4AVZA

Tailspike protein mutant e372q of e. coli bacteriophage hk620
Total Genus 226
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
226
sequence length
598
structure length
598
Chain Sequence
b'DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAIL SPIKE PROTEIN
publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 226
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4avzA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4avzA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4avzA02
3GQ9A 1O8KA 1O8JA 1O8FA 3KRGA 1OGOX 4XLAA 3UW0A 2VJJA 4HWVA 3GQ7A 2UVFA 2INUA 3T9GA 4XONA 3SUCA 2IQ7A 4YZQA 2VBMA 4YZXA 1AIRA 4W8QA 3ZSCA 1XG2A 4MR0A 2X6XA 4URRA 4XLCA 1X0CA 4W8RA 1KCCA 4Z03A 4XM3A 3VSVA 2NSPA 1RMGA 1OOCA 4AVZA 2X85A 2VJIA 1H80A 1QCXA 2NTQA 4OZZA 2NSTA 2Z8GA 4XNFA 1EE6A 3EQOA 3GQ8A 1JTAA 3GRHA 4XLHA 1GQ8A 4W8TA 1DBOA 1O8LA 4EW9A 1WMRA 1RWRA 4I84A 3GQAA 4XL9A 1OFLA 3LMWA 1KCDA 4XN0A 2O0VA 4U4BA 1IA5A 2X6YA 4XMYA 4XORA 5C1CA 2O0WA 1BN8A 3ZPPA 4OJLA 4YZAA 3B8YA 2QY1A 3JURA 4NK6A 2EWEA 1O8EA 1VBLA 4Z05A 4MXNA 2O1DA 4XR6A 1K5CA 4Z06A 2BSPA 3VMVA 1CZFA 2NTBA 1PXZA 1PE9A 1DBGA 2UVEA 1O88A 4XOPA 4YEJA 4W8SA 2NT9A 2O04A 1PLUA 1HG8A 1QJVA 1JRGA 2QX3A 2VBKA 2ODLA 3WWGA 4U49A 4XLFA 4XLEA 2VBEA 3VMWA 3VSUA 4XQFA 2PECA 4XN3A 2NTPA 1O8DA 1IB4A 2PYGA 3EQNA 4PMHA 1O8MA 1OGMX 4OJOA 4OJ5A 4OJ6A 4XKWA 1O8IA 4YZ0A 1IDKA 1O8HA 3B90A 2NZMA 1OFMA 1O8GA 2NT6A 4XKVA 2QXZA 2X6WA 5C1EA 4C2LA 2INVA 4OZYA 2O17A 5AMVA 4OJPA 1RU4A 4XOTA 4NK8A 1KTWA 2PYHA 2X3HA 4YELA 1IDJA 3VSTA 1NHCA 3B4NA 1BHEA 3FY3A
chains in the Genus database with same CATH superfamily
3HSRA 1OJLA 4O3MA 4P26A 2RAEA 3GVJA 2CBXA 1MBFA 3K70D 1U9OA 2CRVA 2M0CA 4FN5A 3R60A 1CNEA 4FX0A 2R5ZA 2IQ7A 2K85A 1K4SA 4HIZA 3GFLA 1ZUNB 2VKHA 1NG7A 3BROA 2QENA 1NBMA 4MR0A 1FNDA 2DMQA 2PJPA 2XSDC 2WBMA 2OD5A 5L3GA 2JSCA 1QZYA 1GV2A 4HZFA 1O4XA 2F6CA 2FNAA 4BJ5C 5EGOA 4YAWA 5GAHJ 4ENKA 1D0YA 2X3UA 5F6FA 3I1FA 3SDBA 2WSSA 1R1UA 3OOPA 1T38A 3VODA 1WJAA 4FETA 1DP3A 3CCJI 2QF7A 4XLHA 2HPMA 1XMKA 2EIJH 4GFBA 4ETSA 1VQNB 2Y75A 4YFXF 1ZREA 2NNYA 1A6IA 4BHPA 1ENHA 1W35A 2F5EA 3OS0A 3O8GA 2PE3A 3HRUA 5HS9A 2JRTA 1BJZA 1WVRA 4ABZA 3HOTA 1QPIA 1Y1VJ 3OYHA 2OTLI 4G6IA 5FRMA 1MDMA 3BPVA 1G6NA 2EH3A 2HOTA 3OSFA 1A5JA 3TDZC 3L00A 5LRSA 1WOSA 3ZBUA 1XCVA 4OWRB 1I8DA 1AWCA 3EPZA 2N8GA 4X7FA 2FJ1A 3RIQA 1WCMJ 3NQOA 3Q6RA 5F08A 1AU7A 4HNVA 3CD6B 2W7ZA 3OYBA 2NTBA 1B23P 4ESBA 1BI1A 1E3ZA 3CXCB 3KE2A 1B4AA 4A3JJ 1Z91A 3IH4A 1ODDA 2FMLA 3K7AJ 5CVRA 4DNTB 3HRMA 4WZEA 2HOAA 1ONVA 3FKIJ 2JA5J 3ZXSA 1OB0A 1GJRA 4P25A 2DOEA 4EMSA 3ES9A 2LD5A 3V7AA 3FK6A 4JQFA 4L18B 4YFOA 2ZFWA 3S2WA 4LG0A 3I58A 2VODA 4HNTA 1VF7A 2AO9A 1XDSA 2DA5A 1STZA 1LPQA 3PUFA 3P9CA 4LB6B 5ED4A 1QFYA 1O3RA 3ABKH 3OIPA 3C2HA 2HCJB 2R7TA 4M9ZA 1MNDA 3PIOF 2BX6A 1UD3A 5LEJA 3GVKA 5M5WJ 4AYBA 3W6VA 1Q82D 3VWBA 5J6XA 5FNZA 3B73A 3E3VA 4IF4A 1WSRA 3SJZA 3FM3A 4RD1A 4OINF 1S9HA 3BR3A 1JA1A 2L02A 3TBIA 1HDDC 5C1EA 4AUXA 4XK4A 2ZJ2A 2OAZA 4RCZA 1BA5A 3PNYA 3F6OA 1K61A 4YIIA 3ZQLA 1NHCA 1X4PA 3ESWB 5E1WA 5FLMJ 2FUG2 3OS1A 2IA0A 4DQLA 2EIKH 4RS8A 5A89A 1YJNI 3O2PE 1TZLA 4EGYA 2CQ7A 3IWFA 3I5UA 4S05A 4Y52J 2D3LA 1FSEA 1IRXA 2BY2A 1G7SA 4W8QA 1FNCA 2MBFA 3KP5A 2K9MA 2HXIA 2FNPA 2FOKA 5IYBJ 2R93J 3HIFA 4CZZA 2V5IA 3CMAI 4OJ5A 3GFMA 1L3LA 4PC2A 3F8FA 2M3AA 3WNDA 1BL0A 4KKTA 2Z3YA 2WB1A 3GQBA 2DT5A 1K8FA 5C4JJ 4OAZA 1FBQA 3CUQB 1R7JA 1OYIA 3ZQHA 1K79A 2ZSIB 1Y0RA 1OGJA 4YHBA 1MJAA 3TW7A 1TWHJ 4CXFA 3KCCA 1YI2B 3CCMB 5FKOA 5E3OA 3WTTC 2KL4A 1UAAA 1GR1A 2KIFA 3H36A 3HC7A 1LVKA 2CUFA 1ETVA 4IHXA 1CQXA 3BZCA 3ISPA 2WADA 2VXZA 4M3EA 2X0LA 4UVAA 1Z77A 2LYCA 1Y1WJ 5TV2A 1O3SA 2QTLA 4LBZA 2Z99A 4HA8A 1V3FA 3MKLA 5K7FA 1N08A 1U0JA 2BF4A 2HDCA 2BM4A 2OQRA 1OLTA 1A36A 2J5PA 5JFRA 3NWTA 1I1SA 2VBUA 1QGZA 3A1PA 2XTXA 1YTYA 1GVDA 4N9IA 3TDUC 2AXTC 5FO1A 2EJRA 3AG1H 3T53B 2ZZGA 3H0DA 2UVEA 5D6EA 2P81A 4D7NA 3L1PA 1Y0YA 5E1ZB 4IKFA 1WFXA 2ELJA 1R5BA 5J3OA 3C7JA 1W7PB 3M8JA 1PKVA 2W82A 3S16J 3PENA 4ZV4A 2UXXA 4X0GA 1EV7A 1X1AA 3DQVC 4DZJA 2ZC2A 1WJ5A 2IVMA 4A0YA 1IXSB 5HODA 5CJ9A 5DDGA 3HOYJ 3A03A 3BG6A 3W3CA 4G5GA 2H8WA 2D45A 5IP9J 2ZZQA 4RDUA 3KL9A 3H9GA 3IKVA 3C1DA 3HHHA 2XUBA 1VQKB 3A01B 5BSXA 1LJ9A 4XRMA 2DCUA 2MC4A 4ZYGA 4U0WA 4L5EA 3W2WA 1T5EA 4ANJA 3S1QJ 1U5TB 4U0VA 2Z16A 5E8GA 1MNEA 1ULYA 4RMNA 4A3IJ 1IRZA 3HXLA 3H9JA 2Y0SA 4N3GA 1J5YA 2W57A 2M87A 4PJLA 4DYQA 4L0ZB 4ZDOA 1BMFA 1W34A 3RIRA 2GJPA 1FPQA 1UD6A 1XPXA 1BI3A 2KRFA 5FFXA 1SFUA 2QKLB 4DNRB 3GSIA 2VC0A 2X4HA 3E6BA 2L7KA 2WAQA 1DP7P 2V1DA 2Y0MA 1KQ0A 5D4SA 1WH5A 2Q1ZB 1S7EA 1YW9A 2LR8A 3OOUA 5JI6A 1IJWC 3HOUJ 3H09A 4ZDLA 2VL8A 4HWVA 2B63J 1JGGA 3WTXC 2ME0A 4X7CA 1EFCA 2BEOA 1FTZA 4NUBA 3FXRA 1FX0A 1BR4A 4RJLA 1LDDA 3ZMZA 4E7HA 2VJ5A 2LY1A 1E43A 5B1AH 5JLWA 1U2WA 1FLIA 1WQ2A 5CYVA 4BDYA 3AL0C 1H80A 4P9SA 1QGPA 4BQAA 2KT0A 1IRFA 1Z21A 3RDIA 2GOMA 3VMFA 3OZUA 3B78A 2FQ4A 2LY2A 2WB1N 2L2OA 1YX2A 2X8KA 3GTLJ 3DF8A 3LA2A 1VQ8B 1ZN2A 1Y0NA 4G9YA 2RREA 1O7LA 3IKTA 1U6GA 3F6VA 2XPUA 4AF7A 5TGTA 3ZMTA 1Y0UA 1U2RA 1GV5A 2O03A 3FKSA 1HA3A 3NEUA 5BNGA 1BM9A 1I18A 2R7ZJ 2BE5F 2FMYA 4A69C 2KDZA 2L01A 3CCRI 2QA4B 4OJLA 3PQJA 4IPAA 3FHNA 1MD0A 2R5YB 3BY2A 4P6VF 2EA4A 3I0TA 1QBJA 3ECHA 1WOOA 2P5KA 5J8FA 3PJRA 2DU9A 4RAZA 2J8KA 2QSGX 3WTVC 2OA4A 4BL0B 1ZM9A 4JP0A 1R5OA 3SFZA 4M73A 4UVBA 3J81K 1TT0A 3QP5A 2RDPA 4MLOA 5DNSA 5DD4A 4B09A 5F4OA 3HZJA 4U9UA 1FJLA 1TVCA 2V7VA 3PNTA 2LC2A 3GF2A 4P5OA 2QQ9A 3T5XA 1MSEC 1HW5A 2XPVA 3BDDA 5GTHC 2XGXA 3LAPA 5BMZA 1VQMB 4U49A 3WWGA 1B59A 4IHYA 2QCOA 1XDUA 4HF0A 4NNJA 5CVUA 3TQNA 3L2UA 2OBRA 2IGKA 1DGRM 4XRSG 1VZ0A 1UHMA 2PYGA 1LDJA 2VFNA 5L3DA 1I3QJ 2LSOA 1V4RA 2LMDA 2P6TA 4JX6A 3DEEA 2IGMA 2GWRA 3AK5A 3CCEB 3ZQIA 5GAEJ 5HS8A 1JJ2B 3D1NI 1B8IB 3QOEA 1YJWI 3QYBA 1WPKA 3RPUA 1XB4A 4NB5A 1N06A 3Q3AA 3CJNA 3I4PA 4TMZA 1F20A 2COBA 2HDWA 3LYCA 2H8RA 2ZTGA 4R79A 2KKOA 5FROA 1OR7A 1IUFA 1Z0XA 4A3LJ 2Y0SN 3BH4A 1WGXA 1OCPA 1SMYF 4HDVA 3Q0VA 1MMSA 2CW5A 2E7WA 1G7TA 1ETOA 1QQIA 1XX5A 4AC9A 2KRCA 1KU9A 1LLZA 4GO1A 3HHGA 3W5VA 5DD8A 1KJZA 3PVDA 2VOOA 3P7NA 1RC9A 1XGNA 2VBWA 4CSWA 2VBMA 3FZVA 5D8KB 1XFOA 5F64A 3H1CA 4URRA 3EYYA 2VNKA 1J7KA 2VOPA 1SKYB 3DU5A 3EQLF 1R23A 1L0OC 2YR2A 2BXZA 2M5SA 3VOEA 5M3FJ 3H3UA 3JW4A 4Y9UA 2XZLA 4L0YB 3SZEA 2JSPA 4BQNA 1F36A 1S7AA 2WAEA 1GXQA 3QP6A 3ONQA 1W0UA 1IAWA 3HOZJ 4MEXF 4RD2A 2W84A 2EB7A 5E20A 4P3YA 2UUZA 3K70C 4WXDA 3ERED 1W0KA 1FP1D 3K4CA 2D74A 2OK7A 4ZCLA 5JBQA 2RQQA 3G1LA 5FJ8J 3JAMK 4MGRA 5F0FA 1S29A 1NG6A 4WXCA 4YIRX 1HW1A 2HZTA 3SJPA 1FWZA 2D3NA 3ZQQA 1TTYA 1YFHA 3MZ8A 5CKTA 1POGA 4I0AA 3DKXA 4CZCA 1W0TA 5IYDJ 1ETWA 2ID3A 1OFDA 3A3GA 3B8HA 2FX0A 1X2NA 3SFIA 3V8JA 1T2KA 1PDNC 4IW3B 4PABA 1ZARA 3DBRB 5EDNA 3JU4A 3ZPPA 2X1CA 4DYRA 4KMFA 3FMSA 4V2GA 5CQEA 1N0UA 2PBIA 3DCFA 3ZQCA 1WU8A 3E97A 1O8EA 4NHJA 3CCJB 3QU3A 1MH3A 4DK1A 1ZGAA 4BBSJ 1SAXA 3HTSB 2IGNA 3N05A 2TCTA 2HKXA 1QVFB 2FU4A 3H3ZA 3SHFA 4W97A 4EM1A 4XOPA 2B0LA 2OCEA 3ZMSA 1ZM3A 4FE7A 2RC4A 3DWLE 5HDNA 1U3EM 4LBWA 1JUSA 2OJED 1B1BA 4Y7CA 4IOCF 1V5FA 3GXOA 2OTLB 3OPOA 3RYRA 3U6KA 2BHYA 4ENMA 5J35A 2GJKA 2EZLA 4LOCA 4BEHA 3VR6A 1G3WA 4XLFA 1QVTA 1I50J 1Z67A 3BP8A 3DP7A 3CDLA 1MIJA 1MBHA 2E1NA 2KDOA 4LLLA 3JSPA 2DFIA 2DN0A 5ICEA 5GPCA 2QYOA 3HUGA 2JQ7A 2IS6A 2YX4A 4M3BA 3H3VK 3O8HA 2MFZA 4KDPA 1SMTA 3PQKA 2Q6KA 3MMPA 1T95A 2Y69H 1BC7C 4PJNA 4M74A 4ZZDA 5LHGA 4XIDA 3CJRB 1OFMA 2R7RA 1RUOA 1O8GA 3ROUA 1VQLI 4EQQA 2XTYA 1KYWA 1XMXA 1DARA 1RUNA 2WYRA 3KP3A 2IPQX 1N77A 1T56A 2WA0A 1OMIA 3MKWB 2QBYB 4XOTA 1H88C 2LK2A 3FXMA 4BS9A 2X3HA 2DT7B 3WHBA 1T6XA 1TYVA 4GYGA 2Y48A 2OUMA 1XMAA 3GLLA 1W36C 3H94A 3RKXA 3BCBA 2DMTA 4GQNA 5FKMA 1O8KA 5E18F 2X1DA 4XLPF 2KLOA 2HTJA 3WGHA 1A35A 2ZTNA 3I59A 3Q0WA 4MTEA 2L4MA 1OCCH 3DPUA 4BE1A 3LSRA 1HC8A 2KMUA 2R7WA 1FTTA 1HQCA 3EUHC 2OV7A 3RJPA 1TTTA 3EUKL 1Y56A 1BR2A 3FXJA 3ML6A 3BG9A 5ILVA 4RM0A 3CO6C 2NXNB 5J1RA 3ASRA 3NAWA 2A68F 2EZKA 3K4KA 2X85A 2MSYA 3HG9A 2CJJA 1ZLJA 1ZRDA 3HDDA 4A3GJ 2HFHA 5IPAA 2LF7A 4DK0A 1USSA 3A0BC 3KX2A 2Z8GA 1QVUA 1IF1A 2GK6A 2TDXA 2QKMB 4ZYHA 5HVQC 1YJNB 5FO5A 1Z7UA 4B1RA 3FISA 4EH1A 4DOZA 5CLSA 5HLIA 4AU7A 2M8EA 1U9NA 2AQFA 2VBYA 3R0AA 4G94A 4HV6A 2VBXA 2QZAA 2R5ZB 4I84A 1OFLA 1VQ8I 2BGJA 1K8AD 3RPQA 1EF4A 3ZMDA 4BY7J 3OOCA 3TL4X 2QSFX 5AN9A 4OMZA 1MRZA 1TLHB 1MBJA 4PK4A 4YEIA 1IN7A 4NC7A 3BCDA 4PAAA 1XQBA 4YZAA 3CCSI 1IC8A 3AG4H 3BTIA 2AHQA 4ASUA 4LBVA 3K9TA 2Z33A 1G3SA 1ZHFA 1NRKA 3CDIA 1KU3A 5KK1A 4RDJA 1GVHA 5KSWB 2YU3A 5ICFA 5D5UB 4F91B 1IZ1A 1Z6RA 5AIPA 3W6KB 4BKXA 5IY5H 1HW2A 3ZPLA 1PP7U 1NJID 3AVYA 1W9XA 1CZFA 3TEDA 2V6EA 4HBLA 1SAUA 1DBGA 4XRFA 2R7FA 5TRDA 2M7BA 3K4LA 3W2AA 1PVEA 3ZP5A 1YLOA 4X05A 5KW9A 3SZGA 1Q1VA 2VNJA 4MQVA 4DZPA 4A5NA 2E7XA 2DXIA 2DA4A 3IC7A 3F21A 1LE8A 4XKBA 5ILSA 2VJ4A 2EBIA 2P3MA 1MDMB 2VBKA 5DM6F 3RZOJ 1H85A 3VFZA 1IDZA 3WNCA 3MD2A 1W5SA 4C2TA 1FY7A 5KHDA 1TT5B 1X3UA 2KIMA 3E5UA 4ZYEA 5BOXA 2HPIA 3JRCA 1IG7A 1XD7A 1O8MA 4F52A 4Y33A 4QIWN 1MZBA 2CRGA 4RGRA 4P2NA 4JX4A 2Z9OA 1GAQA 1TSPA 2LRDA 3BG5A 3K6GA 1YX3A 4KYWA 1QFZA 3D5SC 3RTRA 1IJEA 2DIEA 2PMZN 1OYYA 3A8JA 4P9UA 2NAZA 1MJ9A 4PC6A 4F92B 2CW7A 4NDLA 3NB2A 4II2A 2B0RA 2IW5A 2GA1A 4TV7A 2QTZA 4RD0A 2IT0A 3K2ZA 4M6XA 1E64A 1ZK8A 3LL7A 4HX7A 3CDHA 1QA6A 4P6YA 4PC1A 2LNBA 4G6DA 4HPQA 2P7CB 2DMUA 4NK8A 4BXUA 1U8RA 4LG0B 2VONA 5KCMA 4TKOB 1BI2A 1ZM4A 1GVJA 4RB2C 1ZRCA 4IZZA 3CCVI 1ZG5A 2ZBUA 5J47A 3DTKA 2DJNA 2MH2A 1E17A 2NPFA 2JA8J 3SLDA 1D1AA 3QFRA 4S0HB 3GQ7A 3EUHA 1ZGJA 3A0HC 2A69F 4RM3A 1I1GA 1P4WA 2D1VA 1P4MA 4YZXA 5K7ZA 1CGPA 3GTMJ 1RKTA 1W1WE 2M2EA 2PFBA 3QPHA 3ZIAA 1J09A 1XG1A 2VFQA 2X6OA 4B44A 2GPJA 1D1NA 3K1MA 1Z3YA 2X9DA 3U1KA 4ZDPA 3H9NA 3CB4A 3AVWA 1LLWA 5L3FA 3GMEA 2YPRA 2OTJI 1RRJA 3RCOA 4MFDA 2LG4A 2HQRA 2HXOA 4UVCA 4Z4TA 4OZZA 1TQPA 3T51B 1JKOC 1MMDA 3CP2A 4E4HA 5LGNA 3AFHA 2DA2A 1FNBA 1K28D 4Z1MA 5FD6A 4Y3OA 1ZM2A 3WE3A 4PZJA 1YW7A 3KEOA 4CQJA 4J0QA 4P1WA 1JHHA 1UHSA 3HJEA 1RWRA 2M34A 3AG2H 3M7GA 2FBHA 4B3FX 2BZTA 4DYCA 1YLFA 2L3DA 1WTHD 1D3YA 3SDGA 4YAOA 2WY8Q 3DLLF 4OIPF 3OKXA 2XZOA 1WI3A 1FBSA 2XNCA 2JUCA 5LMZA 1IJFA 2M8GX 3VB2A 3FPPA 3RKQA 3WODF 1SKQA 2LREA 4Z05A 4QFMA 2O1DA 3FDYA 1A8PA 4OPSA 3GTPJ 2P0WA 3EETA 4E7SA 1SD4A 1HF2A 5D4RA 4ZTFA 3I9V2 1RPWA 3TW6A 3H0GJ 3OYLA 1TNSA 3D0SA 3H5NA 4A5MA 4G7WA 2P5LC 1R36A 2PEXA 4HLXA 1IHMA 1S8NA 2XV4S 1LEBA 4HE6A 4JBAA 3VO1A 1QFJA 1UD5A 3REOA 2B7BA 1E1QA 4Q5SF 4W8SA 2WC2A 3LSKA 1VFCA 2QE7A 2BPOA 5THXA 2R3SA 2W6JA 2Q6LA 1LUJB 1X2MA 2VI6A 1JJ6C 5CVVA 2STWA 2PMHA 3S1MJ 3CCRB 3F0CA 4X0CA 3WHCA 2E5NA 4D0PA 3JAMZ 4D9JA 4XLEA 1JI8A 4OOSA 3N90A 4A0ZA 1DUXC 4A12A 1MKMA 2PECA 2RNGA 2XKOA 2CWEA 1G8XA 2XVCA 3SEQA 2NRAC 2DA3A 5H6QA 3G4SI 1QQ1A 2KIQA 3ZN1A 2V7QA 3PFYA 2VKVA 3DU6A 3K4MA 3Q3SA 2V7TA 4NBSA 1S72I 2VZLA 1R5ID 3DXJF 4NCNA 3G1MA 2NNNA 1K6YA 3CC7I 4BY1J 3R61A 1I7PA 3QE2A 1OFEA 2WZNA 1EH7A 2VKDA 1KK0A 4KMUX 3NARA 4WZTA 2H1LA 3P5JA 1T0FC 2IS4A 2JTVA 4XD7A 2YWFA 3E6DA 2INVA 4C2LA 3OYEA 1DPRA 3BZKA 2W4SA 1IV6A 3BTLA 1KTWA 3LMMA 1OKRA 4IVNA 3N97A 1R6RA 2BOLA 2IA1A 3ZN0A 4BGDA 5KVRA 4X6AJ 2ETHA 1SFOJ 1WOPA 5M5XJ 3PUMA 4LFUA 3OSGA 4DJAA 3OJWA 2KQRA 4E7LA 3IAS2 3KPHA 2QSHX 1GHCA 3GIRA 1YJWB 3PL8A 1W36D 1KA8A 3SZPA 1TUIA 1C0WA 3WNBA 1I6XA 3E7LA 3AG3H 4YZQA 2W25A 3DTEA 5HLHA 1TP4A 2R7VA 1KQ8A 3PM1A 2DDBA 2PMUA 2V31A 1GLNA 3RSNA 1XCBA 3GTOJ 1X0CA 2IAIA 5J1YA 1J9IA 5GADJ 3VNVA 3NE5B 2NSPA 3SQNA 3LSMA 1E79A 4M3DA 4XSZF 3G3ZA 2K02A 3CCQI 1APLC 3S14J 4ZGQB 1IXCA 3Q9SA 4WQMA 3GZ6A 2NTQA 4RPDA 2H27A 1G59A 4KJZA 1FP2A 2V7FA 3KZZA 5LRRA 2CV2A 2IOUG 4DQ2A 1PXZA 1SM4A 2QGGA 1QZZA 4UV9A 1PJ7A 4LGWA 3JTGA 3ZUGA 2XGJA 1OGIA 1UHWA 3KP6A 2V4JC 1EH8A 2A61A 3M07A 2O0VA 2DAOA 1IA5A 1U78A 4XMYA 5F1JA 2JJ7A 4BBRJ 3KYLA 3TOAA 3FMQA 2HTSA 5K5RA 3LFUA 3S2DJ 1P2FA 4Z4WA 3E0JB 1MMAA 2O0WA 1ETXA 3AVXA 2WTEA 3BWGA 1YRNA 2LBFA 1DABA 3BY6A 3TP3A 2XC7A 1FYMA 1G4DA 2HVSA 3MN2A 4U88A 1KZLA 3IP4B 3PA1A 4MXNA 2JA7J 1Y39A 2M4GA 1D0ZA 1Z7LA 4XR6A 4P9FA 4F93B 1H8EA 3VMVA 1WXRA 1ZYRF 4CUGA 4PGHA 3I56I 1X3WB 2ZITA 1BX0A 3PUBA 4BNCA 3BCFA 3P27A 4YEJA 3R0JA 1V0FA 3MEXA 3WTZA 4XRSA 1NB0A 1PLUA 1V55H 2CK3A 3MZHA 4C30A 4P96A 3KP2A 3OYMA 5K1YA 2V1NA 3CTAA 3M8FA 4I7HA 4KA4A 2IS2A 1QJVA 2MC3A 4CDGA 4P55A 1YX5A 1IN8A 1G2HA 4FT8A 2DEUA 5DEQA 3LFKA 2M0MA 4UHTA 1DDGA 2EWNA 4KN4X 4C43A 3A35A 4EV0A 5HXBA 2IXSA 4G6QA 2L7ZA 1UMKA 2ZMEC 4PSXA 4PMHA 2E1CA 4M4SA 2KJBA 4EJUA 1HZEA 5A2QZ 3CUQC 1H8HA 4Z4RA 2W00A 2JUGA 2R92J 4MTDA 1BIAA 1R5NA 3WU0A 4OOVA 3JRGA 2Z2SB 3VSKA 4A2UA 2L9SA 4IHSA 2QLZA 1LEAA 2LF8A 4EJWA 5HOOA 1BQEA 1I39A 2WJYA 2VT2A 4FX4A 1ETQA 2ZXWH 3VYRB 3WU1B 3L2RA 4OJPA 2KZVA 4Z4ZA 2G7HA 1TWFJ 1P4AA 4AM3A 3KYDB 4N9HA 2FRHA 2CV0A 1QUFA 2AS5F 2B5OA 2BVNA 4RB0A 1REPC 2XEXA 1BJAA 1R1VA 3IV5A 4GDFA 1JT6A 3G71I 3FY3A 1FYLA 3OW2B 3FHZA 2QVOA 3OR1C 3W6JB 4BE0A 2R9VA 2Y9YA 1RZ4A 3PSFA 4UB8C 3W2VA 3WTUC 2Y9ZA 1R5HA 4AIHA 4J00A 2INUA 1WHUA 4TMVA 1VQLB 1XS9A 3WE2A 3G73A 4BH9A 1ACIA 2HEOA 2D2WA 4B3GA 2IEKA 4IRIA 2BXYA 3T56B 1K4TA 4J01A 4IOAF 3BR5A 3SEZA 1IUYA 4LC0A 1HLVA 5IYCJ 2NVQJ 3J7YJ 1QX4A 4AYBN 4N0BA 3RQIA 2IS1A 1NB9A 5LGTA 1OB5A 4RAYA 1TLLA 3B6CA 4IRHA 1OYWA 5F0CA 4UY8I 4XNFA 4PC7A 4HSRA 1JTAA 3PETA 3BR0A 4RM2A 2HVRA 5EYRA 1O8LA 1PP8F 2OC6A 3H9QA 2JJ1A 5BSYA 2OBTA 3H92A 1LDKB 4BACA 1FOKA 2DBBA 2HLDA 4XL9A 1OISA 3BTCA 3ISXA 3OR2C 4KUMA 4RAGA 4EJOA 2GOXB 1QRCA 3PSZA 2PJRA 1U5TC 5LHIA 1T39A 1NH3A 1Z6TA 4A3CJ 3AL0B 4RLZA 4HQEA 1SEUA 4QWQA 2GREA 4Z4VA 3VEPA 3FXLA 4CGZA 3JURA 1P7JA 3HPGA 3JTHA 3OAAA 2DMPA 1W4MA 3PNVA 2VB6A 1K78B 2E1OA 1K5CA 4LMYA 4BPRA 1PYVA 1OB2A 2IA2A 4Z4YA 1FT9A 3DKWA 3V7SA 3OFNA 3BJAA 3TO6A 1EH6A 2LTPA 2DETA 4A3EJ 2VLAA 1WJDA 1WJCA 1YW8A 2E1BA 1M1KD 1FBUA 1FIPA 4P3IA 4G7HF 1AA7A 4YIFA 2YS9A 2GXGA 3QRFF 2YUSA 2EV0A 2ZZFA 4B4DA 2E71A 4CYDA 2YWEA 2EFOA 3W5UA 5DCMA 2QX3A 1VLYA 3OZWA 2XNJA 4AIJA 3T8TA 4ACBA 2BV6A 2ZMEA 3CCSB 2XC1A 1FDRA 4RA2A 2YWHA 1WH7A 3VSLA 3QU6A 4XQFA 4OPOA 3KZIC 2G0YA 3ZRGA 1K83J 1QHGA 5LEKA 4I09A 3EQNA 4PUSA 2I8DA 1T6SA 1SVOA 1QGYA 3TO9A 5BPDA 4KFCA 1ORKA 1VHOA 3AGPA 5KAFC 2BVMA 3H35A 1V0EA 3LNNA 1P4XA 5E79C 4M6YA 4BU2A 3LOCA 1A04A 1VQ6I 2O9LA 1SC7A 1FSHA 1QA1A 4QTRA 1QRBA 5D5XB 4XSXF 4IHTA 1FOYA 5GPAA 1D8JA 5M5YJ 1CNFA 3WG7H 1OQYA 2DK5A 4S04A 4E0FA 2FEZA 2XTWA 1FEXA 5FKKA 2E1MB 1MSFC 3CPXA 4U7BA 2CYYA 2ZXJA 4EEFG 4DQKA 4BEHB 1EZGA 3CJQB 3CJTB 3KETA 5DUKA 4QVAA 1FNMA 1W87A 4I02A 1LVAA 4M3GA 1F4KA 4IJAA 3HUGB 2IRFG 4B8XA 1HKSA 3QPTA 1RR8C 1BHEA 4MFEA 1H42A 4ACAA 3GQ9A 5HS7A 1OGOX 4B47A 1IGNA 4G6TB 1TYUA 3FJOA 2EPFA 6PAXA 4XONA 1ZQ3P 3C2BA 1USTA 3QFTA 3BC9A 1TNTA 1Y8RB 1KK1A 1RESA 4I99C 1HOMA 2EIMH 2DERA 1TYWA 2MD5A 2X0KA 4W8RA 3NAUA 1SFEA 4A6DA 2VE9A 2HOSA 3VSVA 1TW2A 3L2QA 2DA7A 3P9IA 3IRRA 2BSAA 3CCVB 2V26A 2FXAA 3E6CC 1VJSA 3E5XA 1EE6A 4D5FA 2FD5A 5TR9A 4DGWB 3S1NJ 3ASTA 4IXAA 4MYTA 3BT9A 5HZBA 1IXRC 2RGVA 4HE5A 3N6ZA 4O6JA 1PUEE 2ISYA 2E5ZA 2WAQN 2XAJA 3I59B 3IWZA 2E35A 3J80Z 1IRGA 4LBYA 3GQAA 2CQKA 1LQ1A 1KGSA 4RDKA 4FASD 4M71A 1VTNC 2EV6A 2JMWA 1KD1D 3MHPA 1OCZH 2G7UA 3CZ6A 3K69A 5E3NA 4RPBA 4TSFA 1YITI 3SKBA 2OTJB 3DPTA 3UKGA 3BOQA 3P9KA 4KICA 3B8YA 4AF6A 5IYNA 1S5LC 3QWLA 3F9KA 1JTYA 4OM9A 2C5HA 2HR3A 4MQ9F 1YIOA 2DQRA 2K9QA 3KFWX 5J4YA 1K78A 3I71A 2NOJB 2MH9A 3VDXA 2QN6A 1Q1HA 4LIVA 1ERDA 2F43A 3ERMA 2VYQA 4WZLA 2Y2ZA 2IJLA 5FFZA 2RC6A 1X1DA 4N4NB 1S4MA 4N4OB 2H1KA 2F1LA 3ZBTA 2L9RA 1UD4A 4HYEA 2BM5A 4EM0B 4BYYA 2RN7A 1JRGA 3GW2A 4Q7JB 2GM4A 4UUSB 3JR9A 4RD3A 3E20A 3OL4A 5M3MJ 4AWXB 2F4OB 4MO7A 3I4NJ 4M9XA 3ZZTA 2R7OA 3A4CA 2RNJA 2JIZA 1TL8A 2C6YA 3JQQA 2XGDA 3ASNH 4GGGA 1XGSA 1SFKA 1JJ8C 2Q8KA 2ICWG 2V79A 2DLLA 3K1NA 3IRQA 2A6TA 1CF7A 2JWTA 4ZYAA 1O3QA 3DLAA 4LLNA 1EFUA 3OE7A 2XF7A 2R7XA 3SXYA 5DYMA 2VNHA 2F2EA 4JK1X 1LE8B 2ZXHA 5DUIA 5D5VB 4A3BJ 3RZDJ 1WI9A 1FC3A 1R22A 1J9ZA 1WZ2A 5AIQA 4ON0A 2XOKA 3GEZA 1E3HA 4LK0F 4YAUA 3M9AA 3BY1A 1VQPB 3U9GA 4YFNF 1JGSA 4F55A 3OIOA 4GYIA 5AONA 3G4SB 1WJFA 3J81k 1RQRA 3LSGA 5JVGF 1DU6A 4G7XA 1QVGB 2QQBA 2FE3A 1H8AC 1S72B 3MAJA 5EF6A 5C44J 3FXOA 3RKWA 4OIRF 4ZYDA 2BM1A 3ML3A 3CC7B 4KN7X 1TQMA 2WY7Q 2OBPA 1JKRC 3VYSB 3GCMA 3GWZA 3A3BA 3FX3A 3GTJJ 2DK8A 3GFJA 4RLFA 1LNWA 2O0YA 4BHCA 2DYRH 1GO2A 1KCCA 3HL2A 3GUDA 5GV7A 4Z03A 2Z5UA 2M9HA 4I01A 2H6BA 2XAUA 1BW5A 2HOEA 4ZH4F 1W5TA 1W7PD 5HNHA 1ZKGA 2BMWA 4RD6A 1R49A 2ISZA 1QCXA 4L5IA 2B7EA 4QLCU 4BQQA 2OU2A 1R4MB 5HKKA 2VQCA 3MFKA 3L2CA 1N8RD 2BVLA 1VF9A 4CH7A 3J7AO 4BJ6C 4BAYA 4TMTA 2CS3A 3DBLB 1WMRA 2M5WA 2VFOA 2EINH 4ITVA 3LMWA 2F5DA 5B6IA 1KCDA 3OWTA 2LVSA 2OYNA 3U1DA 3QSYA 4U4BA 3PSIA 2DQLA 3MQ0A 3LQRA 2CNDA 3WBKA 2ELKA 4A3KJ 2DOGA 2E2HJ 1ETKA 4PCQA 1R4NB 5B66C 2P7VB 4ZC3A 5HNFA 1HA8A 2JVGA 4NQWA 1NK3P 3CCQB 5IOYA 4NK6A 5L46A 1ZTRA 5BPIA 3GYHX 1H9GA 1D8TA 2M45A 2K4BA 3MMYB 1MNMC 2HYFA 1SANA 2XF6A 3B6AA 2PIAA 3B82A 4E7ZA 4UUTA 4ROXA 1KZHA 1J2XA 1O88A 3K0LA 3U6BA 5CQGA 2ZL5A 3ZR8X 2F3LA 3AVTA 2R7UA 3OW7A 3FKJA 5D6FA 3JRHA 2DO7A 4KITB 2O04A 2BM6A 2GAUA 5IP7J 2XRLA 2ZKZA 4QUZA 2K86A 1FMVA 3OMYA 1F43A 5JLVC 4X06A 5A2QK 5LHHA 3A8KA 2E2IJ 3HGGA 3JRDA 3AVVA 5FKNA 2W7NA 4Q47A 4UUSA 2DI3A 3HTUA 1BOAA 2MA3A 3I64A 5EG0A 4QSHA 1EP3B 1HXDA 3QOPA 3OYFA 4FTHA 4IHVA 2CV1A 3AVUA 1OGMX 4RDLA 3A1YA 1J0RA 3I56B 4M1KA 2EIXA 3HM5A 4C3JJ 3BNWA 1COWA 1D8KA 2OZ6A 1XB2A 1TW3A 3Q9VA 2I5UA 3KZYA 3A2KA 2CW0F 3T0YA 3FIWA 1DPUA 4A3DJ 1HSJA 4L9NA 5LFAA 3DEUA 1BLIA 1FYKA 2IP2A 2NS7A 1ZRFA 2EV5A 2LKPA 2CC2A 2LH9A 2KRHA 1H9TA 1T33A 3OS2A 1SVLA 2H6CA 3UNGC 3FBNB 3LQ6A 2XGCA 1D5VA 1SFXA 1AIPA 4I2OA 1IN5A 1YS6A 3ONYA 3F8CA 2XIGA 3MCZA 3GVLA 2HWVA 1MABA 3WY9A 3O3KA 1PUFA 2FX3A 1W5CC 3M8EA 4YELA 3L2WA 2VUMJ 1X4OA 2DDAA 1UD2A 4OU0A 2EZHA 3CCLB 1H0MA 2CGPA 1KYZA 4Y17A 4CO8A 1S0UA 3VO2A 2BGCA 4XLAA 1ZGWA 4O5VA 1E3OC 5C4XJ 1DQUA 2E60A 3C18A 2DT6A 4IQ4A 2EFPA 3SUCA 5HLGA 1K4ZA 2ZCWA 5EEAA 3ELKA 4F7DA 3ZSCA 2Z6BD 1XG2A 1D1CA 2MYSA 2K3FA 2QMUA 1HKQA 2X1EA 2R7SA 2ZZEA 5L3BA 4PFOA 5K5OA 5E8IA 1OCOH 3HRSA 3ONUA 3E1YE 4E7JA 2B7CA 3TMOA 2VJIA 2EA2A 3LQQA 3HOWJ 3S32A 3JQPA 3G71B 3DEWA 3OYCA 1NHAA 1ZH5A 3U2QA 2KP6A 5LBQA 4HF2A 5GTIC 3EQOA 5BQTA 4PSWA 3V4GA 2DA1A 2W1OA 2ESNA 2K5CA 4R8HA 3K1PA 4BE2A 2QEXI 2C77A 2ZNYA 3WGGA 4KIGA 1Z3XA 4HSTA 1QG0A 1Q81D 2F48A 2KIUA 2NVYJ 2V9PA 3OP1A 1VQ9I 1P6RA 5DTDA 4B4CA 4YCQA 1WKMA 2MG4A 1OFCX 3QPSA 4UZFA 2A5YB 4BQOA 1HF0A 1P92A 2KVOA 3LVBA 5D8LB 2JZYA 5H5JA 4Y15A 1SD5A 3HOXJ 4V02C 1LFBA 3CRZA 3LSHA 3PUNA 4DIQA 4P12A 2GIZA 4M0LA 2JPCA 4LLGF 4CCLA 1QHHD 3RY8A 2VFPA 2CFXA 2XGEA 4R1HA 1S7OA 1K73D 3SYJA 3SJMA 3F72A 5ILUA 4Y9RA 1N0VC 4HF1A 3CC4B 1F9NA 4CHUA 3K4JA 3JRAA 2XAQA 2D9RA 3OJXA 3QFSA 2VBZA 1JXSA 3E5QA 3MKZA 1KU2A 2CFOA 5TISC 1XTAA 4YG2F 2HDDA 3KEQA 4M53A 3S3NA 5GAGJ 2QZ8A 4E6KG 2ZNZA 4A93J 5A8AA 4IEJA 4IL6C 4X07A 2VBEA 2FQ3A 3P26A 1YRNB 1MBEA 3VSUA 2LBFB 1HKTA 4FCYA 4CYCA 4G1BA 4RLQA 3JRIA 2Y31A 2VBSA 1IDYA 2VIXA 3HEFA 3PFIA 3F8MA 3RYPA 1HDPA 3ASPA 2ZJPF 3F23A 5E1XA 2O8XA 2YU9J 3S17J 2WJVA 2EQRA 5E3MA 1NTCA 3NRVA 1ZG1A 2OPTA 3CMMA 2CQQA 5DN6A 1Y6IA 2W24A 1IB0A 3K4BA 2XT2A 1HBXG 2DOAA 1O57A 2V4DA 1ZAOA 1FMWA 1QGAA 4OZYA 5F27A 3NWSA 1YQAA 1BX1A 1QZEA 2VBTA 4MNUA 2HU9A 3G1OA 4P1VA 2P4WA 1WWXA 4HX4A 2ECBA 5EZHA 1YOVB 2HKOA 4L9JA 3FXUA 4UB6C 4QHYA 2CH0A 4A6EA 1VQPI 3L7WA 4UZUA 2Z1DA 2JN6A 1DGWY 1VQ6B 2NYXA 3I55I 5IOZA 3JRBA 2DYIA 4NBQA 1EA0A 2YWGA 2ECCA 2FA5A 1ELOA 2DOFA 3JQRA 1JT0A 1UELB 4YAFA 5L3EA 3SZTA 3TOBA 1QNTA 2J5OA 3TKYA 3DPLC 2DFEA 2DTRA 1BC8C 2CUEA 3V8LA 4MHGA 4Z4UA 4JMQA 1OOCA 2BW3A 4AVZA 5KAIC 3J80K 1ZELA 1T08B 4RCYA 3TO7A 2C5BA 2ZXIA 1Y8QB 4B43A 4C9YA 5DS9A 4AIKA 2GBYA 4FXUA 3LNQA 3GQ8A 4LJZF 3GRHA 3F8BA 1T6YA 3K10A 4NC6A 1N78A 2LP0A 1FRNA 3FPKA 3S3MA 5IYRA 3Q6QA 3ABMH 3FK7A 1B72A 1Z05A 3GZ5A 2JA6J 1QRYA 2CUZA 2Q2EA 3ZQ7A 4C2MJ 2HQNA 1UD8A 4KIBA 1EJ9A 1LKXA 2WAFA 3O6BB 2GQFA 1E62A 2FBIA 3GLXA 1R71A 5B5EC 2GIVA 2MLGA 1D0XA 4JOMA 3L9FA 1TYXA 3VNUA 2HMAA 2V1XA 3ZGKA 1VQ4I 1Q7YD 3SQVA 2L7MP 2XB0X 1N07A 3OYGA 1XGMA 3LSPA 4PGGA 4Y4RA 3FMRA 2ZO4A 4EM2A 1WPCA 2HZDA 2O3FA 4H0EA 3IUOA 3OV8A 2JVHA 1YJ9I 1RR7A 3E1SA 4PDKA 1F1ZA 1JB9A 4YXWA 2M1BA 4D1QA 2NT9A 1JE8A 2DJIA 2PJRB 1AKHA 1YITB 2JT1A 3BC8A 3BR6A 4UNOA 1EP1B 4IRGA 1QA2A 2WPDA 3CMEI 1JUMA 3EYIA 1J75A 3K4NA 2L0KA 3PO3J 2VPLA 5IT9K 2STTA 2M7AA 5H6RA 4QPQA 1KK2A 2GA2A 4FE4A 1H89C 1E3PA 1KQ5A 3QODA 1P7IA 3W2GA 2A6HF 3EUAA 4LD5A 4CICA 5JVTA 2HQAA 2XAHA 2E36A 2ADUA 5FGMA 1DU0A 1IV8A 2KHMA 3CQZJ 3S93A 3PIPF 1VQ7I 4CA0A 4HDUA 1ZLKA 3HAGA 3CC2B 1T98A 1V5EA 2CO5A 4OAYA 4IX7A 4YZ0A 3AGQA 2CG4A 1U8BA 1VNDA 4KT5C 2HS5A 4Q48A 1YIJI 3OIQA 4C2UA 4UUVA 5IYPA 1O8HA 3SY2A 4G8XA 1W2BB 3HGYA 2D1HA 5GP9A 2P8TA 3V7CA 4E7IA 4EJTA 3PO2J 2BM0A 5DCMB 3VYTB 5KNLA 3ZQGA 2ZMEB 1XN7A 4Y13A 3HB9A 1W0JA 2HYJA 4TMXA 1IO2A 4G7OF 2MABA 3KP4A 2PYHA 2LOOA 2MGQA 2O6GE 3VSTA 5DS0A 3M3YJ 2HNHA 2VQLA 4PJ0C 4E70A 4Z4SA 1F5TA 4NC8A 4C3IJ 4UAJA 4L5JA 4GRIA 3ABLH 4M72A 3CCLI 1BPLA 1QPMA 1AMOA 5FLVA 2L5QA 3T9GA 3GTQJ 3OYDA 5LD2C 3LA3A 3Q38A 3LSTA 1DDIA 1T0FA 1VLOA 2BGIA 4X7DA 3MVPA 4KISA 1RIOH 2HGCA 4CCKA 5HDKA 3RI4A 4D5CA 1SVMA 2GXBA 1N75A 3ZOBA 2CU7A 4HAMA 5B3SH 2C4UA 3ASSA 2K3PA 2K40A 2H94A 1IW7F 3BQJA 1V54H 3ZZ0A 2EZIA 4HV5A 1MBKA 4OOIA 4R71A 3CPWB 2NSTA 2LKXA 1R00A 1GAWA 2Q0OA 3IH2A 3GBGA 1YHQI 1DBOA 2HVQA 1AOYA 2CQXA 3EDPA 5CPRB 3OYIA 2ZFUA 4ZCIA 1UG0A 1VQ5I 2PI0A 3MKYB 2X6YA 1NK2P 2F1MA 1VQOI 1WJEA 3DV8A 2CQNA 5C1CA 3CMYA 3S1RJ 4ENJA 1KTVA 5FB2A 1EFRA 1PJRA 2HDNB 2QY1A 2NVUB 5EZGA 4Y7NJ 1HCRA 4YC5A 5H20A 3WQZA 2A6EF 5K5QA 2WV1A 2BN4A 1ZG3A 3ZPNA 2VC1A 3A8IA 3AKZA 1PE9A 2GZWA 2OZUA 3VYUB 1UMQA 4D7MA 3CC4I 4RGSA 5IYWA 5HDGA 4TT3A 1ZR4A 1ZR2A 1YS7A 3GZNB 2PX9A 2HYGD 4EATA 5EJCA 2IGOA 1XSXA 1EFTA 3W2EA 3ZC3A 4XKCA 5J3LA 3M4OJ 3HYIA 3LSJA 2XPWA 2ODLA 4RGXA 3W2HA 3VMWA 3R6JA 4AC0A 1XSVA 4XN3A 1MMNA 2A07F 1E1RA 2K9LA 4FK8A 2NTPA 1TQIA 4BUPA 5JR3A 2BV3A 1OR7C 3KLOA 4MIMA 1GDTA 2GXAA 2R6HA 4OJ6A 4X8IA 3CLOA 1RETA 3MZYA 3CCUB 3W2FA 3WTWC 3E6MA 4AD9A 1OPCA 4P22A 1E63A 5BS6A 1O8IA 3DBHB 2V6CA 4KKSA 2GQQA 2NZMA 4RBOA 1WDTA 1ITYA 2C78A 2L9VA 3ZMUA 2O8KA 2PG4A 3P4GA 3LWFA 1GT0C 4OIQF 1KQSB 3FXKA 4RB1A 4I6ZA 3I54A 1EWYA 3OZVA 1LFPA 2RKHA 4LB5A 4PFPA 2QQAA 5FLXK 4B3XA 4DNCA 2BY3A 4U87A 3CUQA 2LLKA 2L54A 3L09A 1OHHA 1XGOA 2XT4A 1N25A 1TBXA 2ESHA 4AIDA 5IYQA 3H5AA 3A02A 1ETYA 2DYSH 2XASA 1O8FA 5EEHA 2VNIA 4X7EA 1O8JA 1BI0A 3BJOA 4WWVA 3W2IA 2UWMA 2VJJA 2CW8A 3WBJA 1VQNI 3S15J 2BM7A 2UVFA 1CF7B 2PMDA 2LFBA 5FD5A 2OK8A 1TWCJ 1E0EA 4K1XA 1AHDP 1KK3A 4A0XA 1V5GA 3F8NA 1X1PA 2X6XA 3U2RA 3ZQFA 2X51A 5EMNA 5F04A 3GX4X 4Z2YA 1PJ6A 2DPDA 2JN9A 3BH7B 2CSOA 2WWYA 4V19K 1K7AA 1QU3A 4EGZA 2K4JA 4HG2A 1RMGA 4ZZLA 1CLWA 4AVPA 1R5GA 2DMNA 3V7RA 2K27A 5K7HA 4LITA 3ASQA 3CF2A 3ASOH 2YSRA 2Q6OA 1YO5C 2DPUA 4XICA 2MLKA 2MW8A 2VKEA 2Q6IA 2VN2A 2I1LA 1GQ8A 1B9NA 1JTXA 2Y30A 2EFWA 4W8TA 3V42A 3CD6I 2VBVA 1MMGA 5HLTA 4PGOA 5GV8A 4EW9A 2RV8A 1QA3A 4I0BA 2VQHA 5J4VA 2ZL6A 1XC5A 3ZZUA 5HZAA 1FIAA 1W7PA 3OYAA 1QUEA 2QDXA 3CESA 2CMPA 3HKZA 2RC5A 2CF4A 3BQYA 5JHUA 2NVXJ 2R4GA 4B48A 5H2FC 3OEEA 2LY9A 1BIBA 2XAGA 2E1MC 2DTZA 3BCAA 3V76A 4BXFA 2EWEA 3G2BA 3OYNA 3JREA 4ZGNB 1GXPA 1UZCA 5JHFA 5CVIA 1HVXA 2A5WA 2BBYA 2F4MB 1BBYA 2E19A 1G3TA 2VASA 2W85A 3A01A 2QEXB 4C0SA 4G7ZF 3L2VA 4FQGA 1OCRH 1VQ9B 4BHBA 3J7ZI 3QYEA 1U5TA 2TRTA 5C3EJ 2FOWA 3R6KA 4OPVA 3I3LA 5FO0A 3MCAA 4X1EA 1D1BA 2O5RA 1VI0A 1BR1A 1JKQC 3HOSA 2GJRA 2W6IA 4WZKA 5TY0A 3DU1X 2AHOA 4KKUA 4NQWB 3WG9A 3UR3C 2ZL7A 4J19A 4HX8A 4ZTJA 4H4KC 4WWCA 2RVCA 4WX9A 1IB4A 1RQPA 2D5VA 3FBIB 3LO8A 3HSEA 3OY9A 1R9TJ 3BG7A 3CO7C 3GO5A 4HRIA 1BJKA 3KEWA 2YUHA 1RKWA 2VT3A 1Z9CA 2JJ2A 2RQPA 5H59A 1FOXA 2AXLA 3F3XA 3R6SA 5ICCA 1B2RA 1R1TA 2A3SA 4FWTA 1MGTA 3D5LA 4FHTA 4L9VA 1KQ9A 3CC2I 1JA0A 4OPWA 1SD6A 9ANTA 2WR8A 3B90A 4RB3C 3GTKJ 1MW7A 2QM3A 2OBSA 1X19A 3AAFA 2BYVE 2IBDA 5CDFA 3RKYA 4WXHA 1A6QA 3Q5FA 2O17A 2OF7A 3CUOA 1TWAJ 2QQ8A 4WCGA 4WK8F 4II3A 1M1EB 5EG0B 1JHFA 1UB9A 1X58A 3OYKA 4H9GA 1ON1A 2DFFA 4CCJA 1IDJA 2V9VA 1KMHA 3B4NA 4RAFA 3G6EI 1DDNA 1SD7A 3ABTA 3HPHA 5FIUA 3JX8A 4M2LA 3KRGA 1YE9A 3TH0A 1YI2I 2R7DA 1TC3C 1YG2A 1G3YA 1KONA 3CCMI 3UW0A 2P6SA 5IT3A 5F4MA 5IT9Z 3BTJA 2XROA 3QAHA 3F22A 3QYFA 2BHZA 3B02A 1B9MA 3WU2C 3G05A 4G1VA 5F4JA 3PSSA 1S6LA 2LDUA 5LGUA 2DW4A 4RGUA 2XF5A 4XLCA 2EK5A 4DBQA 4DBRA 3JSOA 2A05A 3OEHA 1QO0D 4YRVA 4RD4A 4L9TA 5DV5A 1PJ5A 2KZGA 1WSUA 4XM3A 3JCUC 3N4MA 1YYVA 2ZB9A 5A88A 2R5YA 2VQGA 1PUFB 1IN4A 3I55B 5DSZA 2O6WA 5DM7F 2O7OA 2DY1A 5EEGA 2L7FP 3CCYA 1N05A 5ICGA 3ABUA 4TN1A 3V8KA 3SLNA 2VPRA 2DA6A 3KLNA 4OIOF 2F4NA 1UCRA 5DCFA 1ON2A 5TJJA 2G0EA 4ENNA 5E6TA 4U0YA 2COMA 1WRJA 4IO9F 4XORA 3K2AA 5F0HA 2QYUA 2KJCA 2CUJA 2VXDA 2LKSA 5E3LA 3HKZN 1JKPC 3IHUA 4B3AA 2O61A 1G7RA 1VBLA 1L1IA 2PMZA 3WTSC 3FM5A 2E2JJ 2PLFA 2ZSHB 4I98B 4YALA 2FSWA 2UZKA 2EFGA 4Z06A 4C3HJ 2J7KA 2V7XA 4XBFA 4Z6YA 5B1BH 1VQKI 1EXMA 1JNYA 1RI7A 4OOXA 3COAC 4UV8A 2ZBVA 4M9SA 4A3MJ 3KEYA 1B8IA 3LA7A 1A31A 5IK2A 5ERIA 3BJ6A 1T6ZA 2L4AA 1MJBA 2YX7A 3CLQA 3WGIA 2ZBKA 3G6EB 4GXOA 1HG8A 3KIOA 2DFHA 3M1EA 4FISA 2GLOA 3HOVJ 3Q39A 2UXNA 5D5WB 1FX7A 3ZMVA 3WYAA 1LFUP 2XRNA 3FF5A 1VQ4B 4PJMA 3I53A 1KRHA 2XZPA 4MYUA 4ASNA 3GTGJ 3RPUD 1OCTC 1O8DA 1LB2A 3SYTA 2H09A 2ID6A 2DODA 2EFNA 2JA2A 2HQ5A 4A3FJ 2JRMA 1K9MD 2FF4A 3PA2A 1YJ9B 3J7AY 1I5ZA 2KISA 5FL7A 3FXQA 2XSJC 4K2EA 5FKLA 5L3CA 3OYJA 4XKWA 2ZJRF 3CCUI 4WF2A 1IDKA 3LQEA 2DCEA 3BR2A 2NS0A 4ESJA 2EILH 2ACJA 2E1RA 3JRFA 3CMEB 3D5RC 2WZPP 5JLXA 4YFKF 2QXZA 2VFMA 3BZ6A 2W48A 4YDTA 4M3FA 4M6VA 3LSIA 1FOWA 1FZPB 4KT6A 2QGUA 1UFMA 2XHKA 3GFIA 1J59A 3DDYA 3BQZA 4HW0A 1E3XA 5J40A 4HNUA 3ULQB 3W5HA 2NS8A 2XB5A 4CYCB 3S3OA 1V5VA 3BLYA 2C2WA 2G9WA 2PQ8A 5JMCB 1I6HJ 4U7DA 5FRNA 1VQ7B 4TMWA 3QFCA 3KP7A 4GCVA 1D2EA 3R4KA 3IH3A 1YIJB 1X1BA 1Q9SA 1EP2B 2B9SA 4CCNA 4IQJA 3DKYA 3S2HJ 1EA3A 1WJBA 2NV4A 1M90D 1AIRA 3CMAB 2R0QC 1NDHA 2J8IA 2M30A 3X2QH 1G7CA 2JPBA 2F5VA 4LIUA 2WV0A 5EGOB 3T1BA 1KC8D 4LG3A 2EFQA 3QQAA 2QA4I 4JYKA 4CCMA 4CCOA 2PN6A 4MEYF 1DG1G 2ME6A 3KYCB 4F3QA 2C4TA 4QV2A 2K9NA 4BXXJ 2BSPA 1E2XA 1UJ8A 2FBKA 1FNNA 1S3JA 4QVJA 3DTIA 2KFDA 1CQTA 1GUUA 1MBGA 2K9SA 4V2FA 4BDZA 1IN6A 2V1UA 2BY1A 2I10A 2V9KA 2XDVA 3C2GA 5LLQA 1LM1A 2F5CA 2QUFA 3TP0A 3C3WA 1O3TA 4XN0A 5FLXZ 5E17F 1EKEA 1Q86D 4ZCMA 4F7ZA 3CF5F 3QPLA 2UV1A 2OCCH 2X48A 3U21A 3IAM2 2R7QA 3RQ4A 1MH4A 4UXNA 2M4KA 2NVTJ 1BN8A 2P5VA 2BW3B 3H5RA 4LK1F 1VQMI 3S8PA 2L9NA 4HEA2 1UG2A 1JUPA 2BY0A 2XNDA 2NOGA 3MWMA 4XLNF 1FRQA 4N3NA 4BJTA 2ELHA 1YHQB 3TGNA 1X3ZB 1I27A 5J1UA 2V7WA 3VPRA 4HLYA 1BW6A 3OL3A 4HQMA 3ECOA 2F5FA 4DW6A 2AQEA 3CCEI 4PJJA 4W1UA 3Q0UA 3ZCOA 4EVIA 3CW2A 4L8JA 1VQ5B 1WORA 1I3AA 1B72B 3IL2A 3CP8A 3I4MJ 1R58A 2Q2EB 3BG3A 2FVGA 5IP6A 1VQOB 2JDIA 2QWWA 1HSTA 3BPXA 4QPOA 1BN5A 2XKPA 4HOBA 2XAFA 2JK3A 4ZJZA 1XSDA 3J81Z 4G12A 3LJYA 2GK7A 2OQGA 2QBYA 2ZJQF 4KIFA 3SEJA 2VE8A 3FWEA 4OP7A 1T8IA 1RNLA 2MD0A 3GVAA 4OJOA 1KU7A 1TWGJ 1D5YA 2LZJA 2E34A 3HBLA 2PLYA 4I76A 4JX5A 1BOBA 4KNYA 3D26A 5J8CA 1F60A 2V7UA 5FA6A 3WTYC 1VHEA 4PC3A 3WXMA 4JRAC 3HSFA 4Q4ZF 1AKHB 3LAJA 4E7KA 5F1RA 2K7LA 4IHWA 2NT6A 4XKVA 1K6OA 3T8RA 2X6WA 1X1CA 1WP6A 2X53S 5AMVA 2KPMA 4EJVA 3HRTA 4OMYA 1P9QC 1RU4A 1XE1A 2HI3A 1O7FA 3M1CA 3BH6B 1B6AA 4ESFA 4UZEA 4KH3A 5CVJA 1WSVA 3DFGA 2F4IA 3BR1A 1Z1DA 1QH0A
chains in the Genus database with same CATH topology
2VQLA 3GQ9A 1O8KA 2X1DA 1OGOX 4B47A 4G6TB 4NC8A 3GVJA 4GRIA 2KLOA 3K70D 1BPLA 2L5QA 2ZTNA 3T9GA 3OYDA 4XONA 5LD2C 2IQ7A 3DPUA 4BE1A 3BC9A 4HIZA 2KMUA 2R7WA 2VKHA 1NG7A 4KISA 4MR0A 1NBMA 3EUHC 2OV7A 4CCKA 2WBMA 1Y56A 1BR2A 3EUKL 1N75A 4W8RA 2F6CA 3VSVA 2K3PA 4BJ5C 3K4KA 2X85A 3HG9A 3L2QA 1D0YA 3SDBA 2V26A 2WSSA 4DK0A 1VJSA 2NSTA 3KX2A 2Z8GA 1WJAA 4FETA 1EE6A 2GK6A 2QKMB 5HVQC 4XLHA 1DP3A 3GBGA 2HPMA 4DGWB 1DBOA 2HVQA 5CPRB 4DOZA 4AU7A 2AQFA 4I84A 3OYIA 2ZFUA 2E5ZA 3OS0A 3GQAA 1OFLA 1UG0A 2V31A 4FASD 3MKYB 3HOTA 3OOCA 2X6YA 3CZ6A 3TL4X 2F1MA 1WJEA 3OYHA 4TSFA 4G6IA 5FRMA 5C1CA 4PK4A 3DPTA 1EFRA 4NC7A 3BCDA 4YZAA 3B8YA 1PJRA 2QY1A 3F9KA 4OWRB 1I8DA 4ASUA 3WQZA 3EPZA 1NRKA 3ZPNA 4F91B 2NOJB 3VDXA 3OYBA 1CZFA 2NTBA 3AKZA 1W9XA 4LIVA 1ERDA 2V6EA 2F43A 1E3ZA 1SAUA 3VYUB 1DBGA 1PE9A 2M7BA 3K4LA 3W2AA 1X1DA 4N4NB 4N4OB 4TT3A 3SZGA 4DNTB 2DXIA 3ZXSA 4EATA 2IGOA 1OB0A 1UD4A 1JRGA 4XKBA 2VJ4A 4XKCA 2VBKA 2ODLA 4JQFA 3VMWA 3MD2A 4C2TA 5KHDA 4XN3A 1MMNA 1E1RA 2NTPA 2K9LA 3OL4A 2HPIA 1VF7A 4HNTA 4BUPA 1O8MA 4F52A 1OR7C 4Y33A 2R7OA 3A4CA 2JIZA 4OJ6A 2LRDA 3K6GA 1YX3A 3D5SC 3OIPA 1SFKA 3C2HA 3RTRA 2R7TA 2DIEA 4P22A 1MNDA 1O8IA 2A6TA 4KKSA 4ZYAA 3OE7A 3DLAA 2NZMA 4F92B 2CW7A 4AYBA 3GVKA 2XF7A 4II2A 3VWBA 2R7XA 1S9HA 2ZXHA 3TBIA 5C1EA 3LL7A 4HPQA 1LFPA 2XOKA 4NK8A 3PNYA 4PFPA 4B3XA 5KCMA 4U87A 4F55A 4TKOB 1NHCA 1X4PA 1WJFA 3OS1A 4IZZA 2FUG2 1OHHA 3LSGA 4G7XA 3H5AA 3DTKA 1O8JA 1O8FA 1D1AA 2UWMA 2VJJA 1TZLA 2CW8A 2WY7Q 3GQ7A 2UVFA 3VYSB 2D3LA 4RM3A 3A3BA 4YZXA 1IRXA 4W8QA 1E0EA 3ZIAA 4RLFA 2K9MA 1V5GA 2X6XA 1J09A 2X51A 4B44A 1Z3YA 4ZDPA 1QU3A 1KCCA 3HL2A 4Z03A 2M3AA 4HG2A 1RMGA 2WB1A 2XAUA 3GQBA 3RCOA 5HNHA 4OAZA 2LG4A 4LITA 1QCXA 3CF2A 2ZSIB 4OZZA 3T51B 4BQQA 1MMDA 3CP2A 2VQCA 5HKKA 4E4HA 3AFHA 2BVLA 4CH7A 1K28D 4Z1MA 4BJ6C 1UAAA 2KL4A 1GQ8A 4Y3OA 3V42A 4W8TA 1MMGA 2CS3A 5HLTA 4EW9A 3HC7A 1LVKA 1WMRA 2VQHA 1RWRA 4P1WA 4ITVA 2WADA 2VXZA 3LMWA 1KCDA 3OWTA 4B3FX 3OYAA 4U4BA 2LYCA 3CESA 2CMPA 3PSIA 3HKZA 1WTHD 2R4GA 2WY8Q 4B48A 2XZOA 3OEEA 5HNFA 1U0JA 4ZC3A 1HA8A 2JVGA 2E1MC 4NK6A 3BCAA 3FPPA 4BXFA 2EWEA 3G2BA 3OYNA 1OLTA 5JHFA 3MMYB 2LREA 2ZZEA 4Z05A 3NWTA 1HVXA 2A5WA 3FDYA 2O1DA 2XF6A 2P0WA 2VASA 4E7SA 4ZTFA 3I9V2 3T53B 1PXZA 3OYLA 4G7WA 3H5NA 4E7ZA 2ZZGA 3L2VA 3H0DA 2UVEA 1O88A 5CQGA 3QYEA 3ZR8X 4IKFA 1UD5A 4W8SA 1WFXA 3I3LA 2ELJA 3FKJA 2R7UA 3LSKA 1E1QA 4KITB 3M8JA 1PKVA 2QE7A 2O04A 2W82A 2W6JA 2GJRA 1FMVA 1D1BA 2O5RA 1BR1A 1X1AA 3DQVC 3OMYA 4X0GA 3HOSA 2W6IA 1WJ5A 2E5NA 4KKUA 4NQWB 4D9JA 4XLEA 3UR3C 1JI8A 2W7NA 4ZTJA 4H4KC 3W3CA 3BG6A 2PECA 2RNGA 1BHEA 1IB4A 3OYFA 2ZZQA 3FBIB 2CV1A 1OGMX 3OY9A 3A1YA 3BG7A 3H9GA 1G8XA 3SEQA 4HRIA 3KEWA 4OJ5A 2JJ2A 2MC4A 3PFYA 2V7QA 1COWA 3K4MA 3DU6A 3W2WA 1T5EA 4ANJA 3A2KA 1UD3A 3D5LA 1BLIA 5LFAA 1K6YA 3B90A 2Z16A 1MNEA 2LH9A 1MW7A 2KRHA 2VKDA 4RMNA 1X19A 3HXLA 3H9JA 2Y0SA 3OS2A 1T0FC 4PJLA 3UNGC 3FBNB 2IS4A 4ZDOA 5CDFA 1BMFA 4XD7A 4C2LA 2INVA 3OYEA 2GJPA 1UD6A 2O17A 2W4SA 3GVLA 4II3A 1KTWA 2QKLB 3LMMA 3OYKA 1MABA 4DNRB 1R6RA 4YELA 4CCJA 2BOLA 4BGDA 3L2WA 1KMHA 1X4OA 2L7KA 2WAQA 1IDJA 3B4NA 1UD2A 3HPHA 4DJAA 3KRGA 2KQRA 4E7LA 1YE9A 3IAS2 2Q1ZB 3OOUA 1KONA 3PL8A 4XLAA 1W36D 3UW0A 4HWVA 4ZDLA 2VL8A 1DQUA 2E60A 2DT6A 4IQ4A 3QYFA 3G05A 3SUCA 4YZQA 3DTEA 3ZSCA 2R7VA 2Z6BD 1XG2A 1D1CA 2MYSA 2XF5A 4NUBA 4XLCA 4DBRA 2X1EA 4DBQA 2R7SA 1BR4A 1GLNA 3RSNA 4PFOA 4YRVA 2VJ5A 2LY1A 4E7HA 1E43A 3OEHA 1X0CA 4XM3A 3NE5B 2NSPA 4E7JA 3LSMA 3TMOA 4BDYA 1E79A 3AL0C 1H80A 2VJIA 3S32A 2VQGA 3OW7A 1Z21A 2GOMA 3OYCA 2NTQA 2KP6A 1G59A 4KJZA 2V7FA 2CV2A 3EQOA 4PSWA 2LY2A 2W1OA 2K5CA 2L2OA 4BE2A 2X8KA 1Z3XA 4HSTA 2XGJA 2RREA 2V4JC 2O0VA 4BQOA 2KVOA 5TGTA 1IA5A 4XMYA 4XORA 3KYLA 3FKSA 3LFUA 1I18A 3E0JB 1MMAA 2O0WA 2CUJA 2VXDA 4OJLA 3LSHA 4DIQA 2LBFA 4CCLA 3FHNA 2XC7A 1QHHD 2HVSA 1KZLA 1VBLA 2PMZA 3IP4B 4MXNA 2M4GA 2ZSHB 3PJRA 1D0ZA 1Z7LA 4XR6A 4F93B 1H8EA 4Z06A 3VMVA 4BL0B 4CUGA 1TT0A 3K4JA 3PUBA 3BCFA 3KEYA 4MLOA 4YEJA 1V0FA 3MKZA 2CFOA 5IK2A 3PNTA 1PLUA 2LC2A 2CK3A 4P5OA 4C30A 3OYMA 1HG8A 2V1NA 3S3NA 2IS2A 1QJVA 4E6KG 3WWGA 1YX5A 4U49A 2VBEA 2M0MA 3VSUA 4PJMA 2LBFB 4NNJA 2XZPA 3A35A 3L2UA 3RPUD 2IXSA 1O8DA 2IGKA 1DGRM 3SYTA 1VZ0A 4PSXA 2PYGA 4RLQA 4PMHA 2JA2A 2VIXA 1HZEA 3DEEA 2IGMA 1H8HA 3J7AY 5FL7A 2W00A 2JUGA 2XSJC 2WJVA 3OYJA 4XKWA 3QOEA 1IDKA 2Z2SB 3QYBA 3CMMA 2DCEA 5DN6A 1Y6IA 3VSKA 2L9SA 3K4BA 5HOOA 3D5RC 2DOAA 2V4DA 2WJYA 2WZPP 2QXZA 1FMWA 4OZYA 2HDWA 3NWSA 3LSIA 3VYRB 3L2RA 4OJPA 4KT6A 2ZTGA 2KZVA 4R79A 3DDYA 2HU9A 5FROA 1E3XA 3BH4A 4HNUA 2CV0A 3S3OA 3BLYA 2CH0A 5FRNA 4UZUA 2Z1DA 3FY3A 1DGWY 3OR1C 4BE0A 2KRCA 2R9VA 3PSFA 3W2VA 1X1BA 4J00A 2INUA 1UELB 4CCNA 4IQJA 3DKYA 4CSWA 2VBMA 1EA3A 1WJBA 1AIRA 4B3GA 3T56B 4URRA 3DPLC 4J01A 3SEZA 2F5VA 3DU5A 1SKYB 4LIUA 2M5SA 2XZLA 4JMQA 2JSPA 2BW3A 4AVZA 4LG3A 4BQNA 2IS1A 2WAEA 1ZELA 1OOCA 3ONQA 1FX0A 4CCMA 4CCOA 2ZXIA 4B43A 4F3QA 4C9YA 2UUZA 3K70C 4FXUA 4XNFA 1W0KA 3K4CA 4HSRA 1JTAA 3GRHA 4RM2A 2HVRA 3GQ8A 3DTIA 2RQQA 1O8LA 3K10A 1N78A 2OC6A 3H9QA 4BDZA 2JJ1A 1NG6A 3S3MA 2V9KA 2XDVA 1LDKB 4BACA 3C2GA 2D3NA 3ZQQA 4XL9A 2HLDA 3OR2C 5CKTA 3DKXA 2GOXB 4XN0A 4CZCA 2PJRA 2CUZA 1UD8A 3A3GA 1LKXA 3AL0B 2UV1A 2WAFA 3U21A 3IAM2 2R7QA 3RQ4A 3JU4A 2M4KA 1D0XA 4JOMA 2X1CA 1BN8A 3ZPPA 2BW3B 3H5RA 5CQEA 3JURA 3HPGA 3S8PA 2L9NA 3OAAA 4HEA2 2XNDA 3PNVA 3ZGKA 1O8EA 2VB6A 4BJTA 3OYGA 4DK1A 1K5CA 4Y4RA 1PYVA 2BSPA 3OFNA 2IGNA 2HZDA 3N05A 1WPCA 3IUOA 3OL3A 2JVHA 2AQEA 2VLAA 4XOPA 1WJDA 1WJCA 3E1SA 4PJJA 3ZCOA 4YXWA 2E1BA 4L8JA 4D1QA 3DWLE 2NT9A 1AA7A 2DJIA 3CP8A 2PJRB 1V5FA 2Q2EB 3OPOA 2JDIA 3BC8A 2ZZFA 4QPOA 2QX3A 2WPDA 1VLYA 4ZJZA 2GJKA 4BEHA 3K4NA 2VPLA 4KKTA 3VR6A 4XLFA 2M7AA 4QPQA 3VSLA 2GK7A 4XQFA 2KDOA 3QODA 3EUAA 3ZRGA 1QHGA 3EQNA 2IS6A 4PUSA 2I8DA 2MD0A 4OJOA 2HQAA 2MFZA 2BVMA 3H35A 1V0EA 2LZJA 2KHMA 3S93A 3LNNA 4BU2A 4CA0A 3HAGA 1BOBA 1V5EA 1T95A 4OAYA 4IX7A 4PJNA 4YZ0A 4C2UA 1O8HA 3OIQA 3CJRB 1OFMA 2R7RA 1O8GA 4E7KA 4E0FA 2NT6A 4XKVA 4E7IA 2E1MB 3VYTB 2X6WA 1X1CA 4U7BA 5KNLA 1WP6A 4BEHB 2X53S 1N77A 5AMVA 3CJQB 2KPMA 1W0JA 2WA0A 3MKWB 1P9QC 1RU4A 4XOTA 2MABA 4BS9A 2PYHA 2DT7B 2X3HA 2LOOA 3HUGB 3M1CA 3VSTA 3H94A 2OUMA 2HNHA 1W36C 2F4IA 4GQNA 3BCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ9 A;  1O8K A;  1O8J A;  1O8F A;  3KRG A;  1OGO X;  4XLA A;  3UW0 A;  2VJJ A;  4HWV A;  3GQ7 A;  2UVF A;  2INU A;  3T9G A;  4XON A;  3SUC A;  2IQ7 A;  4YZQ A;  2VBM A;  4YZX A;  1AIR A;  4W8Q A;  3ZSC A;  1XG2 A;  4MR0 A;  2X6X A;  4URR A;  4XLC A;  1X0C A;  4W8R A;  1KCC A;  4Z03 A;  4XM3 A;  3VSV A;  2NSP A;  1RMG A;  1OOC A;  4AVZ A;  2X85 A;  2VJI A;  1H80 A;  1QCX A;  2NTQ A;  4OZZ A;  2NST A;  2Z8G A;  4XNF A;  1EE6 A;  3EQO A;  3GQ8 A;  1JTA A;  3GRH A;  4XLH A;  1GQ8 A;  4W8T A;  1DBO A;  1O8L A;  4EW9 A;  1WMR A;  1RWR A;  4I84 A;  3GQA A;  4XL9 A;  1OFL A;  3LMW A;  1KCD A;  4XN0 A;  2O0V A;  4U4B A;  1IA5 A;  2X6Y A;  4XMY A;  4XOR A;  5C1C A;  2O0W A;  1BN8 A;  3ZPP A;  4OJL A;  4YZA A;  3B8Y A;  2QY1 A;  3JUR A;  4NK6 A;  2EWE A;  1O8E A;  1VBL A;  4Z05 A;  4MXN A;  2O1D A;  4XR6 A;  1K5C A;  4Z06 A;  2BSP A;  3VMV A;  1CZF A;  2NTB A;  1PXZ A;  1PE9 A;  1DBG A;  2UVE A;  1O88 A;  4XOP A;  4YEJ A;  4W8S A;  2NT9 A;  2O04 A;  1PLU A;  1HG8 A;  1QJV A;  1JRG A;  2QX3 A;  2VBK A;  2ODL A;  3WWG A;  4U49 A;  4XLF A;  4XLE A;  2VBE A;  3VMW A;  3VSU A;  4XQF A;  2PEC A;  4XN3 A;  2NTP A;  1O8D A;  1IB4 A;  2PYG A;  3EQN A;  4PMH A;  1O8M A;  1OGM X;  4OJO A;  4OJ5 A;  4OJ6 A;  4XKW A;  1O8I A;  4YZ0 A;  1IDK A;  1O8H A;  3B90 A;  2NZM A;  1OFM A;  1O8G A;  2NT6 A;  4XKV A;  2QXZ A;  2X6W A;  5C1E A;  4C2L A;  2INV A;  4OZY A;  2O17 A;  5AMV A;  4OJP A;  1RU4 A;  4XOT A;  4NK8 A;  1KTW A;  2PYH A;  2X3H A;  4YEL A;  1IDJ A;  3VST A;  1NHC A;  3B4N A;  1BHE A;  3FY3 A; 
#chains in the Genus database with same CATH topology
 3HSR A;  1OJL A;  4O3M A;  4P26 A;  2RAE A;  3GVJ A;  2CBX A;  1MBF A;  3K70 D;  1U9O A;  2CRV A;  2M0C A;  4FN5 A;  3R60 A;  1CNE A;  4FX0 A;  2R5Z A;  2IQ7 A;  2K85 A;  1K4S A;  4HIZ A;  3GFL A;  1ZUN B;  2VKH A;  1NG7 A;  3BRO A;  2QEN A;  1NBM A;  4MR0 A;  1FND A;  2DMQ A;  2PJP A;  2XSD C;  2WBM A;  2OD5 A;  5L3G A;  2JSC A;  1QZY A;  1GV2 A;  4HZF A;  1O4X A;  2F6C A;  2FNA A;  4BJ5 C;  5EGO A;  4YAW A;  5GAH J;  4ENK A;  1D0Y A;  2X3U A;  5F6F A;  3I1F A;  3SDB A;  2WSS A;  1R1U A;  3OOP A;  1T38 A;  3VOD A;  1WJA A;  4FET A;  1DP3 A;  3CCJ I;  2QF7 A;  4XLH A;  2HPM A;  1XMK A;  2EIJ H;  4GFB A;  4ETS A;  1VQN B;  2Y75 A;  4YFX F;  1ZRE A;  2NNY A;  1A6I A;  4BHP A;  1ENH A;  1W35 A;  2F5E A;  3OS0 A;  3O8G A;  2PE3 A;  3HRU A;  5HS9 A;  2JRT A;  1BJZ A;  1WVR A;  4ABZ A;  3HOT A;  1QPI A;  1Y1V J;  3OYH A;  2OTL I;  4G6I A;  5FRM A;  1MDM A;  3BPV A;  1G6N A;  2EH3 A;  2HOT A;  3OSF A;  1A5J A;  3TDZ C;  3L00 A;  5LRS A;  1WOS A;  3ZBU A;  1XCV A;  4OWR B;  1I8D A;  1AWC A;  3EPZ A;  2N8G A;  4X7F A;  2FJ1 A;  3RIQ A;  1WCM J;  3NQO A;  3Q6R A;  5F08 A;  1AU7 A;  4HNV A;  3CD6 B;  2W7Z A;  3OYB A;  2NTB A;  1B23 P;  4ESB A;  1BI1 A;  1E3Z A;  3CXC B;  3KE2 A;  1B4A A;  4A3J J;  1Z91 A;  3IH4 A;  1ODD A;  2FML A;  3K7A J;  5CVR A;  4DNT B;  3HRM A;  4WZE A;  2HOA A;  1ONV A;  3FKI J;  2JA5 J;  3ZXS A;  1OB0 A;  1GJR A;  4P25 A;  2DOE A;  4EMS A;  3ES9 A;  2LD5 A;  3V7A A;  3FK6 A;  4JQF A;  4L18 B;  4YFO A;  2ZFW A;  3S2W A;  4LG0 A;  3I58 A;  2VOD A;  4HNT A;  1VF7 A;  2AO9 A;  1XDS A;  2DA5 A;  1STZ A;  1LPQ A;  3PUF A;  3P9C A;  4LB6 B;  5ED4 A;  1QFY A;  1O3R A;  3ABK H;  3OIP A;  3C2H A;  2HCJ B;  2R7T A;  4M9Z A;  1MND A;  3PIO F;  2BX6 A;  1UD3 A;  5LEJ A;  3GVK A;  5M5W J;  4AYB A;  3W6V A;  1Q82 D;  3VWB A;  5J6X A;  5FNZ A;  3B73 A;  3E3V A;  4IF4 A;  1WSR A;  3SJZ A;  3FM3 A;  4RD1 A;  4OIN F;  1S9H A;  3BR3 A;  1JA1 A;  2L02 A;  3TBI A;  1HDD C;  5C1E A;  4AUX A;  4XK4 A;  2ZJ2 A;  2OAZ A;  4RCZ A;  1BA5 A;  3PNY A;  3F6O A;  1K61 A;  4YII A;  3ZQL A;  1NHC A;  1X4P A;  3ESW B;  5E1W A;  5FLM J;  2FUG 2;  3OS1 A;  2IA0 A;  4DQL A;  2EIK H;  4RS8 A;  5A89 A;  1YJN I;  3O2P E;  1TZL A;  4EGY A;  2CQ7 A;  3IWF A;  3I5U A;  4S05 A;  4Y52 J;  2D3L A;  1FSE A;  1IRX A;  2BY2 A;  1G7S A;  4W8Q A;  1FNC A;  2MBF A;  3KP5 A;  2K9M A;  2HXI A;  2FNP A;  2FOK A;  5IYB J;  2R93 J;  3HIF A;  4CZZ A;  2V5I A;  3CMA I;  4OJ5 A;  3GFM A;  1L3L A;  4PC2 A;  3F8F A;  2M3A A;  3WND A;  1BL0 A;  4KKT A;  2Z3Y A;  2WB1 A;  3GQB A;  2DT5 A;  1K8F A;  5C4J J;  4OAZ A;  1FBQ A;  3CUQ B;  1R7J A;  1OYI A;  3ZQH A;  1K79 A;  2ZSI B;  1Y0R A;  1OGJ A;  4YHB A;  1MJA A;  3TW7 A;  1TWH J;  4CXF A;  3KCC A;  1YI2 B;  3CCM B;  5FKO A;  5E3O A;  3WTT C;  2KL4 A;  1UAA A;  1GR1 A;  2KIF A;  3H36 A;  3HC7 A;  1LVK A;  2CUF A;  1ETV A;  4IHX A;  1CQX A;  3BZC A;  3ISP A;  2WAD A;  2VXZ A;  4M3E A;  2X0L A;  4UVA A;  1Z77 A;  2LYC A;  1Y1W J;  5TV2 A;  1O3S A;  2QTL A;  4LBZ A;  2Z99 A;  4HA8 A;  1V3F A;  3MKL A;  5K7F A;  1N08 A;  1U0J A;  2BF4 A;  2HDC A;  2BM4 A;  2OQR A;  1OLT A;  1A36 A;  2J5P A;  5JFR A;  3NWT A;  1I1S A;  2VBU A;  1QGZ A;  3A1P A;  2XTX A;  1YTY A;  1GVD A;  4N9I A;  3TDU C;  2AXT C;  5FO1 A;  2EJR A;  3AG1 H;  3T53 B;  2ZZG A;  3H0D A;  2UVE A;  5D6E A;  2P81 A;  4D7N A;  3L1P A;  1Y0Y A;  5E1Z B;  4IKF A;  1WFX A;  2ELJ A;  1R5B A;  5J3O A;  3C7J A;  1W7P B;  3M8J A;  1PKV A;  2W82 A;  3S16 J;  3PEN A;  4ZV4 A;  2UXX A;  4X0G A;  1EV7 A;  1X1A A;  3DQV C;  4DZJ A;  2ZC2 A;  1WJ5 A;  2IVM A;  4A0Y A;  1IXS B;  5HOD A;  5CJ9 A;  5DDG A;  3HOY J;  3A03 A;  3BG6 A;  3W3C A;  4G5G A;  2H8W A;  2D45 A;  5IP9 J;  2ZZQ A;  4RDU A;  3KL9 A;  3H9G A;  3IKV A;  3C1D A;  3HHH A;  2XUB A;  1VQK B;  3A01 B;  5BSX A;  1LJ9 A;  4XRM A;  2DCU A;  2MC4 A;  4ZYG A;  4U0W A;  4L5E A;  3W2W A;  1T5E A;  4ANJ A;  3S1Q J;  1U5T B;  4U0V A;  2Z16 A;  5E8G A;  1MNE A;  1ULY A;  4RMN A;  4A3I J;  1IRZ A;  3HXL A;  3H9J A;  2Y0S A;  4N3G A;  1J5Y A;  2W57 A;  2M87 A;  4PJL A;  4DYQ A;  4L0Z B;  4ZDO A;  1BMF A;  1W34 A;  3RIR A;  2GJP A;  1FPQ A;  1UD6 A;  1XPX A;  1BI3 A;  2KRF A;  5FFX A;  1SFU A;  2QKL B;  4DNR B;  3GSI A;  2VC0 A;  2X4H A;  3E6B A;  2L7K A;  2WAQ A;  1DP7 P;  2V1D A;  2Y0M A;  1KQ0 A;  5D4S A;  1WH5 A;  2Q1Z B;  1S7E A;  1YW9 A;  2LR8 A;  3OOU A;  5JI6 A;  1IJW C;  3HOU J;  3H09 A;  4ZDL A;  2VL8 A;  4HWV A;  2B63 J;  1JGG A;  3WTX C;  2ME0 A;  4X7C A;  1EFC A;  2BEO A;  1FTZ A;  4NUB A;  3FXR A;  1FX0 A;  1BR4 A;  4RJL A;  1LDD A;  3ZMZ A;  4E7H A;  2VJ5 A;  2LY1 A;  1E43 A;  5B1A H;  5JLW A;  1U2W A;  1FLI A;  1WQ2 A;  5CYV A;  4BDY A;  3AL0 C;  1H80 A;  4P9S A;  1QGP A;  4BQA A;  2KT0 A;  1IRF A;  1Z21 A;  3RDI A;  2GOM A;  3VMF A;  3OZU A;  3B78 A;  2FQ4 A;  2LY2 A;  2WB1 N;  2L2O A;  1YX2 A;  2X8K A;  3GTL J;  3DF8 A;  3LA2 A;  1VQ8 B;  1ZN2 A;  1Y0N A;  4G9Y A;  2RRE A;  1O7L A;  3IKT A;  1U6G A;  3F6V A;  2XPU A;  4AF7 A;  5TGT A;  3ZMT A;  1Y0U A;  1U2R A;  1GV5 A;  2O03 A;  3FKS A;  1HA3 A;  3NEU A;  5BNG A;  1BM9 A;  1I18 A;  2R7Z J;  2BE5 F;  2FMY A;  4A69 C;  2KDZ A;  2L01 A;  3CCR I;  2QA4 B;  4OJL A;  3PQJ A;  4IPA A;  3FHN A;  1MD0 A;  2R5Y B;  3BY2 A;  4P6V F;  2EA4 A;  3I0T A;  1QBJ A;  3ECH A;  1WOO A;  2P5K A;  5J8F A;  3PJR A;  2DU9 A;  4RAZ A;  2J8K A;  2QSG X;  3WTV C;  2OA4 A;  4BL0 B;  1ZM9 A;  4JP0 A;  1R5O A;  3SFZ A;  4M73 A;  4UVB A;  3J81 K;  1TT0 A;  3QP5 A;  2RDP A;  4MLO A;  5DNS A;  5DD4 A;  4B09 A;  5F4O A;  3HZJ A;  4U9U A;  1FJL A;  1TVC A;  2V7V A;  3PNT A;  2LC2 A;  3GF2 A;  4P5O A;  2QQ9 A;  3T5X A;  1MSE C;  1HW5 A;  2XPV A;  3BDD A;  5GTH C;  2XGX A;  3LAP A;  5BMZ A;  1VQM B;  4U49 A;  3WWG A;  1B59 A;  4IHY A;  2QCO A;  1XDU A;  4HF0 A;  4NNJ A;  5CVU A;  3TQN A;  3L2U A;  2OBR A;  2IGK A;  1DGR M;  4XRS G;  1VZ0 A;  1UHM A;  2PYG A;  1LDJ A;  2VFN A;  5L3D A;  1I3Q J;  2LSO A;  1V4R A;  2LMD A;  2P6T A;  4JX6 A;  3DEE A;  2IGM A;  2GWR A;  3AK5 A;  3CCE B;  3ZQI A;  5GAE J;  5HS8 A;  1JJ2 B;  3D1N I;  1B8I B;  3QOE A;  1YJW I;  3QYB A;  1WPK A;  3RPU A;  1XB4 A;  4NB5 A;  1N06 A;  3Q3A A;  3CJN A;  3I4P A;  4TMZ A;  1F20 A;  2COB A;  2HDW A;  3LYC A;  2H8R A;  2ZTG A;  4R79 A;  2KKO A;  5FRO A;  1OR7 A;  1IUF A;  1Z0X A;  4A3L J;  2Y0S N;  3BH4 A;  1WGX A;  1OCP A;  1SMY F;  4HDV A;  3Q0V A;  1MMS A;  2CW5 A;  2E7W A;  1G7T A;  1ETO A;  1QQI A;  1XX5 A;  4AC9 A;  2KRC A;  1KU9 A;  1LLZ A;  4GO1 A;  3HHG A;  3W5V A;  5DD8 A;  1KJZ A;  3PVD A;  2VOO A;  3P7N A;  1RC9 A;  1XGN A;  2VBW A;  4CSW A;  2VBM A;  3FZV A;  5D8K B;  1XFO A;  5F64 A;  3H1C A;  4URR A;  3EYY A;  2VNK A;  1J7K A;  2VOP A;  1SKY B;  3DU5 A;  3EQL F;  1R23 A;  1L0O C;  2YR2 A;  2BXZ A;  2M5S A;  3VOE A;  5M3F J;  3H3U A;  3JW4 A;  4Y9U A;  2XZL A;  4L0Y B;  3SZE A;  2JSP A;  4BQN A;  1F36 A;  1S7A A;  2WAE A;  1GXQ A;  3QP6 A;  3ONQ A;  1W0U A;  1IAW A;  3HOZ J;  4MEX F;  4RD2 A;  2W84 A;  2EB7 A;  5E20 A;  4P3Y A;  2UUZ A;  3K70 C;  4WXD A;  3ERE D;  1W0K A;  1FP1 D;  3K4C A;  2D74 A;  2OK7 A;  4ZCL A;  5JBQ A;  2RQQ A;  3G1L A;  5FJ8 J;  3JAM K;  4MGR A;  5F0F A;  1S29 A;  1NG6 A;  4WXC A;  4YIR X;  1HW1 A;  2HZT A;  3SJP A;  1FWZ A;  2D3N A;  3ZQQ A;  1TTY A;  1YFH A;  3MZ8 A;  5CKT A;  1POG A;  4I0A A;  3DKX A;  4CZC A;  1W0T A;  5IYD J;  1ETW A;  2ID3 A;  1OFD A;  3A3G A;  3B8H A;  2FX0 A;  1X2N A;  3SFI A;  3V8J A;  1T2K A;  1PDN C;  4IW3 B;  4PAB A;  1ZAR A;  3DBR B;  5EDN A;  3JU4 A;  3ZPP A;  2X1C A;  4DYR A;  4KMF A;  3FMS A;  4V2G A;  5CQE A;  1N0U A;  2PBI A;  3DCF A;  3ZQC A;  1WU8 A;  3E97 A;  1O8E A;  4NHJ A;  3CCJ B;  3QU3 A;  1MH3 A;  4DK1 A;  1ZGA A;  4BBS J;  1SAX A;  3HTS B;  2IGN A;  3N05 A;  2TCT A;  2HKX A;  1QVF B;  2FU4 A;  3H3Z A;  3SHF A;  4W97 A;  4EM1 A;  4XOP A;  2B0L A;  2OCE A;  3ZMS A;  1ZM3 A;  4FE7 A;  2RC4 A;  3DWL E;  5HDN A;  1U3E M;  4LBW A;  1JUS A;  2OJE D;  1B1B A;  4Y7C A;  4IOC F;  1V5F A;  3GXO A;  2OTL B;  3OPO A;  3RYR A;  3U6K A;  2BHY A;  4ENM A;  5J35 A;  2GJK A;  2EZL A;  4LOC A;  4BEH A;  3VR6 A;  1G3W A;  4XLF A;  1QVT A;  1I50 J;  1Z67 A;  3BP8 A;  3DP7 A;  3CDL A;  1MIJ A;  1MBH A;  2E1N A;  2KDO A;  4LLL A;  3JSP A;  2DFI A;  2DN0 A;  5ICE A;  5GPC A;  2QYO A;  3HUG A;  2JQ7 A;  2IS6 A;  2YX4 A;  4M3B A;  3H3V K;  3O8H A;  2MFZ A;  4KDP A;  1SMT A;  3PQK A;  2Q6K A;  3MMP A;  1T95 A;  2Y69 H;  1BC7 C;  4PJN A;  4M74 A;  4ZZD A;  5LHG A;  4XID A;  3CJR B;  1OFM A;  2R7R A;  1RUO A;  1O8G A;  3ROU A;  1VQL I;  4EQQ A;  2XTY A;  1KYW A;  1XMX A;  1DAR A;  1RUN A;  2WYR A;  3KP3 A;  2IPQ X;  1N77 A;  1T56 A;  2WA0 A;  1OMI A;  3MKW B;  2QBY B;  4XOT A;  1H88 C;  2LK2 A;  3FXM A;  4BS9 A;  2X3H A;  2DT7 B;  3WHB A;  1T6X A;  1TYV A;  4GYG A;  2Y48 A;  2OUM A;  1XMA A;  3GLL A;  1W36 C;  3H94 A;  3RKX A;  3BCB A;  2DMT A;  4GQN A;  5FKM A;  1O8K A;  5E18 F;  2X1D A;  4XLP F;  2KLO A;  2HTJ A;  3WGH A;  1A35 A;  2ZTN A;  3I59 A;  3Q0W A;  4MTE A;  2L4M A;  1OCC H;  3DPU A;  4BE1 A;  3LSR A;  1HC8 A;  2KMU A;  2R7W A;  1FTT A;  1HQC A;  3EUH C;  2OV7 A;  3RJP A;  1TTT A;  3EUK L;  1Y56 A;  1BR2 A;  3FXJ A;  3ML6 A;  3BG9 A;  5ILV A;  4RM0 A;  3CO6 C;  2NXN B;  5J1R A;  3ASR A;  3NAW A;  2A68 F;  2EZK A;  3K4K A;  2X85 A;  2MSY A;  3HG9 A;  2CJJ A;  1ZLJ A;  1ZRD A;  3HDD A;  4A3G J;  2HFH A;  5IPA A;  2LF7 A;  4DK0 A;  1USS A;  3A0B C;  3KX2 A;  2Z8G A;  1QVU A;  1IF1 A;  2GK6 A;  2TDX A;  2QKM B;  4ZYH A;  5HVQ C;  1YJN B;  5FO5 A;  1Z7U A;  4B1R A;  3FIS A;  4EH1 A;  4DOZ A;  5CLS A;  5HLI A;  4AU7 A;  2M8E A;  1U9N A;  2AQF A;  2VBY A;  3R0A A;  4G94 A;  4HV6 A;  2VBX A;  2QZA A;  2R5Z B;  4I84 A;  1OFL A;  1VQ8 I;  2BGJ A;  1K8A D;  3RPQ A;  1EF4 A;  3ZMD A;  4BY7 J;  3OOC A;  3TL4 X;  2QSF X;  5AN9 A;  4OMZ A;  1MRZ A;  1TLH B;  1MBJ A;  4PK4 A;  4YEI A;  1IN7 A;  4NC7 A;  3BCD A;  4PAA A;  1XQB A;  4YZA A;  3CCS I;  1IC8 A;  3AG4 H;  3BTI A;  2AHQ A;  4ASU A;  4LBV A;  3K9T A;  2Z33 A;  1G3S A;  1ZHF A;  1NRK A;  3CDI A;  1KU3 A;  5KK1 A;  4RDJ A;  1GVH A;  5KSW B;  2YU3 A;  5ICF A;  5D5U B;  4F91 B;  1IZ1 A;  1Z6R A;  5AIP A;  3W6K B;  4BKX A;  5IY5 H;  1HW2 A;  3ZPL A;  1PP7 U;  1NJI D;  3AVY A;  1W9X A;  1CZF A;  3TED A;  2V6E A;  4HBL A;  1SAU A;  1DBG A;  4XRF A;  2R7F A;  5TRD A;  2M7B A;  3K4L A;  3W2A A;  1PVE A;  3ZP5 A;  1YLO A;  4X05 A;  5KW9 A;  3SZG A;  1Q1V A;  2VNJ A;  4MQV A;  4DZP A;  4A5N A;  2E7X A;  2DXI A;  2DA4 A;  3IC7 A;  3F21 A;  1LE8 A;  4XKB A;  5ILS A;  2VJ4 A;  2EBI A;  2P3M A;  1MDM B;  2VBK A;  5DM6 F;  3RZO J;  1H85 A;  3VFZ A;  1IDZ A;  3WNC A;  3MD2 A;  1W5S A;  4C2T A;  1FY7 A;  5KHD A;  1TT5 B;  1X3U A;  2KIM A;  3E5U A;  4ZYE A;  5BOX A;  2HPI A;  3JRC A;  1IG7 A;  1XD7 A;  1O8M A;  4F52 A;  4Y33 A;  4QIW N;  1MZB A;  2CRG A;  4RGR A;  4P2N A;  4JX4 A;  2Z9O A;  1GAQ A;  1TSP A;  2LRD A;  3BG5 A;  3K6G A;  1YX3 A;  4KYW A;  1QFZ A;  3D5S C;  3RTR A;  1IJE A;  2DIE A;  2PMZ N;  1OYY A;  3A8J A;  4P9U A;  2NAZ A;  1MJ9 A;  4PC6 A;  4F92 B;  2CW7 A;  4NDL A;  3NB2 A;  4II2 A;  2B0R A;  2IW5 A;  2GA1 A;  4TV7 A;  2QTZ A;  4RD0 A;  2IT0 A;  3K2Z A;  4M6X A;  1E64 A;  1ZK8 A;  3LL7 A;  4HX7 A;  3CDH A;  1QA6 A;  4P6Y A;  4PC1 A;  2LNB A;  4G6D A;  4HPQ A;  2P7C B;  2DMU A;  4NK8 A;  4BXU A;  1U8R A;  4LG0 B;  2VON A;  5KCM A;  4TKO B;  1BI2 A;  1ZM4 A;  1GVJ A;  4RB2 C;  1ZRC A;  4IZZ A;  3CCV I;  1ZG5 A;  2ZBU A;  5J47 A;  3DTK A;  2DJN A;  2MH2 A;  1E17 A;  2NPF A;  2JA8 J;  3SLD A;  1D1A A;  3QFR A;  4S0H B;  3GQ7 A;  3EUH A;  1ZGJ A;  3A0H C;  2A69 F;  4RM3 A;  1I1G A;  1P4W A;  2D1V A;  1P4M A;  4YZX A;  5K7Z A;  1CGP A;  3GTM J;  1RKT A;  1W1W E;  2M2E A;  2PFB A;  3QPH A;  3ZIA A;  1J09 A;  1XG1 A;  2VFQ A;  2X6O A;  4B44 A;  2GPJ A;  1D1N A;  3K1M A;  1Z3Y A;  2X9D A;  3U1K A;  4ZDP A;  3H9N A;  3CB4 A;  3AVW A;  1LLW A;  5L3F A;  3GME A;  2YPR A;  2OTJ I;  1RRJ A;  3RCO A;  4MFD A;  2LG4 A;  2HQR A;  2HXO A;  4UVC A;  4Z4T A;  4OZZ A;  1TQP A;  3T51 B;  1JKO C;  1MMD A;  3CP2 A;  4E4H A;  5LGN A;  3AFH A;  2DA2 A;  1FNB A;  1K28 D;  4Z1M A;  5FD6 A;  4Y3O A;  1ZM2 A;  3WE3 A;  4PZJ A;  1YW7 A;  3KEO A;  4CQJ A;  4J0Q A;  4P1W A;  1JHH A;  1UHS A;  3HJE A;  1RWR A;  2M34 A;  3AG2 H;  3M7G A;  2FBH A;  4B3F X;  2BZT A;  4DYC A;  1YLF A;  2L3D A;  1WTH D;  1D3Y A;  3SDG A;  4YAO A;  2WY8 Q;  3DLL F;  4OIP F;  3OKX A;  2XZO A;  1WI3 A;  1FBS A;  2XNC A;  2JUC A;  5LMZ A;  1IJF A;  2M8G X;  3VB2 A;  3FPP A;  3RKQ A;  3WOD F;  1SKQ A;  2LRE A;  4Z05 A;  4QFM A;  2O1D A;  3FDY A;  1A8P A;  4OPS A;  3GTP J;  2P0W A;  3EET A;  4E7S A;  1SD4 A;  1HF2 A;  5D4R A;  4ZTF A;  3I9V 2;  1RPW A;  3TW6 A;  3H0G J;  3OYL A;  1TNS A;  3D0S A;  3H5N A;  4A5M A;  4G7W A;  2P5L C;  1R36 A;  2PEX A;  4HLX A;  1IHM A;  1S8N A;  2XV4 S;  1LEB A;  4HE6 A;  4JBA A;  3VO1 A;  1QFJ A;  1UD5 A;  3REO A;  2B7B A;  1E1Q A;  4Q5S F;  4W8S A;  2WC2 A;  3LSK A;  1VFC A;  2QE7 A;  2BPO A;  5THX A;  2R3S A;  2W6J A;  2Q6L A;  1LUJ B;  1X2M A;  2VI6 A;  1JJ6 C;  5CVV A;  2STW A;  2PMH A;  3S1M J;  3CCR B;  3F0C A;  4X0C A;  3WHC A;  2E5N A;  4D0P A;  3JAM Z;  4D9J A;  4XLE A;  1JI8 A;  4OOS A;  3N90 A;  4A0Z A;  1DUX C;  4A12 A;  1MKM A;  2PEC A;  2RNG A;  2XKO A;  2CWE A;  1G8X A;  2XVC A;  3SEQ A;  2NRA C;  2DA3 A;  5H6Q A;  3G4S I;  1QQ1 A;  2KIQ A;  3ZN1 A;  2V7Q A;  3PFY A;  2VKV A;  3DU6 A;  3K4M A;  3Q3S A;  2V7T A;  4NBS A;  1S72 I;  2VZL A;  1R5I D;  3DXJ F;  4NCN A;  3G1M A;  2NNN A;  1K6Y A;  3CC7 I;  4BY1 J;  3R61 A;  1I7P A;  3QE2 A;  1OFE A;  2WZN A;  1EH7 A;  2VKD A;  1KK0 A;  4KMU X;  3NAR A;  4WZT A;  2H1L A;  3P5J A;  1T0F C;  2IS4 A;  2JTV A;  4XD7 A;  2YWF A;  3E6D A;  2INV A;  4C2L A;  3OYE A;  1DPR A;  3BZK A;  2W4S A;  1IV6 A;  3BTL A;  1KTW A;  3LMM A;  1OKR A;  4IVN A;  3N97 A;  1R6R A;  2BOL A;  2IA1 A;  3ZN0 A;  4BGD A;  5KVR A;  4X6A J;  2ETH A;  1SFO J;  1WOP A;  5M5X J;  3PUM A;  4LFU A;  3OSG A;  4DJA A;  3OJW A;  2KQR A;  4E7L A;  3IAS 2;  3KPH A;  2QSH X;  1GHC A;  3GIR A;  1YJW B;  3PL8 A;  1W36 D;  1KA8 A;  3SZP A;  1TUI A;  1C0W A;  3WNB A;  1I6X A;  3E7L A;  3AG3 H;  4YZQ A;  2W25 A;  3DTE A;  5HLH A;  1TP4 A;  2R7V A;  1KQ8 A;  3PM1 A;  2DDB A;  2PMU A;  2V31 A;  1GLN A;  3RSN A;  1XCB A;  3GTO J;  1X0C A;  2IAI A;  5J1Y A;  1J9I A;  5GAD J;  3VNV A;  3NE5 B;  2NSP A;  3SQN A;  3LSM A;  1E79 A;  4M3D A;  4XSZ F;  3G3Z A;  2K02 A;  3CCQ I;  1APL C;  3S14 J;  4ZGQ B;  1IXC A;  3Q9S A;  4WQM A;  3GZ6 A;  2NTQ A;  4RPD A;  2H27 A;  1G59 A;  4KJZ A;  1FP2 A;  2V7F A;  3KZZ A;  5LRR A;  2CV2 A;  2IOU G;  4DQ2 A;  1PXZ A;  1SM4 A;  2QGG A;  1QZZ A;  4UV9 A;  1PJ7 A;  4LGW A;  3JTG A;  3ZUG A;  2XGJ A;  1OGI A;  1UHW A;  3KP6 A;  2V4J C;  1EH8 A;  2A61 A;  3M07 A;  2O0V A;  2DAO A;  1IA5 A;  1U78 A;  4XMY A;  5F1J A;  2JJ7 A;  4BBR J;  3KYL A;  3TOA A;  3FMQ A;  2HTS A;  5K5R A;  3LFU A;  3S2D J;  1P2F A;  4Z4W A;  3E0J B;  1MMA A;  2O0W A;  1ETX A;  3AVX A;  2WTE A;  3BWG A;  1YRN A;  2LBF A;  1DAB A;  3BY6 A;  3TP3 A;  2XC7 A;  1FYM A;  1G4D A;  2HVS A;  3MN2 A;  4U88 A;  1KZL A;  3IP4 B;  3PA1 A;  4MXN A;  2JA7 J;  1Y39 A;  2M4G A;  1D0Z A;  1Z7L A;  4XR6 A;  4P9F A;  4F93 B;  1H8E A;  3VMV A;  1WXR A;  1ZYR F;  4CUG A;  4PGH A;  3I56 I;  1X3W B;  2ZIT A;  1BX0 A;  3PUB A;  4BNC A;  3BCF A;  3P27 A;  4YEJ A;  3R0J A;  1V0F A;  3MEX A;  3WTZ A;  4XRS A;  1NB0 A;  1PLU A;  1V55 H;  2CK3 A;  3MZH A;  4C30 A;  4P96 A;  3KP2 A;  3OYM A;  5K1Y A;  2V1N A;  3CTA A;  3M8F A;  4I7H A;  4KA4 A;  2IS2 A;  1QJV A;  2MC3 A;  4CDG A;  4P55 A;  1YX5 A;  1IN8 A;  1G2H A;  4FT8 A;  2DEU A;  5DEQ A;  3LFK A;  2M0M A;  4UHT A;  1DDG A;  2EWN A;  4KN4 X;  4C43 A;  3A35 A;  4EV0 A;  5HXB A;  2IXS A;  4G6Q A;  2L7Z A;  1UMK A;  2ZME C;  4PSX A;  4PMH A;  2E1C A;  4M4S A;  2KJB A;  4EJU A;  1HZE A;  5A2Q Z;  3CUQ C;  1H8H A;  4Z4R A;  2W00 A;  2JUG A;  2R92 J;  4MTD A;  1BIA A;  1R5N A;  3WU0 A;  4OOV A;  3JRG A;  2Z2S B;  3VSK A;  4A2U A;  2L9S A;  4IHS A;  2QLZ A;  1LEA A;  2LF8 A;  4EJW A;  5HOO A;  1BQE A;  1I39 A;  2WJY A;  2VT2 A;  4FX4 A;  1ETQ A;  2ZXW H;  3VYR B;  3WU1 B;  3L2R A;  4OJP A;  2KZV A;  4Z4Z A;  2G7H A;  1TWF J;  1P4A A;  4AM3 A;  3KYD B;  4N9H A;  2FRH A;  2CV0 A;  1QUF A;  2AS5 F;  2B5O A;  2BVN A;  4RB0 A;  1REP C;  2XEX A;  1BJA A;  1R1V A;  3IV5 A;  4GDF A;  1JT6 A;  3G71 I;  3FY3 A;  1FYL A;  3OW2 B;  3FHZ A;  2QVO A;  3OR1 C;  3W6J B;  4BE0 A;  2R9V A;  2Y9Y A;  1RZ4 A;  3PSF A;  4UB8 C;  3W2V A;  3WTU C;  2Y9Z A;  1R5H A;  4AIH A;  4J00 A;  2INU A;  1WHU A;  4TMV A;  1VQL B;  1XS9 A;  3WE2 A;  3G73 A;  4BH9 A;  1ACI A;  2HEO A;  2D2W A;  4B3G A;  2IEK A;  4IRI A;  2BXY A;  3T56 B;  1K4T A;  4J01 A;  4IOA F;  3BR5 A;  3SEZ A;  1IUY A;  4LC0 A;  1HLV A;  5IYC J;  2NVQ J;  3J7Y J;  1QX4 A;  4AYB N;  4N0B A;  3RQI A;  2IS1 A;  1NB9 A;  5LGT A;  1OB5 A;  4RAY A;  1TLL A;  3B6C A;  4IRH A;  1OYW A;  5F0C A;  4UY8 I;  4XNF A;  4PC7 A;  4HSR A;  1JTA A;  3PET A;  3BR0 A;  4RM2 A;  2HVR A;  5EYR A;  1O8L A;  1PP8 F;  2OC6 A;  3H9Q A;  2JJ1 A;  5BSY A;  2OBT A;  3H92 A;  1LDK B;  4BAC A;  1FOK A;  2DBB A;  2HLD A;  4XL9 A;  1OIS A;  3BTC A;  3ISX A;  3OR2 C;  4KUM A;  4RAG A;  4EJO A;  2GOX B;  1QRC A;  3PSZ A;  2PJR A;  1U5T C;  5LHI A;  1T39 A;  1NH3 A;  1Z6T A;  4A3C J;  3AL0 B;  4RLZ A;  4HQE A;  1SEU A;  4QWQ A;  2GRE A;  4Z4V A;  3VEP A;  3FXL A;  4CGZ A;  3JUR A;  1P7J A;  3HPG A;  3JTH A;  3OAA A;  2DMP A;  1W4M A;  3PNV A;  2VB6 A;  1K78 B;  2E1O A;  1K5C A;  4LMY A;  4BPR A;  1PYV A;  1OB2 A;  2IA2 A;  4Z4Y A;  1FT9 A;  3DKW A;  3V7S A;  3OFN A;  3BJA A;  3TO6 A;  1EH6 A;  2LTP A;  2DET A;  4A3E J;  2VLA A;  1WJD A;  1WJC A;  1YW8 A;  2E1B A;  1M1K D;  1FBU A;  1FIP A;  4P3I A;  4G7H F;  1AA7 A;  4YIF A;  2YS9 A;  2GXG A;  3QRF F;  2YUS A;  2EV0 A;  2ZZF A;  4B4D A;  2E71 A;  4CYD A;  2YWE A;  2EFO A;  3W5U A;  5DCM A;  2QX3 A;  1VLY A;  3OZW A;  2XNJ A;  4AIJ A;  3T8T A;  4ACB A;  2BV6 A;  2ZME A;  3CCS B;  2XC1 A;  1FDR A;  4RA2 A;  2YWH A;  1WH7 A;  3VSL A;  3QU6 A;  4XQF A;  4OPO A;  3KZI C;  2G0Y A;  3ZRG A;  1K83 J;  1QHG A;  5LEK A;  4I09 A;  3EQN A;  4PUS A;  2I8D A;  1T6S A;  1SVO A;  1QGY A;  3TO9 A;  5BPD A;  4KFC A;  1ORK A;  1VHO A;  3AGP A;  5KAF C;  2BVM A;  3H35 A;  1V0E A;  3LNN A;  1P4X A;  5E79 C;  4M6Y A;  4BU2 A;  3LOC A;  1A04 A;  1VQ6 I;  2O9L A;  1SC7 A;  1FSH A;  1QA1 A;  4QTR A;  1QRB A;  5D5X B;  4XSX F;  4IHT A;  1FOY A;  5GPA A;  1D8J A;  5M5Y J;  1CNF A;  3WG7 H;  1OQY A;  2DK5 A;  4S04 A;  4E0F A;  2FEZ A;  2XTW A;  1FEX A;  5FKK A;  2E1M B;  1MSF C;  3CPX A;  4U7B A;  2CYY A;  2ZXJ A;  4EEF G;  4DQK A;  4BEH B;  1EZG A;  3CJQ B;  3CJT B;  3KET A;  5DUK A;  4QVA A;  1FNM A;  1W87 A;  4I02 A;  1LVA A;  4M3G A;  1F4K A;  4IJA A;  3HUG B;  2IRF G;  4B8X A;  1HKS A;  3QPT A;  1RR8 C;  1BHE A;  4MFE A;  1H42 A;  4ACA A;  3GQ9 A;  5HS7 A;  1OGO X;  4B47 A;  1IGN A;  4G6T B;  1TYU A;  3FJO A;  2EPF A;  6PAX A;  4XON A;  1ZQ3 P;  3C2B A;  1UST A;  3QFT A;  3BC9 A;  1TNT A;  1Y8R B;  1KK1 A;  1RES A;  4I99 C;  1HOM A;  2EIM H;  2DER A;  1TYW A;  2MD5 A;  2X0K A;  4W8R A;  3NAU A;  1SFE A;  4A6D A;  2VE9 A;  2HOS A;  3VSV A;  1TW2 A;  3L2Q A;  2DA7 A;  3P9I A;  3IRR A;  2BSA A;  3CCV B;  2V26 A;  2FXA A;  3E6C C;  1VJS A;  3E5X A;  1EE6 A;  4D5F A;  2FD5 A;  5TR9 A;  4DGW B;  3S1N J;  3AST A;  4IXA A;  4MYT A;  3BT9 A;  5HZB A;  1IXR C;  2RGV A;  4HE5 A;  3N6Z A;  4O6J A;  1PUE E;  2ISY A;  2E5Z A;  2WAQ N;  2XAJ A;  3I59 B;  3IWZ A;  2E35 A;  3J80 Z;  1IRG A;  4LBY A;  3GQA A;  2CQK A;  1LQ1 A;  1KGS A;  4RDK A;  4FAS D;  4M71 A;  1VTN C;  2EV6 A;  2JMW A;  1KD1 D;  3MHP A;  1OCZ H;  2G7U A;  3CZ6 A;  3K69 A;  5E3N A;  4RPB A;  4TSF A;  1YIT I;  3SKB A;  2OTJ B;  3DPT A;  3UKG A;  3BOQ A;  3P9K A;  4KIC A;  3B8Y A;  4AF6 A;  5IYN A;  1S5L C;  3QWL A;  3F9K A;  1JTY A;  4OM9 A;  2C5H A;  2HR3 A;  4MQ9 F;  1YIO A;  2DQR A;  2K9Q A;  3KFW X;  5J4Y A;  1K78 A;  3I71 A;  2NOJ B;  2MH9 A;  3VDX A;  2QN6 A;  1Q1H A;  4LIV A;  1ERD A;  2F43 A;  3ERM A;  2VYQ A;  4WZL A;  2Y2Z A;  2IJL A;  5FFZ A;  2RC6 A;  1X1D A;  4N4N B;  1S4M A;  4N4O B;  2H1K A;  2F1L A;  3ZBT A;  2L9R A;  1UD4 A;  4HYE A;  2BM5 A;  4EM0 B;  4BYY A;  2RN7 A;  1JRG A;  3GW2 A;  4Q7J B;  2GM4 A;  4UUS B;  3JR9 A;  4RD3 A;  3E20 A;  3OL4 A;  5M3M J;  4AWX B;  2F4O B;  4MO7 A;  3I4N J;  4M9X A;  3ZZT A;  2R7O A;  3A4C A;  2RNJ A;  2JIZ A;  1TL8 A;  2C6Y A;  3JQQ A;  2XGD A;  3ASN H;  4GGG A;  1XGS A;  1SFK A;  1JJ8 C;  2Q8K A;  2ICW G;  2V79 A;  2DLL A;  3K1N A;  3IRQ A;  2A6T A;  1CF7 A;  2JWT A;  4ZYA A;  1O3Q A;  3DLA A;  4LLN A;  1EFU A;  3OE7 A;  2XF7 A;  2R7X A;  3SXY A;  5DYM A;  2VNH A;  2F2E A;  4JK1 X;  1LE8 B;  2ZXH A;  5DUI A;  5D5V B;  4A3B J;  3RZD J;  1WI9 A;  1FC3 A;  1R22 A;  1J9Z A;  1WZ2 A;  5AIQ A;  4ON0 A;  2XOK A;  3GEZ A;  1E3H A;  4LK0 F;  4YAU A;  3M9A A;  3BY1 A;  1VQP B;  3U9G A;  4YFN F;  1JGS A;  4F55 A;  3OIO A;  4GYI A;  5AON A;  3G4S B;  1WJF A;  3J81 k;  1RQR A;  3LSG A;  5JVG F;  1DU6 A;  4G7X A;  1QVG B;  2QQB A;  2FE3 A;  1H8A C;  1S72 B;  3MAJ A;  5EF6 A;  5C44 J;  3FXO A;  3RKW A;  4OIR F;  4ZYD A;  2BM1 A;  3ML3 A;  3CC7 B;  4KN7 X;  1TQM A;  2WY7 Q;  2OBP A;  1JKR C;  3VYS B;  3GCM A;  3GWZ A;  3A3B A;  3FX3 A;  3GTJ J;  2DK8 A;  3GFJ A;  4RLF A;  1LNW A;  2O0Y A;  4BHC A;  2DYR H;  1GO2 A;  1KCC A;  3HL2 A;  3GUD A;  5GV7 A;  4Z03 A;  2Z5U A;  2M9H A;  4I01 A;  2H6B A;  2XAU A;  1BW5 A;  2HOE A;  4ZH4 F;  1W5T A;  1W7P D;  5HNH A;  1ZKG A;  2BMW A;  4RD6 A;  1R49 A;  2ISZ A;  1QCX A;  4L5I A;  2B7E A;  4QLC U;  4BQQ A;  2OU2 A;  1R4M B;  5HKK A;  2VQC A;  3MFK A;  3L2C A;  1N8R D;  2BVL A;  1VF9 A;  4CH7 A;  3J7A O;  4BJ6 C;  4BAY A;  4TMT A;  2CS3 A;  3DBL B;  1WMR A;  2M5W A;  2VFO A;  2EIN H;  4ITV A;  3LMW A;  2F5D A;  5B6I A;  1KCD A;  3OWT A;  2LVS A;  2OYN A;  3U1D A;  3QSY A;  4U4B A;  3PSI A;  2DQL A;  3MQ0 A;  3LQR A;  2CND A;  3WBK A;  2ELK A;  4A3K J;  2DOG A;  2E2H J;  1ETK A;  4PCQ A;  1R4N B;  5B66 C;  2P7V B;  4ZC3 A;  5HNF A;  1HA8 A;  2JVG A;  4NQW A;  1NK3 P;  3CCQ B;  5IOY A;  4NK6 A;  5L46 A;  1ZTR A;  5BPI A;  3GYH X;  1H9G A;  1D8T A;  2M45 A;  2K4B A;  3MMY B;  1MNM C;  2HYF A;  1SAN A;  2XF6 A;  3B6A A;  2PIA A;  3B82 A;  4E7Z A;  4UUT A;  4ROX A;  1KZH A;  1J2X A;  1O88 A;  3K0L A;  3U6B A;  5CQG A;  2ZL5 A;  3ZR8 X;  2F3L A;  3AVT A;  2R7U A;  3OW7 A;  3FKJ A;  5D6F A;  3JRH A;  2DO7 A;  4KIT B;  2O04 A;  2BM6 A;  2GAU A;  5IP7 J;  2XRL A;  2ZKZ A;  4QUZ A;  2K86 A;  1FMV A;  3OMY A;  1F43 A;  5JLV C;  4X06 A;  5A2Q K;  5LHH A;  3A8K A;  2E2I J;  3HGG A;  3JRD A;  3AVV A;  5FKN A;  2W7N A;  4Q47 A;  4UUS A;  2DI3 A;  3HTU A;  1BOA A;  2MA3 A;  3I64 A;  5EG0 A;  4QSH A;  1EP3 B;  1HXD A;  3QOP A;  3OYF A;  4FTH A;  4IHV A;  2CV1 A;  3AVU A;  1OGM X;  4RDL A;  3A1Y A;  1J0R A;  3I56 B;  4M1K A;  2EIX A;  3HM5 A;  4C3J J;  3BNW A;  1COW A;  1D8K A;  2OZ6 A;  1XB2 A;  1TW3 A;  3Q9V A;  2I5U A;  3KZY A;  3A2K A;  2CW0 F;  3T0Y A;  3FIW A;  1DPU A;  4A3D J;  1HSJ A;  4L9N A;  5LFA A;  3DEU A;  1BLI A;  1FYK A;  2IP2 A;  2NS7 A;  1ZRF A;  2EV5 A;  2LKP A;  2CC2 A;  2LH9 A;  2KRH A;  1H9T A;  1T33 A;  3OS2 A;  1SVL A;  2H6C A;  3UNG C;  3FBN B;  3LQ6 A;  2XGC A;  1D5V A;  1SFX A;  1AIP A;  4I2O A;  1IN5 A;  1YS6 A;  3ONY A;  3F8C A;  2XIG A;  3MCZ A;  3GVL A;  2HWV A;  1MAB A;  3WY9 A;  3O3K A;  1PUF A;  2FX3 A;  1W5C C;  3M8E A;  4YEL A;  3L2W A;  2VUM J;  1X4O A;  2DDA A;  1UD2 A;  4OU0 A;  2EZH A;  3CCL B;  1H0M A;  2CGP A;  1KYZ A;  4Y17 A;  4CO8 A;  1S0U A;  3VO2 A;  2BGC A;  4XLA A;  1ZGW A;  4O5V A;  1E3O C;  5C4X J;  1DQU A;  2E60 A;  3C18 A;  2DT6 A;  4IQ4 A;  2EFP A;  3SUC A;  5HLG A;  1K4Z A;  2ZCW A;  5EEA A;  3ELK A;  4F7D A;  3ZSC A;  2Z6B D;  1XG2 A;  1D1C A;  2MYS A;  2K3F A;  2QMU A;  1HKQ A;  2X1E A;  2R7S A;  2ZZE A;  5L3B A;  4PFO A;  5K5O A;  5E8I A;  1OCO H;  3HRS A;  3ONU A;  3E1Y E;  4E7J A;  2B7C A;  3TMO A;  2VJI A;  2EA2 A;  3LQQ A;  3HOW J;  3S32 A;  3JQP A;  3G71 B;  3DEW A;  3OYC A;  1NHA A;  1ZH5 A;  3U2Q A;  2KP6 A;  5LBQ A;  4HF2 A;  5GTI C;  3EQO A;  5BQT A;  4PSW A;  3V4G A;  2DA1 A;  2W1O A;  2ESN A;  2K5C A;  4R8H A;  3K1P A;  4BE2 A;  2QEX I;  2C77 A;  2ZNY A;  3WGG A;  4KIG A;  1Z3X A;  4HST A;  1QG0 A;  1Q81 D;  2F48 A;  2KIU A;  2NVY J;  2V9P A;  3OP1 A;  1VQ9 I;  1P6R A;  5DTD A;  4B4C A;  4YCQ A;  1WKM A;  2MG4 A;  1OFC X;  3QPS A;  4UZF A;  2A5Y B;  4BQO A;  1HF0 A;  1P92 A;  2KVO A;  3LVB A;  5D8L B;  2JZY A;  5H5J A;  4Y15 A;  1SD5 A;  3HOX J;  4V02 C;  1LFB A;  3CRZ A;  3LSH A;  3PUN A;  4DIQ A;  4P12 A;  2GIZ A;  4M0L A;  2JPC A;  4LLG F;  4CCL A;  1QHH D;  3RY8 A;  2VFP A;  2CFX A;  2XGE A;  4R1H A;  1S7O A;  1K73 D;  3SYJ A;  3SJM A;  3F72 A;  5ILU A;  4Y9R A;  1N0V C;  4HF1 A;  3CC4 B;  1F9N A;  4CHU A;  3K4J A;  3JRA A;  2XAQ A;  2D9R A;  3OJX A;  3QFS A;  2VBZ A;  1JXS A;  3E5Q A;  3MKZ A;  1KU2 A;  2CFO A;  5TIS C;  1XTA A;  4YG2 F;  2HDD A;  3KEQ A;  4M53 A;  3S3N A;  5GAG J;  2QZ8 A;  4E6K G;  2ZNZ A;  4A93 J;  5A8A A;  4IEJ A;  4IL6 C;  4X07 A;  2VBE A;  2FQ3 A;  3P26 A;  1YRN B;  1MBE A;  3VSU A;  2LBF B;  1HKT A;  4FCY A;  4CYC A;  4G1B A;  4RLQ A;  3JRI A;  2Y31 A;  2VBS A;  1IDY A;  2VIX A;  3HEF A;  3PFI A;  3F8M A;  3RYP A;  1HDP A;  3ASP A;  2ZJP F;  3F23 A;  5E1X A;  2O8X A;  2YU9 J;  3S17 J;  2WJV A;  2EQR A;  5E3M A;  1NTC A;  3NRV A;  1ZG1 A;  2OPT A;  3CMM A;  2CQQ A;  5DN6 A;  1Y6I A;  2W24 A;  1IB0 A;  3K4B A;  2XT2 A;  1HBX G;  2DOA A;  1O57 A;  2V4D A;  1ZAO A;  1FMW A;  1QGA A;  4OZY A;  5F27 A;  3NWS A;  1YQA A;  1BX1 A;  1QZE A;  2VBT A;  4MNU A;  2HU9 A;  3G1O A;  4P1V A;  2P4W A;  1WWX A;  4HX4 A;  2ECB A;  5EZH A;  1YOV B;  2HKO A;  4L9J A;  3FXU A;  4UB6 C;  4QHY A;  2CH0 A;  4A6E A;  1VQP I;  3L7W A;  4UZU A;  2Z1D A;  2JN6 A;  1DGW Y;  1VQ6 B;  2NYX A;  3I55 I;  5IOZ A;  3JRB A;  2DYI A;  4NBQ A;  1EA0 A;  2YWG A;  2ECC A;  2FA5 A;  1ELO A;  2DOF A;  3JQR A;  1JT0 A;  1UEL B;  4YAF A;  5L3E A;  3SZT A;  3TOB A;  1QNT A;  2J5O A;  3TKY A;  3DPL C;  2DFE A;  2DTR A;  1BC8 C;  2CUE A;  3V8L A;  4MHG A;  4Z4U A;  4JMQ A;  1OOC A;  2BW3 A;  4AVZ A;  5KAI C;  3J80 K;  1ZEL A;  1T08 B;  4RCY A;  3TO7 A;  2C5B A;  2ZXI A;  1Y8Q B;  4B43 A;  4C9Y A;  5DS9 A;  4AIK A;  2GBY A;  4FXU A;  3LNQ A;  3GQ8 A;  4LJZ F;  3GRH A;  3F8B A;  1T6Y A;  3K10 A;  4NC6 A;  1N78 A;  2LP0 A;  1FRN A;  3FPK A;  3S3M A;  5IYR A;  3Q6Q A;  3ABM H;  3FK7 A;  1B72 A;  1Z05 A;  3GZ5 A;  2JA6 J;  1QRY A;  2CUZ A;  2Q2E A;  3ZQ7 A;  4C2M J;  2HQN A;  1UD8 A;  4KIB A;  1EJ9 A;  1LKX A;  2WAF A;  3O6B B;  2GQF A;  1E62 A;  2FBI A;  3GLX A;  1R71 A;  5B5E C;  2GIV A;  2MLG A;  1D0X A;  4JOM A;  3L9F A;  1TYX A;  3VNU A;  2HMA A;  2V1X A;  3ZGK A;  1VQ4 I;  1Q7Y D;  3SQV A;  2L7M P;  2XB0 X;  1N07 A;  3OYG A;  1XGM A;  3LSP A;  4PGG A;  4Y4R A;  3FMR A;  2ZO4 A;  4EM2 A;  1WPC A;  2HZD A;  2O3F A;  4H0E A;  3IUO A;  3OV8 A;  2JVH A;  1YJ9 I;  1RR7 A;  3E1S A;  4PDK A;  1F1Z A;  1JB9 A;  4YXW A;  2M1B A;  4D1Q A;  2NT9 A;  1JE8 A;  2DJI A;  2PJR B;  1AKH A;  1YIT B;  2JT1 A;  3BC8 A;  3BR6 A;  4UNO A;  1EP1 B;  4IRG A;  1QA2 A;  2WPD A;  3CME I;  1JUM A;  3EYI A;  1J75 A;  3K4N A;  2L0K A;  3PO3 J;  2VPL A;  5IT9 K;  2STT A;  2M7A A;  5H6R A;  4QPQ A;  1KK2 A;  2GA2 A;  4FE4 A;  1H89 C;  1E3P A;  1KQ5 A;  3QOD A;  1P7I A;  3W2G A;  2A6H F;  3EUA A;  4LD5 A;  4CIC A;  5JVT A;  2HQA A;  2XAH A;  2E36 A;  2ADU A;  5FGM A;  1DU0 A;  1IV8 A;  2KHM A;  3CQZ J;  3S93 A;  3PIP F;  1VQ7 I;  4CA0 A;  4HDU A;  1ZLK A;  3HAG A;  3CC2 B;  1T98 A;  1V5E A;  2CO5 A;  4OAY A;  4IX7 A;  4YZ0 A;  3AGQ A;  2CG4 A;  1U8B A;  1VND A;  4KT5 C;  2HS5 A;  4Q48 A;  1YIJ I;  3OIQ A;  4C2U A;  4UUV A;  5IYP A;  1O8H A;  3SY2 A;  4G8X A;  1W2B B;  3HGY A;  2D1H A;  5GP9 A;  2P8T A;  3V7C A;  4E7I A;  4EJT A;  3PO2 J;  2BM0 A;  5DCM B;  3VYT B;  5KNL A;  3ZQG A;  2ZME B;  1XN7 A;  4Y13 A;  3HB9 A;  1W0J A;  2HYJ A;  4TMX A;  1IO2 A;  4G7O F;  2MAB A;  3KP4 A;  2PYH A;  2LOO A;  2MGQ A;  2O6G E;  3VST A;  5DS0 A;  3M3Y J;  2HNH A;  2VQL A;  4PJ0 C;  4E70 A;  4Z4S A;  1F5T A;  4NC8 A;  4C3I J;  4UAJ A;  4L5J A;  4GRI A;  3ABL H;  4M72 A;  3CCL I;  1BPL A;  1QPM A;  1AMO A;  5FLV A;  2L5Q A;  3T9G A;  3GTQ J;  3OYD A;  5LD2 C;  3LA3 A;  3Q38 A;  3LST A;  1DDI A;  1T0F A;  1VLO A;  2BGI A;  4X7D A;  3MVP A;  4KIS A;  1RIO H;  2HGC A;  4CCK A;  5HDK A;  3RI4 A;  4D5C A;  1SVM A;  2GXB A;  1N75 A;  3ZOB A;  2CU7 A;  4HAM A;  5B3S H;  2C4U A;  3ASS A;  2K3P A;  2K40 A;  2H94 A;  1IW7 F;  3BQJ A;  1V54 H;  3ZZ0 A;  2EZI A;  4HV5 A;  1MBK A;  4OOI A;  4R71 A;  3CPW B;  2NST A;  2LKX A;  1R00 A;  1GAW A;  2Q0O A;  3IH2 A;  3GBG A;  1YHQ I;  1DBO A;  2HVQ A;  1AOY A;  2CQX A;  3EDP A;  5CPR B;  3OYI A;  2ZFU A;  4ZCI A;  1UG0 A;  1VQ5 I;  2PI0 A;  3MKY B;  2X6Y A;  1NK2 P;  2F1M A;  1VQO I;  1WJE A;  3DV8 A;  2CQN A;  5C1C A;  3CMY A;  3S1R J;  4ENJ A;  1KTV A;  5FB2 A;  1EFR A;  1PJR A;  2HDN B;  2QY1 A;  2NVU B;  5EZG A;  4Y7N J;  1HCR A;  4YC5 A;  5H20 A;  3WQZ A;  2A6E F;  5K5Q A;  2WV1 A;  2BN4 A;  1ZG3 A;  3ZPN A;  2VC1 A;  3A8I A;  3AKZ A;  1PE9 A;  2GZW A;  2OZU A;  3VYU B;  1UMQ A;  4D7M A;  3CC4 I;  4RGS A;  5IYW A;  5HDG A;  4TT3 A;  1ZR4 A;  1ZR2 A;  1YS7 A;  3GZN B;  2PX9 A;  2HYG D;  4EAT A;  5EJC A;  2IGO A;  1XSX A;  1EFT A;  3W2E A;  3ZC3 A;  4XKC A;  5J3L A;  3M4O J;  3HYI A;  3LSJ A;  2XPW A;  2ODL A;  4RGX A;  3W2H A;  3VMW A;  3R6J A;  4AC0 A;  1XSV A;  4XN3 A;  1MMN A;  2A07 F;  1E1R A;  2K9L A;  4FK8 A;  2NTP A;  1TQI A;  4BUP A;  5JR3 A;  2BV3 A;  1OR7 C;  3KLO A;  4MIM A;  1GDT A;  2GXA A;  2R6H A;  4OJ6 A;  4X8I A;  3CLO A;  1RET A;  3MZY A;  3CCU B;  3W2F A;  3WTW C;  3E6M A;  4AD9 A;  1OPC A;  4P22 A;  1E63 A;  5BS6 A;  1O8I A;  3DBH B;  2V6C A;  4KKS A;  2GQQ A;  2NZM A;  4RBO A;  1WDT A;  1ITY A;  2C78 A;  2L9V A;  3ZMU A;  2O8K A;  2PG4 A;  3P4G A;  3LWF A;  1GT0 C;  4OIQ F;  1KQS B;  3FXK A;  4RB1 A;  4I6Z A;  3I54 A;  1EWY A;  3OZV A;  1LFP A;  2RKH A;  4LB5 A;  4PFP A;  2QQA A;  5FLX K;  4B3X A;  4DNC A;  2BY3 A;  4U87 A;  3CUQ A;  2LLK A;  2L54 A;  3L09 A;  1OHH A;  1XGO A;  2XT4 A;  1N25 A;  1TBX A;  2ESH A;  4AID A;  5IYQ A;  3H5A A;  3A02 A;  1ETY A;  2DYS H;  2XAS A;  1O8F A;  5EEH A;  2VNI A;  4X7E A;  1O8J A;  1BI0 A;  3BJO A;  4WWV A;  3W2I A;  2UWM A;  2VJJ A;  2CW8 A;  3WBJ A;  1VQN I;  3S15 J;  2BM7 A;  2UVF A;  1CF7 B;  2PMD A;  2LFB A;  5FD5 A;  2OK8 A;  1TWC J;  1E0E A;  4K1X A;  1AHD P;  1KK3 A;  4A0X A;  1V5G A;  3F8N A;  1X1P A;  2X6X A;  3U2R A;  3ZQF A;  2X51 A;  5EMN A;  5F04 A;  3GX4 X;  4Z2Y A;  1PJ6 A;  2DPD A;  2JN9 A;  3BH7 B;  2CSO A;  2WWY A;  4V19 K;  1K7A A;  1QU3 A;  4EGZ A;  2K4J A;  4HG2 A;  1RMG A;  4ZZL A;  1CLW A;  4AVP A;  1R5G A;  2DMN A;  3V7R A;  2K27 A;  5K7H A;  4LIT A;  3ASQ A;  3CF2 A;  3ASO H;  2YSR A;  2Q6O A;  1YO5 C;  2DPU A;  4XIC A;  2MLK A;  2MW8 A;  2VKE A;  2Q6I A;  2VN2 A;  2I1L A;  1GQ8 A;  1B9N A;  1JTX A;  2Y30 A;  2EFW A;  4W8T A;  3V42 A;  3CD6 I;  2VBV A;  1MMG A;  5HLT A;  4PGO A;  5GV8 A;  4EW9 A;  2RV8 A;  1QA3 A;  4I0B A;  2VQH A;  5J4V A;  2ZL6 A;  1XC5 A;  3ZZU A;  5HZA A;  1FIA A;  1W7P A;  3OYA A;  1QUE A;  2QDX A;  3CES A;  2CMP A;  3HKZ A;  2RC5 A;  2CF4 A;  3BQY A;  5JHU A;  2NVX J;  2R4G A;  4B48 A;  5H2F C;  3OEE A;  2LY9 A;  1BIB A;  2XAG A;  2E1M C;  2DTZ A;  3BCA A;  3V76 A;  4BXF A;  2EWE A;  3G2B A;  3OYN A;  3JRE A;  4ZGN B;  1GXP A;  1UZC A;  5JHF A;  5CVI A;  1HVX A;  2A5W A;  2BBY A;  2F4M B;  1BBY A;  2E19 A;  1G3T A;  2VAS A;  2W85 A;  3A01 A;  2QEX B;  4C0S A;  4G7Z F;  3L2V A;  4FQG A;  1OCR H;  1VQ9 B;  4BHB A;  3J7Z I;  3QYE A;  1U5T A;  2TRT A;  5C3E J;  2FOW A;  3R6K A;  4OPV A;  3I3L A;  5FO0 A;  3MCA A;  4X1E A;  1D1B A;  2O5R A;  1VI0 A;  1BR1 A;  1JKQ C;  3HOS A;  2GJR A;  2W6I A;  4WZK A;  5TY0 A;  3DU1 X;  2AHO A;  4KKU A;  4NQW B;  3WG9 A;  3UR3 C;  2ZL7 A;  4J19 A;  4HX8 A;  4ZTJ A;  4H4K C;  4WWC A;  2RVC A;  4WX9 A;  1IB4 A;  1RQP A;  2D5V A;  3FBI B;  3LO8 A;  3HSE A;  3OY9 A;  1R9T J;  3BG7 A;  3CO7 C;  3GO5 A;  4HRI A;  1BJK A;  3KEW A;  2YUH A;  1RKW A;  2VT3 A;  1Z9C A;  2JJ2 A;  2RQP A;  5H59 A;  1FOX A;  2AXL A;  3F3X A;  3R6S A;  5ICC A;  1B2R A;  1R1T A;  2A3S A;  4FWT A;  1MGT A;  3D5L A;  4FHT A;  4L9V A;  1KQ9 A;  3CC2 I;  1JA0 A;  4OPW A;  1SD6 A;  9ANT A;  2WR8 A;  3B90 A;  4RB3 C;  3GTK J;  1MW7 A;  2QM3 A;  2OBS A;  1X19 A;  3AAF A;  2BYV E;  2IBD A;  5CDF A;  3RKY A;  4WXH A;  1A6Q A;  3Q5F A;  2O17 A;  2OF7 A;  3CUO A;  1TWA J;  2QQ8 A;  4WCG A;  4WK8 F;  4II3 A;  1M1E B;  5EG0 B;  1JHF A;  1UB9 A;  1X58 A;  3OYK A;  4H9G A;  1ON1 A;  2DFF A;  4CCJ A;  1IDJ A;  2V9V A;  1KMH A;  3B4N A;  4RAF A;  3G6E I;  1DDN A;  1SD7 A;  3ABT A;  3HPH A;  5FIU A;  3JX8 A;  4M2L A;  3KRG A;  1YE9 A;  3TH0 A;  1YI2 I;  2R7D A;  1TC3 C;  1YG2 A;  1G3Y A;  1KON A;  3CCM I;  3UW0 A;  2P6S A;  5IT3 A;  5F4M A;  5IT9 Z;  3BTJ A;  2XRO A;  3QAH A;  3F22 A;  3QYF A;  2BHZ A;  3B02 A;  1B9M A;  3WU2 C;  3G05 A;  4G1V A;  5F4J A;  3PSS A;  1S6L A;  2LDU A;  5LGU A;  2DW4 A;  4RGU A;  2XF5 A;  4XLC A;  2EK5 A;  4DBQ A;  4DBR A;  3JSO A;  2A05 A;  3OEH A;  1QO0 D;  4YRV A;  4RD4 A;  4L9T A;  5DV5 A;  1PJ5 A;  2KZG A;  1WSU A;  4XM3 A;  3JCU C;  3N4M A;  1YYV A;  2ZB9 A;  5A88 A;  2R5Y A;  2VQG A;  1PUF B;  1IN4 A;  3I55 B;  5DSZ A;  2O6W A;  5DM7 F;  2O7O A;  2DY1 A;  5EEG A;  2L7F P;  3CCY A;  1N05 A;  5ICG A;  3ABU A;  4TN1 A;  3V8K A;  3SLN A;  2VPR A;  2DA6 A;  3KLN A;  4OIO F;  2F4N A;  1UCR A;  5DCF A;  1ON2 A;  5TJJ A;  2G0E A;  4ENN A;  5E6T A;  4U0Y A;  2COM A;  1WRJ A;  4IO9 F;  4XOR A;  3K2A A;  5F0H A;  2QYU A;  2KJC A;  2CUJ A;  2VXD A;  2LKS A;  5E3L A;  3HKZ N;  1JKP C;  3IHU A;  4B3A A;  2O61 A;  1G7R A;  1VBL A;  1L1I A;  2PMZ A;  3WTS C;  3FM5 A;  2E2J J;  2PLF A;  2ZSH B;  4I98 B;  4YAL A;  2FSW A;  2UZK A;  2EFG A;  4Z06 A;  4C3H J;  2J7K A;  2V7X A;  4XBF A;  4Z6Y A;  5B1B H;  1VQK I;  1EXM A;  1JNY A;  1RI7 A;  4OOX A;  3COA C;  4UV8 A;  2ZBV A;  4M9S A;  4A3M J;  3KEY A;  1B8I A;  3LA7 A;  1A31 A;  5IK2 A;  5ERI A;  3BJ6 A;  1T6Z A;  2L4A A;  1MJB A;  2YX7 A;  3CLQ A;  3WGI A;  2ZBK A;  3G6E B;  4GXO A;  1HG8 A;  3KIO A;  2DFH A;  3M1E A;  4FIS A;  2GLO A;  3HOV J;  3Q39 A;  2UXN A;  5D5W B;  1FX7 A;  3ZMV A;  3WYA A;  1LFU P;  2XRN A;  3FF5 A;  1VQ4 B;  4PJM A;  3I53 A;  1KRH A;  2XZP A;  4MYU A;  4ASN A;  3GTG J;  3RPU D;  1OCT C;  1O8D A;  1LB2 A;  3SYT A;  2H09 A;  2ID6 A;  2DOD A;  2EFN A;  2JA2 A;  2HQ5 A;  4A3F J;  2JRM A;  1K9M D;  2FF4 A;  3PA2 A;  1YJ9 B;  3J7A Y;  1I5Z A;  2KIS A;  5FL7 A;  3FXQ A;  2XSJ C;  4K2E A;  5FKL A;  5L3C A;  3OYJ A;  4XKW A;  2ZJR F;  3CCU I;  4WF2 A;  1IDK A;  3LQE A;  2DCE A;  3BR2 A;  2NS0 A;  4ESJ A;  2EIL H;  2ACJ A;  2E1R A;  3JRF A;  3CME B;  3D5R C;  2WZP P;  5JLX A;  4YFK F;  2QXZ A;  2VFM A;  3BZ6 A;  2W48 A;  4YDT A;  4M3F A;  4M6V A;  3LSI A;  1FOW A;  1FZP B;  4KT6 A;  2QGU A;  1UFM A;  2XHK A;  3GFI A;  1J59 A;  3DDY A;  3BQZ A;  4HW0 A;  1E3X A;  5J40 A;  4HNU A;  3ULQ B;  3W5H A;  2NS8 A;  2XB5 A;  4CYC B;  3S3O A;  1V5V A;  3BLY A;  2C2W A;  2G9W A;  2PQ8 A;  5JMC B;  1I6H J;  4U7D A;  5FRN A;  1VQ7 B;  4TMW A;  3QFC A;  3KP7 A;  4GCV A;  1D2E A;  3R4K A;  3IH3 A;  1YIJ B;  1X1B A;  1Q9S A;  1EP2 B;  2B9S A;  4CCN A;  4IQJ A;  3DKY A;  3S2H J;  1EA3 A;  1WJB A;  2NV4 A;  1M90 D;  1AIR A;  3CMA B;  2R0Q C;  1NDH A;  2J8I A;  2M30 A;  3X2Q H;  1G7C A;  2JPB A;  2F5V A;  4LIU A;  2WV0 A;  5EGO B;  3T1B A;  1KC8 D;  4LG3 A;  2EFQ A;  3QQA A;  2QA4 I;  4JYK A;  4CCM A;  4CCO A;  2PN6 A;  4MEY F;  1DG1 G;  2ME6 A;  3KYC B;  4F3Q A;  2C4T A;  4QV2 A;  2K9N A;  4BXX J;  2BSP A;  1E2X A;  1UJ8 A;  2FBK A;  1FNN A;  1S3J A;  4QVJ A;  3DTI A;  2KFD A;  1CQT A;  1GUU A;  1MBG A;  2K9S A;  4V2F A;  4BDZ A;  1IN6 A;  2V1U A;  2BY1 A;  2I10 A;  2V9K A;  2XDV A;  3C2G A;  5LLQ A;  1LM1 A;  2F5C A;  2QUF A;  3TP0 A;  3C3W A;  1O3T A;  4XN0 A;  5FLX Z;  5E17 F;  1EKE A;  1Q86 D;  4ZCM A;  4F7Z A;  3CF5 F;  3QPL A;  2UV1 A;  2OCC H;  2X48 A;  3U21 A;  3IAM 2;  2R7Q A;  3RQ4 A;  1MH4 A;  4UXN A;  2M4K A;  2NVT J;  1BN8 A;  2P5V A;  2BW3 B;  3H5R A;  4LK1 F;  1VQM I;  3S8P A;  2L9N A;  4HEA 2;  1UG2 A;  1JUP A;  2BY0 A;  2XND A;  2NOG A;  3MWM A;  4XLN F;  1FRQ A;  4N3N A;  4BJT A;  2ELH A;  1YHQ B;  3TGN A;  1X3Z B;  1I27 A;  5J1U A;  2V7W A;  3VPR A;  4HLY A;  1BW6 A;  3OL3 A;  4HQM A;  3ECO A;  2F5F A;  4DW6 A;  2AQE A;  3CCE I;  4PJJ A;  4W1U A;  3Q0U A;  3ZCO A;  4EVI A;  3CW2 A;  4L8J A;  1VQ5 B;  1WOR A;  1I3A A;  1B72 B;  3IL2 A;  3CP8 A;  3I4M J;  1R58 A;  2Q2E B;  3BG3 A;  2FVG A;  5IP6 A;  1VQO B;  2JDI A;  2QWW A;  1HST A;  3BPX A;  4QPO A;  1BN5 A;  2XKP A;  4HOB A;  2XAF A;  2JK3 A;  4ZJZ A;  1XSD A;  3J81 Z;  4G12 A;  3LJY A;  2GK7 A;  2OQG A;  2QBY A;  2ZJQ F;  4KIF A;  3SEJ A;  2VE8 A;  3FWE A;  4OP7 A;  1T8I A;  1RNL A;  2MD0 A;  3GVA A;  4OJO A;  1KU7 A;  1TWG J;  1D5Y A;  2LZJ A;  2E34 A;  3HBL A;  2PLY A;  4I76 A;  4JX5 A;  1BOB A;  4KNY A;  3D26 A;  5J8C A;  1F60 A;  2V7U A;  5FA6 A;  3WTY C;  1VHE A;  4PC3 A;  3WXM A;  4JRA C;  3HSF A;  4Q4Z F;  1AKH B;  3LAJ A;  4E7K A;  5F1R A;  2K7L A;  4IHW A;  2NT6 A;  4XKV A;  1K6O A;  3T8R A;  2X6W A;  1X1C A;  1WP6 A;  2X53 S;  5AMV A;  2KPM A;  4EJV A;  3HRT A;  4OMY A;  1P9Q C;  1RU4 A;  1XE1 A;  2HI3 A;  1O7F A;  3M1C A;  3BH6 B;  1B6A A;  4ESF A;  4UZE A;  4KH3 A;  5CVJ A;  1WSV A;  3DFG A;  2F4I A;  3BR1 A;  1Z1D A;  1QH0 A; 
#chains in the Genus database with same CATH homology
 2VQL A;  3GQ9 A;  1O8K A;  2X1D A;  1OGO X;  4B47 A;  4G6T B;  4NC8 A;  3GVJ A;  4GRI A;  2KLO A;  3K70 D;  1BPL A;  2L5Q A;  2ZTN A;  3T9G A;  3OYD A;  4XON A;  5LD2 C;  2IQ7 A;  3DPU A;  4BE1 A;  3BC9 A;  4HIZ A;  2KMU A;  2R7W A;  2VKH A;  1NG7 A;  4KIS A;  4MR0 A;  1NBM A;  3EUH C;  2OV7 A;  4CCK A;  2WBM A;  1Y56 A;  1BR2 A;  3EUK L;  1N75 A;  4W8R A;  2F6C A;  3VSV A;  2K3P A;  4BJ5 C;  3K4K A;  2X85 A;  3HG9 A;  3L2Q A;  1D0Y A;  3SDB A;  2V26 A;  2WSS A;  4DK0 A;  1VJS A;  2NST A;  3KX2 A;  2Z8G A;  1WJA A;  4FET A;  1EE6 A;  2GK6 A;  2QKM B;  5HVQ C;  4XLH A;  1DP3 A;  3GBG A;  2HPM A;  4DGW B;  1DBO A;  2HVQ A;  5CPR B;  4DOZ A;  4AU7 A;  2AQF A;  4I84 A;  3OYI A;  2ZFU A;  2E5Z A;  3OS0 A;  3GQA A;  1OFL A;  1UG0 A;  2V31 A;  4FAS D;  3MKY B;  3HOT A;  3OOC A;  2X6Y A;  3CZ6 A;  3TL4 X;  2F1M A;  1WJE A;  3OYH A;  4TSF A;  4G6I A;  5FRM A;  5C1C A;  4PK4 A;  3DPT A;  1EFR A;  4NC7 A;  3BCD A;  4YZA A;  3B8Y A;  1PJR A;  2QY1 A;  3F9K A;  4OWR B;  1I8D A;  4ASU A;  3WQZ A;  3EPZ A;  1NRK A;  3ZPN A;  4F91 B;  2NOJ B;  3VDX A;  3OYB A;  1CZF A;  2NTB A;  3AKZ A;  1W9X A;  4LIV A;  1ERD A;  2V6E A;  2F43 A;  1E3Z A;  1SAU A;  3VYU B;  1DBG A;  1PE9 A;  2M7B A;  3K4L A;  3W2A A;  1X1D A;  4N4N B;  4N4O B;  4TT3 A;  3SZG A;  4DNT B;  2DXI A;  3ZXS A;  4EAT A;  2IGO A;  1OB0 A;  1UD4 A;  1JRG A;  4XKB A;  2VJ4 A;  4XKC A;  2VBK A;  2ODL A;  4JQF A;  3VMW A;  3MD2 A;  4C2T A;  5KHD A;  4XN3 A;  1MMN A;  1E1R A;  2NTP A;  2K9L A;  3OL4 A;  2HPI A;  1VF7 A;  4HNT A;  4BUP A;  1O8M A;  4F52 A;  1OR7 C;  4Y33 A;  2R7O A;  3A4C A;  2JIZ A;  4OJ6 A;  2LRD A;  3K6G A;  1YX3 A;  3D5S C;  3OIP A;  1SFK A;  3C2H A;  3RTR A;  2R7T A;  2DIE A;  4P22 A;  1MND A;  1O8I A;  2A6T A;  4KKS A;  4ZYA A;  3OE7 A;  3DLA A;  2NZM A;  4F92 B;  2CW7 A;  4AYB A;  3GVK A;  2XF7 A;  4II2 A;  3VWB A;  2R7X A;  1S9H A;  2ZXH A;  3TBI A;  5C1E A;  3LL7 A;  4HPQ A;  1LFP A;  2XOK A;  4NK8 A;  3PNY A;  4PFP A;  4B3X A;  5KCM A;  4U87 A;  4F55 A;  4TKO B;  1NHC A;  1X4P A;  1WJF A;  3OS1 A;  4IZZ A;  2FUG 2;  1OHH A;  3LSG A;  4G7X A;  3H5A A;  3DTK A;  1O8J A;  1O8F A;  1D1A A;  2UWM A;  2VJJ A;  1TZL A;  2CW8 A;  2WY7 Q;  3GQ7 A;  2UVF A;  3VYS B;  2D3L A;  4RM3 A;  3A3B A;  4YZX A;  1IRX A;  4W8Q A;  1E0E A;  3ZIA A;  4RLF A;  2K9M A;  1V5G A;  2X6X A;  1J09 A;  2X51 A;  4B44 A;  1Z3Y A;  4ZDP A;  1QU3 A;  1KCC A;  3HL2 A;  4Z03 A;  2M3A A;  4HG2 A;  1RMG A;  2WB1 A;  2XAU A;  3GQB A;  3RCO A;  5HNH A;  4OAZ A;  2LG4 A;  4LIT A;  1QCX A;  3CF2 A;  2ZSI B;  4OZZ A;  3T51 B;  4BQQ A;  1MMD A;  3CP2 A;  2VQC A;  5HKK A;  4E4H A;  3AFH A;  2BVL A;  4CH7 A;  1K28 D;  4Z1M A;  4BJ6 C;  1UAA A;  2KL4 A;  1GQ8 A;  4Y3O A;  3V42 A;  4W8T A;  1MMG A;  2CS3 A;  5HLT A;  4EW9 A;  3HC7 A;  1LVK A;  1WMR A;  2VQH A;  1RWR A;  4P1W A;  4ITV A;  2WAD A;  2VXZ A;  3LMW A;  1KCD A;  3OWT A;  4B3F X;  3OYA A;  4U4B A;  2LYC A;  3CES A;  2CMP A;  3PSI A;  3HKZ A;  1WTH D;  2R4G A;  2WY8 Q;  4B48 A;  2XZO A;  3OEE A;  5HNF A;  1U0J A;  4ZC3 A;  1HA8 A;  2JVG A;  2E1M C;  4NK6 A;  3BCA A;  3FPP A;  4BXF A;  2EWE A;  3G2B A;  3OYN A;  1OLT A;  5JHF A;  3MMY B;  2LRE A;  2ZZE A;  4Z05 A;  3NWT A;  1HVX A;  2A5W A;  3FDY A;  2O1D A;  2XF6 A;  2P0W A;  2VAS A;  4E7S A;  4ZTF A;  3I9V 2;  3T53 B;  1PXZ A;  3OYL A;  4G7W A;  3H5N A;  4E7Z A;  2ZZG A;  3L2V A;  3H0D A;  2UVE A;  1O88 A;  5CQG A;  3QYE A;  3ZR8 X;  4IKF A;  1UD5 A;  4W8S A;  1WFX A;  3I3L A;  2ELJ A;  3FKJ A;  2R7U A;  3LSK A;  1E1Q A;  4KIT B;  3M8J A;  1PKV A;  2QE7 A;  2O04 A;  2W82 A;  2W6J A;  2GJR A;  1FMV A;  1D1B A;  2O5R A;  1BR1 A;  1X1A A;  3DQV C;  3OMY A;  4X0G A;  3HOS A;  2W6I A;  1WJ5 A;  2E5N A;  4KKU A;  4NQW B;  4D9J A;  4XLE A;  3UR3 C;  1JI8 A;  2W7N A;  4ZTJ A;  4H4K C;  3W3C A;  3BG6 A;  2PEC A;  2RNG A;  1BHE A;  1IB4 A;  3OYF A;  2ZZQ A;  3FBI B;  2CV1 A;  1OGM X;  3OY9 A;  3A1Y A;  3BG7 A;  3H9G A;  1G8X A;  3SEQ A;  4HRI A;  3KEW A;  4OJ5 A;  2JJ2 A;  2MC4 A;  3PFY A;  2V7Q A;  1COW A;  3K4M A;  3DU6 A;  3W2W A;  1T5E A;  4ANJ A;  3A2K A;  1UD3 A;  3D5L A;  1BLI A;  5LFA A;  1K6Y A;  3B90 A;  2Z16 A;  1MNE A;  2LH9 A;  1MW7 A;  2KRH A;  2VKD A;  4RMN A;  1X19 A;  3HXL A;  3H9J A;  2Y0S A;  3OS2 A;  1T0F C;  4PJL A;  3UNG C;  3FBN B;  2IS4 A;  4ZDO A;  5CDF A;  1BMF A;  4XD7 A;  4C2L A;  2INV A;  3OYE A;  2GJP A;  1UD6 A;  2O17 A;  2W4S A;  3GVL A;  4II3 A;  1KTW A;  2QKL B;  3LMM A;  3OYK A;  1MAB A;  4DNR B;  1R6R A;  4YEL A;  4CCJ A;  2BOL A;  4BGD A;  3L2W A;  1KMH A;  1X4O A;  2L7K A;  2WAQ A;  1IDJ A;  3B4N A;  1UD2 A;  3HPH A;  4DJA A;  3KRG A;  2KQR A;  4E7L A;  1YE9 A;  3IAS 2;  2Q1Z B;  3OOU A;  1KON A;  3PL8 A;  4XLA A;  1W36 D;  3UW0 A;  4HWV A;  4ZDL A;  2VL8 A;  1DQU A;  2E60 A;  2DT6 A;  4IQ4 A;  3QYF A;  3G05 A;  3SUC A;  4YZQ A;  3DTE A;  3ZSC A;  2R7V A;  2Z6B D;  1XG2 A;  1D1C A;  2MYS A;  2XF5 A;  4NUB A;  4XLC A;  4DBR A;  2X1E A;  4DBQ A;  2R7S A;  1BR4 A;  1GLN A;  3RSN A;  4PFO A;  4YRV A;  2VJ5 A;  2LY1 A;  4E7H A;  1E43 A;  3OEH A;  1X0C A;  4XM3 A;  3NE5 B;  2NSP A;  4E7J A;  3LSM A;  3TMO A;  4BDY A;  1E79 A;  3AL0 C;  1H80 A;  2VJI A;  3S32 A;  2VQG A;  3OW7 A;  1Z21 A;  2GOM A;  3OYC A;  2NTQ A;  2KP6 A;  1G59 A;  4KJZ A;  2V7F A;  2CV2 A;  3EQO A;  4PSW A;  2LY2 A;  2W1O A;  2K5C A;  2L2O A;  4BE2 A;  2X8K A;  1Z3X A;  4HST A;  2XGJ A;  2RRE A;  2V4J C;  2O0V A;  4BQO A;  2KVO A;  5TGT A;  1IA5 A;  4XMY A;  4XOR A;  3KYL A;  3FKS A;  3LFU A;  1I18 A;  3E0J B;  1MMA A;  2O0W A;  2CUJ A;  2VXD A;  4OJL A;  3LSH A;  4DIQ A;  2LBF A;  4CCL A;  3FHN A;  2XC7 A;  1QHH D;  2HVS A;  1KZL A;  1VBL A;  2PMZ A;  3IP4 B;  4MXN A;  2M4G A;  2ZSH B;  3PJR A;  1D0Z A;  1Z7L A;  4XR6 A;  4F93 B;  1H8E A;  4Z06 A;  3VMV A;  4BL0 B;  4CUG A;  1TT0 A;  3K4J A;  3PUB A;  3BCF A;  3KEY A;  4MLO A;  4YEJ A;  1V0F A;  3MKZ A;  2CFO A;  5IK2 A;  3PNT A;  1PLU A;  2LC2 A;  2CK3 A;  4P5O A;  4C30 A;  3OYM A;  1HG8 A;  2V1N A;  3S3N A;  2IS2 A;  1QJV A;  4E6K G;  3WWG A;  1YX5 A;  4U49 A;  2VBE A;  2M0M A;  3VSU A;  4PJM A;  2LBF B;  4NNJ A;  2XZP A;  3A35 A;  3L2U A;  3RPU D;  2IXS A;  1O8D A;  2IGK A;  1DGR M;  3SYT A;  1VZ0 A;  4PSX A;  2PYG A;  4RLQ A;  4PMH A;  2JA2 A;  2VIX A;  1HZE A;  3DEE A;  2IGM A;  1H8H A;  3J7A Y;  5FL7 A;  2W00 A;  2JUG A;  2XSJ C;  2WJV A;  3OYJ A;  4XKW A;  3QOE A;  1IDK A;  2Z2S B;  3QYB A;  3CMM A;  2DCE A;  5DN6 A;  1Y6I A;  3VSK A;  2L9S A;  3K4B A;  5HOO A;  3D5R C;  2DOA A;  2V4D A;  2WJY A;  2WZP P;  2QXZ A;  1FMW A;  4OZY A;  2HDW A;  3NWS A;  3LSI A;  3VYR B;  3L2R A;  4OJP A;  4KT6 A;  2ZTG A;  2KZV A;  4R79 A;  3DDY A;  2HU9 A;  5FRO A;  1E3X A;  3BH4 A;  4HNU A;  2CV0 A;  3S3O A;  3BLY A;  2CH0 A;  5FRN A;  4UZU A;  2Z1D A;  3FY3 A;  1DGW Y;  3OR1 C;  4BE0 A;  2KRC A;  2R9V A;  3PSF A;  3W2V A;  1X1B A;  4J00 A;  2INU A;  1UEL B;  4CCN A;  4IQJ A;  3DKY A;  4CSW A;  2VBM A;  1EA3 A;  1WJB A;  1AIR A;  4B3G A;  3T56 B;  4URR A;  3DPL C;  4J01 A;  3SEZ A;  2F5V A;  3DU5 A;  1SKY B;  4LIU A;  2M5S A;  2XZL A;  4JMQ A;  2JSP A;  2BW3 A;  4AVZ A;  4LG3 A;  4BQN A;  2IS1 A;  2WAE A;  1ZEL A;  1OOC A;  3ONQ A;  1FX0 A;  4CCM A;  4CCO A;  2ZXI A;  4B43 A;  4F3Q A;  4C9Y A;  2UUZ A;  3K70 C;  4FXU A;  4XNF A;  1W0K A;  3K4C A;  4HSR A;  1JTA A;  3GRH A;  4RM2 A;  2HVR A;  3GQ8 A;  3DTI A;  2RQQ A;  1O8L A;  3K10 A;  1N78 A;  2OC6 A;  3H9Q A;  4BDZ A;  2JJ1 A;  1NG6 A;  3S3M A;  2V9K A;  2XDV A;  1LDK B;  4BAC A;  3C2G A;  2D3N A;  3ZQQ A;  4XL9 A;  2HLD A;  3OR2 C;  5CKT A;  3DKX A;  2GOX B;  4XN0 A;  4CZC A;  2PJR A;  2CUZ A;  1UD8 A;  3A3G A;  1LKX A;  3AL0 B;  2UV1 A;  2WAF A;  3U21 A;  3IAM 2;  2R7Q A;  3RQ4 A;  3JU4 A;  2M4K A;  1D0X A;  4JOM A;  2X1C A;  1BN8 A;  3ZPP A;  2BW3 B;  3H5R A;  5CQE A;  3JUR A;  3HPG A;  3S8P A;  2L9N A;  3OAA A;  4HEA 2;  2XND A;  3PNV A;  3ZGK A;  1O8E A;  2VB6 A;  4BJT A;  3OYG A;  4DK1 A;  1K5C A;  4Y4R A;  1PYV A;  2BSP A;  3OFN A;  2IGN A;  2HZD A;  3N05 A;  1WPC A;  3IUO A;  3OL3 A;  2JVH A;  2AQE A;  2VLA A;  4XOP A;  1WJD A;  1WJC A;  3E1S A;  4PJJ A;  3ZCO A;  4YXW A;  2E1B A;  4L8J A;  4D1Q A;  3DWL E;  2NT9 A;  1AA7 A;  2DJI A;  3CP8 A;  2PJR B;  1V5F A;  2Q2E B;  3OPO A;  2JDI A;  3BC8 A;  2ZZF A;  4QPO A;  2QX3 A;  2WPD A;  1VLY A;  4ZJZ A;  2GJK A;  4BEH A;  3K4N A;  2VPL A;  4KKT A;  3VR6 A;  4XLF A;  2M7A A;  4QPQ A;  3VSL A;  2GK7 A;  4XQF A;  2KDO A;  3QOD A;  3EUA A;  3ZRG A;  1QHG A;  3EQN A;  2IS6 A;  4PUS A;  2I8D A;  2MD0 A;  4OJO A;  2HQA A;  2MFZ A;  2BVM A;  3H35 A;  1V0E A;  2LZJ A;  2KHM A;  3S93 A;  3LNN A;  4BU2 A;  4CA0 A;  3HAG A;  1BOB A;  1V5E A;  1T95 A;  4OAY A;  4IX7 A;  4PJN A;  4YZ0 A;  4C2U A;  1O8H A;  3OIQ A;  3CJR B;  1OFM A;  2R7R A;  1O8G A;  4E7K A;  4E0F A;  2NT6 A;  4XKV A;  4E7I A;  2E1M B;  3VYT B;  2X6W A;  1X1C A;  4U7B A;  5KNL A;  1WP6 A;  4BEH B;  2X53 S;  1N77 A;  5AMV A;  3CJQ B;  2KPM A;  1W0J A;  2WA0 A;  3MKW B;  1P9Q C;  1RU4 A;  4XOT A;  2MAB A;  4BS9 A;  2PYH A;  2DT7 B;  2X3H A;  2LOO A;  3HUG B;  3M1C A;  3VST A;  3H94 A;  2OUM A;  2HNH A;  1W36 C;  2F4I A;  4GQN A;  3BCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...