA 2Q0OA 3V76A 3Q9VA 4AVPA 2MH9A 4UY8I 2LRDA 1IXRC 1MNDA 4FASD 4A3FJ 4EJVA 4G6QA 1DDIA 3GTGJ 2RC6A 5DTDA 2XASA 4C2LA 1LDKB 3BJAA 3CCVI 3S3NA 1JUPA 2F4OB 5C44J 3S3MA 1IRXA 3SZPA 3SJMA 4XSXF 2GA1A 3HRTA 5TRDA 3RYRA 3HSRA 1SD6A 4HZFA 3CCQB 1XCBA 3MCAA 4WZLA 3QQAA 2X1EA 3Q0WA 2HOSA 2BEOA 1I3AA 1V55H 4L0ZB 4V02C 1RKWA 3VNVA 5FA6A 4QV2A 1Q86D 3JRFA 4BEHA 2V7WA 1XGSA 1X3UA 3K4NA 2UXNA 5IOYA 2LBFB 4KN4X 2IA2A 1M90D 3CMYA 2PN6A 4HF1A 3WBJA 3D5LA 2JUCA 4AD9A 4XLPF 3LA7A 4F91B 4RLQA 4I6ZA 2ZNZA 3GQ8A 3KE2A 5HZBA 2QQBA 1K7AA 2WAQN 1EFUA 3MZ8A 1ZR2A 2GOMA 3E6BA 3RYPA 2E1CA 1CZFA 5BPDA 4F7DA 2WJYA 1OMIA 2KT0A 2XAJA 2NNNA 4EW9A 3ASNH 1RIOH 4J0QA 3GMEA 2K9NA 2BM5A 3FXJA 3C7JA 4YCQA 2X6YA 2EFQA 3F72A 3QP6A 5E3LA 4D7NA 2X9DA 2PMUA 1VLYA 3HAGA 2FMLA 4HG2A 2UVFA 3F8CA 1LE8B 3E3VA 4HSTA 1PXZA 2WAFA 2X3HA 2VN2A 2Y69H 3HXLA 2XPWA 2IAIA 4XORA 2X85A 5IP6A 1OCPA 2PECA 3HHHA 4A3BJ 3KEOA 5E8GA 1YJWB 2EIXA 4WF2A 1A6QA 5FGMA 2XEXA 3ONQA 4KIBA 2Z9OA 2XAFA 3WNDA 1OPCA 1RUNA 1S8NA 4N3NA 4WXCA 4BYYA 1MBFA 3N97A 4KJZA 2FOWA 3GRHA 3RPUD 3T9GA 3HIFA 1XX5A 3R6KA 2PE3A 4Z4UA 4Z06A 2IS6A 1JNYA 2P7VB 3OP1A 3G4SB 2INVA 1IN8A 4A6EA 5TJJA 1W5CC 2R7RA 1O8HA 4YIIA 3S1QJ 3LA3A 4Y3OA 1W7PA 2QBYB 2E36A 4DBRA 4J00A 1CQTA 3AKZA 5K7ZA 1FP1D 3PIPF 4FETA 2ZJRF 2DA3A 1UD2A 2IS1A 1K6YA 5IP9J 1HKTA 2O04A 1XD7A 3O3KA 3IAM2 3BH7B 2ZMEC 1QFJA 3PSZA 2MGQA 1O3TA 1PP7U 1BMFA 1L0OC 3OYKA 3ELKA 4FX4A 4HV6A 2WJVA 2DJIA 1R00A 2CUZA 3CC7B 3P7NA 4Z05A 1GR1A 1VHEA 2L9NA 1DP7P 2JA7J 3ABMH 3RQ4A 2ZL7A 4IO9F 1QZZA 3Q5FA 1XB4A 3GVLA 5HODA 2DPUA 4OPWA 5DUIA 2ZBVA 4YDTA 2DXIA 1BL0A 1Z3XA 3D26A 4YAFA 2PFBA 3I58A 1QCXA 3OR2C 1XB2A 2VNJA 2Z5UA 3BG3A 1P4MA 2E1BA 1VQNB 1UG0A 3I55I 2HQ5A 4QVAA 2FSWA 2DA4A 2Y9YA 1PKVA 1TWHJ 1FT9A 2QEXI 1HW2A 1T6YA 1YLOA 5J35A 4P96A 3F21A 4MQ9F 1QGPA 4U88A 1PE9A 2VKEA 1J9IA 3IHUA 3BT9A 3QWLA 2DMTA 5FKNA 2O6GE 1HKSA 3VNUA 4E7LA 4DNRB 4Z4TA 3FK6A 4RAFA 4DGWB 5CLSA 4G6IA 1X2NA 2VNIA 3R6SA 2H1LA 1ORKA 3OW2B 4RCZA 1AOYA 3IL2A 2Q2EB 4HPQA 1ELOA 2XRNA 2ZSHB 1X0CA 2FNAA 2I5UA 4AM3A 1KC8D 4ACAA 1K6OA 1NDHA 3ZPNA 3GO5A 2LMDA 2ELHA 3ABUA 3K0LA 4UUSB 4V2GA 5EZGA 4CUGA 2BMWA 2KHMA 1RUOA 5C1EA 3FXQA 5KSWB 3GZ6A 2RV8A 1ITYA 1AHDP 1O8KA 3NAWA 2ID3A 3WY9A 1HDPA 2P6TA 4JRAC 3ZZUA 4JK1X 2IT0A 1IDZA 2QZAA 3AG2H 1HQCA 1HF2A 3JRBA 3VWBA 1D3YA 3CESA 4EVIA 2H8RA 3IH3A 1D1NA 2LYCA 2HVRA 3I64A 4DYCA 1ONVA 2CFOA 3OOCA 1TQPA 2ZO4A 3WU0A 3CF5F 2GQFA 4P22A 2XT4A 2DLLA 4BDYA 1QHHD 3QPTA 2MBFA 2HZDA 5D6EA 2C77A 5TR9A 2EIKH 3EQLF 3A8JA 1K73D 3ASPA 4EJTA 3FXMA 1BX1A 3NAUA 2LF7A 1FIPA 1DDGA 1WI9A 2F5FA 2FU4A 3QRFF 2VUMJ 2J8IA 1W7PB 2NNYA 3BR1A 2TDXA 2ZBUA 3GIRA 1WJDA 2V4JC 3I0TA 2VFNA 2A3SA 2BYVE 3S93A 3BG6A 3BLYA 5ICGA 1ZM4A 1QO0D 2F4NA 2K9QA 2CO5A 1EH7A 2OTJB 1P9QC 3WTSC 1SEUA 2ESHA 4G7WA 1I6HJ 4IHWA 1OLTA 3H35A 2XC7A 1JKQC 4AIJA 3NEUA 4RDKA 1KYWA 2PX9A 3K4LA 5B3SH 2O0VA 2QLZA 5KCMA 1DU0A 1H80A 4BAYA 4RJLA 3FKIJ 2A5YB 4N4NB 2L3DA 5TY0A 3FZVA 5HLTA 1QU3A 2ELKA 1VQ9I 1RQPA 1W36D 4IHSA 4GCVA 2V79A 2JVGA 3HUGB 4IQ4A 2B9SA 2QBYA 2TRTA 1FRNA 4PC6A 4YEJA 4A3KJ 3W2GA 3I54A 3E97A 4I76A 3WXMA 4CH7A 5D5UB 3CCUI 2ZMEA 4E7ZA 1D0XA 4OINF 2F5CA 2HTSA 1HF0A 3N90A 2F43A 5FD6A 2CJJA 2M0CA 4D1QA 4M3GA 2IGKA 3PA1A 1WKMA 2VOPA 5A2QK 4R8HA 3U1DA 3OJWA 3FMQA 1USTA 2Y0SN 4F92B 3P9IA 4IRIA 3OL4A 2CH0A 1LEAA 4U7BA 2QX3A 2VPRA 2HYGD 3CTAA 4V19K 2VBTA 2Z1DA 2ZJQF 3WTYC 2P0WA 3RJPA 3I71A 3I56B 1EH6A 3FXKA 2VQCA 4D7MA 5GV8A 3GQAA 3TO9A 5TISC 2PQ8A 4CYCB 2R7UA 1FNBA 1B8IA 3GFLA 4OIPF 1GAWA 1VQMB 2F5VA 2LBFA 3BCAA 3MZYA 5DEQA 4U7DA 3RZOJ 5B5EC 5FNZA 3A8KA 1WRJA 3R4KA 4BJ6C 1MNMC 1ZUNB 4P9FA 2W4SA 1G6NA 2HKOA 3JCUC 3W6KB
chains in the Genus database with same CATH topology
3PSIA 5FRMA 1I8DA 5C1CA 2UUZA 1H8HA 4PJJA 4XKWA 2L2OA 2E5ZA 4E4HA 2GOXB 4BU2A 2CV0A 1BLIA 3I9V2 4IQJA 1HVXA 2Q1ZB 3H5NA 2CW8A 5CQEA 1K28D 3VSTA 2ZZEA 3JURA 3KYLA 2VBEA 4XL9A 4BE1A 2PJRB 3A4CA 3B8YA 3LSGA 2VJ5A 2VPLA 2M4GA 2M7AA 3OYMA 4KKSA 3L2QA 4CCLA 3J7AY 3CMMA 4NC8A 3L2WA 4J01A 2QKLB 2R7SA 3ZQQA 2JUGA 4XN3A 2X8KA 3AL0B 1X1CA 3BG7A 3SEZA 3VMWA 1BR2A 3QYBA 1WFXA 4E6KG 4CZCA 4X0GA 3RCOA 1NG6A 1WMRA 2VBMA 3UW0A 2XDVA 1V5GA 2OUMA 3U21A 4BL0B 1MMDA 3LSKA 4PFPA 1VZ0A 4BJTA 3OYJA 3L2UA 1N77A 1NBMA 1O8IA 2OV7A 2R7TA 1WPCA 1UD6A 1HZEA 2XZPA 2Z6BD 4XKBA 4CA0A 1NRKA 5KHDA 3VSVA 4AYBA 3OYIA 4ZYAA 4XD7A 1YE9A 1MMAA 4II2A 1V0EA 3WQZA 2GK7A 4OJPA 3PJRA 3IUOA 2WPDA 2ZXHA 3K4KA 4II3A 4URRA 1H8EA 5HOOA 2V26A 3GBGA 2R4GA 3A1YA 1NG7A 3MMYB 3PFYA 2E5NA 3ZCOA 3TBIA 4C9YA 2GJPA 4BJ5C 3DPUA 4XKVA 1T0FC 4AU7A 1VJSA 3A3BA 3H94A 3OEHA 4YXWA 2O0WA 4XKCA 3QYFA 2GJKA 1EE6A 4YZXA 2BOLA 1LFPA 2E1MB 4NC7A 4DOZA 3OE7A 2NSPA 3LSHA 2CV1A 1RMGA 3FBIB 3EUAA 3OYGA 1IDKA 4MLOA 1E79A 2JJ2A 4MXNA 3VSUA 3SDBA 3RSNA 3H5AA 3SZGA 5IK2A 3VYTB 4ASUA 2KRCA 1N78A 3G2BA 4DBQA 4RM3A 3C2GA 1D1BA 3F9KA 3OR1C 3DEEA 3MKYB 2ZTGA 2KVOA 2VKHA 3ZPPA 2NOJB 4OJ6A 1E0EA 2F6CA 4B43A 3QOEA 1X19A 2HDWA 3DTEA 2K9LA 2X6WA 2JDIA 4TSFA 4MR0A 2HVSA 3CZ6A 4F55A 4TT3A 4IKFA 3OPOA 2HPIA 1D1CA 1QHGA 3ZRGA 4OWRB 2KQRA 2F4IA 3CJQB 4NK8A 1BPLA 4OZYA 1KTWA 3DKYA 3DDYA 3A2KA 1FMWA 4LG3A 1BR1A 4L8JA 3NWSA 4KISA 2IXSA 2O1DA 4KITB 5HNFA 3GVJA 1WJBA 4XLFA 3A35A 3BC9A 3KEWA 1TT0A 3CJRB 3W2AA 2BW3B 4CCJA 2DT6A 2W7NA 2W6IA 2M4KA 3OYEA 3OMYA 3A3GA 4PJNA 4E7KA 2K5CA 2CW7A 4DNTB 3OOUA 3HPGA 3OYLA 2W6JA 4CCKA 1X1DA 3K70C 1PLUA 1RU4A 3G05A 3OYCA 4Z1MA 1MABA 5LFAA 4B47A 4TKOB 3W3CA 3VYSB 2GJRA 2DOAA 1UD3A 3GQ9A 3SEQA 2WAQA 4HSRA 2BSPA 2D3NA 1WJEA 3VYUB 1KONA 3H9QA 2XAUA 1AA7A 4ZDLA 2QY1A 2KZVA 4JOMA 3V42A 3OYNA 2NTBA 2VQHA 1GLNA 3VSKA 2GK6A 5FROA 2AQFA 1IDJA 3UR3C 2VLAA 3BCDA 2KL4A 3VR6A 4OJOA 2WAEA 1OHHA 2VB6A 2O17A 1MMGA 2PMZA 2R7OA 3DU5A 1SAUA 2L9SA 3DQVC 3BH4A 2DIEA 3K4MA 2VIXA 2ZTNA 2QXZA 2KPMA 4CCNA 4OJ5A 1KMHA 4XLEA 2IGNA 1AIRA 2LG4A 3DWLE 2CMPA 3E0JB 2FUG2 2VJJA 3LSIA 1WJAA 3T56B 4PSXA 4BQNA 1O8MA 2IS2A 1WJFA 4N4OB 4F3QA 3LNNA 3DPTA 3OEEA 1OOCA 1Z21A 3WWGA 4HIZA 2KDOA 1LKXA 3K10A 2L7KA 4ZDOA 2XSJC 5KNLA 1E1RA 2MYSA 3EPZA 2UWMA 2XGJA 2A6TA 4LIUA 3ZXSA 4F93B 1OFMA 3LFUA 4ITVA 4OJLA 3L2VA 3N05A 2M5SA 4JMQA 3C2HA 5JHFA 4XN0A 3HOTA 3FY3A 4ZJZA 4H4KC 4XLCA 2INUA 4NQWB 2RREA 4BUPA 2V4DA 3DKXA 1KCDA 1Z3YA 2AQEA 3QYEA 3TMOA 2MABA 4BEHB 2MD0A 1U0JA 1OGMX 3HPHA 4F52A 4IX7A 3OS0A 1WJ5A 3GQ7A 1EFRA 2ZZQA 2HPMA 4YZ0A 2CUJA 3DU6A 3CP8A 2IS4A 3PNYA 3H9GA 4PUSA 1ERDA 2MC4A 3AFHA 2OC6A 2E1MC 1PJRA 1O8GA 5TGTA 4U4BA 2Y0SA 4NUBA 3OYHA 1VF7A 1UD4A 3KEYA 4Y33A 2WA0A 1MNEA 4NNJA 2VBKA 5AMVA 2LRDA 4OAYA 1MNDA 4FASD 3W2WA 4ZTFA 1E3ZA 4C2LA 1LDKB 4OAZA 3S3NA 3LMMA 1IRXA 4G6TB 4LITA 3S3MA 1HA8A 4KKUA 3OYBA 3ZR8X 4HWVA 1W0JA 2X51A 3DPLC 2BW3A 2XF5A 4CSWA 2X1EA 2LZJA 2WB1A 3FBNB 2UV1A 1JI8A 4BS9A 4B3FX 4ZDPA 2R9VA 4PK4A 4BEHA 1JTAA 4PFOA 3K4NA 2LH9A 2LBFB 2R7WA 4GQNA 3W2VA 4IZZA 3D5LA 3HOSA 3T51B 4XNFA 4F91B 1I18A 4RLQA 2NZMA 3GQ8A 3OS2A 2CS3A 4ZTJA 3K4BA 3OIQA 2GOMA 4XM3A 4ANJA 1VBLA 4U49A 4YRVA 1O8DA 4W8SA 1CZFA 3MD2A 2WJYA 5FL7A 4PJLA 4EW9A 2IQ7A 4PSWA 5CQGA 4W8RA 2V1NA 5CPRB 4RM2A 4BQQA 3GQBA 4U87A 2HLDA 3S3OA 2VJ4A 2X6YA 4XLAA 1VLYA 3HAGA 2NT6A 1EA3A 1UAAA 4HG2A 3VDXA 2W1OA 2UVFA 4E0FA 2PYGA 2BVLA 2MFZA 4HSTA 1PXZA 1S9HA 2WAFA 1OR7C 3H5RA 4XMYA 3HXLA 4XORA 1E3XA 2NT9A 2X3HA 1NHCA 2X85A 3OYDA 4FXUA 4P1WA 1OFLA 2JSPA 2XZLA 1DGRM 3L2RA 2R7XA 2PECA 2R7VA 1G59A 4RLFA 3ONQA 2CV2A 3ZIAA 1KZLA 2JJ1A 1SFKA 4YZQA 3FDYA 4PMHA 3GRHA 4KJZA 2VKDA 2V7FA 3K70D 3RPUD 2WADA 4Z06A 3T9GA 1RWRA 1WP6A 1COWA 4HRIA 2IS6A 2VJIA 2INVA 1X1AA 3TL4X 2Z2SB 3OYFA 4QPOA 3I3LA 2V7QA 2XOKA 3GVKA 4BGDA 2WBMA 2R7RA 1QJVA 1IA5A 3T53B 4Y3OA 3E1SA 4RMNA 4J00A 4DBRA 3KX2A 4E7SA 3AKZA 1O88A 4B3GA 4FETA 1D0YA 3ZGKA 3PNTA 1K6YA 1N75A 2IS1A 1UD2A 5CDFA 2K9MA 2O04A 4W8QA 3S32A 2HNHA 3IAM2 3VMVA 4C2UA 3ZSCA 3S8PA 3B4NA 2E60A 1BMFA 3OYKA 3FPPA 2V31A 2WJVA 2DJIA 2ZZFA 2CUZA 1O8FA 1SKYB 2BVMA 4Z05A 2VXZA 3NWTA 2WY8Q 3PNVA 4W8TA 2LC2A 2L9NA 2ZFUA 3EUHC 4XR6A 2XNDA 1DBGA 3H9JA 3RQ4A 2XZOA 3GVLA 3LSMA 1Y6IA 2DXIA 2W82A 1Z3XA 2HQAA 1D0ZA 1G8XA 4QPQA 2V9KA 3OR2C 5HVQC 1QCXA 1XG2A 2E1BA 1UG0A 2IGOA 2LOOA 2JVHA 2RQQA 5LD2C 3EQOA 4CCOA 2LY2A 2XF6A 1PKVA 2WZPP 4NK6A 2VL8A 3MKZA 3SYTA 1PE9A 1DP3A 2ODLA 3HC7A 1YX5A 3UNGC 3KRGA 4B48A 5HKKA 4HNUA 4I84A 4BACA 4E7LA 4DNRB 1W9XA 1Z7LA 4DGWB 4G6IA 4YELA 4B3XA 3OL3A 4Y4RA 2Q2EB 4HPQA 1R6RA 2W00A 3EQNA 2ZSHB 1X0CA 2KRHA 1V5FA 4E7JA 4E7IA 2KLOA 3ZPNA 1DBOA 2X6XA 4G7XA 1V5EA 4CUGA 3OWTA 2KHMA 5C1EA 4C30A 5HNHA 3VYRB 2V6EA 2M7BA 1O8KA 3DTIA 1O8HA 2VQLA 1WTHD 2VQGA 2ELJA 1O8LA 3OAAA 2Z8GA 4HEA2 2Z16A 4BE0A 3RTRA 1T95A 2JA2A 2WSSA 3DLAA 3VWBA 4C2TA 4HNTA 3CESA 3OW7A 3BCBA 1BN8A 3B90A 4XONA 3CP2A 2LYCA 2HVRA 1UELB 3FKJA 4PJMA 3NE5B 2WY7Q 2VASA 2F1MA 2CFOA 3OIPA 3DTKA 2X1DA 2M0MA 3OOCA 2PYHA 2O5RA 1HG8A 4P22A 4EATA 3HG9A 4AVZA 4BDYA 4DK1A 2HU9A 2PJRA 1OB0A 1QHHD 4GRIA 2ZZGA 2M3AA 2HZDA 2LY1A 3K6GA 2X53S 4CCMA 5CKTA 2KMUA 1WJCA 3HL2A 1MMNA 2A5WA 3PSFA 1DGWY 1WJDA 2V4JC 4DJAA 1E1QA 3MKWB 2EWEA 4YZAA 4ZC3A 3JU4A 3S93A 1BHEA 3BG6A 3BLYA 5FRNA 3EUKL 4KT6A 2KP6A 3OYAA 3SUCA 1P9QC 5DN6A 4XOPA 2D3LA 4G7WA 4E7HA 3AL0C 2IGMA 3OFNA 4LIVA 1X1BA 1E43A 2ZXIA 1OLTA 1GQ8A 1PYVA 1V0FA 3H35A 1BR4A 2K3PA 2RNGA 2XC7A 3CF2A 1J09A 2I8DA 3K4LA 1O8JA 2HVQA 3D5RC 3PUBA 2L5QA 4UZUA 1BOBA 2O0VA 3FHNA 5KCMA 4Z03A 3H0DA 3BCFA 4BE2A 1X4OA 1H80A 2VXDA 3OY9A 2R7QA 4N4NB 3QODA 1Y56A 2XF7A 2NSTA 5HLTA 1FX0A 1QU3A 3FKSA 1YX3A 4XLHA 4BXFA 1W36D 3M8JA 4KKTA 2JVGA 3HUGB 4IQ4A 1O8EA 1UD8A 4YEJA 3IP4B 3K4CA 4CH7A 2QE7A 4JQFA 4DIQA 4E7ZA 1D0XA 2NTQA 1KCCA 2NTPA 4XQFA 2UVEA 3M1CA 1JRGA 4OZZA 4B44A 2F43A 1D1AA 4D1QA 1DQUA 2X1CA 2JIZA 2IGKA 3LL7A 2ZSIB 1IB4A 1FMVA 1TZLA 4P5OA 4BQOA 2QKMB 3D5SC 3HKZA 4F92B 3OS1A 3OL4A 2CH0A 4U7BA 2QX3A 1MW7A 4D9JA 3PL8A 2Z1DA 4R79A 2DT7B 2P0WA 1K5CA 3LMWA 1T5EA 2VQCA 4XOTA 3GQAA 2CK3A 1ZELA 3IAS2 2LREA 2R7UA 4DK0A 4BDZA 2DCEA 1X4PA 2F5VA 2LBFA 3BCAA 1UD5A 1OGOX 1LVKA 1W36C 4BJ6C 3BC8A 2W4SA 3K4JA 1W0KA 3VSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C1C A;  3EQN A;  1X0C A;  4XKW A;  2NZM A;  2QY1 A;  3GQ8 A;  2NTB A;  1DBO A;  2X6X A;  4XM3 A;  1VBL A;  4W8S A;  4U49 A;  1O8D A;  1CZF A;  3VST A;  3JUR A;  2VBE A;  4XL9 A;  1IDJ A;  3B8Y A;  5C1E A;  4EW9 A;  1O8K A;  1O8H A;  4OJO A;  2IQ7 A;  2O17 A;  4W8R A;  1O8L A;  2Z8G A;  2X6Y A;  4XN3 A;  2QXZ A;  4XLA A;  3VMW A;  4OJ5 A;  1BN8 A;  2NT6 A;  4XLE A;  4XON A;  1AIR A;  2VBM A;  3B90 A;  2UVF A;  3UW0 A;  1WMR A;  2VJJ A;  2PYG A;  1PXZ A;  4XMY A;  2X3H A;  1O8I A;  2PYH A;  4XOR A;  1O8M A;  2NT9 A;  1NHC A;  1HG8 A;  2X85 A;  3VSV A;  1OFL A;  4AVZ A;  1OOC A;  2PEC A;  3WWG A;  4OJP A;  4URR A;  4YZQ A;  1OFM A;  4PMH A;  3GRH A;  4YZA A;  4OJL A;  2EWE A;  4XKV A;  3T9G A;  4Z06 A;  4XN0 A;  3FY3 A;  1RWR A;  1BHE A;  2O0W A;  4XLC A;  2INU A;  2VJI A;  2INV A;  1QJV A;  1EE6 A;  3SUC A;  1KCD A;  4YZX A;  1IA5 A;  4XOP A;  2NSP A;  1RMG A;  1IDK A;  1GQ8 A;  4MXN A;  1OGM X;  3VSU A;  1O88 A;  4W8Q A;  1O8J A;  2O04 A;  3GQ7 A;  2O0V A;  4Z03 A;  3VMV A;  3ZSC A;  3ZPP A;  4YZ0 A;  3B4N A;  4OJ6 A;  1H80 A;  2NST A;  4MR0 A;  2X6W A;  1O8F A;  4XLH A;  4Z05 A;  1O8G A;  4U4B A;  4W8T A;  1O8E A;  4YEJ A;  4XR6 A;  1DBG A;  5AMV A;  2VBK A;  4NK8 A;  2NTQ A;  1KCC A;  2NTP A;  4XQF A;  2UVE A;  1KTW A;  1JRG A;  4OZY A;  4OZZ A;  4C2L A;  1QCX A;  1XG2 A;  2O1D A;  1IB4 A;  4HWV A;  4XLF A;  3EQO A;  2QX3 A;  4NK6 A;  1PE9 A;  2ODL A;  1PLU A;  1K5C A;  1RU4 A;  3LMW A;  4XOT A;  3KRG A;  3GQA A;  4I84 A;  1JTA A;  3GQ9 A;  4YEL A;  1OGO X;  2BSP A;  4XNF A; 
#chains in the Genus database with same CATH topology
 1UFM A;  3BP8 A;  4D5C A;  4ABZ A;  1YIT I;  5FO0 A;  4XKW A;  1ZAO A;  4HDU A;  1S0U A;  1OCC H;  3AK5 A;  2AHQ A;  4R1H A;  3Q39 A;  2PI0 A;  4CQJ A;  1EFT A;  1K28 D;  4KUM A;  1Z0X A;  3VST A;  4M53 A;  3B78 A;  3ABK H;  4BE1 A;  2PJR B;  3A4C A;  4M72 A;  4PC7 A;  4X7F A;  3B8Y A;  2VPL A;  4UVB A;  1ZKG A;  1ZHF A;  3CMM A;  4NC8 A;  4LBZ A;  2HZT A;  2EV5 A;  2ACJ A;  2LKP A;  2PBI A;  3M8E A;  3TP3 A;  3SEZ A;  1BR2 A;  4YIR X;  1D8K A;  4CZC A;  5K1Y A;  4X0G A;  3UW0 A;  1IF1 A;  3O8G A;  5K5O A;  3V8K A;  2RQP A;  4BBR J;  5DM6 F;  4UZF A;  4X0C A;  1NBM A;  3AGP A;  4Q48 A;  4G5G A;  2EFG A;  1O8I A;  1IRF A;  4GDF A;  2R7T A;  1WH7 A;  5THX A;  2K85 A;  2LSO A;  3FM5 A;  5KHD A;  3OYI A;  1TC3 C;  4XD7 A;  2P5L C;  3PJR A;  5BQT A;  1ZTR A;  3K4K A;  4II3 A;  5DM7 F;  4XRS G;  5HOO A;  1OCT C;  1VQL B;  1OCZ H;  2V26 A;  3GBG A;  2ZJ2 A;  4RDU A;  1HOM A;  3A1Y A;  3GW2 A;  4M3F A;  1IRG A;  1B4A A;  5JMC B;  3PFY A;  4GFB A;  1ZGW A;  3ZCO A;  3A3B A;  4BJ5 C;  4M1K A;  4AU7 A;  4AIK A;  2CW0 F;  2ZCW A;  9ANT A;  2VE9 A;  1GHC A;  5JVG F;  4A69 C;  1K4S A;  3KIO A;  1O4X A;  3RDI A;  4ZYG A;  4DOZ A;  3J7Z I;  2NSP A;  5BNG A;  1USS A;  2CV1 A;  3FBI B;  4W97 A;  1KK2 A;  4RB3 C;  3SDB A;  4H9G A;  2VKV A;  3H5A A;  2FOK A;  4ASU A;  3G2B A;  4ZZL A;  2LK2 A;  1XMX A;  4RM3 A;  4G8X A;  2A6E F;  1NK3 P;  3WTX C;  4IL6 C;  2VKH A;  2XUB A;  1B9N A;  3ZPP A;  2ZB9 A;  3SYJ A;  3NRV A;  3JQQ A;  2HOA A;  4B43 A;  1QNT A;  3QOE A;  5JVT A;  1FY7 A;  2NVT J;  3DTE A;  4LLL A;  4PC3 A;  1WSR A;  3WGH A;  2JDI A;  5M5Y J;  1XG1 A;  2M8E A;  5EF6 A;  3GFJ A;  3IKV A;  1YI2 I;  4IRH A;  4L18 B;  3CXC B;  1YW7 A;  1D1C A;  1JE8 A;  1JTX A;  2AO9 A;  2F5E A;  2KQR A;  2Y30 A;  4OWR B;  3H9N A;  4DQK A;  3K7A J;  3A03 A;  1AKH B;  4OZY A;  1WOR A;  5IYC J;  4ON0 A;  4S04 A;  3Q3A A;  4NDL A;  2V7U A;  4OOI A;  2IXS A;  4UUS A;  2BE5 F;  3J81 k;  2VFQ A;  4KIT B;  3V8L A;  1VFC A;  3BC9 A;  4QUZ A;  3CJR B;  4RD6 A;  1FJL A;  2W6I A;  3E20 A;  2CQQ A;  2EZH A;  3B73 A;  1BI1 A;  3A3G A;  4OMZ A;  4DNT B;  3TP0 A;  4L9J A;  3RKX A;  3K70 C;  4TMZ A;  3FMS A;  3PEN A;  3DKW A;  3VOD A;  5ICC A;  5LLQ A;  4S05 A;  1T6Z A;  4Q7J B;  3K2A A;  1IW7 F;  3QE2 A;  2K3F A;  4IHY A;  3F8M A;  1B72 B;  2X4H A;  5IOZ A;  2DQR A;  2R7F A;  2PEX A;  2WAQ A;  5B1A H;  3FIS A;  5EYR A;  2D3N A;  2BSP A;  4A3D J;  4A3L J;  2FVG A;  1JHF A;  2EA2 A;  3H9Q A;  2XAU A;  1FZP B;  2BY0 A;  1XSD A;  5FO1 A;  3AVT A;  4ZDL A;  4RCY A;  4YAL A;  2DDA A;  4JOM A;  3OYN A;  3JRD A;  4Q5S F;  4HX4 A;  2VQH A;  1T2K A;  2VNH A;  1YFH A;  3VSK A;  1B2R A;  4UNO A;  2CND A;  5J1Y A;  5DDG A;  2AQF A;  3I59 B;  2VLA A;  1R49 A;  2G0Y A;  3LJY A;  2KL4 A;  1TL8 A;  3VR6 A;  4OJO A;  2WAE A;  5E1Z B;  1OHH A;  1W1W E;  1ZAR A;  4FQG A;  1E62 A;  4L9N A;  1XDU A;  3DQV C;  3BH4 A;  4LG0 B;  1M1K D;  1MKM A;  3JQR A;  2C6Y A;  2QXZ A;  4OU0 A;  4OJ5 A;  4LBV A;  1KMH A;  1BA5 A;  1XSX A;  3PET A;  2M2E A;  3LOC A;  4A3G J;  1ETX A;  5IT3 A;  1B59 A;  1U9O A;  4Y7N J;  5J8C A;  3HGY A;  1YS6 A;  2DYS H;  1LDD A;  3LNN A;  3AAF A;  1OCR H;  1Z21 A;  3HZJ A;  5FLX Z;  3WWG A;  1GXP A;  1RQR A;  2KDO A;  2JJ7 A;  1KQ5 A;  3K10 A;  3S2W A;  1G3T A;  2EBI A;  1P7I A;  3ZMZ A;  3P27 A;  3U6B A;  2M30 A;  4RM0 A;  1QPM A;  1O3R A;  4LIU A;  3ZXS A;  4YFK F;  2VOO A;  3ZQG A;  1ZLJ A;  3CD6 B;  3N05 A;  3KEQ A;  1J59 A;  3C2H A;  1ZRF A;  4XN0 A;  4LBY A;  1TYV A;  3ZQI A;  3BDD A;  4DQ2 A;  2PJP A;  3PQJ A;  3GTM J;  2V4D A;  1SKQ A;  3C3W A;  4A3M J;  3DKX A;  2E1N A;  2KIQ A;  4YHB A;  3MQ0 A;  2AQE A;  3FMR A;  2MAB A;  2DEU A;  2HYF A;  2CG4 A;  1OGM X;  1FNN A;  1KQ0 A;  3NQO A;  4N9I A;  1YTY A;  3S1N J;  3JW4 A;  1IJF A;  3ULQ B;  1BJZ A;  4ZCL A;  2OTL B;  4G1B A;  3ZQF A;  5D8K B;  1EFR A;  3SFI A;  4ZYH A;  5HLI A;  3H9G A;  3JRE A;  5EDN A;  2MC4 A;  2M9H A;  5E3N A;  5A89 A;  2E1M C;  4BXU A;  4WZE A;  2Y0S A;  1C0W A;  1OR7 A;  3N4M A;  3OYH A;  1I1S A;  1KK1 A;  3ASR A;  4C3H J;  5E3M A;  5AMV A;  4X7C A;  3HSE A;  2VOD A;  3S1R J;  4KFC A;  4OAY A;  3W2W A;  1W4M A;  4Y17 A;  4ZTF A;  1H0M A;  3E6M A;  3QPL A;  4PDK A;  3PO2 J;  2EV6 A;  4HDV A;  1K4Z A;  4G6T B;  1F20 A;  2WTE A;  2YSR A;  3A0H C;  4HWV A;  5B66 C;  3R6J A;  2OZU A;  4A0Y A;  4CDG A;  3BR2 A;  1EZG A;  2LZJ A;  4YC5 A;  4W1U A;  4K1X A;  1BX0 A;  4UB6 C;  3FBN B;  3EET A;  3GYH X;  1GT0 C;  2NPF A;  3ML3 A;  4B3F X;  2K40 A;  2PMZ N;  2M8G X;  1N25 A;  3ZMV A;  4A0Z A;  1Q82 D;  4PK4 A;  2HTJ A;  3GTK J;  1IXC A;  1K61 A;  1R7J A;  4PFO A;  1BBY A;  3K1N A;  2FX3 A;  1UHS A;  2VBS A;  1Z77 A;  1FNC A;  1U6G A;  4Y9R A;  2L9V A;  3GSI A;  3GTQ J;  4GQN A;  1WQ2 A;  3EYI A;  4I2O A;  4M9X A;  1TP4 A;  3J80 K;  3T51 B;  1I18 A;  1N8R D;  5GTH C;  2QCO A;  4MHG A;  2NZM A;  4X07 A;  4AC9 A;  2YWH A;  4V2F A;  3S2H J;  2CS3 A;  4ZTJ A;  1TWF J;  3K4B A;  3OIQ A;  1XE1 A;  1W5S A;  1TYU A;  1VQP B;  2P6S A;  1ZK8 A;  1MZB A;  3MD2 A;  2FMY A;  3E5Q A;  1I50 J;  1ZRE A;  1V5V A;  5F4M A;  1T39 A;  1QZE A;  1KU7 A;  5J3O A;  2FD5 A;  1POG A;  3BY6 A;  2V1N A;  4W8R A;  5DUK A;  4OMY A;  2LKS A;  4PCQ A;  1R5O A;  3GQB A;  4L9T A;  5IY5 H;  2VJ4 A;  3LST A;  1SAX A;  3MKL A;  3ZMU A;  3I53 A;  1WH5 A;  3CUQ A;  2L7Z A;  3ESW B;  5E3O A;  3CMA B;  2NT6 A;  2W1O A;  2HWV A;  4BNC A;  2PYG A;  2XKP A;  1FOK A;  4Z4R A;  1S9H A;  4XMY A;  1E3X A;  2HQN A;  1OB5 A;  2BN4 A;  3ZP5 A;  2FBI A;  3BQZ A;  3OYD A;  1K4T A;  2ETH A;  2JSP A;  3AG3 H;  3S1M J;  1OFL A;  4YFO A;  4BPR A;  4XK4 A;  1G59 A;  1NB9 A;  2BBY A;  2V6C A;  3CQZ J;  4BQA A;  3F8B A;  1OFE A;  4XRS A;  4XRM A;  1SFE A;  4H0E A;  4U0W A;  2OZ6 A;  3FDY A;  5HS7 A;  4WWC A;  3LQQ A;  1LE8 A;  4PMH A;  2VC0 A;  1LNW A;  2V7F A;  2WAD A;  1WP6 A;  1COW A;  2VFM A;  3FWE A;  3PUN A;  3BJ6 A;  4P6V F;  4QPO A;  3I3L A;  2V7Q A;  2WBM A;  1IA5 A;  1K9M D;  1AWC A;  1GUU A;  2GWR A;  1UB9 A;  5JI6 A;  3WGI A;  1GVJ A;  3E1S A;  4I98 B;  4RMN A;  2EZI A;  1MRZ A;  1XQB A;  2O03 A;  1BIA A;  1OQY A;  3ZGK A;  2NS8 A;  3PNT A;  4P12 A;  4HQE A;  4QFM A;  5F4O A;  2E7X A;  2A07 F;  3VMV A;  3CLO A;  1FPQ A;  1PVE A;  3VFZ A;  1YG2 A;  4UVC A;  3KP6 A;  3RKQ A;  5D5X B;  1U5T B;  4ZH4 F;  4RB1 A;  1VQL I;  2DA6 A;  2Z33 A;  1X58 A;  3FPP A;  5D8L B;  2ZZF A;  3QFS A;  2EIL H;  1O8F A;  1QRC A;  1H8A C;  1SKY B;  3NWT A;  2WY8 Q;  2QVO A;  5F6F A;  1UHM A;  4XR6 A;  3H9J A;  5LEK A;  2GM4 A;  5F0H A;  1XGO A;  3LSM A;  2W82 A;  2QDX A;  2BV3 A;  2M1B A;  2JPC A;  1G8X A;  1BI2 A;  4X1E A;  1JJ8 C;  2Q6K A;  4ENJ A;  4BHC A;  3P4G A;  1A31 A;  1TUI A;  2Q6O A;  2LOO A;  4RGR A;  2RQQ A;  3VMF A;  3EQO A;  4CCO A;  1XN7 A;  2GXA A;  2WZP P;  1Y8R B;  3JAM K;  2B7C A;  2EPF A;  2L4A A;  4M4S A;  2ODL A;  4M6V A;  5HLG A;  1YX5 A;  3H1C A;  4XLN F;  3UNG C;  2F4M B;  4HNU A;  1HC8 A;  2K27 A;  2H27 A;  3HRS A;  1W9X A;  3Q38 A;  2M5W A;  1Z7L A;  3B6A A;  2KDZ A;  3LQR A;  5E20 A;  1MSF C;  4X7E A;  5FKM A;  1MD0 A;  4Y4R A;  2H8W A;  3IWZ A;  1D2E A;  1R6R A;  4DW6 A;  1RZ4 A;  5CVU A;  2KRH A;  1P2F A;  4XIC A;  1XSV A;  4IEJ A;  3SJZ A;  1IDY A;  1TQI A;  2HYJ A;  3K2Z A;  4IPA A;  3WTZ A;  3I59 A;  3CCQ I;  2VON A;  3TO7 A;  5CJ9 A;  5HNH A;  4MO7 A;  5DCF A;  2VQL A;  1WTH D;  2PG4 A;  1ZGJ A;  2VQG A;  1LUJ B;  4O5V A;  4KMF A;  4HEA 2;  1S3J A;  2ZL5 A;  3A01 B;  4BE0 A;  1U78 A;  3ASQ A;  1FBS A;  2DYI A;  3DLA A;  4KIF A;  2XPU A;  4HNT A;  4C2T A;  3DV8 A;  2G0E A;  3B90 A;  4XON A;  1BM9 A;  2XTY A;  2IA0 A;  4I02 A;  1Q81 D;  2TCT A;  3FKJ A;  4PJM A;  2OTJ I;  2WY7 Q;  1KZH A;  2F1M A;  3OIP A;  3R0A A;  2PYH A;  5BS6 A;  2O5R A;  5H20 A;  1SVO A;  1HG8 A;  3R60 A;  3HM5 A;  3MEX A;  3W6J B;  4DK1 A;  2DO7 A;  2CQX A;  4GRI A;  1G2H A;  3RKY A;  1YJ9 B;  1ZQ3 P;  1S5L C;  1WSU A;  1R58 A;  1FND A;  4CCM A;  1ETK A;  3Q6Q A;  3AVW A;  3HL2 A;  4C2M J;  2HOE A;  1MMN A;  3JTG A;  1BC8 C;  1DGW Y;  2B7E A;  3HRM A;  3WHC A;  4MNU A;  2EWE A;  3AG4 H;  4RAZ A;  1IGN A;  3HOZ J;  2OBT A;  3JU4 A;  2FBH A;  1BHE A;  4AUX A;  1VQ5 I;  1KGS A;  2FA5 A;  2N8G A;  2O7O A;  5CVV A;  5F1R A;  3EUK L;  4GYG A;  5GPC A;  1PJ5 A;  1ULY A;  2D3L A;  3G6E B;  3AL0 C;  2IGM A;  4HQM A;  4M73 A;  2O61 A;  3OFN A;  1X1B A;  4B4C A;  4BHP A;  1E43 A;  1GQ8 A;  1V0F A;  2C78 A;  5KW9 A;  3AVY A;  4TMX A;  1B6A A;  4IHV A;  2LNB A;  4G9Y A;  5H5J A;  3BTL A;  1WHU A;  1F60 A;  4UZU A;  1BOB A;  3BZK A;  3BCF A;  5F0C A;  2BGC A;  2R7Q A;  4YAW A;  1TLH B;  3QPH A;  2GAU A;  3FKS A;  5LGU A;  2R5Y B;  5LBQ A;  1WZ2 A;  2XC1 A;  1YX3 A;  3I56 I;  4BXF A;  3J7A O;  1D8J A;  2OBP A;  2DBB A;  4ZGN B;  1UHW A;  3EYY A;  4CHU A;  2IBD A;  2VT3 A;  2QE7 A;  2IA1 A;  4DIQ A;  2AHO A;  2NTQ A;  2XGD A;  2Z3Y A;  4U0Y A;  1S6L A;  4LLN A;  1KCC A;  2M34 A;  2UVE A;  1IAW A;  3TW7 A;  3ZZ0 A;  4OZZ A;  3MFK A;  3H0G J;  2IRF G;  1DQU A;  2X1C A;  1BW6 A;  2CC2 A;  5LRR A;  3EDP A;  1IB4 A;  4FX0 A;  3VO1 A;  5IYW A;  1IV8 A;  1SMT A;  2O6W A;  2ID6 A;  3F3X A;  2QKM B;  4YFN F;  4LFU A;  4A3J J;  3HKZ A;  3CME B;  1QA1 A;  1UZC A;  1MW7 A;  4FIS A;  3OJX A;  3WBK A;  4JYK A;  2HFH A;  2DER A;  4R79 A;  3BNW A;  1R5N A;  1K5C A;  3HBL A;  3DEW A;  3WE3 A;  1T5E A;  2OBS A;  1ZEL A;  4DK0 A;  1R1T A;  1R5H A;  3CC4 I;  1B1B A;  1MBE A;  1UD5 A;  3PUM A;  5JLX A;  3TQN A;  3CCR I;  1YIJ B;  3BC8 A;  1RRJ A;  4OOS A;  3VSL A;  3PSI A;  1ZG3 A;  4Z4Z A;  3QU3 A;  4E4H A;  2GOX B;  2CV0 A;  3CO6 C;  3LVB A;  1B23 P;  1KU3 A;  3I9V 2;  1NHA A;  4IQJ A;  2OF7 A;  3IH4 A;  3ZZT A;  2E34 A;  2CW8 A;  1WI3 A;  2GBY A;  1V54 H;  3SDG A;  3DF8 A;  2ZZE A;  3KYL A;  1KA8 A;  2ZBK A;  1TVC A;  5ICE A;  3QFR A;  2VBE A;  3JUR A;  3HTS B;  1FIA A;  2DAO A;  2M4G A;  1WU8 A;  1Z6T A;  3G1O A;  3L2Q A;  4BKX A;  3J7A Y;  4KKS A;  4RD0 A;  2G9W A;  5E6T A;  4HNV A;  1QQI A;  4J01 A;  2QKL B;  2R7S A;  4FTH A;  2QYU A;  2ISY A;  1S7A A;  2JUG A;  4B4D A;  5D4S A;  1STZ A;  3ES9 A;  2HQR A;  3AL0 B;  3BG7 A;  3BWG A;  2OTL I;  3VMW A;  3PIO F;  1H9T A;  2YPR A;  4MIM A;  1ENH A;  1QPI A;  1KRH A;  4E6K G;  4OPO A;  2JN6 A;  3O2P E;  2LKX A;  1K78 A;  2XDV A;  5KAI C;  2OUM A;  3TDZ C;  5EJC A;  1A36 A;  4BJT A;  2HKX A;  2KFD A;  4CO8 A;  3L2U A;  2GIV A;  2HXO A;  4HA8 A;  2WZN A;  2OV7 A;  1PUF B;  2K4J A;  4MTD A;  2DA5 A;  2Y48 A;  2XZP A;  1CLW A;  1SVM A;  1CGP A;  2BM1 A;  4A2U A;  4OJP A;  4XSZ F;  2Z99 A;  3IKT A;  5IYN A;  3F8F A;  3KLO A;  2LTP A;  4O3M A;  4IHX A;  1NG7 A;  2P7C B;  4G1V A;  1BI3 A;  3TBI A;  1GV2 A;  4YXW A;  3RIQ A;  3BY1 A;  3ECH A;  4I0B A;  3OEH A;  2H09 A;  4NQW A;  5DV5 A;  4N3G A;  2F48 A;  1QA2 A;  4CZZ A;  4Z4S A;  2GJK A;  3AG1 H;  4YZX A;  1RKT A;  1LFP A;  4NC7 A;  3OE7 A;  3WTW C;  3EUA A;  2YX4 A;  1IDK A;  3VSU A;  1TTY A;  1HW1 A;  5IK2 A;  1NTC A;  2VFP A;  4JX4 A;  4TMW A;  4WZT A;  2KRC A;  4LB5 A;  4FE4 A;  5IYR A;  5FKO A;  4IVN A;  4MQV A;  1IN6 A;  1D1B A;  2P4W A;  3CJT B;  1J9Z A;  3OR1 C;  3V7A A;  3DEE A;  3LFK A;  3MKY B;  2KVO A;  2W7Z A;  1WWX A;  3CCY A;  2NRA C;  1UCR A;  1QFZ A;  4OJ6 A;  1EP1 B;  1OIS A;  2F6C A;  5AON A;  2CU7 A;  4Y9U A;  3CCV B;  1QA6 A;  1OYW A;  3BR6 A;  3P9K A;  5LHG A;  3OZV A;  1XPX A;  3EUH A;  4F55 A;  2C5B A;  1EH8 A;  2DK5 A;  4DYQ A;  5FLX K;  3ZRG A;  5LHH A;  2OK7 A;  3ECO A;  3DKY A;  4KIC A;  3A2K A;  4GGG A;  1V4R A;  3ZQL A;  1FX7 A;  4RD3 A;  3IRQ A;  1IB0 A;  1QVU A;  4HLY A;  1G7T A;  3A35 A;  1L1I A;  5J47 A;  3W5V A;  3W2A A;  1HW5 A;  2BW3 B;  3CO7 C;  3LSJ A;  2DPD A;  4E70 A;  1Y0N A;  3BTC A;  3K9T A;  2QYO A;  3MMP A;  3C1D A;  4CCK A;  2YWF A;  1PLU A;  3OSG A;  3ZMS A;  2JSC A;  2L7F P;  3BG5 A;  2V1U A;  2R93 J;  1RNL A;  2BF4 A;  2RDP A;  4ZCI A;  3HOW J;  1Y1V J;  1UD3 A;  3F6O A;  2JA5 J;  1ETO A;  1TWG J;  3SEQ A;  2QSH X;  4ZV4 A;  3H3V K;  4A3I J;  1XMA A;  2VBU A;  1WJE A;  3VYU B;  3F22 A;  3ONY A;  5IYD J;  5K7F A;  2X0K A;  4Y7C A;  3BQY A;  5DSZ A;  2V7V A;  3GVA A;  1T98 A;  1Y39 A;  4LB6 B;  4ZYD A;  4EH1 A;  3V8J A;  1DG1 G;  5DYM A;  2RVC A;  1F4K A;  1U5T C;  2OQR A;  3A0B C;  2LVS A;  1R1U A;  2FQ3 A;  3CC2 B;  1ZGA A;  4HLX A;  4EQQ A;  2CRV A;  2O17 A;  1O7L A;  1MMG A;  2ME0 A;  1R36 A;  3DFG A;  2B0L A;  2PMZ A;  2R7O A;  3DU5 A;  1SAU A;  1N06 A;  2Q8K A;  2HDC A;  3K4M A;  4KH3 A;  3LAJ A;  2ZTN A;  2KPM A;  2Q2E A;  4CCN A;  1T6X A;  3FXR A;  1AIR A;  2LG4 A;  3TGN A;  4CIC A;  1F9N A;  2OQG A;  2XB0 X;  4KN7 X;  3ZQC A;  2A68 F;  3GTJ J;  3G71 I;  5B6I A;  1BJA A;  1ON2 A;  3CRZ A;  1E63 A;  3TW6 A;  4F3Q A;  5C4X J;  3DPT A;  3OEE A;  1OOC A;  5B1B H;  1RR8 C;  3ZPL A;  3MVP A;  3IC7 A;  4HIZ A;  5JLW A;  1LKX A;  4RAY A;  3SHF A;  3M9A A;  1ZM9 A;  4ZDO A;  4F7Z A;  2XSJ C;  2F5D A;  4M6Y A;  3KZI C;  1JT0 A;  4CGZ A;  2UWM A;  5FIU A;  4AIH A;  2A6T A;  4F93 B;  1OFM A;  2VBZ A;  3LFU A;  3U9G A;  3L2V A;  2MC3 A;  1WOP A;  3DP7 A;  2BXY A;  5F27 A;  2INU A;  3JRG A;  2BHY A;  4BUP A;  4WWV A;  4G12 A;  2XVC A;  1KCD A;  1J7K A;  1Z3Y A;  3QYE A;  3TMO A;  3UKG A;  1MBJ A;  3JRA A;  1TNT A;  4F52 A;  3M4O J;  3DBR B;  3KP4 A;  4RAG A;  4HE6 A;  1DAR A;  4MEY F;  1Z1D A;  2OAZ A;  3GQ7 A;  2EB7 A;  4PZJ A;  5LEJ A;  1PUF A;  1YJ9 I;  2Y31 A;  2CUJ A;  3DU6 A;  1U8B A;  2IS4 A;  2J5O A;  4Y15 A;  2XGE A;  4PUS A;  1CQX A;  4TN1 A;  3B02 A;  1EA0 A;  3N6Z A;  4BY7 J;  1PJR A;  3CUQ C;  5TGT A;  5L3C A;  5EZH A;  3PFI A;  3ZQ7 A;  4NUB A;  1SM4 A;  1VF7 A;  4JX5 A;  2FF4 A;  4L9V A;  3W5U A;  3KZZ A;  3HTU A;  1U3E M;  3V4G A;  1VQ4 I;  1O7F A;  1KU9 A;  2LR8 A;  4FN5 A;  3R61 A;  5IYP A;  4QWQ A;  1NJI D;  3AVX A;  1E3Z A;  5HXB A;  2NYX A;  1LDJ A;  3LMM A;  4LIT A;  2QGG A;  4RS8 A;  3SZT A;  1HA8 A;  4KKU A;  2R92 J;  4TMT A;  3ZR8 X;  4L5I A;  1EWY A;  1ZRC A;  4RB0 A;  3JRH A;  3ZMD A;  2X51 A;  3DPL C;  4YG2 F;  2L7M P;  1YRN B;  4CSW A;  4M3D A;  1EXM A;  3SEJ A;  1U2W A;  2WB1 A;  2PLF A;  3MHP A;  2UV1 A;  1JI8 A;  1KU2 A;  1JGG A;  2EFN A;  4BS9 A;  5FJ8 J;  4KA4 A;  4ZDP A;  2LDU A;  1FOX A;  1IUY A;  5E79 C;  3CB4 A;  4X06 A;  2R7W A;  3I4P A;  5DD4 A;  1EJ9 A;  2KKO A;  4XNF A;  3IH2 A;  5A8A A;  4EMS A;  2NS0 A;  2KIU A;  4MFD A;  3HGG A;  3OS2 A;  1QH0 A;  2EWN A;  4XM3 A;  1PDN C;  3AST A;  1VBL A;  4W8S A;  1FYK A;  2GLO A;  1SD5 A;  1D5V A;  4WZK A;  3CCM B;  1O8D A;  3ZN0 A;  5FL7 A;  3S17 J;  3FXU A;  2P5V A;  5DCM A;  2F2E A;  2OK8 A;  2IQ7 A;  4PSW A;  5CPR B;  1X3Z B;  1VQ7 B;  4U9U A;  4RLZ A;  4U87 A;  4G7O F;  2HLD A;  4EGY A;  3G73 A;  5J1U A;  5DNS A;  1TW3 A;  1YYV A;  4XLA A;  1JKP C;  1WOO A;  3U6K A;  3KZY A;  1EA3 A;  2YWE A;  3P5J A;  3VDX A;  1YX2 A;  5F4J A;  1OCO H;  2O9L A;  4E0F A;  2CSO A;  3WG7 H;  2QSF X;  1I1G A;  1KQ9 A;  3I5U A;  1OR7 C;  1W34 A;  2H6B A;  2C4U A;  3BRO A;  2L0K A;  2LY9 A;  1NHC A;  2RGV A;  2YS9 A;  3ZQH A;  4PGO A;  3VO2 A;  2XZL A;  1DGR M;  2AXL A;  2X0L A;  4ZGQ B;  3CCS B;  1YLF A;  1IJW C;  2HMA A;  4PC2 A;  3ZIA A;  1YJN I;  4M71 A;  1KZL A;  5AN9 A;  1BIB A;  2IJL A;  3GF2 A;  2IVM A;  1SFK A;  3LSP A;  1RET A;  4N9H A;  2JJ1 A;  4UZE A;  2COB A;  1GDT A;  2VNK A;  1OGI A;  3LAP A;  3B8H A;  2VKD A;  3K70 D;  1UMK A;  5HDK A;  3H36 A;  2IW5 A;  2Y0M A;  1BI0 A;  5AIP A;  2D5V A;  4HRI A;  5FLV A;  1JA0 A;  3ZUG A;  5HZA A;  1RWR A;  3PSS A;  3H3U A;  3TL4 X;  2OCC H;  2Z2S B;  5EGO A;  3OYF A;  2XOK A;  2DFI A;  3GVK A;  4QVJ A;  1QJV A;  3JRI A;  1DUX C;  2L01 A;  3G1L A;  2D9R A;  4Z4W A;  3MWM A;  4DZJ A;  1VTN C;  4X6A J;  4E7S A;  1LFB A;  1K8A D;  2L02 A;  2XHK A;  6PAX A;  3SZE A;  1G3S A;  5BPI A;  1N75 A;  5CVI A;  2M45 A;  5D4R A;  1E64 A;  3S32 A;  3T0Y A;  5IYQ A;  2HNH A;  2XTX A;  1MSE C;  3PUF A;  3F23 A;  2E60 A;  1YW8 A;  4RB2 C;  4FE7 A;  3GTL J;  4IHT A;  1XGM A;  4ENK A;  4CXF A;  2VXZ A;  2BM6 A;  5JBQ A;  3PNV A;  4W8T A;  1GO2 A;  1JKO C;  2A6H F;  2KJB A;  2YU3 A;  1Y6I A;  2J8K A;  2HDN B;  2HQA A;  1RI7 A;  5FKK A;  3J81 Z;  4PGH A;  2V9K A;  5HVQ C;  2IGO A;  4LLG F;  3OZW A;  1TT5 B;  5LD2 C;  4EJO A;  2XF6 A;  3DLL F;  1JKR C;  1DPU A;  2HR3 A;  1TBX A;  2DU9 A;  4NK6 A;  2VL8 A;  4HV5 A;  3K1P A;  4UVA A;  1OJL A;  2VYQ A;  4ROX A;  3BTJ A;  2PMH A;  4YEI A;  3KRG A;  3WTT C;  5HKK A;  2I10 A;  3TED A;  5TV2 A;  3O8H A;  2ZME B;  3OSF A;  1B72 A;  3I4M J;  5EGO B;  2WC2 A;  4YEL A;  2BY3 A;  3HUG A;  5F08 A;  4IOC F;  1YS7 A;  4ASN A;  2W84 A;  2DMP A;  2W00 A;  3DBL B;  4A6D A;  3EQN A;  2CWE A;  2MG4 A;  2QZ8 A;  4A5N A;  4IJA A;  3CPW B;  2KLO A;  1EP3 B;  1DBO A;  3LSR A;  1CF7 A;  1YO5 C;  3AVV A;  3OWT A;  2V9V A;  5BMZ A;  4X8I A;  1IN7 A;  2L4M A;  2X6O A;  3OOP A;  4WK8 F;  1R1V A;  2BHZ A;  2ELJ A;  4ZYE A;  3OAA A;  4RDL A;  1O8L A;  2VFO A;  2P3M A;  3JSO A;  5FFX A;  1T95 A;  2JA2 A;  4LD5 A;  1H88 C;  1SC7 A;  2D45 A;  3OW7 A;  4CYC A;  3BCB A;  3H3Z A;  2DET A;  3DU1 X;  5J3L A;  4G7H F;  1EFC A;  3RI4 A;  3WE2 A;  1UEL B;  4YAO A;  1W2B B;  2JA6 J;  2DA1 A;  1Q9S A;  4J19 A;  1IV6 A;  3DTK A;  2M0M A;  5IPA A;  1W87 A;  4EAT A;  3M8F A;  4AVZ A;  2BY1 A;  3L7W A;  4GXO A;  3CCJ I;  2PJR A;  3REO A;  1KQS B;  2LY1 A;  3K6G A;  5EEG A;  2P81 A;  2X53 S;  3CLQ A;  5CKT A;  3SJP A;  1NB0 A;  3BQJ A;  1APL C;  1WJC A;  2EZL A;  2CUF A;  2L9R A;  2A5W A;  2BZT A;  4MFE A;  1WGX A;  1VQ8 B;  1YQA A;  3ISX A;  5E1W A;  3MKW B;  3CC4 B;  1ZLK A;  4ZC3 A;  3WGG A;  1BQE A;  5FB2 A;  1YI2 B;  5FRN A;  5L3B A;  1SMY F;  1N07 A;  3FXL A;  3TH0 A;  4KT6 A;  2KP6 A;  3OYA A;  3BZC A;  3QFT A;  4XOP A;  1GVH A;  4XRF A;  1R71 A;  5A2Q Z;  1LQ1 A;  1BOA A;  1O57 A;  1PYV A;  3G71 B;  2EIN H;  5E8I A;  1VHO A;  3KP3 A;  1DU6 A;  4HX8 A;  2HVQ A;  3PUB A;  3M07 A;  2L5Q A;  5ILS A;  2HDD A;  2HS5 A;  4P1V A;  2VT2 A;  2XTW A;  5EG0 B;  3QOD A;  1Y56 A;  2XF7 A;  2NST A;  1FX0 A;  3JRC A;  1QUF A;  3M8J A;  4KKT A;  3CCJ B;  2E2H J;  2W48 A;  3TOA A;  3G4S I;  1LEB A;  4C3I J;  1QUE A;  4FT8 A;  3BR5 A;  4JQF A;  4P25 A;  1Z67 A;  4A3C J;  1JJ2 B;  2EIJ H;  1H42 A;  3SLN A;  4LC0 A;  1OFC X;  1LVA A;  2XKO A;  4WXH A;  2NOG A;  2JIZ A;  3LL7 A;  4QHY A;  2ZSI B;  1IO2 A;  1FMV A;  1UJ8 A;  1TZL A;  4K2E A;  1FSH A;  4P5O A;  4BQO A;  3D1N I;  4Q4Z F;  4YFX F;  1FTT A;  3OS1 A;  2EFW A;  2F1L A;  1FP2 A;  3PL8 A;  5GP9 A;  1QBJ A;  4X05 A;  2DT7 B;  3CCL B;  5CVJ A;  3LMW A;  1ETY A;  4XOT A;  1BN5 A;  4AF7 A;  3IAS 2;  2LRE A;  4BDZ A;  1TWC J;  1N0V C;  3ZBT A;  1ZG1 A;  1OGO X;  1W36 C;  2R0Q C;  5BOX A;  1HXD A;  2GQQ A;  2PMD A;  3K4J A;  1I8D A;  1FBU A;  2B5O A;  5C1C A;  4RD2 A;  2BGJ A;  2L2O A;  2DK8 A;  2FX0 A;  3W2I A;  3CCM I;  3W2F A;  1NH3 A;  1HA3 A;  1MIJ A;  5D5V B;  5CQE A;  4HX7 A;  5JLV C;  2CQ7 A;  4EJW A;  3CCE I;  5F1J A;  1FYL A;  2AS5 F;  2R7Z J;  4XL9 A;  3LNQ A;  2ZL6 A;  2VJ5 A;  3WU2 C;  1Q1V A;  2M7A A;  3OYM A;  2RNJ A;  1MGT A;  3L2W A;  1K8F A;  1TYX A;  1QA3 A;  3ZQQ A;  2DOD A;  2WWY A;  5E18 F;  2BM7 A;  2V7X A;  1X1C A;  2R5Z A;  4OPS A;  2CRG A;  1YJW I;  3GTP J;  1WFX A;  5J1R A;  2VBM A;  2VC1 A;  1YJN B;  2GZW A;  1WMR A;  5FFZ A;  4AWX B;  1V5G A;  2RKH A;  4Z6Y A;  3NAR A;  3ISP A;  4PFP A;  3OYJ A;  4KIG A;  2EJR A;  1WPC A;  2Z6B D;  1UD6 A;  4XKB A;  4CA0 A;  1NRK A;  3AGQ A;  4AYB A;  1VQN I;  4ZYA A;  5GAH J;  1V0E A;  3KP2 A;  2GK7 A;  4UAJ A;  2WPD A;  1LPQ A;  3V7S A;  2ZXH A;  4URR A;  1FLI A;  1G7S A;  1H8E A;  3I4N J;  2Y9Z A;  2R7D A;  1BW5 A;  4HF2 A;  2DQL A;  4Y52 J;  1YIT B;  5FKL A;  2E5N A;  1LLZ A;  4XID A;  4RBO A;  1W5T A;  2NS7 A;  2GJP A;  3H94 A;  3SKB A;  1T0F C;  4DNC A;  3M1E A;  2JZY A;  3ZOB A;  1EE6 A;  4UHT A;  3R0J A;  3WTU C;  3FHZ A;  1JGS A;  2E1M B;  4LK0 F;  2QMU A;  3LSH A;  3A1P A;  1E79 A;  2JJ2 A;  3RSN A;  1U8R A;  4MYU A;  1N78 A;  3F6V A;  1MBG A;  4AID A;  3C2G A;  3CCR B;  4I01 A;  5DS0 A;  3DEU A;  1AIP A;  2DW4 A;  2ZTG A;  4JX6 A;  4M2L A;  4RD4 A;  1SD7 A;  2XGX A;  4Z2Y A;  3GX4 X;  3VEP A;  2L54 A;  2FJ1 A;  1X19 A;  2EH3 A;  2HDW A;  2K9L A;  2VI6 A;  2J7K A;  4MR0 A;  2C4T A;  1SAN A;  3TOB A;  5FO5 A;  4IKF A;  3OPO A;  5HDN A;  2WR8 A;  2HPI A;  2ZXW H;  1I39 A;  4LG0 A;  2H1K A;  1X3W B;  4UB8 C;  4OIR F;  3TDU C;  3LQE A;  3CJQ B;  1RPW A;  2JQ7 A;  4NK8 A;  1BPL A;  5EMN A;  2W25 A;  5KAF C;  4ENN A;  4RGX A;  1FMW A;  3VB2 A;  1IJE A;  5HS9 A;  2DMN A;  5ERI A;  2GRE A;  2HCJ B;  2OD5 A;  1KYZ A;  1FNM A;  2O1D A;  3E6D A;  3SQN A;  3W2E A;  4XLF A;  4TV7 A;  3CCU B;  4CCJ A;  1YRN A;  2DT6 A;  3GEZ A;  2BX6 A;  1K79 A;  2M4K A;  1TW2 A;  3OYE A;  1JT6 A;  3B82 A;  3PA2 A;  4PJN A;  2K5C A;  1I27 A;  3HPG A;  3OYL A;  2XB5 A;  4RGU A;  1QGY A;  1X1D A;  3K1M A;  5J8F A;  2W6J A;  5M5W J;  3G05 A;  1VQ9 B;  1RU4 A;  3OYC A;  4BXX J;  2LF8 A;  3GZN B;  4NBS A;  2R5Z B;  3CDL A;  2GJR A;  4QSH A;  5K5R A;  1IXS B;  1YIJ I;  2EA4 A;  3GQ9 A;  1MMS A;  2FEZ A;  3ONU A;  1BJK A;  2G7U A;  1U2R A;  2JRT A;  1UMQ A;  1KON A;  2HXI A;  2XIG A;  1LFU P;  1MBK A;  2VBX A;  3SLD A;  5EG0 A;  2NTB A;  1KTV A;  1T6S A;  3JTH A;  3WOD F;  1GLN A;  3GCM A;  2BY2 A;  1SFX A;  1T08 B;  1CNF A;  3A8I A;  3BH6 B;  1I3Q J;  5FRO A;  1K83 J;  5HDG A;  2DTR A;  1IDJ A;  2KIM A;  3BCD A;  3HOV J;  1MBH A;  1VQK I;  2V1X A;  1JJ6 C;  1FSE A;  5F0F A;  4OIO F;  2VBV A;  5C3E J;  1R5G A;  3GZ5 A;  2L9S A;  2VIX A;  4LK1 F;  1FBQ A;  2W57 A;  1MDM A;  3DWL E;  2CMP A;  3S16 J;  3E0J B;  2VJJ A;  4HAM A;  1XC5 A;  1R5I D;  1W7P D;  2Y75 A;  4U0V A;  1WJA A;  4WX9 A;  3T56 B;  1Y8Q B;  2XSD C;  3I1F A;  1O8M A;  3QU6 A;  2IS2 A;  1Z91 A;  1IC8 A;  2JPB A;  2NAZ A;  4B1R A;  1HCR A;  2FE3 A;  3CDH A;  1SD4 A;  1E1R A;  1EP2 B;  2KJC A;  3EPZ A;  1X2M A;  2H6C A;  1J75 A;  2OU2 A;  1EV7 A;  5GV7 A;  1TNS A;  4OJL A;  3FF5 A;  1RES A;  2JWT A;  4JMQ A;  3HOT A;  1E3O C;  4ZJZ A;  2DFH A;  4H4K C;  1OGJ A;  2MH2 A;  4NQW B;  3PVD A;  1Z9C A;  1KK0 A;  1VQ4 B;  1VQK B;  4G6D A;  2KRF A;  1G7R A;  1Y1W J;  4Z4Y A;  2IPQ X;  2MD0 A;  3DBH B;  2DMU A;  4EGZ A;  2ZIT A;  2X3U A;  4P6Y A;  2YWG A;  3OS0 A;  1B9M A;  3CJN A;  1G7C A;  1HBX G;  3S2D J;  2R6H A;  2Q6I A;  5A88 A;  2ZZQ A;  2HPM A;  3KPH A;  3CP8 A;  4P9S A;  1R23 A;  1ERD A;  2A61 A;  1J2X A;  3HYI A;  1SFO J;  1A5J A;  3BJO A;  3AFH A;  5CYV A;  1Y0Y A;  2LLK A;  2I1L A;  4WXD A;  5DD8 A;  3S14 J;  3L00 A;  3CC7 I;  2COM A;  2E2I J;  4U4B A;  1XCV A;  1U9N A;  3BY2 A;  1VQP I;  3ROU A;  3V7R A;  1UD4 A;  3KEY A;  4Y33 A;  4DYR A;  1W0T A;  1MH3 A;  1MNE A;  2WA0 A;  2V1D A;  4NNJ A;  3ZN1 A;  2VBK A;  5ILU A;  3H09 A;  3IWF A;  5K5Q A;  2OCE A;  4A0X A;  4OAZ A;  2HEO A;  1YW9 A;  1JUM A;  2EV0 A;  3E5X A;  3OKX A;  4M0L A;  5J4Y A;  5IP7 J;  1OFD A;  1W0J A;  4IXA A;  1VQM I;  1QRY A;  3FJO A;  2BW3 A;  2XF5 A;  2RC4 A;  3SY2 A;  3X2Q H;  3JQP A;  2BM4 A;  2P8T A;  3MCZ A;  4B3A A;  2R9V A;  2XGC A;  1DAB A;  4HYE A;  1ZM3 A;  1VQ5 B;  2GIZ A;  1JTA A;  5HS8 A;  1B8I B;  2LH9 A;  1NK2 P;  4HBL A;  4AYB N;  1QGA A;  3WNC A;  3W2V A;  4IZZ A;  4OP7 A;  5K7H A;  3HOS A;  1EF4 A;  1JA1 A;  2KIF A;  4AC0 A;  1T56 A;  3TO6 A;  2MA3 A;  3G3Z A;  4LMY A;  2DOF A;  2DY1 A;  2WV0 A;  1P7J A;  4WCG A;  4IOA F;  1FOY A;  1MJ9 A;  2K02 A;  4P3Y A;  1CF7 B;  2XAQ A;  2D2W A;  4ANJ A;  4YRV A;  4U49 A;  2GXG A;  4IRG A;  3ERE D;  4PJL A;  2BGI A;  1VQO B;  4FK8 A;  2H94 A;  1S4M A;  2B0R A;  5H2F C;  4M9S A;  5CQG A;  1ZM2 A;  4ESJ A;  2BXZ A;  1OYI A;  4RM2 A;  4BQQ A;  1A04 A;  4FCY A;  3S3O A;  3HSF A;  3I55 B;  4NHJ A;  1XFO A;  2XNJ A;  1AU7 A;  3IV5 A;  4P3I A;  1MH4 A;  5H6Q A;  1R4N B;  1UAA A;  2IOU G;  4PAA A;  4I7H A;  3GLX A;  4ENM A;  2PLY A;  2A05 A;  4A3E J;  1H89 C;  2DMQ A;  1QG0 A;  2R5Y A;  1KQ8 A;  2BVL A;  2MFZ A;  1YHQ I;  5BSX A;  5H6R A;  2YUH A;  3H5R A;  4PAB A;  2NT9 A;  2DI3 A;  4FXU A;  4P1W A;  3WYA A;  3L2R A;  4UV8 A;  4MYT A;  2R7X A;  5M3M J;  2R7V A;  5L3E A;  2CQK A;  1QVF B;  2NXN B;  4RLF A;  2CV2 A;  1QZY A;  3KLN A;  4EM2 A;  4NBQ A;  1H9G A;  1PJ6 A;  4YZQ A;  1CNE A;  3C2B A;  4LOC A;  3W5H A;  2XAH A;  4ZZD A;  1TTT A;  1G4D A;  5EEH A;  1I7P A;  2R3S A;  2W85 A;  3IRR A;  3HKZ N;  1F1Z A;  1O3Q A;  5L3G A;  1K78 B;  4LBW A;  2VJI A;  5JHU A;  1X1A A;  4RPD A;  3LQ6 A;  3HB9 A;  4FHT A;  4BGD A;  3E1Y E;  3W2H A;  5J6X A;  3T53 B;  2EK5 A;  3Q3S A;  2RC5 A;  2DT5 A;  4HW0 A;  3LO8 A;  3KX2 A;  1O88 A;  4B3G A;  4MTE A;  1D0Y A;  1REP C;  5CDF A;  4W8Q A;  3SFZ A;  2K9M A;  4M3B A;  4CYD A;  3KYC B;  4C2U A;  3ZSC A;  2OPT A;  3S8P A;  3B4N A;  3QSY A;  1TQM A;  1GXQ A;  4UUT A;  3GXO A;  5L3F A;  4MGR A;  3RPQ A;  5LHI A;  4AF6 A;  2V31 A;  1DPR A;  2MLG A;  2BVM A;  2EQR A;  2XV4 S;  3WHB A;  2LC2 A;  2ZFU A;  1P92 A;  3EUH C;  2XND A;  4BHB A;  1DBG A;  3COA C;  4M3E A;  2XZO A;  5GAE J;  1JXS A;  2XRL A;  3Q0U A;  1E2X A;  1S72 B;  1WOS A;  2GA2 A;  2QA4 I;  5AIQ A;  1D0Z A;  4QPQ A;  4TMV A;  4ACB A;  1XG2 A;  3GFI A;  1FEX A;  3B6C A;  1U5T A;  2WV1 A;  3VOE A;  2JVH A;  1LM1 A;  1O3S A;  2ZC2 A;  2ESN A;  2LY2 A;  2ZKZ A;  4B09 A;  4EM0 B;  3GTO J;  4NC6 A;  1R5B A;  2V5I A;  2X48 A;  4A93 J;  1ACI A;  3E7L A;  3MKZ A;  3SYT A;  1A35 A;  2NVQ J;  1QGZ A;  1DP3 A;  4X7D A;  3HC7 A;  1AMO A;  2XRO A;  3L2C A;  4B48 A;  2DYR H;  2E7W A;  2F3L A;  4I84 A;  1LJ9 A;  4BAC A;  1ZYR F;  2QUF A;  2JA8 J;  4P2N A;  2PIA A;  5DS9 A;  3ABT A;  3G1M A;  1N0U A;  1ETQ A;  1ZR4 A;  1FC3 A;  3BOQ A;  4B3X A;  3OL3 A;  4L5E A;  1G3W A;  3TKY A;  2DOE A;  2QSG X;  5DCM B;  3HJE A;  2E35 A;  2QWW A;  1ETV A;  3Q9S A;  3HOX J;  1VQ6 I;  2DA2 A;  1V5F A;  2KZG A;  2UXX A;  2UZK A;  4E7J A;  2LP0 A;  1OKR A;  4E7I A;  2HGC A;  5GPA A;  2X6X A;  3QFC A;  1LB2 A;  2XT2 A;  2C5H A;  1KJZ A;  4G7X A;  2JRM A;  1V5E A;  2LFB A;  2ZXJ A;  2QGU A;  1FTZ A;  4C30 A;  2ADU A;  1OYY A;  1ZN2 A;  2ICW G;  2M7B A;  3VYR B;  3DTI A;  2M87 A;  3PQK A;  2V6E A;  3HOY J;  4OIQ F;  1F43 A;  4KYW A;  1FWZ A;  2Z8G A;  4L5J A;  1TYW A;  2Z16 A;  4D5F A;  3JAM Z;  2E2J J;  3RTR A;  3FK7 A;  1L3L A;  2QF7 A;  2WSS A;  2NV4 A;  5FD5 A;  3KYD B;  1BN8 A;  3CUQ B;  3CP2 A;  4A5M A;  3NE5 B;  3FX3 A;  1VQO I;  1XGN A;  2VAS A;  1WXR A;  2X1D A;  3L09 A;  3KP5 A;  5KK1 A;  3HG9 A;  2GXB A;  5JFR A;  4LGW A;  2HU9 A;  1Q1H A;  2EIM H;  1OB0 A;  3T8T A;  2ZZG A;  2M3A A;  2CFX A;  1T8I A;  2KMU A;  3GLL A;  2QEX B;  1OB2 A;  5M5X J;  4FWT A;  1VQ6 B;  3PSF A;  4YAU A;  1WPK A;  4OOV A;  1VF9 A;  5J40 A;  4A12 A;  3KP7 A;  3FM3 A;  1Z6R A;  5E1X A;  4DJA A;  1E1Q A;  4YZA A;  3CDI A;  2BPO A;  4HF0 A;  1IZ1 A;  4O6J A;  1MDM B;  3CPX A;  2FNP A;  1IUF A;  2K86 A;  3SUC A;  2YR2 A;  3LA2 A;  5DN6 A;  3GFM A;  1RR7 A;  4E7H A;  3D0S A;  4S0H B;  4LIV A;  4GYI A;  4P9U A;  2ZXI A;  2GPJ A;  2JT1 A;  2RAE A;  1BR4 A;  2K3P A;  2RNG A;  1I5Z A;  3BPV A;  3CF2 A;  1R9T J;  2YX7 A;  2CGP A;  1J09 A;  1DDN A;  2I8D A;  1O8J A;  3D5R C;  3QAH A;  1VND A;  5IT9 Z;  3FHN A;  3QOP A;  3PO3 J;  2W24 A;  3OZU A;  2MLK A;  3H0D A;  3NB2 A;  4Z03 A;  4BE2 A;  4UUV A;  1X4O A;  2VXD A;  4BH9 A;  3OY9 A;  2BSA A;  3ZMT A;  1TSP A;  1Z7U A;  1Q7Y D;  2DJN A;  4RDJ A;  1GVD A;  4XLH A;  4OOX A;  2FRH A;  2DCU A;  3ZC3 A;  1O8E A;  4DQL A;  1UD8 A;  5H59 A;  2ECB A;  3IP4 B;  2O0Y A;  3K4C A;  2D74 A;  2D1V A;  2EFP A;  2EZK A;  4L0Y B;  2CBX A;  5IT9 K;  1RC9 A;  2NTP A;  4XQF A;  3CMA I;  2WYR A;  3S15 J;  3M1C A;  1JRG A;  2CW5 A;  1XTA A;  2YUS A;  4B44 A;  1D1A A;  3ERM A;  4XBF A;  2MSY A;  4C0S A;  2QQ9 A;  1D8T A;  5LGT A;  2Q6L A;  3QPS A;  3HHG A;  1KD1 D;  3D5S C;  2CUE A;  1JTY A;  1D5Y A;  5M3F J;  4KMU X;  1Y0R A;  3CCE B;  3H92 A;  3C18 A;  4D9J A;  3JSP A;  2B63 J;  1Z05 A;  4HOB A;  3L1P A;  1T0F A;  2DN0 A;  2VE8 A;  1E17 A;  1A8P A;  1PJ7 A;  2CK3 A;  3HRU A;  3RIR A;  4MEX F;  5E17 F;  4PC1 A;  2ECC A;  2DCE A;  1X4P A;  4JP0 A;  3RZD J;  4BY1 J;  2JK3 A;  1LVK A;  1BC7 C;  4UXN A;  3OYB A;  3E6C C;  5ICF A;  1W0K A;  2NVU B;  5FRM A;  2UUZ A;  1H8H A;  4PJJ A;  1F5T A;  2E5Z A;  3FPK A;  4BU2 A;  2B7B A;  1BLI A;  1A6I A;  3ASO H;  4B8X A;  1HVX A;  1MJB A;  2Q1Z B;  1X1P A;  4ESB A;  1IG7 A;  1W35 A;  3H5N A;  2EFO A;  5CVR A;  1I6X A;  2P5K A;  3JR9 A;  2ZJP F;  2ZFW A;  4QLC U;  1WDT A;  2K7L A;  5GAG J;  4N0B A;  2G7H A;  3LSG A;  1N08 A;  4P55 A;  1HSJ A;  2VZL A;  3CUO A;  4CCL A;  4P26 A;  1ZH5 A;  2STT A;  4C43 A;  1P4X A;  3OIO A;  5GAD J;  4BBS J;  3OV8 A;  4XN3 A;  3T8R A;  2X8K A;  3KCC A;  3QYB A;  2NVY J;  1GV5 A;  2YU9 J;  3MAJ A;  3M3Y J;  3RCO A;  1NG6 A;  4EJU A;  2JMW A;  1S7O A;  2OA4 A;  1PUE E;  3U21 A;  2O3F A;  4BL0 B;  1HST A;  4HE5 A;  1MMD A;  3LSK A;  1VZ0 A;  2E1O A;  3P9C A;  1N77 A;  1IRZ A;  1HLV A;  1HDD C;  3VSV A;  1HZE A;  1N05 A;  1T33 A;  4IF4 A;  3QP5 A;  4EM1 A;  3T5X A;  1YE9 A;  1MMA A;  4II2 A;  3WQZ A;  4EEF G;  1FDR A;  3IUO A;  1IN5 A;  2NVX J;  3E5U A;  4PGG A;  4KDP A;  1V3F A;  3BTI A;  5LMZ A;  1VLO A;  5IYB J;  2R4G A;  3MMY B;  2C2W A;  3GWZ A;  1JHH A;  1S7E A;  3HEF A;  1QQ1 A;  5F64 A;  4C9Y A;  3KFW X;  3DPU A;  1P4W A;  4I09 A;  4XKV A;  1VJS A;  3RPU A;  1WSV A;  2QN6 A;  2STW A;  3KL9 A;  5BSY A;  2WB1 N;  3RY8 A;  4XKC A;  4M74 A;  2O8X A;  2O0W A;  4I99 C;  2O8K A;  2BVN A;  2K9S A;  2QQA A;  3A02 A;  3QYF A;  3PM1 A;  2BOL A;  5KVR A;  1RMG A;  1R4M B;  3OYG A;  4NB5 A;  4MLO A;  3LYC A;  1YHQ B;  4MXN A;  1TWA J;  4YIF A;  2FQ4 A;  1G3Y A;  3SZG A;  4Z4V A;  2XNC A;  3VYT B;  3GUD A;  3AVU A;  4DBQ A;  4OPV A;  3M7G A;  3F9K A;  1JUS A;  1WVR A;  1LLW A;  2NOJ B;  3LWF A;  1E0E A;  2OBR A;  4EV0 A;  1VQ7 I;  2JN9 A;  1XS9 A;  5JR3 A;  1PP8 F;  4TSF A;  2CQN A;  2X6W A;  3SQV A;  2HVS A;  5D6F A;  3ABL H;  3CZ6 A;  4LJZ F;  4KT5 C;  3FIW A;  4TT3 A;  1YIO A;  3Q0V A;  2JTV A;  1QHG A;  4NCN A;  3P26 A;  2F4I A;  1P4A A;  1TLL A;  2QTZ A;  3G6E I;  2ME6 A;  5ED4 A;  1YOV B;  3BR3 A;  1R22 A;  5HLH A;  1ZRD A;  1IHM A;  2QTL A;  4LG3 A;  3DDY A;  1KTW A;  1BR1 A;  4L8J A;  2QQ8 A;  3NWS A;  4KIS A;  3J80 Z;  1WCM J;  2BV6 A;  3J7Y J;  3GVJ A;  5HNF A;  1Y0U A;  1WJB A;  2XAG A;  3CD6 I;  3KEW A;  1TT0 A;  1QVG B;  4ZCM A;  4C3J J;  2W7N A;  4OM9 A;  4RGS A;  3OMY A;  3CCL I;  3BR0 A;  2DOG A;  2HI3 A;  4E7K A;  2CW7 A;  2A69 F;  3OOU A;  5ILV A;  3KET A;  3J81 K;  3T1B A;  4Z1M A;  1MAB A;  2BM0 A;  5LFA A;  4B47 A;  4TKO B;  3W3C A;  3VYS B;  4R71 A;  2DOA A;  3O6B B;  3CME I;  5GTI C;  2DFE A;  1E3H A;  1IN4 A;  2ZNY A;  4HSR A;  1ZG5 A;  5F04 A;  1KK3 A;  3VPR A;  1E3P A;  3Q6R A;  5EEA A;  1AA7 A;  1EKE A;  1S72 I;  2E19 A;  3F8N A;  2QY1 A;  2KZV A;  3K69 A;  4KNY A;  3V42 A;  1HKQ A;  4M9Z A;  2ISZ A;  3HOU J;  1FOW A;  5C4J J;  4WQM A;  3JX8 A;  3WTV C;  4UV9 A;  2GK6 A;  4IW3 B;  3L9F A;  3F0C A;  2VBW A;  1M1E B;  2IEK A;  1J0R A;  3ML6 A;  2HOT A;  3UR3 C;  2V7T A;  2RN7 A;  2VB6 A;  4JBA A;  2E1R A;  1MJA A;  1FYM A;  1SVL A;  3DCF A;  3U1K A;  3ASS A;  1QVT A;  1ODD A;  1S29 A;  1UG2 A;  3DXJ F;  4G94 A;  2DIE A;  3WNB A;  3WG9 A;  3WU1 B;  2CF4 A;  4XLE A;  2IGN A;  3CCS I;  3BZ6 A;  2FUG 2;  2QM3 A;  3RQI A;  1QRB A;  4Q47 A;  3LSI A;  3SXY A;  5LGN A;  2J5P A;  2V9P A;  2OJE D;  2VBY A;  4PSX A;  2IP2 A;  4BQN A;  2D1H A;  1W0U A;  1WJF A;  4N4O B;  1ON1 A;  5L46 A;  1VI0 A;  5D5W B;  3BPX A;  4G7Z F;  1SFU A;  2KIS A;  1QX4 A;  3CW2 A;  1T38 A;  2DTZ A;  2XPV A;  3HDD A;  1XMK A;  2QEN A;  1FRQ A;  2L7K A;  2K4B A;  5KNL A;  3V7C A;  1F36 A;  2QA4 B;  2MYS A;  2XGJ A;  5FLM J;  4ITV A;  2Y2Z A;  2M5S A;  5JHF A;  1H85 A;  3FY3 A;  1J5Y A;  5L3D A;  4XLC A;  1P6R A;  2E71 A;  2RRE A;  1AKH A;  1GJR A;  4RA2 A;  5LRS A;  4ESF A;  3A01 A;  4DZP A;  3CC2 I;  3U2R A;  4ETS A;  2AXT C;  1XDS A;  4BEH B;  4M6X A;  1VQ8 I;  1QFY A;  4PJ0 C;  1U0J A;  3HPH A;  3RKW A;  2CYY A;  4D0P A;  3MZH A;  1JB9 A;  2MD5 A;  4IX7 A;  2LD5 A;  4QTR A;  4Y13 A;  3U2Q A;  1WJ5 A;  4RD1 A;  2OYN A;  3FXO A;  2DDB A;  2MW8 A;  4YZ0 A;  4I0A A;  4QIW N;  2DFF A;  2DA7 A;  4GO1 A;  3W6V A;  3PNY A;  5J4V A;  3MN2 A;  2FXA A;  4RPB A;  3ZBU A;  2OC6 A;  1GAQ A;  1ETW A;  3BG9 A;  1O8G A;  2FBK A;  2Q0O A;  3V76 A;  3Q9V A;  4AVP A;  2MH9 A;  4UY8 I;  2LRD A;  1IXR C;  1MND A;  4FAS D;  4A3F J;  4EJV A;  4G6Q A;  1DDI A;  3GTG J;  2RC6 A;  5DTD A;  2XAS A;  4C2L A;  1LDK B;  3BJA A;  3CCV I;  3S3N A;  1JUP A;  2F4O B;  5C44 J;  3S3M A;  1IRX A;  3SZP A;  3SJM A;  4XSX F;  2GA1 A;  3HRT A;  5TRD A;  3RYR A;  3HSR A;  1SD6 A;  4HZF A;  3CCQ B;  1XCB A;  3MCA A;  4WZL A;  3QQA A;  2X1E A;  3Q0W A;  2HOS A;  2BEO A;  1I3A A;  1V55 H;  4L0Z B;  4V02 C;  1RKW A;  3VNV A;  5FA6 A;  4QV2 A;  1Q86 D;  3JRF A;  4BEH A;  2V7W A;  1XGS A;  1X3U A;  3K4N A;  2UXN A;  5IOY A;  2LBF B;  4KN4 X;  2IA2 A;  1M90 D;  3CMY A;  2PN6 A;  4HF1 A;  3WBJ A;  3D5L A;  2JUC A;  4AD9 A;  4XLP F;  3LA7 A;  4F91 B;  4RLQ A;  4I6Z A;  2ZNZ A;  3GQ8 A;  3KE2 A;  5HZB A;  2QQB A;  1K7A A;  2WAQ N;  1EFU A;  3MZ8 A;  1ZR2 A;  2GOM A;  3E6B A;  3RYP A;  2E1C A;  1CZF A;  5BPD A;  4F7D A;  2WJY A;  1OMI A;  2KT0 A;  2XAJ A;  2NNN A;  4EW9 A;  3ASN H;  1RIO H;  4J0Q A;  3GME A;  2K9N A;  2BM5 A;  3FXJ A;  3C7J A;  4YCQ A;  2X6Y A;  2EFQ A;  3F72 A;  3QP6 A;  5E3L A;  4D7N A;  2X9D A;  2PMU A;  1VLY A;  3HAG A;  2FML A;  4HG2 A;  2UVF A;  3F8C A;  1LE8 B;  3E3V A;  4HST A;  1PXZ A;  2WAF A;  2X3H A;  2VN2 A;  2Y69 H;  3HXL A;  2XPW A;  2IAI A;  4XOR A;  2X85 A;  5IP6 A;  1OCP A;  2PEC A;  3HHH A;  4A3B J;  3KEO A;  5E8G A;  1YJW B;  2EIX A;  4WF2 A;  1A6Q A;  5FGM A;  2XEX A;  3ONQ A;  4KIB A;  2Z9O A;  2XAF A;  3WND A;  1OPC A;  1RUN A;  1S8N A;  4N3N A;  4WXC A;  4BYY A;  1MBF A;  3N97 A;  4KJZ A;  2FOW A;  3GRH A;  3RPU D;  3T9G A;  3HIF A;  1XX5 A;  3R6K A;  2PE3 A;  4Z4U A;  4Z06 A;  2IS6 A;  1JNY A;  2P7V B;  3OP1 A;  3G4S B;  2INV A;  1IN8 A;  4A6E A;  5TJJ A;  1W5C C;  2R7R A;  1O8H A;  4YII A;  3S1Q J;  3LA3 A;  4Y3O A;  1W7P A;  2QBY B;  2E36 A;  4DBR A;  4J00 A;  1CQT A;  3AKZ A;  5K7Z A;  1FP1 D;  3PIP F;  4FET A;  2ZJR F;  2DA3 A;  1UD2 A;  2IS1 A;  1K6Y A;  5IP9 J;  1HKT A;  2O04 A;  1XD7 A;  3O3K A;  3IAM 2;  3BH7 B;  2ZME C;  1QFJ A;  3PSZ A;  2MGQ A;  1O3T A;  1PP7 U;  1BMF A;  1L0O C;  3OYK A;  3ELK A;  4FX4 A;  4HV6 A;  2WJV A;  2DJI A;  1R00 A;  2CUZ A;  3CC7 B;  3P7N A;  4Z05 A;  1GR1 A;  1VHE A;  2L9N A;  1DP7 P;  2JA7 J;  3ABM H;  3RQ4 A;  2ZL7 A;  4IO9 F;  1QZZ A;  3Q5F A;  1XB4 A;  3GVL A;  5HOD A;  2DPU A;  4OPW A;  5DUI A;  2ZBV A;  4YDT A;  2DXI A;  1BL0 A;  1Z3X A;  3D26 A;  4YAF A;  2PFB A;  3I58 A;  1QCX A;  3OR2 C;  1XB2 A;  2VNJ A;  2Z5U A;  3BG3 A;  1P4M A;  2E1B A;  1VQN B;  1UG0 A;  3I55 I;  2HQ5 A;  4QVA A;  2FSW A;  2DA4 A;  2Y9Y A;  1PKV A;  1TWH J;  1FT9 A;  2QEX I;  1HW2 A;  1T6Y A;  1YLO A;  5J35 A;  4P96 A;  3F21 A;  4MQ9 F;  1QGP A;  4U88 A;  1PE9 A;  2VKE A;  1J9I A;  3IHU A;  3BT9 A;  3QWL A;  2DMT A;  5FKN A;  2O6G E;  1HKS A;  3VNU A;  4E7L A;  4DNR B;  4Z4T A;  3FK6 A;  4RAF A;  4DGW B;  5CLS A;  4G6I A;  1X2N A;  2VNI A;  3R6S A;  2H1L A;  1ORK A;  3OW2 B;  4RCZ A;  1AOY A;  3IL2 A;  2Q2E B;  4HPQ A;  1ELO A;  2XRN A;  2ZSH B;  1X0C A;  2FNA A;  2I5U A;  4AM3 A;  1KC8 D;  4ACA A;  1K6O A;  1NDH A;  3ZPN A;  3GO5 A;  2LMD A;  2ELH A;  3ABU A;  3K0L A;  4UUS B;  4V2G A;  5EZG A;  4CUG A;  2BMW A;  2KHM A;  1RUO A;  5C1E A;  3FXQ A;  5KSW B;  3GZ6 A;  2RV8 A;  1ITY A;  1AHD P;  1O8K A;  3NAW A;  2ID3 A;  3WY9 A;  1HDP A;  2P6T A;  4JRA C;  3ZZU A;  4JK1 X;  2IT0 A;  1IDZ A;  2QZA A;  3AG2 H;  1HQC A;  1HF2 A;  3JRB A;  3VWB A;  1D3Y A;  3CES A;  4EVI A;  2H8R A;  3IH3 A;  1D1N A;  2LYC A;  2HVR A;  3I64 A;  4DYC A;  1ONV A;  2CFO A;  3OOC A;  1TQP A;  2ZO4 A;  3WU0 A;  3CF5 F;  2GQF A;  4P22 A;  2XT4 A;  2DLL A;  4BDY A;  1QHH D;  3QPT A;  2MBF A;  2HZD A;  5D6E A;  2C77 A;  5TR9 A;  2EIK H;  3EQL F;  3A8J A;  1K73 D;  3ASP A;  4EJT A;  3FXM A;  1BX1 A;  3NAU A;  2LF7 A;  1FIP A;  1DDG A;  1WI9 A;  2F5F A;  2FU4 A;  3QRF F;  2VUM J;  2J8I A;  1W7P B;  2NNY A;  3BR1 A;  2TDX A;  2ZBU A;  3GIR A;  1WJD A;  2V4J C;  3I0T A;  2VFN A;  2A3S A;  2BYV E;  3S93 A;  3BG6 A;  3BLY A;  5ICG A;  1ZM4 A;  1QO0 D;  2F4N A;  2K9Q A;  2CO5 A;  1EH7 A;  2OTJ B;  1P9Q C;  3WTS C;  1SEU A;  2ESH A;  4G7W A;  1I6H J;  4IHW A;  1OLT A;  3H35 A;  2XC7 A;  1JKQ C;  4AIJ A;  3NEU A;  4RDK A;  1KYW A;  2PX9 A;  3K4L A;  5B3S H;  2O0V A;  2QLZ A;  5KCM A;  1DU0 A;  1H80 A;  4BAY A;  4RJL A;  3FKI J;  2A5Y B;  4N4N B;  2L3D A;  5TY0 A;  3FZV A;  5HLT A;  1QU3 A;  2ELK A;  1VQ9 I;  1RQP A;  1W36 D;  4IHS A;  4GCV A;  2V79 A;  2JVG A;  3HUG B;  4IQ4 A;  2B9S A;  2QBY A;  2TRT A;  1FRN A;  4PC6 A;  4YEJ A;  4A3K J;  3W2G A;  3I54 A;  3E97 A;  4I76 A;  3WXM A;  4CH7 A;  5D5U B;  3CCU I;  2ZME A;  4E7Z A;  1D0X A;  4OIN F;  2F5C A;  2HTS A;  1HF0 A;  3N90 A;  2F43 A;  5FD6 A;  2CJJ A;  2M0C A;  4D1Q A;  4M3G A;  2IGK A;  3PA1 A;  1WKM A;  2VOP A;  5A2Q K;  4R8H A;  3U1D A;  3OJW A;  3FMQ A;  1UST A;  2Y0S N;  4F92 B;  3P9I A;  4IRI A;  3OL4 A;  2CH0 A;  1LEA A;  4U7B A;  2QX3 A;  2VPR A;  2HYG D;  3CTA A;  4V19 K;  2VBT A;  2Z1D A;  2ZJQ F;  3WTY C;  2P0W A;  3RJP A;  3I71 A;  3I56 B;  1EH6 A;  3FXK A;  2VQC A;  4D7M A;  5GV8 A;  3GQA A;  3TO9 A;  5TIS C;  2PQ8 A;  4CYC B;  2R7U A;  1FNB A;  1B8I A;  3GFL A;  4OIP F;  1GAW A;  1VQM B;  2F5V A;  2LBF A;  3BCA A;  3MZY A;  5DEQ A;  4U7D A;  3RZO J;  5B5E C;  5FNZ A;  3A8K A;  1WRJ A;  3R4K A;  4BJ6 C;  1MNM C;  1ZUN B;  4P9F A;  2W4S A;  1G6N A;  2HKO A;  3JCU C;  3W6K B; 
#chains in the Genus database with same CATH homology
 3PSI A;  5FRM A;  1I8D A;  5C1C A;  2UUZ A;  1H8H A;  4PJJ A;  4XKW A;  2L2O A;  2E5Z A;  4E4H A;  2GOX B;  4BU2 A;  2CV0 A;  1BLI A;  3I9V 2;  4IQJ A;  1HVX A;  2Q1Z B;  3H5N A;  2CW8 A;  5CQE A;  1K28 D;  3VST A;  2ZZE A;  3JUR A;  3KYL A;  2VBE A;  4XL9 A;  4BE1 A;  2PJR B;  3A4C A;  3B8Y A;  3LSG A;  2VJ5 A;  2VPL A;  2M4G A;  2M7A A;  3OYM A;  4KKS A;  3L2Q A;  4CCL A;  3J7A Y;  3CMM A;  4NC8 A;  3L2W A;  4J01 A;  2QKL B;  2R7S A;  3ZQQ A;  2JUG A;  4XN3 A;  2X8K A;  3AL0 B;  1X1C A;  3BG7 A;  3SEZ A;  3VMW A;  1BR2 A;  3QYB A;  1WFX A;  4E6K G;  4CZC A;  4X0G A;  3RCO A;  1NG6 A;  1WMR A;  2VBM A;  3UW0 A;  2XDV A;  1V5G A;  2OUM A;  3U21 A;  4BL0 B;  1MMD A;  3LSK A;  4PFP A;  1VZ0 A;  4BJT A;  3OYJ A;  3L2U A;  1N77 A;  1NBM A;  1O8I A;  2OV7 A;  2R7T A;  1WPC A;  1UD6 A;  1HZE A;  2XZP A;  2Z6B D;  4XKB A;  4CA0 A;  1NRK A;  5KHD A;  3VSV A;  4AYB A;  3OYI A;  4ZYA A;  4XD7 A;  1YE9 A;  1MMA A;  4II2 A;  1V0E A;  3WQZ A;  2GK7 A;  4OJP A;  3PJR A;  3IUO A;  2WPD A;  2ZXH A;  3K4K A;  4II3 A;  4URR A;  1H8E A;  5HOO A;  2V26 A;  3GBG A;  2R4G A;  3A1Y A;  1NG7 A;  3MMY B;  3PFY A;  2E5N A;  3ZCO A;  3TBI A;  4C9Y A;  2GJP A;  4BJ5 C;  3DPU A;  4XKV A;  1T0F C;  4AU7 A;  1VJS A;  3A3B A;  3H94 A;  3OEH A;  4YXW A;  2O0W A;  4XKC A;  3QYF A;  2GJK A;  1EE6 A;  4YZX A;  2BOL A;  1LFP A;  2E1M B;  4NC7 A;  4DOZ A;  3OE7 A;  2NSP A;  3LSH A;  2CV1 A;  1RMG A;  3FBI B;  3EUA A;  3OYG A;  1IDK A;  4MLO A;  1E79 A;  2JJ2 A;  4MXN A;  3VSU A;  3SDB A;  3RSN A;  3H5A A;  3SZG A;  5IK2 A;  3VYT B;  4ASU A;  2KRC A;  1N78 A;  3G2B A;  4DBQ A;  4RM3 A;  3C2G A;  1D1B A;  3F9K A;  3OR1 C;  3DEE A;  3MKY B;  2ZTG A;  2KVO A;  2VKH A;  3ZPP A;  2NOJ B;  4OJ6 A;  1E0E A;  2F6C A;  4B43 A;  3QOE A;  1X19 A;  2HDW A;  3DTE A;  2K9L A;  2X6W A;  2JDI A;  4TSF A;  4MR0 A;  2HVS A;  3CZ6 A;  4F55 A;  4TT3 A;  4IKF A;  3OPO A;  2HPI A;  1D1C A;  1QHG A;  3ZRG A;  4OWR B;  2KQR A;  2F4I A;  3CJQ B;  4NK8 A;  1BPL A;  4OZY A;  1KTW A;  3DKY A;  3DDY A;  3A2K A;  1FMW A;  4LG3 A;  1BR1 A;  4L8J A;  3NWS A;  4KIS A;  2IXS A;  2O1D A;  4KIT B;  5HNF A;  3GVJ A;  1WJB A;  4XLF A;  3A35 A;  3BC9 A;  3KEW A;  1TT0 A;  3CJR B;  3W2A A;  2BW3 B;  4CCJ A;  2DT6 A;  2W7N A;  2W6I A;  2M4K A;  3OYE A;  3OMY A;  3A3G A;  4PJN A;  4E7K A;  2K5C A;  2CW7 A;  4DNT B;  3OOU A;  3HPG A;  3OYL A;  2W6J A;  4CCK A;  1X1D A;  3K70 C;  1PLU A;  1RU4 A;  3G05 A;  3OYC A;  4Z1M A;  1MAB A;  5LFA A;  4B47 A;  4TKO B;  3W3C A;  3VYS B;  2GJR A;  2DOA A;  1UD3 A;  3GQ9 A;  3SEQ A;  2WAQ A;  4HSR A;  2BSP A;  2D3N A;  1WJE A;  3VYU B;  1KON A;  3H9Q A;  2XAU A;  1AA7 A;  4ZDL A;  2QY1 A;  2KZV A;  4JOM A;  3V42 A;  3OYN A;  2NTB A;  2VQH A;  1GLN A;  3VSK A;  2GK6 A;  5FRO A;  2AQF A;  1IDJ A;  3UR3 C;  2VLA A;  3BCD A;  2KL4 A;  3VR6 A;  4OJO A;  2WAE A;  1OHH A;  2VB6 A;  2O17 A;  1MMG A;  2PMZ A;  2R7O A;  3DU5 A;  1SAU A;  2L9S A;  3DQV C;  3BH4 A;  2DIE A;  3K4M A;  2VIX A;  2ZTN A;  2QXZ A;  2KPM A;  4CCN A;  4OJ5 A;  1KMH A;  4XLE A;  2IGN A;  1AIR A;  2LG4 A;  3DWL E;  2CMP A;  3E0J B;  2FUG 2;  2VJJ A;  3LSI A;  1WJA A;  3T56 B;  4PSX A;  4BQN A;  1O8M A;  2IS2 A;  1WJF A;  4N4O B;  4F3Q A;  3LNN A;  3DPT A;  3OEE A;  1OOC A;  1Z21 A;  3WWG A;  4HIZ A;  2KDO A;  1LKX A;  3K10 A;  2L7K A;  4ZDO A;  2XSJ C;  5KNL A;  1E1R A;  2MYS A;  3EPZ A;  2UWM A;  2XGJ A;  2A6T A;  4LIU A;  3ZXS A;  4F93 B;  1OFM A;  3LFU A;  4ITV A;  4OJL A;  3L2V A;  3N05 A;  2M5S A;  4JMQ A;  3C2H A;  5JHF A;  4XN0 A;  3HOT A;  3FY3 A;  4ZJZ A;  4H4K C;  4XLC A;  2INU A;  4NQW B;  2RRE A;  4BUP A;  2V4D A;  3DKX A;  1KCD A;  1Z3Y A;  2AQE A;  3QYE A;  3TMO A;  2MAB A;  4BEH B;  2MD0 A;  1U0J A;  1OGM X;  3HPH A;  4F52 A;  4IX7 A;  3OS0 A;  1WJ5 A;  3GQ7 A;  1EFR A;  2ZZQ A;  2HPM A;  4YZ0 A;  2CUJ A;  3DU6 A;  3CP8 A;  2IS4 A;  3PNY A;  3H9G A;  4PUS A;  1ERD A;  2MC4 A;  3AFH A;  2OC6 A;  2E1M C;  1PJR A;  1O8G A;  5TGT A;  4U4B A;  2Y0S A;  4NUB A;  3OYH A;  1VF7 A;  1UD4 A;  3KEY A;  4Y33 A;  2WA0 A;  1MNE A;  4NNJ A;  2VBK A;  5AMV A;  2LRD A;  4OAY A;  1MND A;  4FAS D;  3W2W A;  4ZTF A;  1E3Z A;  4C2L A;  1LDK B;  4OAZ A;  3S3N A;  3LMM A;  1IRX A;  4G6T B;  4LIT A;  3S3M A;  1HA8 A;  4KKU A;  3OYB A;  3ZR8 X;  4HWV A;  1W0J A;  2X51 A;  3DPL C;  2BW3 A;  2XF5 A;  4CSW A;  2X1E A;  2LZJ A;  2WB1 A;  3FBN B;  2UV1 A;  1JI8 A;  4BS9 A;  4B3F X;  4ZDP A;  2R9V A;  4PK4 A;  4BEH A;  1JTA A;  4PFO A;  3K4N A;  2LH9 A;  2LBF B;  2R7W A;  4GQN A;  3W2V A;  4IZZ A;  3D5L A;  3HOS A;  3T51 B;  4XNF A;  4F91 B;  1I18 A;  4RLQ A;  2NZM A;  3GQ8 A;  3OS2 A;  2CS3 A;  4ZTJ A;  3K4B A;  3OIQ A;  2GOM A;  4XM3 A;  4ANJ A;  1VBL A;  4U49 A;  4YRV A;  1O8D A;  4W8S A;  1CZF A;  3MD2 A;  2WJY A;  5FL7 A;  4PJL A;  4EW9 A;  2IQ7 A;  4PSW A;  5CQG A;  4W8R A;  2V1N A;  5CPR B;  4RM2 A;  4BQQ A;  3GQB A;  4U87 A;  2HLD A;  3S3O A;  2VJ4 A;  2X6Y A;  4XLA A;  1VLY A;  3HAG A;  2NT6 A;  1EA3 A;  1UAA A;  4HG2 A;  3VDX A;  2W1O A;  2UVF A;  4E0F A;  2PYG A;  2BVL A;  2MFZ A;  4HST A;  1PXZ A;  1S9H A;  2WAF A;  1OR7 C;  3H5R A;  4XMY A;  3HXL A;  4XOR A;  1E3X A;  2NT9 A;  2X3H A;  1NHC A;  2X85 A;  3OYD A;  4FXU A;  4P1W A;  1OFL A;  2JSP A;  2XZL A;  1DGR M;  3L2R A;  2R7X A;  2PEC A;  2R7V A;  1G59 A;  4RLF A;  3ONQ A;  2CV2 A;  3ZIA A;  1KZL A;  2JJ1 A;  1SFK A;  4YZQ A;  3FDY A;  4PMH A;  3GRH A;  4KJZ A;  2VKD A;  2V7F A;  3K70 D;  3RPU D;  2WAD A;  4Z06 A;  3T9G A;  1RWR A;  1WP6 A;  1COW A;  4HRI A;  2IS6 A;  2VJI A;  2INV A;  1X1A A;  3TL4 X;  2Z2S B;  3OYF A;  4QPO A;  3I3L A;  2V7Q A;  2XOK A;  3GVK A;  4BGD A;  2WBM A;  2R7R A;  1QJV A;  1IA5 A;  3T53 B;  4Y3O A;  3E1S A;  4RMN A;  4J00 A;  4DBR A;  3KX2 A;  4E7S A;  3AKZ A;  1O88 A;  4B3G A;  4FET A;  1D0Y A;  3ZGK A;  3PNT A;  1K6Y A;  1N75 A;  2IS1 A;  1UD2 A;  5CDF A;  2K9M A;  2O04 A;  4W8Q A;  3S32 A;  2HNH A;  3IAM 2;  3VMV A;  4C2U A;  3ZSC A;  3S8P A;  3B4N A;  2E60 A;  1BMF A;  3OYK A;  3FPP A;  2V31 A;  2WJV A;  2DJI A;  2ZZF A;  2CUZ A;  1O8F A;  1SKY B;  2BVM A;  4Z05 A;  2VXZ A;  3NWT A;  2WY8 Q;  3PNV A;  4W8T A;  2LC2 A;  2L9N A;  2ZFU A;  3EUH C;  4XR6 A;  2XND A;  1DBG A;  3H9J A;  3RQ4 A;  2XZO A;  3GVL A;  3LSM A;  1Y6I A;  2DXI A;  2W82 A;  1Z3X A;  2HQA A;  1D0Z A;  1G8X A;  4QPQ A;  2V9K A;  3OR2 C;  5HVQ C;  1QCX A;  1XG2 A;  2E1B A;  1UG0 A;  2IGO A;  2LOO A;  2JVH A;  2RQQ A;  5LD2 C;  3EQO A;  4CCO A;  2LY2 A;  2XF6 A;  1PKV A;  2WZP P;  4NK6 A;  2VL8 A;  3MKZ A;  3SYT A;  1PE9 A;  1DP3 A;  2ODL A;  3HC7 A;  1YX5 A;  3UNG C;  3KRG A;  4B48 A;  5HKK A;  4HNU A;  4I84 A;  4BAC A;  4E7L A;  4DNR B;  1W9X A;  1Z7L A;  4DGW B;  4G6I A;  4YEL A;  4B3X A;  3OL3 A;  4Y4R A;  2Q2E B;  4HPQ A;  1R6R A;  2W00 A;  3EQN A;  2ZSH B;  1X0C A;  2KRH A;  1V5F A;  4E7J A;  4E7I A;  2KLO A;  3ZPN A;  1DBO A;  2X6X A;  4G7X A;  1V5E A;  4CUG A;  3OWT A;  2KHM A;  5C1E A;  4C30 A;  5HNH A;  3VYR B;  2V6E A;  2M7B A;  1O8K A;  3DTI A;  1O8H A;  2VQL A;  1WTH D;  2VQG A;  2ELJ A;  1O8L A;  3OAA A;  2Z8G A;  4HEA 2;  2Z16 A;  4BE0 A;  3RTR A;  1T95 A;  2JA2 A;  2WSS A;  3DLA A;  3VWB A;  4C2T A;  4HNT A;  3CES A;  3OW7 A;  3BCB A;  1BN8 A;  3B90 A;  4XON A;  3CP2 A;  2LYC A;  2HVR A;  1UEL B;  3FKJ A;  4PJM A;  3NE5 B;  2WY7 Q;  2VAS A;  2F1M A;  2CFO A;  3OIP A;  3DTK A;  2X1D A;  2M0M A;  3OOC A;  2PYH A;  2O5R A;  1HG8 A;  4P22 A;  4EAT A;  3HG9 A;  4AVZ A;  4BDY A;  4DK1 A;  2HU9 A;  2PJR A;  1OB0 A;  1QHH D;  4GRI A;  2ZZG A;  2M3A A;  2HZD A;  2LY1 A;  3K6G A;  2X53 S;  4CCM A;  5CKT A;  2KMU A;  1WJC A;  3HL2 A;  1MMN A;  2A5W A;  3PSF A;  1DGW Y;  1WJD A;  2V4J C;  4DJA A;  1E1Q A;  3MKW B;  2EWE A;  4YZA A;  4ZC3 A;  3JU4 A;  3S93 A;  1BHE A;  3BG6 A;  3BLY A;  5FRN A;  3EUK L;  4KT6 A;  2KP6 A;  3OYA A;  3SUC A;  1P9Q C;  5DN6 A;  4XOP A;  2D3L A;  4G7W A;  4E7H A;  3AL0 C;  2IGM A;  3OFN A;  4LIV A;  1X1B A;  1E43 A;  2ZXI A;  1OLT A;  1GQ8 A;  1PYV A;  1V0F A;  3H35 A;  1BR4 A;  2K3P A;  2RNG A;  2XC7 A;  3CF2 A;  1J09 A;  2I8D A;  3K4L A;  1O8J A;  2HVQ A;  3D5R C;  3PUB A;  2L5Q A;  4UZU A;  1BOB A;  2O0V A;  3FHN A;  5KCM A;  4Z03 A;  3H0D A;  3BCF A;  4BE2 A;  1X4O A;  1H80 A;  2VXD A;  3OY9 A;  2R7Q A;  4N4N B;  3QOD A;  1Y56 A;  2XF7 A;  2NST A;  5HLT A;  1FX0 A;  1QU3 A;  3FKS A;  1YX3 A;  4XLH A;  4BXF A;  1W36 D;  3M8J A;  4KKT A;  2JVG A;  3HUG B;  4IQ4 A;  1O8E A;  1UD8 A;  4YEJ A;  3IP4 B;  3K4C A;  4CH7 A;  2QE7 A;  4JQF A;  4DIQ A;  4E7Z A;  1D0X A;  2NTQ A;  1KCC A;  2NTP A;  4XQF A;  2UVE A;  3M1C A;  1JRG A;  4OZZ A;  4B44 A;  2F43 A;  1D1A A;  4D1Q A;  1DQU A;  2X1C A;  2JIZ A;  2IGK A;  3LL7 A;  2ZSI B;  1IB4 A;  1FMV A;  1TZL A;  4P5O A;  4BQO A;  2QKM B;  3D5S C;  3HKZ A;  4F92 B;  3OS1 A;  3OL4 A;  2CH0 A;  4U7B A;  2QX3 A;  1MW7 A;  4D9J A;  3PL8 A;  2Z1D A;  4R79 A;  2DT7 B;  2P0W A;  1K5C A;  3LMW A;  1T5E A;  2VQC A;  4XOT A;  3GQA A;  2CK3 A;  1ZEL A;  3IAS 2;  2LRE A;  2R7U A;  4DK0 A;  4BDZ A;  2DCE A;  1X4P A;  2F5V A;  2LBF A;  3BCA A;  1UD5 A;  1OGO X;  1LVK A;  1W36 C;  4BJ6 C;  3BC8 A;  2W4S A;  3K4J A;  1W0K A;  3VSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...