4AVZA

Tailspike protein mutant e372q of e. coli bacteriophage hk620
Total Genus 226
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
226
sequence length
598
structure length
598
Chain Sequence
DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords TAIL SPIKE PROTEIN
total genus 226
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4avzA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4avzA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4avzA02
4OJ6A 4XLCA 4W8QA 4YEJA 4XN3A 4Z06A 2QY1A 3B8YA 3WWGA 1HG8A 1RMGA 3FY3A 2PYGA 1CZFA 2IQ7A 4YZAA 3GQ7A 4NK8A 4NK6A 4MXNA 1IB4A 5AMVA 4U4BA 4U49A 4AVZA 1KCCA 4Z03A 4URRA 3KRGA 2INVA 4EW9A 2VJJA 2X3HA 4XR6A 1DBGA 4MR0A 1PLUA 2O1DA 2X6WA 4XLEA 1KTWA 2X85A 5C1CA 1OGMX 3EQOA 1O8LA 2NT6A 2UVFA 2VBMA 1JTAA 2VBKA 1O8KA 3GRHA 2EWEA 1AIRA 3GQ9A 3VSUA 1O8EA 1QJVA 1PE9A 1KCDA 4W8SA 4XN0A 2VJIA 3VMVA 4XMYA 3VSTA 5C1EA 3B4NA 2X6YA 1H80A 2NT9A 3VSVA 4XOPA 2O0VA 4YZXA 2ODLA 1O8GA 4OJ5A 1GQ8A 2NTPA 1O88A 2NZMA 4W8TA 1K5CA 3GQAA 1O8HA 3EQNA 1IA5A 1BN8A 1QCXA 4OZZA 4C2LA 4OJLA 4XLFA 4Z05A 3UW0A 4XLHA 3T9GA 1OFMA 3ZPPA 4XKVA 1O8MA 2VBEA 1OFLA 3ZSCA 4XKWA 4XL9A 2NSTA 1O8DA 4OJPA 1IDKA 1O8IA 1RWRA 1PXZA 4W8RA 2NTBA 1OOCA 1VBLA 2NSPA 4XQFA 2QXZA 4YELA 4I84A 1O8FA 2INUA 4XOTA 1O8JA 4XNFA 1XG2A 2UVEA 4XONA 3B90A 4OZYA 1OGOX 2NTQA 1IDJA 2BSPA 2O0WA 4XM3A 4HWVA 3JURA 2X6XA 1EE6A 3LMWA 4YZ0A 2Z8GA 2QX3A 2O04A 1DBOA 4YZQA 1X0CA 4XLAA 3VMWA 1JRGA 1NHCA 2PECA 4PMHA 2PYHA 1BHEA 2O17A 3SUCA 3GQ8A 4OJOA 1WMRA 1RU4A 4XORA
chains in the Genus database with same CATH superfamily
2ID6A 3GTOJ 1Q81D 3B78A 2QY1A 1U0JA 1ZHFA 2TCTA 3WTWC 1D8JA 2K9NA 4WF2A 4QV2A 3RKYA 4NQWA 2HQ5A 1B72B 5HS7A 2IQ7A 3KCCA 4NNJA 1H8HA 1SKYB 3BY6A 4UVAA 2A3SA 4LK0F 1JUPA 2XAFA 1SD6A 1A6QA 3W2AA 3EYIA 4XD7A 3CW2A 4YDTA 4Y9UA 2A6TA 2HQAA 3SDGA 1XS9A 1O3RA 3CMEI 3RPUA 1EA0A 1BBYA 4MYTA 4URRA 1TUIA 2DPUA 3CF5F 3LMMA 4C2UA 2VJJA 3LSMA 3H3UA 1P7IA 2PJPA 2GREA 4Y13A 2W25A 2DA4A 3BOQA 4CZCA 4U7DA 4M4SA 1ZK8A 4CCOA 5EEHA 2H6CA 5L3GA 3K2AA 3CMMA 4LOCA 5A88A 4HNUA 4C3HJ 2DA2A 1XMXA 1W5SA 2J8KA 1FIPA 3WU2C 1ZRCA 3ASRA 3FK6A 5CVUA 4GDFA 3I1FA 1WPCA 3BG9A 3CRZA 1V3FA 2V9VA 3EUHC 3TQNA 1T6SA 1U5TB 4PJNA 2QYOA 1BIAA 3WNBA 4IL6C 1XCVA 1IJWC 4TMXA 2BY2A 3QPTA 4MFDA 1QGAA 2O0VA 5E18F 2ELJA 1KQ8A 1EP2B 3GVJA 3DV8A 4MQ9F 4OIPF 2HS5A 2RREA 1W2BB 1WJFA 1WTHD 3AVWA 2DETA 2XNDA 2EPFA 4BDZA 1KGSA 4X7CA 1IV8A 3JAMK 1N8RD 3G3ZA 2H09A 4PJJA 1X1CA 1RPWA 3GVKA 3NQOA 5THXA 5GTIC 4BY1J 2YWEA 1OISA 2PX9A 3R6SA 2HVQA 3ASNH 2JWTA 3TO7A 2EA4A 1R5OA 4Y15A 2WY7Q 4ENJA 2GWRA 2DEUA 2AQFA 1Q86D 1WHUA 2UUZA 4D7MA 1ZLKA 5EEGA 2L4MA 1QA3A 1OFLA 3AK5A 3BH6B 2ZXHA 1R1UA 4OPVA 3U9GA 2QKLB 3FMSA 1AIPA 5DCMB 2VJ5A 1T56A 5LRSA 4OMZA 1XN7A 2QUFA 1IJEA 3W5UA 3C1DA 4B4CA 4DNRB 5BOXA 1O8IA 3O2PE 2VPLA 2R7QA 3BJ6A 4PUSA 2IOUG 3M3YJ 3U6KA 3K70D 1LM1A 3TEDA 3NWTA 1NBMA 3CCMI 2M87A 1EFUA 3B73A 1BI0A 1FBSA 1IRXA 4II2A 1YJ9I 2XZLA 3BROA 3AVXA 4I0BA 3NARA 3LA2A 5HDGA 1J9IA 1QFZA 3GW2A 5EF6A 1TNTA 4LITA 2CUFA 1NK3P 1FTZA 4TMVA 4Z2YA 2E2HJ 1WSRA 4U9UA 3K4MA 2YS9A 1EE6A 1UHWA 2K85A 3PJRA 2RGVA 4AD9A 4RMNA 5FO0A 5CQEA 4IKFA 1YJNB 3FPKA 1W7PA 3VMWA 1MRZA 4B3GA 2MH9A 4IHTA 4LFUA 4EJOA 1VQKI 1NHCA 5BMZA 1DGWY 3GQ8A 3SY2A 4C3IJ 4EQQA 1FY7A 3HRMA 1UZCA 4BEHB 1YOVB 5HLGA 3GTLJ 2VBZA 2W57A 1HG8A 3ASSA 5DYMA 1ENHA 3TH0A 4UB6C 1BJZA 2ZJQF 4B3AA 1T6XA 2LF7A 1IDYA 4HF1A 1YIJI 1WOPA 3SEJA 3L2WA 5AMVA 3WYAA 4YIFA 3HOUJ 4M6YA 5LLQA 4ZDPA 4UUSA 4IZZA 1U8RA 1U3EM 4M2LA 1T2KA 4PGHA 1YTYA 4I6ZA 3QYEA 4QUZA 3G4SI 3RQIA 2HVSA 1XMAA 1JKQC 2X53S 3K4CA 2RN7A 1KQ9A 4M3FA 1OGIA 2O3FA 2OK7A 3M07A 3GVLA 1U9OA 2IA2A 2BGCA 1VQ5I 3JX8A 1D5YA 4OINF 1YG2A 3LNQA 1SAUA 4HSTA 1WJDA 1RETA 3RTRA 4HA8A 1Z3XA 4DYRA 3OYDA 4L0ZB 2V7FA 2K9LA 2L0KA 3T5XA 1E0EA 1R49A 3AGPA 1XGNA 3FF5A 3WODF 2VNHA 5C3EJ 4B8XA 2YUSA 1QQIA 3K6GA 1YQAA 3MAJA 4BQOA 1TZLA 3R61A 5HOOA 4RLZA 3FXRA 3OIOA 2KPMA 4N3NA 2AQEA 2CSOA 3LQ6A 2VBTA 2X6YA 4M9SA 3RYPA 6PAXA 4B47A 4QVJA 4Z6YA 1ZRDA 1MSEC 5L3CA 5ERIA 3GQAA 5EEAA 3S16J 2GXAA 3ONQA 1R23A 2LFBA 4BEHA 2QCOA 4RM2A 3DPLC 2BVLA 3E1SA 5C44J 1E3OC 1U8BA 3LL7A 4HAMA 2QA4I 4LLGF 4U0WA 3GTGJ 3LO8A 4OJLA 5JLWA 5FLXK 5FA6A 2P4WA 1JI8A 4Z05A 2CQXA 2DO7A 1EH6A 1Y56A 1E2XA 3BP8A 3CJQB 1K28D 1IUYA 4YALA 3W2HA 1AU7A 3SEZA 4QWQA 3MZHA 4OJPA 1B6AA 4UXNA 5BPDA 3ZR8X 3S1QJ 5A8AA 2NSPA 3L09A 2VBUA 2VE8A 4E7KA 3WBJA 5FKOA 2HDDA 2DCUA 2IS6A 4BUPA 5D5UB 1TVCA 4Z4SA 3CCJB 4I7HA 2F5CA 3CD6I 2ISYA 1QBJA 2C6YA 4FASD 4HYEA 1SANA 3TBIA 3TO6A 2KZVA 5J1RA 2TRTA 1RUNA 4WK8F 3CLOA 4ZYAA 4HWVA 2COMA 2P6TA 2Z5UA 1JKRC 4TT3A 3GFJA 4L9JA 2DCEA 3H9QA 3MKYB 4II3A 4RD3A 2XASA 1QPIA 1KK3A 1J09A 1WI9A 2AHQA 4EGZA 2PMDA 3MMYB 1XPXA 1X0CA 3GUDA 1SVMA 4Q7JB 2WB1N 1IRGA 1EFRA 3BC8A 3WTSC 5HDNA 4XLPF 1G7TA 1N0VC 2DK5A 5BSYA 3CP2A 4LBYA 1MMNA 4BACA 4YXWA 3K4NA 3F6VA 3JQPA 1ACIA 1BX1A 2F3LA 2IT0A 2EBIA 1MMAA 2BHYA 3DP7A 3KL9A 2PJRB 3PUNA 1Z6TA 3L00A 1E1RA 5LD2C 1Y0YA 2OPTA 1QHGA 1Y6IA 5IYBJ 2DA7A 1UD3A 3FKJA 1J59A 1X1PA 2QBYB 4U49A 2OTJB 1BI3A 3K4LA 2Y0MA 3MWMA 4MNUA 2X0LA 4BJ6C 5E17F 3BR0A 2XPWA 3K2ZA 4ZZLA 3VNVA 1DBGA 1OYWA 3DWLE 3P9KA 3VWBA 3CJTB 4U0VA 1MABA 4RD1A 5TV2A 3ZZUA 2HDNB 4OP7A 4MR0A 2X85A 1ZARA 1GHCA 2H6BA 5EDNA 1Z6RA 2KKOA 3CC4I 1B59A 2F5EA 1WJEA 4A5NA 2E2IJ 2LP0A 5IYNA 4HE6A 3J7YJ 3OYIA 4HLXA 2QZAA 1T6YA 2ID3A 4LBZA 2FOKA 3ZC3A 3J7ZI 3DTEA 3IKTA 2DERA 4LMYA 5C1EA 3PM1A 1Y1WJ 2MABA 2Y48A 4BDYA 4OJ5A 3AL0C 2Z99A 1QGYA 2B7CA 2QGGA 4MEYF 4PC6A 5IOZA 1HLVA 1FNCA 1IW7F 2A5WA 3CC7I 2CG4A 2HNHA 2ME6A 1XFOA 1Y0UA 4UB8C 3RIRA 1IA5A 3HUGB 3LNNA 2C77A 3BNWA 2BM5A 1BN5A 4CO8A 1BN8A 4ZYDA 3K4BA 5IP6A 3V7SA 4P9SA 3LYCA 2OTJI 4YFNF 1AWCA 1FP1D 1U5TA 2KLOA 3UW0A 2M4GA 2JA6J 1OFMA 1X19A 1BJAA 3C18A 3KP5A 3S1MJ 2W48A 3AG3H 2GZWA 1E3XA 2F43A 1XSVA 2CQNA 2BMWA 2QYUA 2OUMA 3OV8A 2DT5A 3QE2A 3S3NA 4QIWN 1MD0A 1Y0RA 1PDNC 3ZIAA 1YX3A 1IUFA 3BTCA 5DCFA 2QSHX 5D4RA 2CUJA 1RNLA 2CMPA 3HGYA 3CMEB 2K27A 1LE8B 2EZKA 2N8GA 4OIQF 1P9QC 2FMLA 1YS7A 5FO5A 3E6DA 2CBXA 1E17A 3E5QA 4WXCA 3RSNA 2WSSA 2KP6A 3ASPA 2NAZA 1OGOX 1LJ9A 2VT3A 3ML6A 1AHDP 2OTLI 4M72A 5ED4A 3E6CC 4RB2C 1J0RA 2GIVA 2X6XA 3O6BB 3RYRA 1GO2A 5IYPA 1WCMJ 1T0FC 2VQHA 1FNNA 1SVOA 2VJ4A 3NB2A 1FPQA 2H1KA 3S2WA 2XSJC 2HYGD 3B6CA 4BYYA 5L3DA 3PUFA 5HLHA 5FIUA 4BE1A 2M7AA 1R00A 3FISA 3IAS2 5F27A 3GZ6A 3NE5B 4OPOA 2COBA 4XRSA 2J7KA 2Y0SA 5ICFA 2DIEA 2NPFA 4B09A 1EH7A 2EB7A 1S72I 2NNNA 1VF7A 1LUJB 2XGDA 1WWXA 3BG5A 1HKSA 2R9VA 3V42A 5HS8A 1JA0A 3F23A 1MIJA 1WSVA 3T8RA 1EZGA 1IJFA 1HVXA 2W85A 2JVHA 1YX2A 4Z4TA 2DFFA 3CJNA 4AWXB 1CQXA 1F60A 1UD6A 3Q3AA 4OOVA 5BSXA 3PIPF 3H09A 3UNGC 4IO9F 1K78B 1F43A 4WZLA 4S04A 2VBXA 3A01B 4NC6A 1NB9A 2INVA 4RAZA 4HX4A 4FXUA 5CJ9A 3CF2A 1HA3A 2MYSA 2Z1DA 2QQ8A 4GRIA 2JTVA 3DEUA 4M9XA 3HM5A 1BOAA 1X3WB 3WU0A 3QQAA 1O8LA 3EQOA 2AS5F 2HXIA 2M1BA 3H3ZA 4EJWA 5H6RA 3CO7C 4XKCA 5JI6A 2P7CB 2V7TA 4OOSA 2GAUA 1UHSA 3OYNA 1VQPB 2CK3A 1YIJB 3V8KA 4DBRA 1A35A 2CV0A 2QA4B 3DBHB 1R5BA 1PE9A 2HLDA 2DOFA 2XAUA 1KU3A 3QSYA 1QJVA 3NWSA 2YU9J 3D1NI 5D6EA 1ETYA 2LMDA 3QPSA 2V7QA 3W3CA 1QA6A 2LBFA 2VBYA 5D8LB 2E1MC 4KKSA 5IYQA 3CP8A 1UG2A 2EK5A 4A2UA 4MLOA 2NZMA 3ZUGA 2CFOA 1GVDA 1D2EA 3GIRA 1Z1DA 2NVYJ 3HC7A 4DBQA 1X4PA 4FK8A 2V5IA 3OP1A 4MHGA 1VQ7B 1YITB 1GLNA 2WZNA 2HWVA 5CKTA 4M71A 3CD6B 3KYCB 2C2WA 1ELOA 4ZCIA 1F5TA 2XZPA 3BZCA 1K4TA 1FOYA 1NDHA 4CSWA 3BQZA 3HIFA 1GV5A 2FBIA 2LVSA 1NTCA 3O8HA 4ZJZA 5FB2A 1FYMA 1GDTA 1EJ9A 3GQBA 5D5WB 1VQ6I 3A1YA 3P9IA 3ABUA 3MKZA 4E7JA 1GAQA 1CNEA 3OOCA 3HG9A 2VL8A 2IGOA 2DYRH 2X1EA 3FXJA 1UCRA 4ASUA 3KEQA 2X9DA 4BHCA 3LSGA 4Z4WA 2BM7A 4Z4RA 4UAJA 1JT0A 4BPRA 1YIOA 2VT2A 1E43A 4D9JA 2VZLA 2E60A 2GBYA 1BOBA 2DMPA 5M3FJ 5FL7A 1VQ5B 3W2VA 3BR2A 2HZDA 4P3IA 2BM6A 4EM0B 1HXDA 1YLOA 2L5QA 1E63A 1BL0A 2X8KA 5TY0A 1J75A 4WCGA 1PJ5A 3ABKH 1LB2A 5GAGJ 3LOCA 5B3SH 4GXOA 3HYIA 1DBOA 3MQ0A 1VQNI 3VR6A 2F4OB 1HSTA 3BR6A 2D3NA 2W00A 4PK4A 1T39A 1XGSA 2CUZA 4X6AJ 2GJKA 2IGNA 4DYQA 5EJCA 2WAEA 1WQ2A 3JW4A 4KDPA 3CUQA 2D5VA 2P8TA 4M3EA 2O17A 2DDAA 1Z3YA 1OFEA 4CYCB 4XSZF 4G1VA 3A8JA 4I02A 3H9GA 3ISPA 3ZQGA 2XGCA 3JRBA 5K7FA 4UY8I 1K73D 4Z06A 3WWGA 1ERDA 1OB2A 1ORKA 5GAHJ 4ENKA 1W0JA 1VQLB 2YU3A 3EUKL 4ESFA 3HSFA 2DODA 5KVRA 1QPMA 1C0WA 4WWVA 1QVGB 2DMNA 4X07A 2ZFWA 2PI0A 3PQJA 2MLGA 4UHTA 3OJXA 1VQ6B 3FBIB 1IRFA 3OSGA 2P7VB 3HOYJ 2KMUA 3SJPA 1QO0D 3GLLA 2HOEA 3ZMZA 3V7AA 2BOLA 4AF6A 1HZEA 2UZKA 1OMIA 3OS1A 2FX3A 4M3BA 3P9CA 1X2MA 3BWGA 1W5CC 4XR6A 3S3MA 3BH4A 2ZZQA 4LB5A 1KYZA 2O1DA 4E7IA 3LJYA 1XC5A 4AF7A 3ZMTA 3CUOA 1VQ4B 1DPUA 1OGMX 5HZBA 4UVCA 1UB9A 2XNJA 2VBMA 1RI7A 3MFKA 4DIQA 4G6TB 3BY2A 2AO9A 4LC0A 5FO1A 3BTJA 2Z8GA 3GRHA 1P4XA 3HGGA 3I0TA 2K86A 2ZXWH 3KP7A 2FNPA 2XOKA 3RPQA 4UV8A 4IF4A 2XT4A 2VC0A 1T08B 3BPXA 4DJAA 4ESBA 5FRMA 4GFBA 4TMTA 2IGKA 1KD1D 4CDGA 2YWGA 3B4NA 2BXZA 2DFIA 2M5WA 3KEOA 2M0CA 5LFAA 3DCFA 5L3FA 2G9WA 4RAYA 3G73A 1EFCA 5FGMA 2O6GE 5HXBA 2K02A 5GP9A 1OB0A 4ITVA 2R93J 1Y8QB 3I3LA 3GYHX 3CDHA 2EFQA 2MA3A 1W36D 4O5VA 2HI3A 4V02C 5E79C 4BU2A 3IP4B 1SMYF 2PEXA 4L9VA 1Q7YD 4M6XA 4OMYA 1PVEA 1H89C 1WXRA 4Z4VA 3K0LA 3J81k 3ZOBA 1CF7B 1TNSA 5HNHA 5FD6A 2ZNZA 1N06A 2ZMEB 1RR7A 4ZYEA 1JE8A 1EP1B 1KMHA 3OEHA 4UZUA 1T33A 2NSTA 1H0MA 2FF4A 1PXZA 1ZM4A 4BXFA 1USSA 2EINH 4E7SA 5LHGA 1J7KA 2R5ZA 3PETA 3DQVC 4PJ0C 2RC5A 2FNAA 1T95A 3S1RJ 1FSHA 1YLFA 1WRJA 3IRRA 4J0QA 1LLZA 1TYXA 4X7DA 3T1BA 4Z4YA 3F22A 3FXMA 2B0RA 4UUSB 3L2CA 5D5XB 4ZYHA 4OAZA 2EIMH 5FROA 3T51B 1YX5A 3D0SA 1G7RA 2O61A 4EGYA 2OK8A 2QF7A 3MD2A 4J19A 1FC3A 1STZA 1ETXA 3WHBA 1ZM3A 4PC2A 3JURA 2K40A 3PNYA 1V5EA 3OR1C 3W6JB 1I5ZA 4DNTB 2VPRA 1OCRH 3S2DJ 1WVRA 1MJBA 3IHUA 4BE2A 1FOKA 3VSKA 4R71A 3VNUA 4FISA 1LFBA 3C2BA 3TW6A 3LSPA 2BPOA 1TLHB 2R6HA 1Y1VJ 3S3OA 2TDXA 5JHUA 2OBTA 4RS8A 2EFNA 4HV6A 1WMRA 4BHBA 3B8HA 2UV1A 2WJYA 1KZLA 4RLFA 4UZFA 1R22A 3WXMA 4HSRA 2PIAA 1LLWA 1OFDA 2IS1A 2DMTA 3DXJF 4ZGQB 1RMGA 2XPUA 2Y0SN 2YUHA 1QHHD 2PN6A 3CCLI 5EZHA 2BY1A 2H94A 5FJ8J 3LSJA 3W6KB 1SEUA 2CC2A 1IB4A 1M1EB 4CCKA 3T53B 5LHHA 4I01A 4JX5A 2HZTA 2E1CA 4RAGA 4IQ4A 3S14J 3HXLA 3HSRA 2DYSH 2BBYA 3K69A 2BGIA 4OPWA 2VYQA 3WGGA 4LG0A 1R5NA 2ZC2A 2QDXA 1QGPA 1FYLA 4HEA2 4U88A 1E62A 3KFWX 4QHYA 4ASNA 3KP6A 3SJMA 2MC3A 4JX6A 4F55A 2IBDA 1JTAA 1U5TC 2DA5A 3P27A 1FOXA 1XTAA 2JUGA 2WADA 3PNVA 1QVUA 1I39A 1JJ2B 1G59A 4RM3A 2X6OA 1YI2B 1S7OA 3DF8A 3P7NA 2E1MB 4W8SA 2E36A 3WHCA 3OPOA 4IX7A 4Y17A 2VOPA 1I1SA 3WE2A 2CQ7A 3I4PA 4BGDA 4U7BA 1Y39A 1FIAA 2O6WA 3K4JA 2FXAA 2ACJA 4XOPA 2P81A 1UAAA 4DQ2A 2RVCA 4YIRX 1VZ0A 4KICA 3G2BA 4M9ZA 2R7WA 3LSIA 4P6VF 3ZZ0A 1K5CA 3EUAA 4GYGA 5CVVA 5M3MJ 3CCYA 1GXPA 1GAWA 3JRGA 1DDGA 1QCXA 1VQMI 4KFCA 3PL8A 4XBFA 3WQZA 4L18B 1BR2A 2ECCA 2LLKA 1IV6A 3E0JB 2EZLA 1T6ZA 2VONA 3F72A 5IYRA 1Q1HA 2VBEA 5TGTA 4H0EA 4G7XA 4M74A 4RJLA 1KK1A 2QWWA 3A0HC 2HKOA 3OOUA 5BPIA 4OOIA 2VFQA 1E3HA 2XRNA 3ZQFA 4C2TA 2IS2A 5M5WJ 2CRVA 4N4OB 2W6JA 1JGGA 1VQNB 2DA6A 4GQNA 1IN8A 1SD7A 4XQFA 4P55A 3DLLF 2LY2A 2WY8Q 3BH7B 5IP7J 3BC9A 2IA1A 5ILUA 4E7ZA 2E5NA 3A4CA 4MIMA 4HLYA 1JTXA 4N3GA 2D2WA 4D5CA 1QFJA 4RD2A 3V7CA 1CQTA 4IEJA 1F9NA 4Q4ZF 4YG2F 3LWFA 4D5FA 4BQNA 3OW2B 1AOYA 2IS4A 3NAWA 3BQJA 1UD5A 2V7UA 1ETKA 1V4RA 1RESA 3W5HA 2QEXI 1MH3A 1RZ4A 3HOSA 4RAFA 2NS0A 4EJVA 5EZGA 3G6EB 1WJBA 4E70A 4NBSA 1WOSA 2R7TA 2EZIA 3PFIA 2FBKA 4CCNA 1N05A 2HCJB 2D1HA 1LNWA 1WH5A 2XV4S 4BXUA 2VFPA 1CZFA 1D0YA 1HKTA 4CCMA 2BEOA 4A0ZA 1OCOH 2FJ1A 2VODA 2BVMA 3H9JA 3S17J 3OY9A 3F9KA 2Q1ZB 3FKIJ 1FDRA 2WZPP 2XAHA 4TMWA 1IZ1A 5E3OA 1NB0A 1R36A 2VNKA 4KKUA 2L02A 4HRIA 5JVTA 3W5VA 4XSXF 1OR7C 1P7JA 3F3XA 2OQGA 2XF5A 3I56I 1HC8A 1BI1A 1GVJA 2HTJA 3EQLF 2JA5J 2ZZEA 2FD5A 1M1KD 4R79A 1ZQ3P 4CGZA 2R7XA 5E3LA 3OEEA 4NK8A 4XK4A 2MH2A 4U4BA 2VBSA 4U87A 3DLAA 2OV7A 1KCCA 3W2WA 4BAYA 1SC7A 3E97A 4MTDA 4AUXA 1MDMA 2YWFA 1O3SA 2OCEA 1SFKA 2OYNA 2OC6A 4IRGA 5EGOA 4P26A 2X6WA 5IOYA 2LKSA 2HU9A 2DYIA 1VQOB 3JU4A 2CO5A 3QRFF 2JA8J 2Y30A 1XG1A 4ZC3A 4NBQA 3VYUB 2KJCA 1MMSA 2OBSA 1O8KA 5J8CA 4IHYA 3CCEB 4B43A 4MO7A 4MFEA 4DZPA 1QU3A 2I5UA 1D0ZA 4RPDA 1T98A 1HW2A 4KYWA 4BJ5C 5HNFA 1KONA 3TGNA 2ZZGA 1WJ5A 4IHXA 1EWYA 1VQKB 5A2QZ 2VFMA 3LQRA 2RNJA 2VN2A 1KU2A 1DG1G 2ZTNA 1R1VA 3AG1H 1YJWI 3ZPLA 2VUMJ 5J1UA 5H5JA 3CCSB 3MCZA 1K8FA 2GJPA 4G1BA 2NTPA 4KH3A 3VYRB 2WTEA 4W8TA 5EMNA 2WB1A 4LIUA 3L2UA 2LKPA 2QVOA 1Z21A 3ZP5A 3KZYA 1BJKA 4JOMA 1IF1A 4Q5SF 1NRKA 4NUBA 2STTA 4HNTA 2XEXA 3S32A 3V8LA 2A6HF 5JR3A 1TYUA 3CC2I 1QVTA 3GEZA 1R9TJ 4L5IA 2E7WA 1COWA 3RPUD 3J81K 4IQJA 1VQOI 1N25A 3GTPJ 1VJSA 1LDJA 3OMYA 4KMUX 5ILVA 3HZJA 3VOEA 2NVUB 2VE9A 3OL4A 3LAPA 2XC1A 1GV2A 1EKEA 5IYCJ 3H5NA 3I58A 4UV9A 3E6MA 4PGGA 3CMYA 1HOMA 4G7HF 1SFEA 3A1PA 3B02A 5DS9A 4F52A 1F4KA 4UVBA 5JBQA 1Y0NA 3TL4X 2XPVA 2B7EA 1Y8RB 4RLQA 2DOEA 2FUG2 1A6IA 1AKHA 1BC8C 3QFTA 3CCQI 5J4VA 2Z2SB 4FWTA 2L9RA 2L4AA 2V1NA 4JP0A 3ZRGA 2VQCA 1ZM2A 2BSAA 1VQ9B 4YZ0A 2CV2A 1N77A 4ZDOA 3CUQB 4DW6A 2L7ZA 2LZJA 4HQMA 3ZQCA 2QTZA 2L7MP 3OYGA 4RCZA 5E3NA 1H8AC 3ZQIA 1K9MD 2XTYA 3FHNA 5IY5H 3B82A 1F36A 2FEZA 3VYTB 3WTXC 2PYHA 2F4MB 3ONUA 3I4NJ 1S4MA 1PJ6A 2LH9A 3UKGA 1VHOA 1RU4A 2VBWA 1RKTA 3PA1A 2KT0A 4KJZA 2VIXA 3S8PA 4TV7A 4F7ZA 3FMRA 2QQAA 1ZRFA 1SKQA 3ASQA 2LSOA 5D6FA 4NK6A 5JMCB 1W4MA 3GTMJ 1A5JA 4B3FX 5ICCA 1V5VA 5J40A 4WXDA 3F8NA 4RPBA 3OOPA 1W0KA 1D0XA 2L9NA 4E7LA 2L7KA 4KT6A 1G7CA 4AU7A 3H94A 1O3TA 1Z7UA 3LSKA 3L2VA 1I6XA 2RC4A 3G1MA 5J8FA 1ZG1A 3CCSI 1PLUA 1I7PA 3PUBA 1WP6A 2DLLA 2G0YA 1O4XA 2RV8A 3M1EA 2QN6A 1G6NA 2ZFUA 1YE9A 2B0LA 4R8HA 5L3BA 2P6SA 1LKXA 4RGXA 3L7WA 1HDDC 4ENNA 2A05A 3DKWA 1K78A 3RCOA 3R6JA 4KNYA 4FX4A 3FPPA 3VSVA 3M4OJ 3HOVJ 1MMGA 4M0LA 2D74A 2A6EF 1GQ8A 2HQNA 3BCAA 4Y9RA 1NH3A 1B72A 1G3YA 2VKHA 3CZ6A 3A0BC 3KP2A 4NQWB 2XC7A 2V6EA 3N90A 2D45A 3GF2A 1SFUA 1MBKA 1GUUA 4LK1F 1UFMA 3GSIA 4OZZA 1U2WA 2R7FA 3CCJI 4HDVA 3H5RA 4KA4A 4ETSA 3W6VA 1QRBA 2WC2A 4HPQA 2A07F 2RQQA 1ONVA 3I4MJ 4HV5A 4PC3A 3ZN1A 3U1DA 3JQRA 5FLVA 4KN7X 1HW1A 1MJ9A 3RJPA 2ZKZA 4IRIA 3WGHA 2K5CA 3G1OA 4YELA 3U1KA 1S5LC 2FOWA 1WI3A 1R1TA 4NHJA 4S0HB 3RKXA 4CA0A 3PQKA 1LE8A 1QH0A 1O8JA 4ZDLA 3O8GA 2ADUA 3D5SC 4D0PA 1UMQA 2OJED 3GX4X 2CV1A 2JN9A 3WNCA 3Q0UA 4RD0A 2GLOA 4ZGNB 3P26A 2CF4A 1S7EA 1B2RA 2LY9A 1K4ZA 1HBXG 2BSPA 1RRJA 3PA2A 3FBNB 4O3MA 4P5OA 2O0YA 4E7HA 3H0DA 3HSEA 5CVIA 1QA1A 2VBVA 2VQGA 1CNFA 2FSWA 4TN1A 5GV8A 3CUQC 1N75A 1S29A 3FXOA 3I9V2 3RKQA 1EV7A 1VQ7I 3DFGA 3IWFA 1JGSA 1OYYA 4AIKA 2WAFA 1BQEA 1JJ6C 3VDXA 1JKOC 2KISA 3QFRA 1BHEA 1FEXA 1Z9CA 2VB6A 4NB5A 1K79A 5H2FC 3D26A 2DJIA 1GR1A 4OPSA 2M30A 2UWMA 4OJ6A 2O8XA 4YEJA 3VPRA 1MH4A 3ES9A 4RGSA 1TP4A 2EWNA 2XROA 2IEKA 3LA3A 3PENA 3KZIC 4RCYA 2HDCA 3BZ6A 4PABA 4EVIA 5J1YA 3ELKA 2CFXA 3ESWB 5BNGA 5BS6A 2Z3YA 2CW0F 3BCDA 4EMSA 3M8EA 3U2QA 3ISXA 1ZGAA 2W7NA 1QZYA 4QSHA 4RA2A 3IWZA 2DTZA 2AXLA 3JRHA 5CYVA 1KTWA 1ZLJA 5CPRB 2Y9YA 1JB9A 1N08A 2DA1A 3BJOA 1FRQA 1POGA 3SKBA 3CC7B 2H8RA 3HKZA 3BTLA 5D4SA 2GQFA 1WOOA 2X0KA 3VB2A 3E5UA 4LBVA 1TQPA 4KT5C 1E3ZA 4K2EA 4EJTA 5IT9Z 4DQLA 1WH7A 2X48A 1XB2A 4TMZA 1D8KA 2F2EA 4XN0A 1WZ2A 2VJIA 3QYFA 1DUXC 4UUVA 2IVMA 3HJEA 3KEWA 1HSJA 2V1UA 1ZAOA 2GJRA 2NS7A 4DNCA 3IH2A 2XAGA 4IJAA 4RGUA 1FZPB 1YHQB 2M2EA 1VNDA 1G8XA 2KHMA 4XICA 2FA5A 4G6DA 2QSGX 3BR3A 3FWEA 1D5VA 3GXOA 2KFDA 2GA1A 1K61A 2PJRA 4AC0A 1A8PA 2F5DA 3W2GA 1YRNB 2M8GX 2PMZN 3DU6A 1IG7A 4C2LA 3WGIA 1FBQA 3BG6A 4E4HA 1QRCA 1TL8A 4A12A 2BW3B 1I3QJ 3H3VK 4P25A 2EIJH 1TLLA 4XKVA 3TOBA 1O8MA 2ZO4A 1ZR2A 5TRDA 3RZDJ 1EXMA 3EYYA 2O8KA 2V4DA 2QKMB 1YJWB 1R71A 3I56B 2KRFA 1W35A 1B9NA 1O8DA 3F8CA 3TDUC 1TYVA 2DU9A 4C2MJ 1FT9A 3HAGA 4AC9A 1F1ZA 4FT8A 3IL2A 3GO5A 2R7RA 1D8TA 2X3UA 2X1DA 3Q6RA 1TWFJ 1UHMA 2DOAA 3FZVA 1V0EA 1NJID 2W6IA 3OW7A 4ROXA 2R4GA 1D3YA 5CLSA 4AVPA 4MQVA 4P1VA 1VQMB 4FX0A 2O9LA 3QAHA 1L1IA 2M34A 4AIHA 3GFIA 1W0TA 3VO2A 5K5OA 2E19A 2ESNA 2IGMA 5HKKA 1L3LA 2Q6KA 2QTLA 4QPQA 4HX8A 2F4NA 2DMUA 2JIZA 1OFCX 1LDDA 1OJLA 1B9MA 5F4JA 1P6RA 5FD5A 2ME0A 4C30A 5IYWA 2I1LA 2QX3A 1QNTA 1MJAA 5J4YA 3AG2H 3SZPA 2CW8A 2PBIA 2ZJPF 1FNBA 3PO3J 2E7XA 1K6YA 4L5JA 3W2FA 3VEPA 1U2RA 2R5YA 5LMZA 1R6RA 1JUMA 2Z16A 3HRUA 3EETA 1D1CA 1DP7P 3BCFA 1NG6A 4G12A 2HQRA 3FM5A 4JMQA 3CESA 4EM1A 3AG4H 4V2GA 1RQRA 1ZUNB 1I1GA 3H5AA 1X2NA 2LTPA 1BR1A 1ITYA 1DGRM 3M1CA 3MZ8A 2F1LA 3MHPA 4JYKA 1Z7LA 2Q6IA 1EF4A 5DUKA 3OIPA 3WTTC 2PMZA 4LD5A 1ZELA 3DBRB 1KQ0A 2MW8A 5F64A 1H8EA 5DN6A 1FLIA 3U6BA 1TC3C 3BDDA 2D1VA 2QM3A 2DMQA 3V8JA 4OM9A 2KIUA 2XAQA 4YAFA 1ZM9A 1BMFA 4IHSA 1OCPA 4LLNA 1R5HA 1JTYA 1XGOA 4B48A 3OKXA 3ROUA 5HODA 3FHZA 4RD6A 1IN4A 2HTSA 3OFNA 3C2HA 3BR5A 2XT2A 4PJMA 1BA5A 1QUFA 2K4BA 1YYVA 5LGUA 2EWEA 1AIRA 3GQ9A 3LQEA 3I55I 3T8TA 1U78A 2OBRA 4AM3A 1GVHA 2LRDA 4YFOA 2WYRA 4XLNF 2XIGA 3DEEA 2FRHA 3M8FA 4X1EA 1OPCA 1RUOA 3J7AY 3VMVA 1T0FA 3QP6A 3O3KA 4ZCMA 2KRHA 2F48A 4KITB 4ZV4A 3OE7A 3KLOA 4YZXA 4KIFA 2QQBA 2WAQN 3I53A 3HDDA 2UXXA 2EV6A 5DV5A 5B66C 5HVQC 5IYDJ 5CVRA 1G3TA 2BYVE 5E6TA 2QEXB 1LVAA 2P5KA 2Z6BD 3DPTA 3G6EI 1JA1A 2WV1A 4CH7A 3SQNA 1XSXA 2F4IA 5LEKA 2EFWA 2EFOA 3E1YE 4RGRA 5K5QA 1NHAA 3FXKA 2L54A 3L9FA 5LGTA 3ML3A 2CH0A 4XLHA 5GAEJ 2R0QC 2QENA 4O6JA 2XB5A 5FKNA 3X2QH 3N4MA 3HOWJ 3ZQ7A 2GPJA 4X7EA 1K7AA 2CYYA 3QPHA 3OYFA 1T8IA 5F04A 3BG3A 4C9YA 1LEAA 4HNVA 3A8IA 2D3LA 2E1RA 2E1NA 2MD5A 2NTBA 1P4AA 4K1XA 1XSDA 1YW8A 2KIMA 3VYSB 1YI2I 3AVUA 3N6ZA 4LGWA 2M7BA 1ZKGA 1ZYRF 1ETWA 2JRTA 5HS9A 3OZWA 3PSZA 3WTZA 1VQ8I 4B3XA 4XRSG 2ZL5A 4Y3OA 1ZGJA 3CB4A 2ELHA 2L9SA 1VHEA 3ZQHA 2ZBUA 2DN0A 2F5FA 3F8BA 5AONA 3AVYA 3V4GA 5JLVC 3RQ4A 2C5HA 3CPXA 3I59B 1VQLI 4LG3A 4XM3A 1MBJA 2C5BA 2CQKA 3CCUI 4F7DA 4Y52J 3J81Z 4DQKA 3TO9A 2IPQX 4CCLA 3OYMA 3CJRB 3DU5A 4G94A 5F0FA 1X1BA 3JSOA 1WSUA 2O04A 4CYCA 4F91B 3Q38A 3EDPA 3CDIA 1FYKA 3AL0B 2R5YB 4Y33A 3FXUA 2VKDA 4ENMA 3SLDA 1KRHA 2FX0A 2X4HA 1ODDA 1X1DA 4CXFA 2JJ1A 4XKBA 1K83J 1N07A 1X1AA 5A89A 3ZPNA 5J6XA 2Y69H 2QZ8A 1ZR4A 3B8YA 2KQRA 5E3MA 3S15J 3DU1X 2IA0A 5J47A 2KDOA 5K7ZA 1ZN2A 5TJJA 1WGXA 4C43A 5J3LA 4A3BJ 3ZMDA 2Q0OA 5HDKA 2NVXJ 5KAIC 2R7VA 5C4XJ 2LKXA 2KL4A 2DBBA 3KP4A 4WWCA 2BHZA 1NG7A 3NEUA 3IUOA 4CUGA 1LFUP 3H9NA 1W7PD 2E34A 4ANJA 1VQ8B 4HOBA 3OYBA 2BGJA 1LVKA 2WBMA 2PLYA 2JRMA 5E1WA 3LVBA 3IC7A 4P12A 3IV5A 2Q2EA 1IRZA 4OOXA 4GO1A 4WZTA 3J80Z 1UD4A 2WJVA 1YW7A 4QPOA 1ZGWA 2NRAC 1S8NA 2XUBA 4LG0B 1G7SA 4RB0A 1UD8A 2HYJA 4BXXJ 5GV7A 1YW9A 3GCMA 1OYIA 2CW7A 2M4KA 3REOA 3KP3A 4Y7CA 3H92A 2DY1A 3LSTA 4WZKA 2DPDA 3ABLH 1Z05A 3PIOF 2B5OA 2ZCWA 3QU3A 2K9QA 3FJOA 5IP9J 2IP2A 1QVFB 4P3YA 4P1WA 3PSFA 3C7JA 1MNDA 4DZJA 1WJCA 3GFLA 4EM2A 2B7BA 1TBXA 3A35A 4AIJA 4RDKA 2F6CA 3BT9A 3MEXA 3PSIA 4M3DA 3TP3A 2XKOA 5E8GA 3H35A 1BI2A 2EZHA 3C2GA 5FKKA 2FQ3A 2OZ6A 1W9XA 1W5TA 1FWZA 4XRFA 3ZPPA 5C4JJ 1EFTA 3G71I 2P5VA 2LF8A 1HCRA 4G7WA 2NVQJ 4PCQA 3KEYA 1IN7A 2ZSHB 1QZZA 4Y4RA 5LHIA 1XCBA 1IDKA 3K1MA 1RWRA 1BC7C 2BM1A 1OOCA 2R7UA 3ZZTA 2JA2A 4M6VA 1J5YA 5FLXZ 3MMPA 2BVNA 4RD4A 3KPHA 5JFRA 2BX6A 2ZXIA 1VFCA 1LQ1A 2A69F 2CUEA 3DTKA 4FE7A 2E5ZA 3M9AA 1YITI 3T56B 2UXNA 4PDKA 1QGZA 4G7OF 1L0OC 2M45A 1DDIA 2B9SA 1K4SA 2DQLA 2ICWG 1BW5A 3ZCOA 2JN6A 2R5ZB 4OIOF 3R4KA 2HXOA 1VQ4I 2QSFX 1W87A 2CW5A 2ZL6A 4Z1MA 2W24A 1H88C 3N97A 5TISC 1X58A 2R92J 3RY8A 3LMWA 2OBPA 1G3WA 3DBLB 2BM0A 2YSRA 2YX7A 5FKLA 2G0EA 3JRIA 2MBFA 3RZOJ 2PECA 4D1QA 3ZBTA 4PMHA 1U6GA 3OR2C 4FQGA 2VXZA 1B23P 3OL3A 1YJ9B 5H20A 4W97A 5FNZA 1TSPA 2ELKA 2BE5F 3KYDB 3CMAI 4XLCA 3ZMUA 4G7ZF 2OQRA 3B6AA 4XN3A 2M5SA 2DTRA 1B8IA 2L2OA 2JJ7A 4EV0A 3FY3A 4YIIA 1WDTA 2E1BA 3E3VA 3ABMH 1PP8F 3AVTA 4YZAA 1V55H 2HFHA 5B1BH 3I55B 2C78A 3I71A 1AMOA 1IN5A 4A6EA 2VNIA 2STWA 4HIZA 5CDFA 1UD2A 5E20A 2JDIA 2HOAA 3D5LA 3HOXJ 1IXSB 3HBLA 2OU2A 2DXIA 1DU0A 2X3HA 2MFZA 4EW9A 1EH8A 2ESHA 3HPHA 4B1RA 3SLNA 2BY0A 2YX4A 1SFOJ 1T5EA 5ICGA 2HVRA 4DOZA 5L46A 4EATA 4YAOA 3VO1A 2QQ9A 3A02A 4P6YA 4EH1A 2XGEA 2F5VA 3GZ5A 3ZQLA 4A3GJ 2Y2ZA 1BPLA 3CCLB 3ASTA 2RDPA 3MZYA 4Z4UA 2LG4A 3M8JA 3ULQB 1Z91A 4A6DA 2X1CA 4N9IA 1H9TA 1I27A 1JNYA 4XMYA 5F4OA 4BNCA 3HUGA 3HOZJ 3DTIA 2KZGA 1S72B 1R58A 3ZGKA 2V26A 2QE7A 3PUMA 2WWYA 1IXCA 4UUTA 5HLIA 1HW5A 1LPQA 4A3KJ 4A3FJ 1EP3B 2CNDA 3K7AJ 4ZCLA 1H9GA 4HE5A 1HF0A 1OB5A 2VXDA 3CTAA 1TT0A 3GWZA 4X8IA 3Q0WA 1FX7A 4XIDA 1BW6A 5A2QK 2E1OA 2OF7A 1IAWA 5KSWB 5F0HA 3NAUA 2V9KA 3K9TA 1S6LA 3ZMVA 3PO2J 1JT6A 3ERMA 9ANTA 4FN5A 4V19K 4JX4A 1UJ8A 2ZBKA 3I5UA 3TW7A 1REPC 3WTUC 5H6QA 2BV6A 2B63J 5KNLA 3S1NJ 1DU6A 4ESJA 1FX0A 3ZSCA 3A8KA 1CGPA 4DGWB 4G8XA 4XL9A 2D9RA 2Q2EB 3JAMZ 3WTVC 3MKWB 2O03A 4A0XA 2NV4A 1Z0XA 3FK7A 1YFHA 2EV0A 3P4GA 3CC4B 2H8WA 1RC9A 1OHHA 3GBGA 4OU0A 3MCAA 4Z4ZA 3HRSA 3KX2A 1FSEA 2QXZA 1QG0A 2P3MA 5H59A 5LRRA 5B5EC 1APLC 3G05A 1R7JA 2XSDC 2V7WA 2KVOA 3SZEA 2ZSIB 1U9NA 4MTEA 3OYJA 2E2JJ 5LEJA 4N4NB 2QBYA 4XNFA 4OZYA 3DDYA 1SFXA 4GGGA 1FP2A 3Q6QA 4CHUA 3CLQA 4R1HA 3RDIA 2ZL7A 4CICA 1S7AA 4C3JJ 3LQQA 1TTYA 4JBAA 3K70C 4PZJA 4KN4X 1ULYA 4XLAA 2M0MA 4LLLA 3IH4A 2OZUA 1G4DA 3ZBUA 1RR8C 2KJBA 1ETVA 2DAOA 2Q6LA 2JT1A 4X7FA 1KC8D 3A3BA 1IDZA 1JKPC 5KCMA 1ETOA 3Q0VA 4ACAA 3TOAA 1SD5A 3CCRB 2FE3A 2EFPA 4UNOA 4A93J 1IN6A 5DS0A 3DKYA 1ZREA 2HOTA 4BS9A 1V54H 2CWEA 2PQ8A 3E5XA 3ZQQA 4RDUA 1B1BA 1AKHB 1EA3A 2ISZA 1R4NB 1X3UA 4A3JJ 2V79A 1O57A 3BQYA 1YO5C 1FJLA 2OA4A 4HBLA 4WZEA 4PSXA 3ERED 2J5OA 4Z03A 2Q8KA 2LY1A 5M5XJ 1G2HA 5E1XA 1Z67A 4G6QA 3WE3A 4WQMA 4X05A 2BZTA 3SJZA 4I0AA 3HOTA 1HDPA 2DT6A 2BXYA 3KE2A 4XLEA 5C1CA 1OCCH 4I98B 2VBKA 2PFBA 3CXCB 1GXQA 2DK8A 3JSPA 2MLKA 4A3CJ 1PJ7A 1VQ9I 1XE1A 1XQBA 5J3OA 5L3EA 1TTTA 2PE3A 5K7HA 1D1BA 3OZUA 1GT0C 5AN9A 1DPRA 1N78A 1IXRC 2ZJRF 4FHTA 4HG2A 4IHVA 2GOXB 1D1NA 3L2RA 1BIBA 4C0SA 1BM9A 5DNSA 3FM3A 3CC2B 1H80A 1SMTA 1V5GA 3EUHA 2R7SA 4IXAA 3JRCA 2NT9A 3QOPA 2VOOA 2K3FA 4IRHA 4A3LJ 5DTDA 4J00A 4JQFA 2V7VA 1DABA 3JRAA 1MGTA 3N05A 1IB0A 4QVAA 2L7FP 1KYWA 1XX5A 2RAEA 1K6OA 3HHGA 2JZYA 2V31A 4H4KC 4BE0A 3GLXA 1WJAA 1P4WA 1ZG5A 2PLFA 1QX4A 5TR9A 3F6OA 4ZYGA 3ZXSA 3BG7A 4PGOA 2W1OA 4YFXF 3IRQA 5IT9K 1IO2A 3SDBA 5EG0A 1I3AA 2WV0A 2BY3A 3DKXA 4YRVA 2VLAA 1PUFB 3MVPA 2XTXA 3CCQB 4TKOB 3OAAA 2DT7B 4M3GA 4HZFA 2JA7J 3Q9VA 4L5EA 3KLNA 5EGOB 2MG4A 3SFZA 1BX0A 2HR3A 4GCVA 2DFHA 4B44A 3A03A 1MDMB 2J8IA 2XTWA 1A31A 5D8KB 4U0YA 4ZTJA 2GIZA 2P0WA 1SD4A 3GMEA 2Z9OA 4BL0B 4A3MJ 4ON0A 2UVEA 1WKMA 4XONA 3FKSA 5KAFC 1WFXA 1LDKB 2GK7A 1JXSA 3G71B 2VKEA 1IDJA 3VSLA 4KIGA 1HF2A 3PSSA 1T38A 4QTRA 2L3DA 5EYRA 2W82A 3CCEI 1SAXA 3WBKA 1R5GA 1QRYA 2DDBA 3HRTA 4ABZA 3JTGA 1Q82D 3SXYA 5FKMA 4CCJA 1D1AA 1PJRA 4PC7A 3BPVA 5ICEA 3SQVA 4AIDA 4M53A 1JRGA 1W36C 3KZZA 1I8DA 1FOWA 2OD5A 4L9TA 3H1CA 2LDUA 4G9YA 4EJUA 2XNCA 4PC1A 2DFEA 2VC1A 3KIOA 4KIBA 2AXTC 1MKMA 3OYCA 3OYLA 5DDGA 4KISA 2NNYA 3KYLA 2MC4A 3M7GA 2BN4A 3D5RC 3GZNB 4KUMA 3U2RA 3OIQA 4L9NA 4YC5A 3COAC 2WR8A 2XGJA 5FLMJ 3QODA 2Y31A 3SEQA 3J80K 2W4SA 1VQPI 1TWCJ 4YAUA 3GQ7A 3A2KA 4MXNA 1P2FA 2G7HA 1VLOA 2ZBVA 3H36A 2JJ2A 4M73A 1LFPA 3WG9A 1XD7A 2V4JC 2VI6A 5AIQA 5K5RA 2XKPA 3OYKA 3CCMB 3NRVA 3AVVA 3ASOH 4X0GA 4L8JA 1MBFA 2LR8A 2YR2A 3QYBA 4N0BA 2MGQA 4OIRF 3OJWA 3CMAB 2XAJA 2ZB9A 1I6HJ 4X06A 2OCCH 2UVFA 1R5ID 1TW2A 3Q5FA 3RIQA 1V0FA 2BM4A 1ON1A 2V9PA 1UG0A 2CJJA 2O5RA 1O8EA 2XHKA 3IH3A 5GPCA 1K8AD 2Y75A 2IXSA 3K1PA 1BLIA 2QMUA 4MYUA 4YHBA 3S2HJ 3CPWB 2JPCA 5E1ZB 1YRNA 2DW4A 2EIKH 3R60A 2M8EA 3PVDA 5E8IA 2OTLB 1QUEA 2ODLA 2VASA 1XB4A 4LBWA 5ILSA 3SHFA 4BJTA 1O88A 5KK1A 2CRGA 3WG7H 3CCUB 5D5VB 4A3IJ 3CQZJ 1O8HA 4JK1X 1Q9SA 2ETHA 3MN2A 2LOOA 3PFYA 2C4TA 1ON2A 1IGNA 2DI3A 1DP3A 1XMKA 2RQPA 3Q9SA 1FNMA 2QGUA 2HPIA 4PJLA 2HEOA 2BF4A 1WU8A 4H9GA 3JREA 3ECOA 3T9GA 2EFGA 3Q39A 5HZAA 2IRFG 4RDLA 2IJLA 3F8MA 4P9UA 4F93B 1O7FA 1XDUA 4TSFA 3JRDA 3VMFA 1G3SA 1V5FA 2ECBA 1MZBA 1DARA 3OSFA 2ZTGA 2KRCA 3BR1A 4B4DA 3I59A 1OGJA 3SYTA 1SVLA 3BZKA 1S0UA 1VBLA 4P9FA 1X3ZB 3QFCA 4I84A 3FIWA 3SZGA 4I99C 1OR7A 1MBEA 4KMFA 3SYJA 3CCRI 3GVAA 1W1WE 2OAZA 4FETA 3W2IA 2XB0X 4PSWA 3Q3SA 1TQIA 3T0YA 4OWRB 3I54A 1PKVA 2NTQA 4M1KA 4IVNA 4F3QA 4AYBA 5IK2A 4P2NA 2O0WA 3AFHA 2RKHA 1PYVA 1VI0A 2L9VA 2L01A 4CZZA 2LD5A 3HTSB 3QFSA 4ZH4F 3OYHA 5EG0B 1KZHA 3WTYC 1PUFA 4YZQA 1CF7A 3DEWA 4LIVA 1MMDA 1LEBA 1MBHA 3QWLA 5LGNA 3JR9A 1H85A 4HDUA 2WAQA 4HX7A 3TP0A 3VFZA 1I18A 1TWGJ 3SUCA 2F1MA 3TKYA 1J2XA 1HQCA 4XORA 3C3WA 3PNTA 3OZVA 2CU7A 2RNGA 4G6IA 5GPAA 2IAIA 3IKVA 2ZITA 4BQAA 1S3JA 2WA0A 5JLXA 1H42A 4ZTFA 5GTHC 2RC6A 2DQRA 1JUSA 2A5YB 2CQQA 3HEFA 2R7ZJ 2GM4A 3GTKJ 3LFUA 2P5LC 4IHWA 3A3GA 3I64A 2O7OA 2R7DA 2R7OA 4HF2A 2HYFA 5F1RA 1GJRA 3KRGA 1PUEE 4I2OA 3QP5A 2R3SA 2V1XA 4AYBN 2WPDA 3K1NA 3ZMSA 1RQPA 1WORA 4MEXF 3K4KA 2VFOA 3BY1A 2KDZA 5F0CA 3R0AA 3AAFA 2V1DA 1KK2A 2ZMEA 1RKWA 1X4OA 3HTUA 4P96A 4W1UA 4E0FA 3VSUA 2PMHA 4JRAC 2MSYA 3EPZA 2K4JA 2XDVA 3HB9A 3S93A 1O3QA 3GTJJ 3CCVB 4BBSJ 3V76A 2FMYA 2HMAA 4YFKF 5F1JA 4IPAA 4P22A 3BTIA 4XRMA 4OAYA 1O8GA 5CVJA 4A3DJ 4WXHA 3SZTA 4DYCA 5DSZA 1QA2A 5F6FA 5DM6F 1KU7A 1F20A 4D7NA 1RIOH 3ECHA 1MNMC 3R6KA 2V7XA 4HW0A 1HA8A 2CS3A 3G1LA 2A68F 3BJAA 1Z77A 5B1AH 1KU9A 1W0UA 2I10A 1S9HA 5F08A 3SFIA 3L1PA 1ZH5A 5F4MA 1IHMA 2JPBA 4J01A 1W7PB 4A3EJ 4F92B 2JUCA 5DUIA 5M5YJ 1FRNA 1YS6A 1XDSA 2LYCA 4FTHA 2C4UA 1QFYA 5K1YA 4PAAA 2NVTJ 2EIXA 2Z33A 2X51A 2XF7A 2PG4A 5FFZA 3L2QA 2KIFA 2LNBA 2MD0A 3GFMA 3QOEA 2ZJ2A 4IOCF 1E1QA 1N0UA 2BV3A 4PFPA 3OS0A 4BHPA 1KK0A 1E64A 3ABTA 4NCNA 1O8FA 1A04A 2E71A 4RDJA 1UELB 2INUA 3OS2A 1Q1VA 2H1LA 3U21A 5DM7F 2H27A 2VNJA 3CCVI 3LSHA 1MNEA 2GXGA 3K10A 1KA8A 1XGMA 4A0YA 4RM0A 1XG2A 1QQ1A 3B90A 3DPUA 4Y7NJ 3KETA 2QLZA 5AIPA 2IW5A 1TWHJ 1MSFC 4I76A 3FMQA 4CQJA 1HKQA 1AA7A 5DCMA 3UR3C 2K3PA 3OYAA 1B4AA 5J35A 2CGPA 2JMWA 3WU1B 2XF6A 3BLYA 2HDWA 2K7LA 2EA2A 3HKZN 2BW3A 4RB1A 1BR4A 5LBQA 1DDNA 3WY9A 5JHFA 3IAM2 2FQ4A 2JSCA 1FBUA 1QZEA 1TT5B 3AGQA 2EQRA 4FCYA 2GK6A 1WPKA 3JTHA 1YHQI 3WNDA 2VQLA 3F0CA 2V6CA 2HOSA 4L0YB 1VTNC 4IOAF 4W8QA 4HF0A 3J7AO 4YCQA 1TQMA 3BCBA 4RBOA 1IC8A 4IW3B 2PYGA 4NC8A 2AHOA 3P5JA 2XVCA 3E6BA 4LB6B 2HKXA 2NS8A 2LREA 4LJZF 4AVZA 2ZZFA 4BH9A 1YJNI 5B6IA 1JHHA 5GADJ 3QU6A 3LFKA 2GQQA 3CDLA 2PMUA 2XGXA 1DQUA 3HHHA 1FMWA 4BY7J 3JCUC 1TW3A 1E3PA 2K9SA 4QLCU 2GOMA 2NYXA 3ZN0A 4NC7A 2NT6A 1OLTA 3E7LA 2K9MA 4Q48A 2JVGA 4YEIA 1P4MA 2NOJB 2ZNYA 4EEFG 2DOGA 2E35A 1ZG3A 3RKWA 5DEQA 1SM4A 1M90D 3V7RA 2EILH 2I8DA 2NOGA 4ZZDA 2Y9ZA 1JHFA 2JQ7A 1O7LA 1P92A 4UZEA 3A01A 1KCDA 5KHDA 5JVGF 1J9ZA 1KQ5A 1OQYA 3VSTA 1KJZA 1R4MB 2KIQA 4YAWA 3G4SB 4V2FA 2GA2A 1E79A 1W34A 3FXQA 3TMOA 2M9HA 4RB3C 5FRNA 2HGCA 3ONYA 4E6KG 1ZTRA 2EH3A 2JK3A 4MGRA 5BQTA 4KKTA 5DD8A 3OYEA 1B8IB 4G5GA 1MBGA 2XRLA 4I09A 3AKZA 2LBFB 3EQNA 3H0GJ 2W84A 4N9HA 4BQQA 3JRFA 2J5PA 1KQSB 3LA7A 2NXNB 4HQEA 3F21A 2FU4A 1JJ8C 3OWTA 2HPMA 4XLFA 2G7UA 3MKLA 1TYWA 3FX3A 4S05A 3E20A 5DD4A 3W2EA 5FFXA 2Q6OA 1OKRA 1VLYA 4XKWA 2ZXJA 2LC2A 1PP7U 1A36A 2FBHA 3LAJA 1UMKA 2FVGA 2W7ZA 3FXLA 1VF9A 3GTQJ 1CLWA 4W8RA 2VKVA 4FE4A 1ETQA 3TDZC 5KW9A 4XOTA 1OCTC 2A61A 5HLTA 4X0CA 3F8FA 3JQQA 4DK0A 1USTA 3R0JA 2EV5A 3CO6C 3LSRA 2VFNA 3RI4A 1MW7A 5CQGA 4WX9A 1FNDA 4DK1A 2ZMEC 4NDLA 4PFOA 5IPAA 2YPRA 3HPGA 3VODA 4QFMA 1NK2P 2YWHA 4CYDA 2LK2A 1FMVA 2M3AA 1KTVA 4BBRJ 3HL2A 2DA3A 5IT3A 4Q47A 1OCZH 4BKXA 4ACBA 1I50J 3QPLA 2GXBA 1TWAJ 3FDYA 4A5MA 2XZOA 2DJNA 4GYIA 2EJRA 4A69C 4OJOA 1FTTA 2JSPA
chains in the Genus database with same CATH topology
2UWMA 4OJ6A 3H9GA 4YEJA 3DKYA 4Z06A 2QY1A 1U0JA 3WWGA 4BS9A 1ERDA 3ZQQA 1W0JA 3EUKL 2IQ7A 4NNJA 1H8HA 1SKYB 1EA3A 3FBIB 3W2AA 2KMUA 4XD7A 2A6TA 2HQAA 2BOLA 4PSXA 1HZEA 4Z03A 3BCDA 3OS1A 4URRA 2LY1A 2W7NA 3LMMA 4C2UA 2VJJA 3LSMA 4XR6A 3S3MA 3BH4A 2ZZQA 2O1DA 3HOTA 4E7IA 2DT6A 4XLEA 4CZCA 5CPRB 1KTWA 4CCOA 5C1CA 1OGMX 2VBMA 2VBKA 3CMMA 4DIQA 3HKZA 4G6TB 4HNUA 3GRHA 1E3ZA 1WPCA 2XOKA 3EUHC 1D1BA 4XN0A 2VJIA 3QYFA 4DJAA 1N78A 4HG2A 4PJNA 5FRMA 2GOXB 3KEWA 3L2RA 2IGKA 3B4NA 2GJRA 1H80A 2NT9A 1V5GA 2R7SA 2O0VA 2ELJA 5LFAA 3GVJA 1G8XA 2KHMA 4J00A 4JQFA 2RREA 1WJFA 1WTHD 3N05A 2XNDA 4BDZA 2PJRA 1OB0A 4ITVA 3I3LA 2V31A 4H4KC 4PJJA 4BE0A 3DU6A 1X1CA 1WJAA 3GVKA 1W36D 4C2LA 4BU2A 3IP4B 2HVQA 3BG7A 3ZXSA 3BG6A 2W1OA 4E4HA 2WY7Q 2BW3B 2AQFA 4XKVA 3SDBA 2UUZA 1O8MA 3DKXA 4YRVA 5HNHA 1OFLA 2VLAA 2V4DA 2ZXHA 2QKMB 1KMHA 2QKLB 4UZUA 3OEHA 4TKOB 3OAAA 2VJ5A 1O8DA 2DT7B 2NSTA 1O8IA 4DNRB 1PXZA 3HAGA 2VPLA 2R7QA 4PUSA 4BXFA 2R7RA 4E7SA 2X1DA 3K70D 1V0EA 2DOAA 3DQVC 2W6IA 1T95A 3OW7A 2R4GA 4B44A 3NWTA 1NBMA 4ZTJA 2P0WA 4II2A 1IRXA 2XZLA 4BL0B 2UVEA 4OAZA 4XONA 5FROA 3FKSA 3T51B 1YX5A 2IGMA 1WFXA 1LDKB 4LITA 5HKKA 2GK7A 3MD2A 4QPQA 1IDJA 2JIZA 3JURA 3K4MA 3VSLA 1EE6A 3PNYA 1V5EA 3OR1C 4C30A 3PJRA 4DNTB 2Z8GA 2W82A 4RMNA 2QX3A 5CQEA 4BE2A 2CW8A 4IKFA 4CCJA 1D1AA 1PJRA 3VSKA 1K6YA 3VMWA 4B3GA 1W36C 1JRGA 1I8DA 1R6RA 1NHCA 2Z16A 1DGWY 1D1CA 3BCFA 1MABA 3OYCA 3OYLA 1NG6A 3S3OA 4KISA 3GQ8A 4JMQA 3KYLA 2MC4A 3CESA 1WMRA 4BEHB 3D5RC 2UV1A 2WJYA 1KZLA 3H5AA 4RLFA 3OIQA 1BR1A 4HSRA 1DGRM 3M1CA 1HG8A 2IS1A 1RMGA 2XGJA 1Z7LA 3QODA 3SEQA 1QHHD 1CZFA 2W4SA 3GQ7A 3OIPA 1IB4A 3A2KA 3L2WA 4MXNA 2PMZA 5AMVA 1ZELA 4CCKA 1H8EA 5DN6A 3T53B 2JJ2A 1LFPA 4ZDPA 4IZZA 2V4JC 4IQ4A 3HXLA 3OYKA 3QYEA 2HVSA 1BMFA 2X53S 3K4CA 4X0GA 4B48A 3GVLA 4L8JA 4HEA2 3QYBA 3OFNA 2UVFA 3C2HA 4F55A 1JTAA 4PJMA 1SAUA 2JUGA 1WJDA 2WADA 3PNVA 4HSTA 1Z3XA 3RTRA 3OYDA 1V0FA 1AIRA 2EWEA 1UG0A 2K9LA 2V7FA 1E0EA 3GQ9A 2O5RA 1G59A 4RM3A 2LRDA 1O8EA 3K6GA 2E1MB 4W8SA 3DEEA 3J7AY 4BQOA 3VMVA 1TZLA 2IXSA 5HOOA 4IX7A 1BLIA 3OPOA 2KPMA 4BGDA 2AQEA 2KRHA 4U7BA 3K4JA 4KITB 2X6YA 3OE7A 4XOPA 4YZXA 1UAAA 4B47A 2ODLA 1VZ0A 2VASA 3G2BA 5HVQC 2R7WA 3LSIA 1O88A 4BJTA 1K5CA 3EUAA 3GQAA 2Z6BD 3DPTA 1O8HA 4CH7A 2F4IA 2LOOA 3PFYA 3ONQA 4BEHA 4RM2A 3DPLC 2BVLA 3E1SA 1DP3A 1QCXA 3PL8A 3LL7A 2HPIA 4PJLA 3WQZA 4OJLA 1BR2A 3E0JB 1JI8A 4Z05A 2CH0A 4XLHA 3T9GA 1Y56A 3CJQB 1K28D 2VBEA 5TGTA 4F93B 4G7XA 4TSFA 1V5FA 3SEZA 3OYFA 3OOUA 2ZTGA 4OJPA 4C9YA 2KRCA 2IS2A 4C2TA 2D3LA 3SYTA 4N4OB 2W6JA 2NTBA 1VBLA 4GQNA 3ZR8X 2NSPA 3VYSB 4XQFA 4E7KA 4I84A 3SZGA 2LY2A 2WY8Q 2IS6A 2M7BA 4BUPA 3BC9A 4E7ZA 2E5NA 3A4CA 4B3XA 4Y3OA 2D3NA 4FETA 4FASD 3TBIA 4PSWA 2L9SA 2KZVA 4OWRB 1PKVA 4BQNA 2NTQA 2IS4A 5IK2A 3RQ4A 4AYBA 4F3QA 1UD5A 2O0WA 3AFHA 4ZYAA 1PYVA 4LG3A 4XM3A 4HWVA 3HOSA 4TT3A 2DCEA 3H9QA 3MKYB 4II3A 1WJBA 4CCLA 3CJRB 3DU5A 3OYMA 1J09A 1X1BA 2R7TA 3OYHA 2O04A 3MMYB 1X0CA 4YZQA 4F91B 4CCNA 4LIVA 1MMDA 1EFRA 3BC8A 1D0YA 3AL0B 3CP2A 4Y33A 2VKDA 2WAQA 4CCMA 1MMNA 4BACA 4YXWA 3K4NA 1X1DA 1I18A 3SUCA 2JJ1A 2BVMA 3H9JA 2F1MA 4XKBA 3OY9A 3F9KA 1X1AA 2Q1ZB 2WZPP 3ZPNA 4XORA 3PNTA 1MMAA 4KKUA 2PJRB 2RNGA 4HRIA 4G6IA 3B8YA 1OR7C 2XF5A 1E1RA 2KQRA 2WA0A 2ZZEA 4ZTFA 4R79A 5LD2C 2KDOA 2R7XA 3OEEA 4NK8A 1QHGA 1Y6IA 4U4BA 1UD3A 3FKJA 3LFUA 4U87A 3DLAA 2R7VA 2OV7A 4U49A 2KL4A 3A3GA 3W2WA 1KCCA 3K4LA 4BJ6C 1NG7A 2R7OA 3IUOA 4CUGA 3KRGA 4ANJA 1SFKA 3OYBA 1LVKA 1DBGA 2OC6A 3DWLE 2WBMA 3VWBA 2WPDA 4MR0A 2X6WA 2X85A 3K4KA 2HU9A 3JU4A 1X4OA 4ZC3A 3VYUB 1O8KA 1UD4A 2WJVA 4QPOA 4B43A 4E0FA 1WJEA 3VSUA 1QU3A 1D0ZA 1UD8A 4BJ5C 5HNFA 1KONA 3OYIA 3S93A 3EPZA 2XDVA 1WJ5A 2CW7A 2ZZGA 2M4KA 3DTEA 5C1EA 2ZTNA 4P22A 2MABA 4BDYA 1O8GA 4OJ5A 4OAYA 3AL0C 2GJPA 2NTPA 3VYRB 4W8TA 2WB1A 4P1WA 3PSFA 1MNDA 2A5WA 4LIUA 3L2UA 1WJCA 2HNHA 1Z21A 3HUGB 1IA5A 3LNNA 1HA8A 2CS3A 3A35A 1BN8A 4JOMA 2F6CA 3K4BA 1NRKA 3PSIA 3H35A 1S9HA 4NUBA 1W9XA 4HNTA 2KLOA 3C2GA 4J01A 3UW0A 2M4GA 3S32A 4F92B 1OFMA 1X19A 3ZPPA 1E3XA 2F43A 4G7WA 2OUMA 2LYCA 1COWA 3KEYA 2ZSHB 3RPUD 4IQJA 1VJSA 4Y4RA 3S3NA 3OMYA 1IDKA 2X51A 1RWRA 2XF7A 3OL4A 3L2QA 3QOEA 2MD0A 1E1QA 1YX3A 2R7UA 3ZIAA 1OOCA 2JA2A 4PFPA 3OS0A 3H5NA 2ZXIA 1O8FA 2CUJA 3DTKA 2CMPA 2E5ZA 4F52A 1UELB 3T56B 2INUA 3OS2A 3U21A 3TL4X 3LSHA 1MNEA 1P9QC 3K10A 4RLQA 1XG2A 2FUG2 3ZCOA 3B90A 2WSSA 3RSNA 3DPUA 1OGOX 2KP6A 4Z1MA 2Z2SB 2X6XA 2V1NA 1AA7A 3UR3C 3LMWA 2K3PA 3ZRGA 3OYAA 2VQCA 4YZ0A 1T0FC 2VQHA 2VJ4A 2CV2A 2XF6A 3BLYA 1N77A 4ZDOA 2HDWA 2XSJC 2LZJA 5CDFA 2BW3A 3OYGA 4BE1A 2M7AA 3NE5B 3IAS2 1BR4A 3FHNA 2PECA 4D1QA 5JHFA 3IAM2 3VYTB 2PYHA 4PMHA 2Y0SA 3OR2C 2DIEA 2VXZA 3OL3A 2LH9A 1RU4A 2GK6A 1VF7A 4XLCA 2VQLA 4W8QA 4XN3A 2M5SA 2R9VA 3V42A 2L2OA 4KJZA 3FY3A 2VIXA 3BCBA 3S8PA 2E1BA 2PYGA 1HVXA 4NC8A 4YZAA 2JVHA 4NK6A 4B3FX 1UD6A 3UNGC 4HIZA 2LREA 1W0KA 4AVZA 1UD2A 2ZZFA 1D0XA 2L9NA 2JDIA 4E7LA 3D5LA 2L7KA 4KT6A 3H94A 4AU7A 2DXIA 2INVA 2X3HA 2MFZA 3LSKA 3L2VA 4EW9A 1DQUA 3HPHA 4FXUA 1FMWA 1PLUA 3CF2A 3PUBA 2MYSA 2Z1DA 2HVRA 4GRIA 1T5EA 1WP6A 2GOMA 4DOZA 3EQOA 4NC7A 4EATA 1OLTA 1O8LA 2NT6A 2K9MA 2JVGA 2NOJB 4XKCA 2F5VA 3OYNA 2ZFUA 1YE9A 1BPLA 2CK3A 2CV0A 4DBRA 1LKXA 2LG4A 2I8DA 3M8JA 1QJVA 1PE9A 2HLDA 1KCDA 2XAUA 5KHDA 3NWSA 2X1CA 3RCOA 4XMYA 3VSTA 2V7QA 3FPPA 3W3CA 1E79A 3DTIA 3VSVA 2LBFA 3ZGKA 1MMGA 2V26A 2E1MC 3TMOA 2QE7A 4KKSA 3CP8A 5FRNA 1GQ8A 3BCAA 4E6KG 3CZ6A 2VKHA 4MLOA 4NQWB 2XC7A 2V6EA 2CFOA 2NZMA 4KKTA 3OYEA 2VXDA 1TT0A 3HC7A 3AKZA 2LBFB 1X4PA 4DBQA 4BQQA 3EQNA 4OZZA 1GLNA 2V9KA 5CKTA 3H5RA 3OWTA 2HPMA 4XLFA 4HPQA 2RQQA 2XZPA 5KNLA 1FX0A 4CSWA 3ZSCA 1VLYA 4XKWA 4DGWB 4XL9A 4ZJZA 2LC2A 2Q2EB 3MKWB 3GQBA 4W8RA 1OHHA 3A1YA 3GBGA 3MKZA 4E7JA 3OOCA 2K5CA 2VL8A 2IGOA 3HG9A 3KX2A 2X1EA 4YELA 2QXZA 4ASUA 4XOTA 4CA0A 3G05A 5HLTA 3LSGA 2KVOA 4DK0A 4ZDLA 2ZSIB 1O8JA 3D5SC 3OYJA 4N4NB 2CV1A 1E43A 1MW7A 4XNFA 5CQGA 4D9JA 4DK1A 4PFOA 2E60A 1BOBA 4OZYA 5FL7A 3HPGA 3W2VA 3DDYA 2HZDA 2BSPA 2X8KA 2L5QA 1FMVA 3FBNB 4P5OA 2M3AA 4E7HA 3H0DA 3K70C 3HL2A 2VQGA 1DBOA 3VR6A 1N75A 4XLAA 3I9V2 2M0MA 2W00A 4PK4A 2CUZA 2GJKA 2IGNA 2WAFA 2WAEA 3FDYA 3VDXA 1BHEA 2XZOA 2O17A 3A3BA 4OJOA 1Z3YA 2VB6A 5KCMA 2DJIA 2JSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OJ6 A;  4XLC A;  4W8Q A;  4YEJ A;  4XN3 A;  4Z06 A;  2QY1 A;  3B8Y A;  3WWG A;  1HG8 A;  1RMG A;  3FY3 A;  2PYG A;  1CZF A;  2IQ7 A;  4YZA A;  3GQ7 A;  4NK8 A;  4NK6 A;  4MXN A;  1IB4 A;  5AMV A;  4U4B A;  4U49 A;  4AVZ A;  1KCC A;  4Z03 A;  4URR A;  3KRG A;  2INV A;  4EW9 A;  2VJJ A;  2X3H A;  4XR6 A;  1DBG A;  4MR0 A;  1PLU A;  2O1D A;  2X6W A;  4XLE A;  1KTW A;  2X85 A;  5C1C A;  1OGM X;  3EQO A;  1O8L A;  2NT6 A;  2UVF A;  2VBM A;  1JTA A;  2VBK A;  1O8K A;  3GRH A;  2EWE A;  1AIR A;  3GQ9 A;  3VSU A;  1O8E A;  1QJV A;  1PE9 A;  1KCD A;  4W8S A;  4XN0 A;  2VJI A;  3VMV A;  4XMY A;  3VST A;  5C1E A;  3B4N A;  2X6Y A;  1H80 A;  2NT9 A;  3VSV A;  4XOP A;  2O0V A;  4YZX A;  2ODL A;  1O8G A;  4OJ5 A;  1GQ8 A;  2NTP A;  1O88 A;  2NZM A;  4W8T A;  1K5C A;  3GQA A;  1O8H A;  3EQN A;  1IA5 A;  1BN8 A;  1QCX A;  4OZZ A;  4C2L A;  4OJL A;  4XLF A;  4Z05 A;  3UW0 A;  4XLH A;  3T9G A;  1OFM A;  3ZPP A;  4XKV A;  1O8M A;  2VBE A;  1OFL A;  3ZSC A;  4XKW A;  4XL9 A;  2NST A;  1O8D A;  4OJP A;  1IDK A;  1O8I A;  1RWR A;  1PXZ A;  4W8R A;  2NTB A;  1OOC A;  1VBL A;  2NSP A;  4XQF A;  2QXZ A;  4YEL A;  4I84 A;  1O8F A;  2INU A;  4XOT A;  1O8J A;  4XNF A;  1XG2 A;  2UVE A;  4XON A;  3B90 A;  4OZY A;  1OGO X;  2NTQ A;  1IDJ A;  2BSP A;  2O0W A;  4XM3 A;  4HWV A;  3JUR A;  2X6X A;  1EE6 A;  3LMW A;  4YZ0 A;  2Z8G A;  2QX3 A;  2O04 A;  1DBO A;  4YZQ A;  1X0C A;  4XLA A;  3VMW A;  1JRG A;  1NHC A;  2PEC A;  4PMH A;  2PYH A;  1BHE A;  2O17 A;  3SUC A;  3GQ8 A;  4OJO A;  1WMR A;  1RU4 A;  4XOR A; 
#chains in the Genus database with same CATH topology
 2ID6 A;  3GTO J;  1Q81 D;  3B78 A;  2QY1 A;  1U0J A;  1ZHF A;  2TCT A;  3WTW C;  1D8J A;  2K9N A;  4WF2 A;  4QV2 A;  3RKY A;  4NQW A;  2HQ5 A;  1B72 B;  5HS7 A;  2IQ7 A;  3KCC A;  4NNJ A;  1H8H A;  1SKY B;  3BY6 A;  4UVA A;  2A3S A;  4LK0 F;  1JUP A;  2XAF A;  1SD6 A;  1A6Q A;  3W2A A;  3EYI A;  4XD7 A;  3CW2 A;  4YDT A;  4Y9U A;  2A6T A;  2HQA A;  3SDG A;  1XS9 A;  1O3R A;  3CME I;  3RPU A;  1EA0 A;  1BBY A;  4MYT A;  4URR A;  1TUI A;  2DPU A;  3CF5 F;  3LMM A;  4C2U A;  2VJJ A;  3LSM A;  3H3U A;  1P7I A;  2PJP A;  2GRE A;  4Y13 A;  2W25 A;  2DA4 A;  3BOQ A;  4CZC A;  4U7D A;  4M4S A;  1ZK8 A;  4CCO A;  5EEH A;  2H6C A;  5L3G A;  3K2A A;  3CMM A;  4LOC A;  5A88 A;  4HNU A;  4C3H J;  2DA2 A;  1XMX A;  1W5S A;  2J8K A;  1FIP A;  3WU2 C;  1ZRC A;  3ASR A;  3FK6 A;  5CVU A;  4GDF A;  3I1F A;  1WPC A;  3BG9 A;  3CRZ A;  1V3F A;  2V9V A;  3EUH C;  3TQN A;  1T6S A;  1U5T B;  4PJN A;  2QYO A;  1BIA A;  3WNB A;  4IL6 C;  1XCV A;  1IJW C;  4TMX A;  2BY2 A;  3QPT A;  4MFD A;  1QGA A;  2O0V A;  5E18 F;  2ELJ A;  1KQ8 A;  1EP2 B;  3GVJ A;  3DV8 A;  4MQ9 F;  4OIP F;  2HS5 A;  2RRE A;  1W2B B;  1WJF A;  1WTH D;  3AVW A;  2DET A;  2XND A;  2EPF A;  4BDZ A;  1KGS A;  4X7C A;  1IV8 A;  3JAM K;  1N8R D;  3G3Z A;  2H09 A;  4PJJ A;  1X1C A;  1RPW A;  3GVK A;  3NQO A;  5THX A;  5GTI C;  4BY1 J;  2YWE A;  1OIS A;  2PX9 A;  3R6S A;  2HVQ A;  3ASN H;  2JWT A;  3TO7 A;  2EA4 A;  1R5O A;  4Y15 A;  2WY7 Q;  4ENJ A;  2GWR A;  2DEU A;  2AQF A;  1Q86 D;  1WHU A;  2UUZ A;  4D7M A;  1ZLK A;  5EEG A;  2L4M A;  1QA3 A;  1OFL A;  3AK5 A;  3BH6 B;  2ZXH A;  1R1U A;  4OPV A;  3U9G A;  2QKL B;  3FMS A;  1AIP A;  5DCM B;  2VJ5 A;  1T56 A;  5LRS A;  4OMZ A;  1XN7 A;  2QUF A;  1IJE A;  3W5U A;  3C1D A;  4B4C A;  4DNR B;  5BOX A;  1O8I A;  3O2P E;  2VPL A;  2R7Q A;  3BJ6 A;  4PUS A;  2IOU G;  3M3Y J;  3U6K A;  3K70 D;  1LM1 A;  3TED A;  3NWT A;  1NBM A;  3CCM I;  2M87 A;  1EFU A;  3B73 A;  1BI0 A;  1FBS A;  1IRX A;  4II2 A;  1YJ9 I;  2XZL A;  3BRO A;  3AVX A;  4I0B A;  3NAR A;  3LA2 A;  5HDG A;  1J9I A;  1QFZ A;  3GW2 A;  5EF6 A;  1TNT A;  4LIT A;  2CUF A;  1NK3 P;  1FTZ A;  4TMV A;  4Z2Y A;  2E2H J;  1WSR A;  4U9U A;  3K4M A;  2YS9 A;  1EE6 A;  1UHW A;  2K85 A;  3PJR A;  2RGV A;  4AD9 A;  4RMN A;  5FO0 A;  5CQE A;  4IKF A;  1YJN B;  3FPK A;  1W7P A;  3VMW A;  1MRZ A;  4B3G A;  2MH9 A;  4IHT A;  4LFU A;  4EJO A;  1VQK I;  1NHC A;  5BMZ A;  1DGW Y;  3GQ8 A;  3SY2 A;  4C3I J;  4EQQ A;  1FY7 A;  3HRM A;  1UZC A;  4BEH B;  1YOV B;  5HLG A;  3GTL J;  2VBZ A;  2W57 A;  1HG8 A;  3ASS A;  5DYM A;  1ENH A;  3TH0 A;  4UB6 C;  1BJZ A;  2ZJQ F;  4B3A A;  1T6X A;  2LF7 A;  1IDY A;  4HF1 A;  1YIJ I;  1WOP A;  3SEJ A;  3L2W A;  5AMV A;  3WYA A;  4YIF A;  3HOU J;  4M6Y A;  5LLQ A;  4ZDP A;  4UUS A;  4IZZ A;  1U8R A;  1U3E M;  4M2L A;  1T2K A;  4PGH A;  1YTY A;  4I6Z A;  3QYE A;  4QUZ A;  3G4S I;  3RQI A;  2HVS A;  1XMA A;  1JKQ C;  2X53 S;  3K4C A;  2RN7 A;  1KQ9 A;  4M3F A;  1OGI A;  2O3F A;  2OK7 A;  3M07 A;  3GVL A;  1U9O A;  2IA2 A;  2BGC A;  1VQ5 I;  3JX8 A;  1D5Y A;  4OIN F;  1YG2 A;  3LNQ A;  1SAU A;  4HST A;  1WJD A;  1RET A;  3RTR A;  4HA8 A;  1Z3X A;  4DYR A;  3OYD A;  4L0Z B;  2V7F A;  2K9L A;  2L0K A;  3T5X A;  1E0E A;  1R49 A;  3AGP A;  1XGN A;  3FF5 A;  3WOD F;  2VNH A;  5C3E J;  4B8X A;  2YUS A;  1QQI A;  3K6G A;  1YQA A;  3MAJ A;  4BQO A;  1TZL A;  3R61 A;  5HOO A;  4RLZ A;  3FXR A;  3OIO A;  2KPM A;  4N3N A;  2AQE A;  2CSO A;  3LQ6 A;  2VBT A;  2X6Y A;  4M9S A;  3RYP A;  6PAX A;  4B47 A;  4QVJ A;  4Z6Y A;  1ZRD A;  1MSE C;  5L3C A;  5ERI A;  3GQA A;  5EEA A;  3S16 J;  2GXA A;  3ONQ A;  1R23 A;  2LFB A;  4BEH A;  2QCO A;  4RM2 A;  3DPL C;  2BVL A;  3E1S A;  5C44 J;  1E3O C;  1U8B A;  3LL7 A;  4HAM A;  2QA4 I;  4LLG F;  4U0W A;  3GTG J;  3LO8 A;  4OJL A;  5JLW A;  5FLX K;  5FA6 A;  2P4W A;  1JI8 A;  4Z05 A;  2CQX A;  2DO7 A;  1EH6 A;  1Y56 A;  1E2X A;  3BP8 A;  3CJQ B;  1K28 D;  1IUY A;  4YAL A;  3W2H A;  1AU7 A;  3SEZ A;  4QWQ A;  3MZH A;  4OJP A;  1B6A A;  4UXN A;  5BPD A;  3ZR8 X;  3S1Q J;  5A8A A;  2NSP A;  3L09 A;  2VBU A;  2VE8 A;  4E7K A;  3WBJ A;  5FKO A;  2HDD A;  2DCU A;  2IS6 A;  4BUP A;  5D5U B;  1TVC A;  4Z4S A;  3CCJ B;  4I7H A;  2F5C A;  3CD6 I;  2ISY A;  1QBJ A;  2C6Y A;  4FAS D;  4HYE A;  1SAN A;  3TBI A;  3TO6 A;  2KZV A;  5J1R A;  2TRT A;  1RUN A;  4WK8 F;  3CLO A;  4ZYA A;  4HWV A;  2COM A;  2P6T A;  2Z5U A;  1JKR C;  4TT3 A;  3GFJ A;  4L9J A;  2DCE A;  3H9Q A;  3MKY B;  4II3 A;  4RD3 A;  2XAS A;  1QPI A;  1KK3 A;  1J09 A;  1WI9 A;  2AHQ A;  4EGZ A;  2PMD A;  3MMY B;  1XPX A;  1X0C A;  3GUD A;  1SVM A;  4Q7J B;  2WB1 N;  1IRG A;  1EFR A;  3BC8 A;  3WTS C;  5HDN A;  4XLP F;  1G7T A;  1N0V C;  2DK5 A;  5BSY A;  3CP2 A;  4LBY A;  1MMN A;  4BAC A;  4YXW A;  3K4N A;  3F6V A;  3JQP A;  1ACI A;  1BX1 A;  2F3L A;  2IT0 A;  2EBI A;  1MMA A;  2BHY A;  3DP7 A;  3KL9 A;  2PJR B;  3PUN A;  1Z6T A;  3L00 A;  1E1R A;  5LD2 C;  1Y0Y A;  2OPT A;  1QHG A;  1Y6I A;  5IYB J;  2DA7 A;  1UD3 A;  3FKJ A;  1J59 A;  1X1P A;  2QBY B;  4U49 A;  2OTJ B;  1BI3 A;  3K4L A;  2Y0M A;  3MWM A;  4MNU A;  2X0L A;  4BJ6 C;  5E17 F;  3BR0 A;  2XPW A;  3K2Z A;  4ZZL A;  3VNV A;  1DBG A;  1OYW A;  3DWL E;  3P9K A;  3VWB A;  3CJT B;  4U0V A;  1MAB A;  4RD1 A;  5TV2 A;  3ZZU A;  2HDN B;  4OP7 A;  4MR0 A;  2X85 A;  1ZAR A;  1GHC A;  2H6B A;  5EDN A;  1Z6R A;  2KKO A;  3CC4 I;  1B59 A;  2F5E A;  1WJE A;  4A5N A;  2E2I J;  2LP0 A;  5IYN A;  4HE6 A;  3J7Y J;  3OYI A;  4HLX A;  2QZA A;  1T6Y A;  2ID3 A;  4LBZ A;  2FOK A;  3ZC3 A;  3J7Z I;  3DTE A;  3IKT A;  2DER A;  4LMY A;  5C1E A;  3PM1 A;  1Y1W J;  2MAB A;  2Y48 A;  4BDY A;  4OJ5 A;  3AL0 C;  2Z99 A;  1QGY A;  2B7C A;  2QGG A;  4MEY F;  4PC6 A;  5IOZ A;  1HLV A;  1FNC A;  1IW7 F;  2A5W A;  3CC7 I;  2CG4 A;  2HNH A;  2ME6 A;  1XFO A;  1Y0U A;  4UB8 C;  3RIR A;  1IA5 A;  3HUG B;  3LNN A;  2C77 A;  3BNW A;  2BM5 A;  1BN5 A;  4CO8 A;  1BN8 A;  4ZYD A;  3K4B A;  5IP6 A;  3V7S A;  4P9S A;  3LYC A;  2OTJ I;  4YFN F;  1AWC A;  1FP1 D;  1U5T A;  2KLO A;  3UW0 A;  2M4G A;  2JA6 J;  1OFM A;  1X19 A;  1BJA A;  3C18 A;  3KP5 A;  3S1M J;  2W48 A;  3AG3 H;  2GZW A;  1E3X A;  2F43 A;  1XSV A;  2CQN A;  2BMW A;  2QYU A;  2OUM A;  3OV8 A;  2DT5 A;  3QE2 A;  3S3N A;  4QIW N;  1MD0 A;  1Y0R A;  1PDN C;  3ZIA A;  1YX3 A;  1IUF A;  3BTC A;  5DCF A;  2QSH X;  5D4R A;  2CUJ A;  1RNL A;  2CMP A;  3HGY A;  3CME B;  2K27 A;  1LE8 B;  2EZK A;  2N8G A;  4OIQ F;  1P9Q C;  2FML A;  1YS7 A;  5FO5 A;  3E6D A;  2CBX A;  1E17 A;  3E5Q A;  4WXC A;  3RSN A;  2WSS A;  2KP6 A;  3ASP A;  2NAZ A;  1OGO X;  1LJ9 A;  2VT3 A;  3ML6 A;  1AHD P;  2OTL I;  4M72 A;  5ED4 A;  3E6C C;  4RB2 C;  1J0R A;  2GIV A;  2X6X A;  3O6B B;  3RYR A;  1GO2 A;  5IYP A;  1WCM J;  1T0F C;  2VQH A;  1FNN A;  1SVO A;  2VJ4 A;  3NB2 A;  1FPQ A;  2H1K A;  3S2W A;  2XSJ C;  2HYG D;  3B6C A;  4BYY A;  5L3D A;  3PUF A;  5HLH A;  5FIU A;  4BE1 A;  2M7A A;  1R00 A;  3FIS A;  3IAS 2;  5F27 A;  3GZ6 A;  3NE5 B;  4OPO A;  2COB A;  4XRS A;  2J7K A;  2Y0S A;  5ICF A;  2DIE A;  2NPF A;  4B09 A;  1EH7 A;  2EB7 A;  1S72 I;  2NNN A;  1VF7 A;  1LUJ B;  2XGD A;  1WWX A;  3BG5 A;  1HKS A;  2R9V A;  3V42 A;  5HS8 A;  1JA0 A;  3F23 A;  1MIJ A;  1WSV A;  3T8R A;  1EZG A;  1IJF A;  1HVX A;  2W85 A;  2JVH A;  1YX2 A;  4Z4T A;  2DFF A;  3CJN A;  4AWX B;  1CQX A;  1F60 A;  1UD6 A;  3Q3A A;  4OOV A;  5BSX A;  3PIP F;  3H09 A;  3UNG C;  4IO9 F;  1K78 B;  1F43 A;  4WZL A;  4S04 A;  2VBX A;  3A01 B;  4NC6 A;  1NB9 A;  2INV A;  4RAZ A;  4HX4 A;  4FXU A;  5CJ9 A;  3CF2 A;  1HA3 A;  2MYS A;  2Z1D A;  2QQ8 A;  4GRI A;  2JTV A;  3DEU A;  4M9X A;  3HM5 A;  1BOA A;  1X3W B;  3WU0 A;  3QQA A;  1O8L A;  3EQO A;  2AS5 F;  2HXI A;  2M1B A;  3H3Z A;  4EJW A;  5H6R A;  3CO7 C;  4XKC A;  5JI6 A;  2P7C B;  2V7T A;  4OOS A;  2GAU A;  1UHS A;  3OYN A;  1VQP B;  2CK3 A;  1YIJ B;  3V8K A;  4DBR A;  1A35 A;  2CV0 A;  2QA4 B;  3DBH B;  1R5B A;  1PE9 A;  2HLD A;  2DOF A;  2XAU A;  1KU3 A;  3QSY A;  1QJV A;  3NWS A;  2YU9 J;  3D1N I;  5D6E A;  1ETY A;  2LMD A;  3QPS A;  2V7Q A;  3W3C A;  1QA6 A;  2LBF A;  2VBY A;  5D8L B;  2E1M C;  4KKS A;  5IYQ A;  3CP8 A;  1UG2 A;  2EK5 A;  4A2U A;  4MLO A;  2NZM A;  3ZUG A;  2CFO A;  1GVD A;  1D2E A;  3GIR A;  1Z1D A;  2NVY J;  3HC7 A;  4DBQ A;  1X4P A;  4FK8 A;  2V5I A;  3OP1 A;  4MHG A;  1VQ7 B;  1YIT B;  1GLN A;  2WZN A;  2HWV A;  5CKT A;  4M71 A;  3CD6 B;  3KYC B;  2C2W A;  1ELO A;  4ZCI A;  1F5T A;  2XZP A;  3BZC A;  1K4T A;  1FOY A;  1NDH A;  4CSW A;  3BQZ A;  3HIF A;  1GV5 A;  2FBI A;  2LVS A;  1NTC A;  3O8H A;  4ZJZ A;  5FB2 A;  1FYM A;  1GDT A;  1EJ9 A;  3GQB A;  5D5W B;  1VQ6 I;  3A1Y A;  3P9I A;  3ABU A;  3MKZ A;  4E7J A;  1GAQ A;  1CNE A;  3OOC A;  3HG9 A;  2VL8 A;  2IGO A;  2DYR H;  2X1E A;  3FXJ A;  1UCR A;  4ASU A;  3KEQ A;  2X9D A;  4BHC A;  3LSG A;  4Z4W A;  2BM7 A;  4Z4R A;  4UAJ A;  1JT0 A;  4BPR A;  1YIO A;  2VT2 A;  1E43 A;  4D9J A;  2VZL A;  2E60 A;  2GBY A;  1BOB A;  2DMP A;  5M3F J;  5FL7 A;  1VQ5 B;  3W2V A;  3BR2 A;  2HZD A;  4P3I A;  2BM6 A;  4EM0 B;  1HXD A;  1YLO A;  2L5Q A;  1E63 A;  1BL0 A;  2X8K A;  5TY0 A;  1J75 A;  4WCG A;  1PJ5 A;  3ABK H;  1LB2 A;  5GAG J;  3LOC A;  5B3S H;  4GXO A;  3HYI A;  1DBO A;  3MQ0 A;  1VQN I;  3VR6 A;  2F4O B;  1HST A;  3BR6 A;  2D3N A;  2W00 A;  4PK4 A;  1T39 A;  1XGS A;  2CUZ A;  4X6A J;  2GJK A;  2IGN A;  4DYQ A;  5EJC A;  2WAE A;  1WQ2 A;  3JW4 A;  4KDP A;  3CUQ A;  2D5V A;  2P8T A;  4M3E A;  2O17 A;  2DDA A;  1Z3Y A;  1OFE A;  4CYC B;  4XSZ F;  4G1V A;  3A8J A;  4I02 A;  3H9G A;  3ISP A;  3ZQG A;  2XGC A;  3JRB A;  5K7F A;  4UY8 I;  1K73 D;  4Z06 A;  3WWG A;  1ERD A;  1OB2 A;  1ORK A;  5GAH J;  4ENK A;  1W0J A;  1VQL B;  2YU3 A;  3EUK L;  4ESF A;  3HSF A;  2DOD A;  5KVR A;  1QPM A;  1C0W A;  4WWV A;  1QVG B;  2DMN A;  4X07 A;  2ZFW A;  2PI0 A;  3PQJ A;  2MLG A;  4UHT A;  3OJX A;  1VQ6 B;  3FBI B;  1IRF A;  3OSG A;  2P7V B;  3HOY J;  2KMU A;  3SJP A;  1QO0 D;  3GLL A;  2HOE A;  3ZMZ A;  3V7A A;  2BOL A;  4AF6 A;  1HZE A;  2UZK A;  1OMI A;  3OS1 A;  2FX3 A;  4M3B A;  3P9C A;  1X2M A;  3BWG A;  1W5C C;  4XR6 A;  3S3M A;  3BH4 A;  2ZZQ A;  4LB5 A;  1KYZ A;  2O1D A;  4E7I A;  3LJY A;  1XC5 A;  4AF7 A;  3ZMT A;  3CUO A;  1VQ4 B;  1DPU A;  1OGM X;  5HZB A;  4UVC A;  1UB9 A;  2XNJ A;  2VBM A;  1RI7 A;  3MFK A;  4DIQ A;  4G6T B;  3BY2 A;  2AO9 A;  4LC0 A;  5FO1 A;  3BTJ A;  2Z8G A;  3GRH A;  1P4X A;  3HGG A;  3I0T A;  2K86 A;  2ZXW H;  3KP7 A;  2FNP A;  2XOK A;  3RPQ A;  4UV8 A;  4IF4 A;  2XT4 A;  2VC0 A;  1T08 B;  3BPX A;  4DJA A;  4ESB A;  5FRM A;  4GFB A;  4TMT A;  2IGK A;  1KD1 D;  4CDG A;  2YWG A;  3B4N A;  2BXZ A;  2DFI A;  2M5W A;  3KEO A;  2M0C A;  5LFA A;  3DCF A;  5L3F A;  2G9W A;  4RAY A;  3G73 A;  1EFC A;  5FGM A;  2O6G E;  5HXB A;  2K02 A;  5GP9 A;  1OB0 A;  4ITV A;  2R93 J;  1Y8Q B;  3I3L A;  3GYH X;  3CDH A;  2EFQ A;  2MA3 A;  1W36 D;  4O5V A;  2HI3 A;  4V02 C;  5E79 C;  4BU2 A;  3IP4 B;  1SMY F;  2PEX A;  4L9V A;  1Q7Y D;  4M6X A;  4OMY A;  1PVE A;  1H89 C;  1WXR A;  4Z4V A;  3K0L A;  3J81 k;  3ZOB A;  1CF7 B;  1TNS A;  5HNH A;  5FD6 A;  2ZNZ A;  1N06 A;  2ZME B;  1RR7 A;  4ZYE A;  1JE8 A;  1EP1 B;  1KMH A;  3OEH A;  4UZU A;  1T33 A;  2NST A;  1H0M A;  2FF4 A;  1PXZ A;  1ZM4 A;  4BXF A;  1USS A;  2EIN H;  4E7S A;  5LHG A;  1J7K A;  2R5Z A;  3PET A;  3DQV C;  4PJ0 C;  2RC5 A;  2FNA A;  1T95 A;  3S1R J;  1FSH A;  1YLF A;  1WRJ A;  3IRR A;  4J0Q A;  1LLZ A;  1TYX A;  4X7D A;  3T1B A;  4Z4Y A;  3F22 A;  3FXM A;  2B0R A;  4UUS B;  3L2C A;  5D5X B;  4ZYH A;  4OAZ A;  2EIM H;  5FRO A;  3T51 B;  1YX5 A;  3D0S A;  1G7R A;  2O61 A;  4EGY A;  2OK8 A;  2QF7 A;  3MD2 A;  4J19 A;  1FC3 A;  1STZ A;  1ETX A;  3WHB A;  1ZM3 A;  4PC2 A;  3JUR A;  2K40 A;  3PNY A;  1V5E A;  3OR1 C;  3W6J B;  1I5Z A;  4DNT B;  2VPR A;  1OCR H;  3S2D J;  1WVR A;  1MJB A;  3IHU A;  4BE2 A;  1FOK A;  3VSK A;  4R71 A;  3VNU A;  4FIS A;  1LFB A;  3C2B A;  3TW6 A;  3LSP A;  2BPO A;  1TLH B;  2R6H A;  1Y1V J;  3S3O A;  2TDX A;  5JHU A;  2OBT A;  4RS8 A;  2EFN A;  4HV6 A;  1WMR A;  4BHB A;  3B8H A;  2UV1 A;  2WJY A;  1KZL A;  4RLF A;  4UZF A;  1R22 A;  3WXM A;  4HSR A;  2PIA A;  1LLW A;  1OFD A;  2IS1 A;  2DMT A;  3DXJ F;  4ZGQ B;  1RMG A;  2XPU A;  2Y0S N;  2YUH A;  1QHH D;  2PN6 A;  3CCL I;  5EZH A;  2BY1 A;  2H94 A;  5FJ8 J;  3LSJ A;  3W6K B;  1SEU A;  2CC2 A;  1IB4 A;  1M1E B;  4CCK A;  3T53 B;  5LHH A;  4I01 A;  4JX5 A;  2HZT A;  2E1C A;  4RAG A;  4IQ4 A;  3S14 J;  3HXL A;  3HSR A;  2DYS H;  2BBY A;  3K69 A;  2BGI A;  4OPW A;  2VYQ A;  3WGG A;  4LG0 A;  1R5N A;  2ZC2 A;  2QDX A;  1QGP A;  1FYL A;  4HEA 2;  4U88 A;  1E62 A;  3KFW X;  4QHY A;  4ASN A;  3KP6 A;  3SJM A;  2MC3 A;  4JX6 A;  4F55 A;  2IBD A;  1JTA A;  1U5T C;  2DA5 A;  3P27 A;  1FOX A;  1XTA A;  2JUG A;  2WAD A;  3PNV A;  1QVU A;  1I39 A;  1JJ2 B;  1G59 A;  4RM3 A;  2X6O A;  1YI2 B;  1S7O A;  3DF8 A;  3P7N A;  2E1M B;  4W8S A;  2E36 A;  3WHC A;  3OPO A;  4IX7 A;  4Y17 A;  2VOP A;  1I1S A;  3WE2 A;  2CQ7 A;  3I4P A;  4BGD A;  4U7B A;  1Y39 A;  1FIA A;  2O6W A;  3K4J A;  2FXA A;  2ACJ A;  4XOP A;  2P81 A;  1UAA A;  4DQ2 A;  2RVC A;  4YIR X;  1VZ0 A;  4KIC A;  3G2B A;  4M9Z A;  2R7W A;  3LSI A;  4P6V F;  3ZZ0 A;  1K5C A;  3EUA A;  4GYG A;  5CVV A;  5M3M J;  3CCY A;  1GXP A;  1GAW A;  3JRG A;  1DDG A;  1QCX A;  1VQM I;  4KFC A;  3PL8 A;  4XBF A;  3WQZ A;  4L18 B;  1BR2 A;  2ECC A;  2LLK A;  1IV6 A;  3E0J B;  2EZL A;  1T6Z A;  2VON A;  3F72 A;  5IYR A;  1Q1H A;  2VBE A;  5TGT A;  4H0E A;  4G7X A;  4M74 A;  4RJL A;  1KK1 A;  2QWW A;  3A0H C;  2HKO A;  3OOU A;  5BPI A;  4OOI A;  2VFQ A;  1E3H A;  2XRN A;  3ZQF A;  4C2T A;  2IS2 A;  5M5W J;  2CRV A;  4N4O B;  2W6J A;  1JGG A;  1VQN B;  2DA6 A;  4GQN A;  1IN8 A;  1SD7 A;  4XQF A;  4P55 A;  3DLL F;  2LY2 A;  2WY8 Q;  3BH7 B;  5IP7 J;  3BC9 A;  2IA1 A;  5ILU A;  4E7Z A;  2E5N A;  3A4C A;  4MIM A;  4HLY A;  1JTX A;  4N3G A;  2D2W A;  4D5C A;  1QFJ A;  4RD2 A;  3V7C A;  1CQT A;  4IEJ A;  1F9N A;  4Q4Z F;  4YG2 F;  3LWF A;  4D5F A;  4BQN A;  3OW2 B;  1AOY A;  2IS4 A;  3NAW A;  3BQJ A;  1UD5 A;  2V7U A;  1ETK A;  1V4R A;  1RES A;  3W5H A;  2QEX I;  1MH3 A;  1RZ4 A;  3HOS A;  4RAF A;  2NS0 A;  4EJV A;  5EZG A;  3G6E B;  1WJB A;  4E70 A;  4NBS A;  1WOS A;  2R7T A;  2EZI A;  3PFI A;  2FBK A;  4CCN A;  1N05 A;  2HCJ B;  2D1H A;  1LNW A;  1WH5 A;  2XV4 S;  4BXU A;  2VFP A;  1CZF A;  1D0Y A;  1HKT A;  4CCM A;  2BEO A;  4A0Z A;  1OCO H;  2FJ1 A;  2VOD A;  2BVM A;  3H9J A;  3S17 J;  3OY9 A;  3F9K A;  2Q1Z B;  3FKI J;  1FDR A;  2WZP P;  2XAH A;  4TMW A;  1IZ1 A;  5E3O A;  1NB0 A;  1R36 A;  2VNK A;  4KKU A;  2L02 A;  4HRI A;  5JVT A;  3W5V A;  4XSX F;  1OR7 C;  1P7J A;  3F3X A;  2OQG A;  2XF5 A;  3I56 I;  1HC8 A;  1BI1 A;  1GVJ A;  2HTJ A;  3EQL F;  2JA5 J;  2ZZE A;  2FD5 A;  1M1K D;  4R79 A;  1ZQ3 P;  4CGZ A;  2R7X A;  5E3L A;  3OEE A;  4NK8 A;  4XK4 A;  2MH2 A;  4U4B A;  2VBS A;  4U87 A;  3DLA A;  2OV7 A;  1KCC A;  3W2W A;  4BAY A;  1SC7 A;  3E97 A;  4MTD A;  4AUX A;  1MDM A;  2YWF A;  1O3S A;  2OCE A;  1SFK A;  2OYN A;  2OC6 A;  4IRG A;  5EGO A;  4P26 A;  2X6W A;  5IOY A;  2LKS A;  2HU9 A;  2DYI A;  1VQO B;  3JU4 A;  2CO5 A;  3QRF F;  2JA8 J;  2Y30 A;  1XG1 A;  4ZC3 A;  4NBQ A;  3VYU B;  2KJC A;  1MMS A;  2OBS A;  1O8K A;  5J8C A;  4IHY A;  3CCE B;  4B43 A;  4MO7 A;  4MFE A;  4DZP A;  1QU3 A;  2I5U A;  1D0Z A;  4RPD A;  1T98 A;  1HW2 A;  4KYW A;  4BJ5 C;  5HNF A;  1KON A;  3TGN A;  2ZZG A;  1WJ5 A;  4IHX A;  1EWY A;  1VQK B;  5A2Q Z;  2VFM A;  3LQR A;  2RNJ A;  2VN2 A;  1KU2 A;  1DG1 G;  2ZTN A;  1R1V A;  3AG1 H;  1YJW I;  3ZPL A;  2VUM J;  5J1U A;  5H5J A;  3CCS B;  3MCZ A;  1K8F A;  2GJP A;  4G1B A;  2NTP A;  4KH3 A;  3VYR B;  2WTE A;  4W8T A;  5EMN A;  2WB1 A;  4LIU A;  3L2U A;  2LKP A;  2QVO A;  1Z21 A;  3ZP5 A;  3KZY A;  1BJK A;  4JOM A;  1IF1 A;  4Q5S F;  1NRK A;  4NUB A;  2STT A;  4HNT A;  2XEX A;  3S32 A;  3V8L A;  2A6H F;  5JR3 A;  1TYU A;  3CC2 I;  1QVT A;  3GEZ A;  1R9T J;  4L5I A;  2E7W A;  1COW A;  3RPU D;  3J81 K;  4IQJ A;  1VQO I;  1N25 A;  3GTP J;  1VJS A;  1LDJ A;  3OMY A;  4KMU X;  5ILV A;  3HZJ A;  3VOE A;  2NVU B;  2VE9 A;  3OL4 A;  3LAP A;  2XC1 A;  1GV2 A;  1EKE A;  5IYC J;  3H5N A;  3I58 A;  4UV9 A;  3E6M A;  4PGG A;  3CMY A;  1HOM A;  4G7H F;  1SFE A;  3A1P A;  3B02 A;  5DS9 A;  4F52 A;  1F4K A;  4UVB A;  5JBQ A;  1Y0N A;  3TL4 X;  2XPV A;  2B7E A;  1Y8R B;  4RLQ A;  2DOE A;  2FUG 2;  1A6I A;  1AKH A;  1BC8 C;  3QFT A;  3CCQ I;  5J4V A;  2Z2S B;  4FWT A;  2L9R A;  2L4A A;  2V1N A;  4JP0 A;  3ZRG A;  2VQC A;  1ZM2 A;  2BSA A;  1VQ9 B;  4YZ0 A;  2CV2 A;  1N77 A;  4ZDO A;  3CUQ B;  4DW6 A;  2L7Z A;  2LZJ A;  4HQM A;  3ZQC A;  2QTZ A;  2L7M P;  3OYG A;  4RCZ A;  5E3N A;  1H8A C;  3ZQI A;  1K9M D;  2XTY A;  3FHN A;  5IY5 H;  3B82 A;  1F36 A;  2FEZ A;  3VYT B;  3WTX C;  2PYH A;  2F4M B;  3ONU A;  3I4N J;  1S4M A;  1PJ6 A;  2LH9 A;  3UKG A;  1VHO A;  1RU4 A;  2VBW A;  1RKT A;  3PA1 A;  2KT0 A;  4KJZ A;  2VIX A;  3S8P A;  4TV7 A;  4F7Z A;  3FMR A;  2QQA A;  1ZRF A;  1SKQ A;  3ASQ A;  2LSO A;  5D6F A;  4NK6 A;  5JMC B;  1W4M A;  3GTM J;  1A5J A;  4B3F X;  5ICC A;  1V5V A;  5J40 A;  4WXD A;  3F8N A;  4RPB A;  3OOP A;  1W0K A;  1D0X A;  2L9N A;  4E7L A;  2L7K A;  4KT6 A;  1G7C A;  4AU7 A;  3H94 A;  1O3T A;  1Z7U A;  3LSK A;  3L2V A;  1I6X A;  2RC4 A;  3G1M A;  5J8F A;  1ZG1 A;  3CCS I;  1PLU A;  1I7P A;  3PUB A;  1WP6 A;  2DLL A;  2G0Y A;  1O4X A;  2RV8 A;  3M1E A;  2QN6 A;  1G6N A;  2ZFU A;  1YE9 A;  2B0L A;  4R8H A;  5L3B A;  2P6S A;  1LKX A;  4RGX A;  3L7W A;  1HDD C;  4ENN A;  2A05 A;  3DKW A;  1K78 A;  3RCO A;  3R6J A;  4KNY A;  4FX4 A;  3FPP A;  3VSV A;  3M4O J;  3HOV J;  1MMG A;  4M0L A;  2D74 A;  2A6E F;  1GQ8 A;  2HQN A;  3BCA A;  4Y9R A;  1NH3 A;  1B72 A;  1G3Y A;  2VKH A;  3CZ6 A;  3A0B C;  3KP2 A;  4NQW B;  2XC7 A;  2V6E A;  3N90 A;  2D45 A;  3GF2 A;  1SFU A;  1MBK A;  1GUU A;  4LK1 F;  1UFM A;  3GSI A;  4OZZ A;  1U2W A;  2R7F A;  3CCJ I;  4HDV A;  3H5R A;  4KA4 A;  4ETS A;  3W6V A;  1QRB A;  2WC2 A;  4HPQ A;  2A07 F;  2RQQ A;  1ONV A;  3I4M J;  4HV5 A;  4PC3 A;  3ZN1 A;  3U1D A;  3JQR A;  5FLV A;  4KN7 X;  1HW1 A;  1MJ9 A;  3RJP A;  2ZKZ A;  4IRI A;  3WGH A;  2K5C A;  3G1O A;  4YEL A;  3U1K A;  1S5L C;  2FOW A;  1WI3 A;  1R1T A;  4NHJ A;  4S0H B;  3RKX A;  4CA0 A;  3PQK A;  1LE8 A;  1QH0 A;  1O8J A;  4ZDL A;  3O8G A;  2ADU A;  3D5S C;  4D0P A;  1UMQ A;  2OJE D;  3GX4 X;  2CV1 A;  2JN9 A;  3WNC A;  3Q0U A;  4RD0 A;  2GLO A;  4ZGN B;  3P26 A;  2CF4 A;  1S7E A;  1B2R A;  2LY9 A;  1K4Z A;  1HBX G;  2BSP A;  1RRJ A;  3PA2 A;  3FBN B;  4O3M A;  4P5O A;  2O0Y A;  4E7H A;  3H0D A;  3HSE A;  5CVI A;  1QA1 A;  2VBV A;  2VQG A;  1CNF A;  2FSW A;  4TN1 A;  5GV8 A;  3CUQ C;  1N75 A;  1S29 A;  3FXO A;  3I9V 2;  3RKQ A;  1EV7 A;  1VQ7 I;  3DFG A;  3IWF A;  1JGS A;  1OYY A;  4AIK A;  2WAF A;  1BQE A;  1JJ6 C;  3VDX A;  1JKO C;  2KIS A;  3QFR A;  1BHE A;  1FEX A;  1Z9C A;  2VB6 A;  4NB5 A;  1K79 A;  5H2F C;  3D26 A;  2DJI A;  1GR1 A;  4OPS A;  2M30 A;  2UWM A;  4OJ6 A;  2O8X A;  4YEJ A;  3VPR A;  1MH4 A;  3ES9 A;  4RGS A;  1TP4 A;  2EWN A;  2XRO A;  2IEK A;  3LA3 A;  3PEN A;  3KZI C;  4RCY A;  2HDC A;  3BZ6 A;  4PAB A;  4EVI A;  5J1Y A;  3ELK A;  2CFX A;  3ESW B;  5BNG A;  5BS6 A;  2Z3Y A;  2CW0 F;  3BCD A;  4EMS A;  3M8E A;  3U2Q A;  3ISX A;  1ZGA A;  2W7N A;  1QZY A;  4QSH A;  4RA2 A;  3IWZ A;  2DTZ A;  2AXL A;  3JRH A;  5CYV A;  1KTW A;  1ZLJ A;  5CPR B;  2Y9Y A;  1JB9 A;  1N08 A;  2DA1 A;  3BJO A;  1FRQ A;  1POG A;  3SKB A;  3CC7 B;  2H8R A;  3HKZ A;  3BTL A;  5D4S A;  2GQF A;  1WOO A;  2X0K A;  3VB2 A;  3E5U A;  4LBV A;  1TQP A;  4KT5 C;  1E3Z A;  4K2E A;  4EJT A;  5IT9 Z;  4DQL A;  1WH7 A;  2X48 A;  1XB2 A;  4TMZ A;  1D8K A;  2F2E A;  4XN0 A;  1WZ2 A;  2VJI A;  3QYF A;  1DUX C;  4UUV A;  2IVM A;  3HJE A;  3KEW A;  1HSJ A;  2V1U A;  1ZAO A;  2GJR A;  2NS7 A;  4DNC A;  3IH2 A;  2XAG A;  4IJA A;  4RGU A;  1FZP B;  1YHQ B;  2M2E A;  1VND A;  1G8X A;  2KHM A;  4XIC A;  2FA5 A;  4G6D A;  2QSG X;  3BR3 A;  3FWE A;  1D5V A;  3GXO A;  2KFD A;  2GA1 A;  1K61 A;  2PJR A;  4AC0 A;  1A8P A;  2F5D A;  3W2G A;  1YRN B;  2M8G X;  2PMZ N;  3DU6 A;  1IG7 A;  4C2L A;  3WGI A;  1FBQ A;  3BG6 A;  4E4H A;  1QRC A;  1TL8 A;  4A12 A;  2BW3 B;  1I3Q J;  3H3V K;  4P25 A;  2EIJ H;  1TLL A;  4XKV A;  3TOB A;  1O8M A;  2ZO4 A;  1ZR2 A;  5TRD A;  3RZD J;  1EXM A;  3EYY A;  2O8K A;  2V4D A;  2QKM B;  1YJW B;  1R71 A;  3I56 B;  2KRF A;  1W35 A;  1B9N A;  1O8D A;  3F8C A;  3TDU C;  1TYV A;  2DU9 A;  4C2M J;  1FT9 A;  3HAG A;  4AC9 A;  1F1Z A;  4FT8 A;  3IL2 A;  3GO5 A;  2R7R A;  1D8T A;  2X3U A;  2X1D A;  3Q6R A;  1TWF J;  1UHM A;  2DOA A;  3FZV A;  1V0E A;  1NJI D;  2W6I A;  3OW7 A;  4ROX A;  2R4G A;  1D3Y A;  5CLS A;  4AVP A;  4MQV A;  4P1V A;  1VQM B;  4FX0 A;  2O9L A;  3QAH A;  1L1I A;  2M34 A;  4AIH A;  3GFI A;  1W0T A;  3VO2 A;  5K5O A;  2E19 A;  2ESN A;  2IGM A;  5HKK A;  1L3L A;  2Q6K A;  2QTL A;  4QPQ A;  4HX8 A;  2F4N A;  2DMU A;  2JIZ A;  1OFC X;  1LDD A;  1OJL A;  1B9M A;  5F4J A;  1P6R A;  5FD5 A;  2ME0 A;  4C30 A;  5IYW A;  2I1L A;  2QX3 A;  1QNT A;  1MJA A;  5J4Y A;  3AG2 H;  3SZP A;  2CW8 A;  2PBI A;  2ZJP F;  1FNB A;  3PO3 J;  2E7X A;  1K6Y A;  4L5J A;  3W2F A;  3VEP A;  1U2R A;  2R5Y A;  5LMZ A;  1R6R A;  1JUM A;  2Z16 A;  3HRU A;  3EET A;  1D1C A;  1DP7 P;  3BCF A;  1NG6 A;  4G12 A;  2HQR A;  3FM5 A;  4JMQ A;  3CES A;  4EM1 A;  3AG4 H;  4V2G A;  1RQR A;  1ZUN B;  1I1G A;  3H5A A;  1X2N A;  2LTP A;  1BR1 A;  1ITY A;  1DGR M;  3M1C A;  3MZ8 A;  2F1L A;  3MHP A;  4JYK A;  1Z7L A;  2Q6I A;  1EF4 A;  5DUK A;  3OIP A;  3WTT C;  2PMZ A;  4LD5 A;  1ZEL A;  3DBR B;  1KQ0 A;  2MW8 A;  5F64 A;  1H8E A;  5DN6 A;  1FLI A;  3U6B A;  1TC3 C;  3BDD A;  2D1V A;  2QM3 A;  2DMQ A;  3V8J A;  4OM9 A;  2KIU A;  2XAQ A;  4YAF A;  1ZM9 A;  1BMF A;  4IHS A;  1OCP A;  4LLN A;  1R5H A;  1JTY A;  1XGO A;  4B48 A;  3OKX A;  3ROU A;  5HOD A;  3FHZ A;  4RD6 A;  1IN4 A;  2HTS A;  3OFN A;  3C2H A;  3BR5 A;  2XT2 A;  4PJM A;  1BA5 A;  1QUF A;  2K4B A;  1YYV A;  5LGU A;  2EWE A;  1AIR A;  3GQ9 A;  3LQE A;  3I55 I;  3T8T A;  1U78 A;  2OBR A;  4AM3 A;  1GVH A;  2LRD A;  4YFO A;  2WYR A;  4XLN F;  2XIG A;  3DEE A;  2FRH A;  3M8F A;  4X1E A;  1OPC A;  1RUO A;  3J7A Y;  3VMV A;  1T0F A;  3QP6 A;  3O3K A;  4ZCM A;  2KRH A;  2F48 A;  4KIT B;  4ZV4 A;  3OE7 A;  3KLO A;  4YZX A;  4KIF A;  2QQB A;  2WAQ N;  3I53 A;  3HDD A;  2UXX A;  2EV6 A;  5DV5 A;  5B66 C;  5HVQ C;  5IYD J;  5CVR A;  1G3T A;  2BYV E;  5E6T A;  2QEX B;  1LVA A;  2P5K A;  2Z6B D;  3DPT A;  3G6E I;  1JA1 A;  2WV1 A;  4CH7 A;  3SQN A;  1XSX A;  2F4I A;  5LEK A;  2EFW A;  2EFO A;  3E1Y E;  4RGR A;  5K5Q A;  1NHA A;  3FXK A;  2L54 A;  3L9F A;  5LGT A;  3ML3 A;  2CH0 A;  4XLH A;  5GAE J;  2R0Q C;  2QEN A;  4O6J A;  2XB5 A;  5FKN A;  3X2Q H;  3N4M A;  3HOW J;  3ZQ7 A;  2GPJ A;  4X7E A;  1K7A A;  2CYY A;  3QPH A;  3OYF A;  1T8I A;  5F04 A;  3BG3 A;  4C9Y A;  1LEA A;  4HNV A;  3A8I A;  2D3L A;  2E1R A;  2E1N A;  2MD5 A;  2NTB A;  1P4A A;  4K1X A;  1XSD A;  1YW8 A;  2KIM A;  3VYS B;  1YI2 I;  3AVU A;  3N6Z A;  4LGW A;  2M7B A;  1ZKG A;  1ZYR F;  1ETW A;  2JRT A;  5HS9 A;  3OZW A;  3PSZ A;  3WTZ A;  1VQ8 I;  4B3X A;  4XRS G;  2ZL5 A;  4Y3O A;  1ZGJ A;  3CB4 A;  2ELH A;  2L9S A;  1VHE A;  3ZQH A;  2ZBU A;  2DN0 A;  2F5F A;  3F8B A;  5AON A;  3AVY A;  3V4G A;  5JLV C;  3RQ4 A;  2C5H A;  3CPX A;  3I59 B;  1VQL I;  4LG3 A;  4XM3 A;  1MBJ A;  2C5B A;  2CQK A;  3CCU I;  4F7D A;  4Y52 J;  3J81 Z;  4DQK A;  3TO9 A;  2IPQ X;  4CCL A;  3OYM A;  3CJR B;  3DU5 A;  4G94 A;  5F0F A;  1X1B A;  3JSO A;  1WSU A;  2O04 A;  4CYC A;  4F91 B;  3Q38 A;  3EDP A;  3CDI A;  1FYK A;  3AL0 B;  2R5Y B;  4Y33 A;  3FXU A;  2VKD A;  4ENM A;  3SLD A;  1KRH A;  2FX0 A;  2X4H A;  1ODD A;  1X1D A;  4CXF A;  2JJ1 A;  4XKB A;  1K83 J;  1N07 A;  1X1A A;  5A89 A;  3ZPN A;  5J6X A;  2Y69 H;  2QZ8 A;  1ZR4 A;  3B8Y A;  2KQR A;  5E3M A;  3S15 J;  3DU1 X;  2IA0 A;  5J47 A;  2KDO A;  5K7Z A;  1ZN2 A;  5TJJ A;  1WGX A;  4C43 A;  5J3L A;  4A3B J;  3ZMD A;  2Q0O A;  5HDK A;  2NVX J;  5KAI C;  2R7V A;  5C4X J;  2LKX A;  2KL4 A;  2DBB A;  3KP4 A;  4WWC A;  2BHZ A;  1NG7 A;  3NEU A;  3IUO A;  4CUG A;  1LFU P;  3H9N A;  1W7P D;  2E34 A;  4ANJ A;  1VQ8 B;  4HOB A;  3OYB A;  2BGJ A;  1LVK A;  2WBM A;  2PLY A;  2JRM A;  5E1W A;  3LVB A;  3IC7 A;  4P12 A;  3IV5 A;  2Q2E A;  1IRZ A;  4OOX A;  4GO1 A;  4WZT A;  3J80 Z;  1UD4 A;  2WJV A;  1YW7 A;  4QPO A;  1ZGW A;  2NRA C;  1S8N A;  2XUB A;  4LG0 B;  1G7S A;  4RB0 A;  1UD8 A;  2HYJ A;  4BXX J;  5GV7 A;  1YW9 A;  3GCM A;  1OYI A;  2CW7 A;  2M4K A;  3REO A;  3KP3 A;  4Y7C A;  3H92 A;  2DY1 A;  3LST A;  4WZK A;  2DPD A;  3ABL H;  1Z05 A;  3PIO F;  2B5O A;  2ZCW A;  3QU3 A;  2K9Q A;  3FJO A;  5IP9 J;  2IP2 A;  1QVF B;  4P3Y A;  4P1W A;  3PSF A;  3C7J A;  1MND A;  4DZJ A;  1WJC A;  3GFL A;  4EM2 A;  2B7B A;  1TBX A;  3A35 A;  4AIJ A;  4RDK A;  2F6C A;  3BT9 A;  3MEX A;  3PSI A;  4M3D A;  3TP3 A;  2XKO A;  5E8G A;  3H35 A;  1BI2 A;  2EZH A;  3C2G A;  5FKK A;  2FQ3 A;  2OZ6 A;  1W9X A;  1W5T A;  1FWZ A;  4XRF A;  3ZPP A;  5C4J J;  1EFT A;  3G71 I;  2P5V A;  2LF8 A;  1HCR A;  4G7W A;  2NVQ J;  4PCQ A;  3KEY A;  1IN7 A;  2ZSH B;  1QZZ A;  4Y4R A;  5LHI A;  1XCB A;  1IDK A;  3K1M A;  1RWR A;  1BC7 C;  2BM1 A;  1OOC A;  2R7U A;  3ZZT A;  2JA2 A;  4M6V A;  1J5Y A;  5FLX Z;  3MMP A;  2BVN A;  4RD4 A;  3KPH A;  5JFR A;  2BX6 A;  2ZXI A;  1VFC A;  1LQ1 A;  2A69 F;  2CUE A;  3DTK A;  4FE7 A;  2E5Z A;  3M9A A;  1YIT I;  3T56 B;  2UXN A;  4PDK A;  1QGZ A;  4G7O F;  1L0O C;  2M45 A;  1DDI A;  2B9S A;  1K4S A;  2DQL A;  2ICW G;  1BW5 A;  3ZCO A;  2JN6 A;  2R5Z B;  4OIO F;  3R4K A;  2HXO A;  1VQ4 I;  2QSF X;  1W87 A;  2CW5 A;  2ZL6 A;  4Z1M A;  2W24 A;  1H88 C;  3N97 A;  5TIS C;  1X58 A;  2R92 J;  3RY8 A;  3LMW A;  2OBP A;  1G3W A;  3DBL B;  2BM0 A;  2YSR A;  2YX7 A;  5FKL A;  2G0E A;  3JRI A;  2MBF A;  3RZO J;  2PEC A;  4D1Q A;  3ZBT A;  4PMH A;  1U6G A;  3OR2 C;  4FQG A;  2VXZ A;  1B23 P;  3OL3 A;  1YJ9 B;  5H20 A;  4W97 A;  5FNZ A;  1TSP A;  2ELK A;  2BE5 F;  3KYD B;  3CMA I;  4XLC A;  3ZMU A;  4G7Z F;  2OQR A;  3B6A A;  4XN3 A;  2M5S A;  2DTR A;  1B8I A;  2L2O A;  2JJ7 A;  4EV0 A;  3FY3 A;  4YII A;  1WDT A;  2E1B A;  3E3V A;  3ABM H;  1PP8 F;  3AVT A;  4YZA A;  1V55 H;  2HFH A;  5B1B H;  3I55 B;  2C78 A;  3I71 A;  1AMO A;  1IN5 A;  4A6E A;  2VNI A;  2STW A;  4HIZ A;  5CDF A;  1UD2 A;  5E20 A;  2JDI A;  2HOA A;  3D5L A;  3HOX J;  1IXS B;  3HBL A;  2OU2 A;  2DXI A;  1DU0 A;  2X3H A;  2MFZ A;  4EW9 A;  1EH8 A;  2ESH A;  3HPH A;  4B1R A;  3SLN A;  2BY0 A;  2YX4 A;  1SFO J;  1T5E A;  5ICG A;  2HVR A;  4DOZ A;  5L46 A;  4EAT A;  4YAO A;  3VO1 A;  2QQ9 A;  3A02 A;  4P6Y A;  4EH1 A;  2XGE A;  2F5V A;  3GZ5 A;  3ZQL A;  4A3G J;  2Y2Z A;  1BPL A;  3CCL B;  3AST A;  2RDP A;  3MZY A;  4Z4U A;  2LG4 A;  3M8J A;  3ULQ B;  1Z91 A;  4A6D A;  2X1C A;  4N9I A;  1H9T A;  1I27 A;  1JNY A;  4XMY A;  5F4O A;  4BNC A;  3HUG A;  3HOZ J;  3DTI A;  2KZG A;  1S72 B;  1R58 A;  3ZGK A;  2V26 A;  2QE7 A;  3PUM A;  2WWY A;  1IXC A;  4UUT A;  5HLI A;  1HW5 A;  1LPQ A;  4A3K J;  4A3F J;  1EP3 B;  2CND A;  3K7A J;  4ZCL A;  1H9G A;  4HE5 A;  1HF0 A;  1OB5 A;  2VXD A;  3CTA A;  1TT0 A;  3GWZ A;  4X8I A;  3Q0W A;  1FX7 A;  4XID A;  1BW6 A;  5A2Q K;  2E1O A;  2OF7 A;  1IAW A;  5KSW B;  5F0H A;  3NAU A;  2V9K A;  3K9T A;  1S6L A;  3ZMV A;  3PO2 J;  1JT6 A;  3ERM A;  9ANT A;  4FN5 A;  4V19 K;  4JX4 A;  1UJ8 A;  2ZBK A;  3I5U A;  3TW7 A;  1REP C;  3WTU C;  5H6Q A;  2BV6 A;  2B63 J;  5KNL A;  3S1N J;  1DU6 A;  4ESJ A;  1FX0 A;  3ZSC A;  3A8K A;  1CGP A;  4DGW B;  4G8X A;  4XL9 A;  2D9R A;  2Q2E B;  3JAM Z;  3WTV C;  3MKW B;  2O03 A;  4A0X A;  2NV4 A;  1Z0X A;  3FK7 A;  1YFH A;  2EV0 A;  3P4G A;  3CC4 B;  2H8W A;  1RC9 A;  1OHH A;  3GBG A;  4OU0 A;  3MCA A;  4Z4Z A;  3HRS A;  3KX2 A;  1FSE A;  2QXZ A;  1QG0 A;  2P3M A;  5H59 A;  5LRR A;  5B5E C;  1APL C;  3G05 A;  1R7J A;  2XSD C;  2V7W A;  2KVO A;  3SZE A;  2ZSI B;  1U9N A;  4MTE A;  3OYJ A;  2E2J J;  5LEJ A;  4N4N B;  2QBY A;  4XNF A;  4OZY A;  3DDY A;  1SFX A;  4GGG A;  1FP2 A;  3Q6Q A;  4CHU A;  3CLQ A;  4R1H A;  3RDI A;  2ZL7 A;  4CIC A;  1S7A A;  4C3J J;  3LQQ A;  1TTY A;  4JBA A;  3K70 C;  4PZJ A;  4KN4 X;  1ULY A;  4XLA A;  2M0M A;  4LLL A;  3IH4 A;  2OZU A;  1G4D A;  3ZBU A;  1RR8 C;  2KJB A;  1ETV A;  2DAO A;  2Q6L A;  2JT1 A;  4X7F A;  1KC8 D;  3A3B A;  1IDZ A;  1JKP C;  5KCM A;  1ETO A;  3Q0V A;  4ACA A;  3TOA A;  1SD5 A;  3CCR B;  2FE3 A;  2EFP A;  4UNO A;  4A93 J;  1IN6 A;  5DS0 A;  3DKY A;  1ZRE A;  2HOT A;  4BS9 A;  1V54 H;  2CWE A;  2PQ8 A;  3E5X A;  3ZQQ A;  4RDU A;  1B1B A;  1AKH B;  1EA3 A;  2ISZ A;  1R4N B;  1X3U A;  4A3J J;  2V79 A;  1O57 A;  3BQY A;  1YO5 C;  1FJL A;  2OA4 A;  4HBL A;  4WZE A;  4PSX A;  3ERE D;  2J5O A;  4Z03 A;  2Q8K A;  2LY1 A;  5M5X J;  1G2H A;  5E1X A;  1Z67 A;  4G6Q A;  3WE3 A;  4WQM A;  4X05 A;  2BZT A;  3SJZ A;  4I0A A;  3HOT A;  1HDP A;  2DT6 A;  2BXY A;  3KE2 A;  4XLE A;  5C1C A;  1OCC H;  4I98 B;  2VBK A;  2PFB A;  3CXC B;  1GXQ A;  2DK8 A;  3JSP A;  2MLK A;  4A3C J;  1PJ7 A;  1VQ9 I;  1XE1 A;  1XQB A;  5J3O A;  5L3E A;  1TTT A;  2PE3 A;  5K7H A;  1D1B A;  3OZU A;  1GT0 C;  5AN9 A;  1DPR A;  1N78 A;  1IXR C;  2ZJR F;  4FHT A;  4HG2 A;  4IHV A;  2GOX B;  1D1N A;  3L2R A;  1BIB A;  4C0S A;  1BM9 A;  5DNS A;  3FM3 A;  3CC2 B;  1H80 A;  1SMT A;  1V5G A;  3EUH A;  2R7S A;  4IXA A;  3JRC A;  2NT9 A;  3QOP A;  2VOO A;  2K3F A;  4IRH A;  4A3L J;  5DTD A;  4J00 A;  4JQF A;  2V7V A;  1DAB A;  3JRA A;  1MGT A;  3N05 A;  1IB0 A;  4QVA A;  2L7F P;  1KYW A;  1XX5 A;  2RAE A;  1K6O A;  3HHG A;  2JZY A;  2V31 A;  4H4K C;  4BE0 A;  3GLX A;  1WJA A;  1P4W A;  1ZG5 A;  2PLF A;  1QX4 A;  5TR9 A;  3F6O A;  4ZYG A;  3ZXS A;  3BG7 A;  4PGO A;  2W1O A;  4YFX F;  3IRQ A;  5IT9 K;  1IO2 A;  3SDB A;  5EG0 A;  1I3A A;  2WV0 A;  2BY3 A;  3DKX A;  4YRV A;  2VLA A;  1PUF B;  3MVP A;  2XTX A;  3CCQ B;  4TKO B;  3OAA A;  2DT7 B;  4M3G A;  4HZF A;  2JA7 J;  3Q9V A;  4L5E A;  3KLN A;  5EGO B;  2MG4 A;  3SFZ A;  1BX0 A;  2HR3 A;  4GCV A;  2DFH A;  4B44 A;  3A03 A;  1MDM B;  2J8I A;  2XTW A;  1A31 A;  5D8K B;  4U0Y A;  4ZTJ A;  2GIZ A;  2P0W A;  1SD4 A;  3GME A;  2Z9O A;  4BL0 B;  4A3M J;  4ON0 A;  2UVE A;  1WKM A;  4XON A;  3FKS A;  5KAF C;  1WFX A;  1LDK B;  2GK7 A;  1JXS A;  3G71 B;  2VKE A;  1IDJ A;  3VSL A;  4KIG A;  1HF2 A;  3PSS A;  1T38 A;  4QTR A;  2L3D A;  5EYR A;  2W82 A;  3CCE I;  1SAX A;  3WBK A;  1R5G A;  1QRY A;  2DDB A;  3HRT A;  4ABZ A;  3JTG A;  1Q82 D;  3SXY A;  5FKM A;  4CCJ A;  1D1A A;  1PJR A;  4PC7 A;  3BPV A;  5ICE A;  3SQV A;  4AID A;  4M53 A;  1JRG A;  1W36 C;  3KZZ A;  1I8D A;  1FOW A;  2OD5 A;  4L9T A;  3H1C A;  2LDU A;  4G9Y A;  4EJU A;  2XNC A;  4PC1 A;  2DFE A;  2VC1 A;  3KIO A;  4KIB A;  2AXT C;  1MKM A;  3OYC A;  3OYL A;  5DDG A;  4KIS A;  2NNY A;  3KYL A;  2MC4 A;  3M7G A;  2BN4 A;  3D5R C;  3GZN B;  4KUM A;  3U2R A;  3OIQ A;  4L9N A;  4YC5 A;  3COA C;  2WR8 A;  2XGJ A;  5FLM J;  3QOD A;  2Y31 A;  3SEQ A;  3J80 K;  2W4S A;  1VQP I;  1TWC J;  4YAU A;  3GQ7 A;  3A2K A;  4MXN A;  1P2F A;  2G7H A;  1VLO A;  2ZBV A;  3H36 A;  2JJ2 A;  4M73 A;  1LFP A;  3WG9 A;  1XD7 A;  2V4J C;  2VI6 A;  5AIQ A;  5K5R A;  2XKP A;  3OYK A;  3CCM B;  3NRV A;  3AVV A;  3ASO H;  4X0G A;  4L8J A;  1MBF A;  2LR8 A;  2YR2 A;  3QYB A;  4N0B A;  2MGQ A;  4OIR F;  3OJW A;  3CMA B;  2XAJ A;  2ZB9 A;  1I6H J;  4X06 A;  2OCC H;  2UVF A;  1R5I D;  1TW2 A;  3Q5F A;  3RIQ A;  1V0F A;  2BM4 A;  1ON1 A;  2V9P A;  1UG0 A;  2CJJ A;  2O5R A;  1O8E A;  2XHK A;  3IH3 A;  5GPC A;  1K8A D;  2Y75 A;  2IXS A;  3K1P A;  1BLI A;  2QMU A;  4MYU A;  4YHB A;  3S2H J;  3CPW B;  2JPC A;  5E1Z B;  1YRN A;  2DW4 A;  2EIK H;  3R60 A;  2M8E A;  3PVD A;  5E8I A;  2OTL B;  1QUE A;  2ODL A;  2VAS A;  1XB4 A;  4LBW A;  5ILS A;  3SHF A;  4BJT A;  1O88 A;  5KK1 A;  2CRG A;  3WG7 H;  3CCU B;  5D5V B;  4A3I J;  3CQZ J;  1O8H A;  4JK1 X;  1Q9S A;  2ETH A;  3MN2 A;  2LOO A;  3PFY A;  2C4T A;  1ON2 A;  1IGN A;  2DI3 A;  1DP3 A;  1XMK A;  2RQP A;  3Q9S A;  1FNM A;  2QGU A;  2HPI A;  4PJL A;  2HEO A;  2BF4 A;  1WU8 A;  4H9G A;  3JRE A;  3ECO A;  3T9G A;  2EFG A;  3Q39 A;  5HZA A;  2IRF G;  4RDL A;  2IJL A;  3F8M A;  4P9U A;  4F93 B;  1O7F A;  1XDU A;  4TSF A;  3JRD A;  3VMF A;  1G3S A;  1V5F A;  2ECB A;  1MZB A;  1DAR A;  3OSF A;  2ZTG A;  2KRC A;  3BR1 A;  4B4D A;  3I59 A;  1OGJ A;  3SYT A;  1SVL A;  3BZK A;  1S0U A;  1VBL A;  4P9F A;  1X3Z B;  3QFC A;  4I84 A;  3FIW A;  3SZG A;  4I99 C;  1OR7 A;  1MBE A;  4KMF A;  3SYJ A;  3CCR I;  3GVA A;  1W1W E;  2OAZ A;  4FET A;  3W2I A;  2XB0 X;  4PSW A;  3Q3S A;  1TQI A;  3T0Y A;  4OWR B;  3I54 A;  1PKV A;  2NTQ A;  4M1K A;  4IVN A;  4F3Q A;  4AYB A;  5IK2 A;  4P2N A;  2O0W A;  3AFH A;  2RKH A;  1PYV A;  1VI0 A;  2L9V A;  2L01 A;  4CZZ A;  2LD5 A;  3HTS B;  3QFS A;  4ZH4 F;  3OYH A;  5EG0 B;  1KZH A;  3WTY C;  1PUF A;  4YZQ A;  1CF7 A;  3DEW A;  4LIV A;  1MMD A;  1LEB A;  1MBH A;  3QWL A;  5LGN A;  3JR9 A;  1H85 A;  4HDU A;  2WAQ A;  4HX7 A;  3TP0 A;  3VFZ A;  1I18 A;  1TWG J;  3SUC A;  2F1M A;  3TKY A;  1J2X A;  1HQC A;  4XOR A;  3C3W A;  3PNT A;  3OZV A;  2CU7 A;  2RNG A;  4G6I A;  5GPA A;  2IAI A;  3IKV A;  2ZIT A;  4BQA A;  1S3J A;  2WA0 A;  5JLX A;  1H42 A;  4ZTF A;  5GTH C;  2RC6 A;  2DQR A;  1JUS A;  2A5Y B;  2CQQ A;  3HEF A;  2R7Z J;  2GM4 A;  3GTK J;  3LFU A;  2P5L C;  4IHW A;  3A3G A;  3I64 A;  2O7O A;  2R7D A;  2R7O A;  4HF2 A;  2HYF A;  5F1R A;  1GJR A;  3KRG A;  1PUE E;  4I2O A;  3QP5 A;  2R3S A;  2V1X A;  4AYB N;  2WPD A;  3K1N A;  3ZMS A;  1RQP A;  1WOR A;  4MEX F;  3K4K A;  2VFO A;  3BY1 A;  2KDZ A;  5F0C A;  3R0A A;  3AAF A;  2V1D A;  1KK2 A;  2ZME A;  1RKW A;  1X4O A;  3HTU A;  4P96 A;  4W1U A;  4E0F A;  3VSU A;  2PMH A;  4JRA C;  2MSY A;  3EPZ A;  2K4J A;  2XDV A;  3HB9 A;  3S93 A;  1O3Q A;  3GTJ J;  3CCV B;  4BBS J;  3V76 A;  2FMY A;  2HMA A;  4YFK F;  5F1J A;  4IPA A;  4P22 A;  3BTI A;  4XRM A;  4OAY A;  1O8G A;  5CVJ A;  4A3D J;  4WXH A;  3SZT A;  4DYC A;  5DSZ A;  1QA2 A;  5F6F A;  5DM6 F;  1KU7 A;  1F20 A;  4D7N A;  1RIO H;  3ECH A;  1MNM C;  3R6K A;  2V7X A;  4HW0 A;  1HA8 A;  2CS3 A;  3G1L A;  2A68 F;  3BJA A;  1Z77 A;  5B1A H;  1KU9 A;  1W0U A;  2I10 A;  1S9H A;  5F08 A;  3SFI A;  3L1P A;  1ZH5 A;  5F4M A;  1IHM A;  2JPB A;  4J01 A;  1W7P B;  4A3E J;  4F92 B;  2JUC A;  5DUI A;  5M5Y J;  1FRN A;  1YS6 A;  1XDS A;  2LYC A;  4FTH A;  2C4U A;  1QFY A;  5K1Y A;  4PAA A;  2NVT J;  2EIX A;  2Z33 A;  2X51 A;  2XF7 A;  2PG4 A;  5FFZ A;  3L2Q A;  2KIF A;  2LNB A;  2MD0 A;  3GFM A;  3QOE A;  2ZJ2 A;  4IOC F;  1E1Q A;  1N0U A;  2BV3 A;  4PFP A;  3OS0 A;  4BHP A;  1KK0 A;  1E64 A;  3ABT A;  4NCN A;  1O8F A;  1A04 A;  2E71 A;  4RDJ A;  1UEL B;  2INU A;  3OS2 A;  1Q1V A;  2H1L A;  3U21 A;  5DM7 F;  2H27 A;  2VNJ A;  3CCV I;  3LSH A;  1MNE A;  2GXG A;  3K10 A;  1KA8 A;  1XGM A;  4A0Y A;  4RM0 A;  1XG2 A;  1QQ1 A;  3B90 A;  3DPU A;  4Y7N J;  3KET A;  2QLZ A;  5AIP A;  2IW5 A;  1TWH J;  1MSF C;  4I76 A;  3FMQ A;  4CQJ A;  1HKQ A;  1AA7 A;  5DCM A;  3UR3 C;  2K3P A;  3OYA A;  1B4A A;  5J35 A;  2CGP A;  2JMW A;  3WU1 B;  2XF6 A;  3BLY A;  2HDW A;  2K7L A;  2EA2 A;  3HKZ N;  2BW3 A;  4RB1 A;  1BR4 A;  5LBQ A;  1DDN A;  3WY9 A;  5JHF A;  3IAM 2;  2FQ4 A;  2JSC A;  1FBU A;  1QZE A;  1TT5 B;  3AGQ A;  2EQR A;  4FCY A;  2GK6 A;  1WPK A;  3JTH A;  1YHQ I;  3WND A;  2VQL A;  3F0C A;  2V6C A;  2HOS A;  4L0Y B;  1VTN C;  4IOA F;  4W8Q A;  4HF0 A;  3J7A O;  4YCQ A;  1TQM A;  3BCB A;  4RBO A;  1IC8 A;  4IW3 B;  2PYG A;  4NC8 A;  2AHO A;  3P5J A;  2XVC A;  3E6B A;  4LB6 B;  2HKX A;  2NS8 A;  2LRE A;  4LJZ F;  4AVZ A;  2ZZF A;  4BH9 A;  1YJN I;  5B6I A;  1JHH A;  5GAD J;  3QU6 A;  3LFK A;  2GQQ A;  3CDL A;  2PMU A;  2XGX A;  1DQU A;  3HHH A;  1FMW A;  4BY7 J;  3JCU C;  1TW3 A;  1E3P A;  2K9S A;  4QLC U;  2GOM A;  2NYX A;  3ZN0 A;  4NC7 A;  2NT6 A;  1OLT A;  3E7L A;  2K9M A;  4Q48 A;  2JVG A;  4YEI A;  1P4M A;  2NOJ B;  2ZNY A;  4EEF G;  2DOG A;  2E35 A;  1ZG3 A;  3RKW A;  5DEQ A;  1SM4 A;  1M90 D;  3V7R A;  2EIL H;  2I8D A;  2NOG A;  4ZZD A;  2Y9Z A;  1JHF A;  2JQ7 A;  1O7L A;  1P92 A;  4UZE A;  3A01 A;  1KCD A;  5KHD A;  5JVG F;  1J9Z A;  1KQ5 A;  1OQY A;  3VST A;  1KJZ A;  1R4M B;  2KIQ A;  4YAW A;  3G4S B;  4V2F A;  2GA2 A;  1E79 A;  1W34 A;  3FXQ A;  3TMO A;  2M9H A;  4RB3 C;  5FRN A;  2HGC A;  3ONY A;  4E6K G;  1ZTR A;  2EH3 A;  2JK3 A;  4MGR A;  5BQT A;  4KKT A;  5DD8 A;  3OYE A;  1B8I B;  4G5G A;  1MBG A;  2XRL A;  4I09 A;  3AKZ A;  2LBF B;  3EQN A;  3H0G J;  2W84 A;  4N9H A;  4BQQ A;  3JRF A;  2J5P A;  1KQS B;  3LA7 A;  2NXN B;  4HQE A;  3F21 A;  2FU4 A;  1JJ8 C;  3OWT A;  2HPM A;  4XLF A;  2G7U A;  3MKL A;  1TYW A;  3FX3 A;  4S05 A;  3E20 A;  5DD4 A;  3W2E A;  5FFX A;  2Q6O A;  1OKR A;  1VLY A;  4XKW A;  2ZXJ A;  2LC2 A;  1PP7 U;  1A36 A;  2FBH A;  3LAJ A;  1UMK A;  2FVG A;  2W7Z A;  3FXL A;  1VF9 A;  3GTQ J;  1CLW A;  4W8R A;  2VKV A;  4FE4 A;  1ETQ A;  3TDZ C;  5KW9 A;  4XOT A;  1OCT C;  2A61 A;  5HLT A;  4X0C A;  3F8F A;  3JQQ A;  4DK0 A;  1UST A;  3R0J A;  2EV5 A;  3CO6 C;  3LSR A;  2VFN A;  3RI4 A;  1MW7 A;  5CQG A;  4WX9 A;  1FND A;  4DK1 A;  2ZME C;  4NDL A;  4PFO A;  5IPA A;  2YPR A;  3HPG A;  3VOD A;  4QFM A;  1NK2 P;  2YWH A;  4CYD A;  2LK2 A;  1FMV A;  2M3A A;  1KTV A;  4BBR J;  3HL2 A;  2DA3 A;  5IT3 A;  4Q47 A;  1OCZ H;  4BKX A;  4ACB A;  1I50 J;  3QPL A;  2GXB A;  1TWA J;  3FDY A;  4A5M A;  2XZO A;  2DJN A;  4GYI A;  2EJR A;  4A69 C;  4OJO A;  1FTT A;  2JSP A; 
#chains in the Genus database with same CATH homology
 2UWM A;  4OJ6 A;  3H9G A;  4YEJ A;  3DKY A;  4Z06 A;  2QY1 A;  1U0J A;  3WWG A;  4BS9 A;  1ERD A;  3ZQQ A;  1W0J A;  3EUK L;  2IQ7 A;  4NNJ A;  1H8H A;  1SKY B;  1EA3 A;  3FBI B;  3W2A A;  2KMU A;  4XD7 A;  2A6T A;  2HQA A;  2BOL A;  4PSX A;  1HZE A;  4Z03 A;  3BCD A;  3OS1 A;  4URR A;  2LY1 A;  2W7N A;  3LMM A;  4C2U A;  2VJJ A;  3LSM A;  4XR6 A;  3S3M A;  3BH4 A;  2ZZQ A;  2O1D A;  3HOT A;  4E7I A;  2DT6 A;  4XLE A;  4CZC A;  5CPR B;  1KTW A;  4CCO A;  5C1C A;  1OGM X;  2VBM A;  2VBK A;  3CMM A;  4DIQ A;  3HKZ A;  4G6T B;  4HNU A;  3GRH A;  1E3Z A;  1WPC A;  2XOK A;  3EUH C;  1D1B A;  4XN0 A;  2VJI A;  3QYF A;  4DJA A;  1N78 A;  4HG2 A;  4PJN A;  5FRM A;  2GOX B;  3KEW A;  3L2R A;  2IGK A;  3B4N A;  2GJR A;  1H80 A;  2NT9 A;  1V5G A;  2R7S A;  2O0V A;  2ELJ A;  5LFA A;  3GVJ A;  1G8X A;  2KHM A;  4J00 A;  4JQF A;  2RRE A;  1WJF A;  1WTH D;  3N05 A;  2XND A;  4BDZ A;  2PJR A;  1OB0 A;  4ITV A;  3I3L A;  2V31 A;  4H4K C;  4PJJ A;  4BE0 A;  3DU6 A;  1X1C A;  1WJA A;  3GVK A;  1W36 D;  4C2L A;  4BU2 A;  3IP4 B;  2HVQ A;  3BG7 A;  3ZXS A;  3BG6 A;  2W1O A;  4E4H A;  2WY7 Q;  2BW3 B;  2AQF A;  4XKV A;  3SDB A;  2UUZ A;  1O8M A;  3DKX A;  4YRV A;  5HNH A;  1OFL A;  2VLA A;  2V4D A;  2ZXH A;  2QKM B;  1KMH A;  2QKL B;  4UZU A;  3OEH A;  4TKO B;  3OAA A;  2VJ5 A;  1O8D A;  2DT7 B;  2NST A;  1O8I A;  4DNR B;  1PXZ A;  3HAG A;  2VPL A;  2R7Q A;  4PUS A;  4BXF A;  2R7R A;  4E7S A;  2X1D A;  3K70 D;  1V0E A;  2DOA A;  3DQV C;  2W6I A;  1T95 A;  3OW7 A;  2R4G A;  4B44 A;  3NWT A;  1NBM A;  4ZTJ A;  2P0W A;  4II2 A;  1IRX A;  2XZL A;  4BL0 B;  2UVE A;  4OAZ A;  4XON A;  5FRO A;  3FKS A;  3T51 B;  1YX5 A;  2IGM A;  1WFX A;  1LDK B;  4LIT A;  5HKK A;  2GK7 A;  3MD2 A;  4QPQ A;  1IDJ A;  2JIZ A;  3JUR A;  3K4M A;  3VSL A;  1EE6 A;  3PNY A;  1V5E A;  3OR1 C;  4C30 A;  3PJR A;  4DNT B;  2Z8G A;  2W82 A;  4RMN A;  2QX3 A;  5CQE A;  4BE2 A;  2CW8 A;  4IKF A;  4CCJ A;  1D1A A;  1PJR A;  3VSK A;  1K6Y A;  3VMW A;  4B3G A;  1W36 C;  1JRG A;  1I8D A;  1R6R A;  1NHC A;  2Z16 A;  1DGW Y;  1D1C A;  3BCF A;  1MAB A;  3OYC A;  3OYL A;  1NG6 A;  3S3O A;  4KIS A;  3GQ8 A;  4JMQ A;  3KYL A;  2MC4 A;  3CES A;  1WMR A;  4BEH B;  3D5R C;  2UV1 A;  2WJY A;  1KZL A;  3H5A A;  4RLF A;  3OIQ A;  1BR1 A;  4HSR A;  1DGR M;  3M1C A;  1HG8 A;  2IS1 A;  1RMG A;  2XGJ A;  1Z7L A;  3QOD A;  3SEQ A;  1QHH D;  1CZF A;  2W4S A;  3GQ7 A;  3OIP A;  1IB4 A;  3A2K A;  3L2W A;  4MXN A;  2PMZ A;  5AMV A;  1ZEL A;  4CCK A;  1H8E A;  5DN6 A;  3T53 B;  2JJ2 A;  1LFP A;  4ZDP A;  4IZZ A;  2V4J C;  4IQ4 A;  3HXL A;  3OYK A;  3QYE A;  2HVS A;  1BMF A;  2X53 S;  3K4C A;  4X0G A;  4B48 A;  3GVL A;  4L8J A;  4HEA 2;  3QYB A;  3OFN A;  2UVF A;  3C2H A;  4F55 A;  1JTA A;  4PJM A;  1SAU A;  2JUG A;  1WJD A;  2WAD A;  3PNV A;  4HST A;  1Z3X A;  3RTR A;  3OYD A;  1V0F A;  1AIR A;  2EWE A;  1UG0 A;  2K9L A;  2V7F A;  1E0E A;  3GQ9 A;  2O5R A;  1G59 A;  4RM3 A;  2LRD A;  1O8E A;  3K6G A;  2E1M B;  4W8S A;  3DEE A;  3J7A Y;  4BQO A;  3VMV A;  1TZL A;  2IXS A;  5HOO A;  4IX7 A;  1BLI A;  3OPO A;  2KPM A;  4BGD A;  2AQE A;  2KRH A;  4U7B A;  3K4J A;  4KIT B;  2X6Y A;  3OE7 A;  4XOP A;  4YZX A;  1UAA A;  4B47 A;  2ODL A;  1VZ0 A;  2VAS A;  3G2B A;  5HVQ C;  2R7W A;  3LSI A;  1O88 A;  4BJT A;  1K5C A;  3EUA A;  3GQA A;  2Z6B D;  3DPT A;  1O8H A;  4CH7 A;  2F4I A;  2LOO A;  3PFY A;  3ONQ A;  4BEH A;  4RM2 A;  3DPL C;  2BVL A;  3E1S A;  1DP3 A;  1QCX A;  3PL8 A;  3LL7 A;  2HPI A;  4PJL A;  3WQZ A;  4OJL A;  1BR2 A;  3E0J B;  1JI8 A;  4Z05 A;  2CH0 A;  4XLH A;  3T9G A;  1Y56 A;  3CJQ B;  1K28 D;  2VBE A;  5TGT A;  4F93 B;  4G7X A;  4TSF A;  1V5F A;  3SEZ A;  3OYF A;  3OOU A;  2ZTG A;  4OJP A;  4C9Y A;  2KRC A;  2IS2 A;  4C2T A;  2D3L A;  3SYT A;  4N4O B;  2W6J A;  2NTB A;  1VBL A;  4GQN A;  3ZR8 X;  2NSP A;  3VYS B;  4XQF A;  4E7K A;  4I84 A;  3SZG A;  2LY2 A;  2WY8 Q;  2IS6 A;  2M7B A;  4BUP A;  3BC9 A;  4E7Z A;  2E5N A;  3A4C A;  4B3X A;  4Y3O A;  2D3N A;  4FET A;  4FAS D;  3TBI A;  4PSW A;  2L9S A;  2KZV A;  4OWR B;  1PKV A;  4BQN A;  2NTQ A;  2IS4 A;  5IK2 A;  3RQ4 A;  4AYB A;  4F3Q A;  1UD5 A;  2O0W A;  3AFH A;  4ZYA A;  1PYV A;  4LG3 A;  4XM3 A;  4HWV A;  3HOS A;  4TT3 A;  2DCE A;  3H9Q A;  3MKY B;  4II3 A;  1WJB A;  4CCL A;  3CJR B;  3DU5 A;  3OYM A;  1J09 A;  1X1B A;  2R7T A;  3OYH A;  2O04 A;  3MMY B;  1X0C A;  4YZQ A;  4F91 B;  4CCN A;  4LIV A;  1MMD A;  1EFR A;  3BC8 A;  1D0Y A;  3AL0 B;  3CP2 A;  4Y33 A;  2VKD A;  2WAQ A;  4CCM A;  1MMN A;  4BAC A;  4YXW A;  3K4N A;  1X1D A;  1I18 A;  3SUC A;  2JJ1 A;  2BVM A;  3H9J A;  2F1M A;  4XKB A;  3OY9 A;  3F9K A;  1X1A A;  2Q1Z B;  2WZP P;  3ZPN A;  4XOR A;  3PNT A;  1MMA A;  4KKU A;  2PJR B;  2RNG A;  4HRI A;  4G6I A;  3B8Y A;  1OR7 C;  2XF5 A;  1E1R A;  2KQR A;  2WA0 A;  2ZZE A;  4ZTF A;  4R79 A;  5LD2 C;  2KDO A;  2R7X A;  3OEE A;  4NK8 A;  1QHG A;  1Y6I A;  4U4B A;  1UD3 A;  3FKJ A;  3LFU A;  4U87 A;  3DLA A;  2R7V A;  2OV7 A;  4U49 A;  2KL4 A;  3A3G A;  3W2W A;  1KCC A;  3K4L A;  4BJ6 C;  1NG7 A;  2R7O A;  3IUO A;  4CUG A;  3KRG A;  4ANJ A;  1SFK A;  3OYB A;  1LVK A;  1DBG A;  2OC6 A;  3DWL E;  2WBM A;  3VWB A;  2WPD A;  4MR0 A;  2X6W A;  2X85 A;  3K4K A;  2HU9 A;  3JU4 A;  1X4O A;  4ZC3 A;  3VYU B;  1O8K A;  1UD4 A;  2WJV A;  4QPO A;  4B43 A;  4E0F A;  1WJE A;  3VSU A;  1QU3 A;  1D0Z A;  1UD8 A;  4BJ5 C;  5HNF A;  1KON A;  3OYI A;  3S93 A;  3EPZ A;  2XDV A;  1WJ5 A;  2CW7 A;  2ZZG A;  2M4K A;  3DTE A;  5C1E A;  2ZTN A;  4P22 A;  2MAB A;  4BDY A;  1O8G A;  4OJ5 A;  4OAY A;  3AL0 C;  2GJP A;  2NTP A;  3VYR B;  4W8T A;  2WB1 A;  4P1W A;  3PSF A;  1MND A;  2A5W A;  4LIU A;  3L2U A;  1WJC A;  2HNH A;  1Z21 A;  3HUG B;  1IA5 A;  3LNN A;  1HA8 A;  2CS3 A;  3A35 A;  1BN8 A;  4JOM A;  2F6C A;  3K4B A;  1NRK A;  3PSI A;  3H35 A;  1S9H A;  4NUB A;  1W9X A;  4HNT A;  2KLO A;  3C2G A;  4J01 A;  3UW0 A;  2M4G A;  3S32 A;  4F92 B;  1OFM A;  1X19 A;  3ZPP A;  1E3X A;  2F43 A;  4G7W A;  2OUM A;  2LYC A;  1COW A;  3KEY A;  2ZSH B;  3RPU D;  4IQJ A;  1VJS A;  4Y4R A;  3S3N A;  3OMY A;  1IDK A;  2X51 A;  1RWR A;  2XF7 A;  3OL4 A;  3L2Q A;  3QOE A;  2MD0 A;  1E1Q A;  1YX3 A;  2R7U A;  3ZIA A;  1OOC A;  2JA2 A;  4PFP A;  3OS0 A;  3H5N A;  2ZXI A;  1O8F A;  2CUJ A;  3DTK A;  2CMP A;  2E5Z A;  4F52 A;  1UEL B;  3T56 B;  2INU A;  3OS2 A;  3U21 A;  3TL4 X;  3LSH A;  1MNE A;  1P9Q C;  3K10 A;  4RLQ A;  1XG2 A;  2FUG 2;  3ZCO A;  3B90 A;  2WSS A;  3RSN A;  3DPU A;  1OGO X;  2KP6 A;  4Z1M A;  2Z2S B;  2X6X A;  2V1N A;  1AA7 A;  3UR3 C;  3LMW A;  2K3P A;  3ZRG A;  3OYA A;  2VQC A;  4YZ0 A;  1T0F C;  2VQH A;  2VJ4 A;  2CV2 A;  2XF6 A;  3BLY A;  1N77 A;  4ZDO A;  2HDW A;  2XSJ C;  2LZJ A;  5CDF A;  2BW3 A;  3OYG A;  4BE1 A;  2M7A A;  3NE5 B;  3IAS 2;  1BR4 A;  3FHN A;  2PEC A;  4D1Q A;  5JHF A;  3IAM 2;  3VYT B;  2PYH A;  4PMH A;  2Y0S A;  3OR2 C;  2DIE A;  2VXZ A;  3OL3 A;  2LH9 A;  1RU4 A;  2GK6 A;  1VF7 A;  4XLC A;  2VQL A;  4W8Q A;  4XN3 A;  2M5S A;  2R9V A;  3V42 A;  2L2O A;  4KJZ A;  3FY3 A;  2VIX A;  3BCB A;  3S8P A;  2E1B A;  2PYG A;  1HVX A;  4NC8 A;  4YZA A;  2JVH A;  4NK6 A;  4B3F X;  1UD6 A;  3UNG C;  4HIZ A;  2LRE A;  1W0K A;  4AVZ A;  1UD2 A;  2ZZF A;  1D0X A;  2L9N A;  2JDI A;  4E7L A;  3D5L A;  2L7K A;  4KT6 A;  3H94 A;  4AU7 A;  2DXI A;  2INV A;  2X3H A;  2MFZ A;  3LSK A;  3L2V A;  4EW9 A;  1DQU A;  3HPH A;  4FXU A;  1FMW A;  1PLU A;  3CF2 A;  3PUB A;  2MYS A;  2Z1D A;  2HVR A;  4GRI A;  1T5E A;  1WP6 A;  2GOM A;  4DOZ A;  3EQO A;  4NC7 A;  4EAT A;  1OLT A;  1O8L A;  2NT6 A;  2K9M A;  2JVG A;  2NOJ B;  4XKC A;  2F5V A;  3OYN A;  2ZFU A;  1YE9 A;  1BPL A;  2CK3 A;  2CV0 A;  4DBR A;  1LKX A;  2LG4 A;  2I8D A;  3M8J A;  1QJV A;  1PE9 A;  2HLD A;  1KCD A;  2XAU A;  5KHD A;  3NWS A;  2X1C A;  3RCO A;  4XMY A;  3VST A;  2V7Q A;  3FPP A;  3W3C A;  1E79 A;  3DTI A;  3VSV A;  2LBF A;  3ZGK A;  1MMG A;  2V26 A;  2E1M C;  3TMO A;  2QE7 A;  4KKS A;  3CP8 A;  5FRN A;  1GQ8 A;  3BCA A;  4E6K G;  3CZ6 A;  2VKH A;  4MLO A;  4NQW B;  2XC7 A;  2V6E A;  2CFO A;  2NZM A;  4KKT A;  3OYE A;  2VXD A;  1TT0 A;  3HC7 A;  3AKZ A;  2LBF B;  1X4P A;  4DBQ A;  4BQQ A;  3EQN A;  4OZZ A;  1GLN A;  2V9K A;  5CKT A;  3H5R A;  3OWT A;  2HPM A;  4XLF A;  4HPQ A;  2RQQ A;  2XZP A;  5KNL A;  1FX0 A;  4CSW A;  3ZSC A;  1VLY A;  4XKW A;  4DGW B;  4XL9 A;  4ZJZ A;  2LC2 A;  2Q2E B;  3MKW B;  3GQB A;  4W8R A;  1OHH A;  3A1Y A;  3GBG A;  3MKZ A;  4E7J A;  3OOC A;  2K5C A;  2VL8 A;  2IGO A;  3HG9 A;  3KX2 A;  2X1E A;  4YEL A;  2QXZ A;  4ASU A;  4XOT A;  4CA0 A;  3G05 A;  5HLT A;  3LSG A;  2KVO A;  4DK0 A;  4ZDL A;  2ZSI B;  1O8J A;  3D5S C;  3OYJ A;  4N4N B;  2CV1 A;  1E43 A;  1MW7 A;  4XNF A;  5CQG A;  4D9J A;  4DK1 A;  4PFO A;  2E60 A;  1BOB A;  4OZY A;  5FL7 A;  3HPG A;  3W2V A;  3DDY A;  2HZD A;  2BSP A;  2X8K A;  2L5Q A;  1FMV A;  3FBN B;  4P5O A;  2M3A A;  4E7H A;  3H0D A;  3K70 C;  3HL2 A;  2VQG A;  1DBO A;  3VR6 A;  1N75 A;  4XLA A;  3I9V 2;  2M0M A;  2W00 A;  4PK4 A;  2CUZ A;  2GJK A;  2IGN A;  2WAF A;  2WAE A;  3FDY A;  3VDX A;  1BHE A;  2XZO A;  2O17 A;  3A3B A;  4OJO A;  1Z3Y A;  2VB6 A;  5KCM A;  2DJI A;  2JSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...