4AVZA

Tailspike protein mutant e372q of e. coli bacteriophage hk620
Total Genus 226
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
226
sequence length
598
structure length
598
Chain Sequence
DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
molecule keywords TAIL SPIKE PROTEIN
total genus 226
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4avzA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4avzA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4avzA02
5C1CA 2X6WA 4OJOA 3VSVA 1O8FA 2NZMA 2EWEA 4OZZA 2X85A 4YELA 4NK6A 4YZQA 4OJ5A 4HWVA 2X6XA 2NTPA 4W8SA 4YZXA 2O17A 3KRGA 2QX3A 4C2LA 2VBMA 4XKVA 3EQOA 1IDKA 1QCXA 1DBOA 2X6YA 3GQAA 3ZPPA 1BHEA 2VJIA 1HG8A 2VBKA 1H80A 4OJLA 2PECA 1JTAA 1QJVA 2NTBA 2NSPA 4XR6A 2VBEA 2NTQA 2PYHA 2BSPA 4W8TA 3WWGA 1K5CA 3GRHA 2Z8GA 1KCDA 4Z06A 3ZSCA 1O8KA 1OGMX 4XLFA 1O8DA 3VSUA 2INUA 1JRGA 1CZFA 4MR0A 4W8RA 3B8YA 3VSTA 3B4NA 4OZYA 4XOTA 2QY1A 2VJJA 1KCCA 2UVEA 4YZ0A 2O0WA 4XLHA 3VMVA 2O1DA 3GQ7A 4XL9A 2X3HA 1PLUA 2O0VA 4YZAA 4OJ6A 2UVFA 1PXZA 1XG2A 4YEJA 4Z03A 4XN3A 4XQFA 1O8HA 1RMGA 2O04A 4XOPA 3UW0A 1NHCA 1DBGA 3LMWA 4XLAA 4URRA 3GQ8A 2NT6A 1IA5A 1RWRA 2QXZA 4XM3A 1AIRA 1X0CA 3T9GA 1O8EA 1OFLA 4NK8A 4Z05A 2NT9A 2NSTA 4W8QA 3SUCA 4I84A 1O88A 1OOCA 4XORA 1OGOX 2PYGA 1O8JA 3JURA 4MXNA 4XKWA 1GQ8A 1VBLA 1BN8A 1O8MA 3B90A 3VMWA 4XMYA 1IDJA 1RU4A 4XONA 4U49A 3EQNA 3FY3A 4XLCA 1OFMA 4U4BA 5C1EA 4AVZA 3GQ9A 4XLEA 1O8IA 2INVA 4XN0A 2ODLA 1PE9A 4OJPA 4XNFA 4EW9A 1O8LA 1KTWA 1IB4A 1WMRA 1EE6A 5AMVA 2IQ7A 4PMHA 1O8GA
chains in the Genus database with same CATH superfamily
2P6TA 1VQ9I 2IA0A 5EG0A 1M90D 5FLMJ 1VQLB 3IH4A 1Z3YA 4M9SA 3GSIA 4NB5A 2XGXA 2NV4A 2Q6KA 4J00A 3BH4A 2Y69H 2ZTNA 1S72I 4ENNA 1BR1A 2V79A 4KDPA 3I4NJ 5CVIA 4DBQA 3GBGA 3WU1B 1CF7A 1IG7A 5L3EA 3AGQA 2L3DA 2L9RA 3F8CA 3RKWA 3L1PA 3TEDA 2R3SA 2HR3A 4P12A 3W5UA 4M4SA 4UUSA 4ZC3A 4TMWA 4WXHA 4M9XA 4ZCLA 1OJLA 1U78A 2QF7A 1ULYA 1UMQA 3ZQ7A 3ZMUA 3BCDA 3DLAA 3Q38A 2DQRA 5DCMA 2C77A 3CCQB 1QVUA 3I53A 4EATA 4A3BJ 4MNUA 5D4SA 1E43A 1YW9A 5DV5A 5ICEA 2E5ZA 3OOPA 1EWYA 1XSDA 1BX1A 3BZKA 3TO9A 3RZDJ 1X2MA 3DPUA 3EDPA 3OYLA 1AWCA 1LDDA 4OPVA 2RQPA 2JJ1A 1G3YA 4M6VA 1VQPI 4Z6YA 1ITYA 1Y39A 2V1UA 3MWMA 1XX5A 1O3TA 5JHUA 5HLHA 2E7XA 2V7VA 3KPHA 3A0HC 2LKXA 1WCMJ 3K4BA 4EQQA 4OP7A 3HKZA 4OIPF 1WSVA 1FSEA 4UUTA 2WZNA 3AKZA 2ZKZA 2HVSA 4B43A 4ZGNB 1IN8A 4OPWA 1FYLA 4OOXA 2VFNA 4FWTA 3QFRA 1E0EA 3HSFA 3BCAA 2FX0A 1QGAA 2W85A 4HE6A 1RKWA 4G9YA 5FFZA 1W2BB 2IS4A 2KDZA 3OL3A 2LLKA 4XN3A 4XQFA 3W2EA 2W6IA 2XRNA 1RZ4A 4N4NB 1KD1D 3I71A 3MD2A 3T53B 4BDZA 2DXIA 3DU6A 4L9NA 2GLOA 1R58A 2STWA 3W2FA 1O8EA 5EYRA 2GXAA 2GOXB 3EUKL 1T33A 4D5FA 3DQVC 4FHTA 5FD5A 4C2UA 3ASOH 3PNVA 3M1CA 4C0SA 2GQFA 3RPUA 3OYNA 5FO5A 2OU2A 1QG0A 3JURA 3V76A 3BY6A 1Z21A 3WBJA 3N05A 3WGIA 3G2BA 3SY2A 4DGWB 5AIPA 1ODDA 1J9ZA 3N97A 4XLCA 4DZPA 1WFXA 2VKVA 1ZM2A 2BMWA 1TWGJ 1Y0NA 2V1XA 2Z16A 4ROXA 3WHCA 2INVA 4L18B 5GAHJ 1U5TA 3JAMZ 2JA7J 2XTWA 1XGNA 1WJFA 2M9HA 4M9ZA 2KZGA 2VNJA 2GA2A 2D2WA 1TTYA 3A8JA 3RKQA 2GJKA 2A05A 1ELOA 3LAJA 2A5YB 3HPGA 4LBVA 2EINH 2P4WA 4I02A 5BSYA 1G3WA 5FKOA 2BVNA 4XRSG 2NPFA 1SMTA 1G7RA 2X85A 4YELA 4BXFA 4YHBA 1JUMA 3D26A 1ZK8A 3IH2A 3NQOA 1FYMA 5IP6A 4BPRA 2YR2A 4DYRA 1J2XA 2LYCA 2XUBA 3MFKA 4KA4A 1I3QJ 3CCUB 1GJRA 2Q8KA 2FNAA 2BM0A 2DDAA 3WG7H 4I0AA 3MKYB 1ENHA 1X1BA 1IDKA 2O03A 3DKYA 2MC3A 3OYIA 2X6YA 1W36D 3S16J 4FXUA 4YCQA 4OJLA 1HOMA 1BOAA 1PUEE 2E2HJ 3DEUA 3H5NA 3G71I 1ZH5A 2ZITA 5CJ9A 1ZLJA 1V3FA 3CMAI 4IVNA 3ABLH 1L1IA 2UUZA 1T0FA 2FD5A 2Y75A 3TKYA 4L8JA 1DGRM 4B3FX 1Y0RA 5AIQA 2NVXJ 1BQEA 2M30A 3HOZJ 1O8KA 4UUSB 4KNYA 4KIBA 2JN9A 5HS8A 3H94A 2BGJA 4MLOA 3JRIA 2DOFA 1PYVA 2G9WA 3OWTA 2JRMA 2F5EA 3D0SA 4DNCA 2QYUA 2C6YA 3KEYA 2P0WA 4X7EA 4O5VA 4ESJA 1ACIA 3JAMK 4HA8A 4M3DA 1CF7B 4GXOA 3H36A 3A3BA 2O61A 2E1MC 2UVEA 3RDIA 2QQBA 1D1BA 3BWGA 1SFXA 4UVBA 5K5RA 3E5XA 4A3FJ 1K78A 1GVDA 3HGYA 3V8LA 1CQTA 4RGSA 1VFCA 4OJ6A 1BI3A 3X2QH 3IRQA 3OAAA 2MC4A 4BJ6C 1HKTA 4YALA 1V5EA 3OYCA 5FO0A 3LQEA 1K73D 1NB9A 2QA4B 1X1CA 1YJWB 4G8XA 3WTYC 1TYXA 1T98A 2J7KA 1GVJA 1EV7A 5BS6A 3L2VA 2B7EA 4IHTA 5D5VB 3OW7A 2YU9J 4AC0A 2CW5A 2DCEA 3H9QA 1N8RD 4E7ZA 1YRNB 1IN4A 5ILSA 3VNVA 2CUEA 2DTRA 3H3ZA 2VQLA 2R7VA 3O3KA 1ZGWA 4MXNA 1FBSA 2NAZA 3ZR8X 1V54H 3B90A 4AD9A 2QEXI 3KYCB 1I6XA 4M1KA 3J81Z 4OIQF 3CLOA 2FBIA 5F4MA 2EPFA 3SQVA 2O8KA 3B82A 1W5CC 2KKOA 4PJJA 4AVZA 4WF2A 1DG1G 3RQ4A 3K1MA 1AIPA 2ZZQA 3K0LA 3HTSB 2LBFA 1GT0C 2B7BA 5FNZA 3U6KA 1Y1VJ 3BY1A 1UAAA 2K4JA 1VI0A 5JHFA 3SEZA 1FOXA 1WJCA 4IW3B 4UVCA 3N6ZA 2DA3A 2CW0F 2P3MA 3QP6A 4WQMA 2LSOA 2BYVE 2JA6J 3ASQA 2R5ZA 2RAEA 2R7SA 4EM0B 3RYPA 4LBWA 1W1WE 3AG4H 2VC1A 3K4MA 3LSHA 3TQNA 4U7DA 3CP8A 1UHMA 1EFCA 1XB4A 1P2FA 2AXTC 2GBYA 4G7ZF 2BVLA 3OYDA 4A3KJ 1O7FA 2K02A 2EFWA 4AIHA 5F0CA 2P5KA 3ABKH 1YHQB 3KZZA 1K4SA 1UELB 1U5TB 3W2IA 2QLZA 2M4KA 4EM1A 2GK6A 5CVJA 3CQZJ 2JT1A 3HSRA 2NVUB 2QX3A 4C2LA 4R71A 5CKTA 1N05A 2HOEA 1SFKA 2B63J 2BHZA 5KAIC 3EYIA 1QCXA 2XF7A 5E3LA 3WGHA 5IY5H 2X0KA 3H0GJ 1S3JA 5J1YA 1R1VA 1OGIA 3Q9VA 1MJBA 2G0YA 2J5PA 4X6AJ 1B6AA 3K7AJ 3GYHX 4BYYA 1OKRA 1LNWA 2HPMA 3A01A 4P22A 4PC2A 1FX0A 3W2VA 2LC2A 2PFBA 1TNTA 4ASNA 1OFEA 2IW5A 4WXDA 1EJ9A 1TT0A 4UAJA 1ONVA 4XLFA 3VPRA 4Z4RA 1O8DA 3CJRB 4PSWA 2HGCA 3KP7A 5C44J 4V02C 3WYAA 2EFPA 4HAMA 2VBUA 1HCRA 1CZFA 4DQKA 2DOEA 5AN9A 2JK3A 3HRSA 4GFBA 4JOMA 4BHCA 2PJPA 2CS3A 2K9MA 4IEJA 1Z67A 4A3EJ 5KHDA 5HKKA 3UR3C 3BROA 2A61A 3L2UA 1OCZH 3AL0B 3ECOA 3ZMVA 3EPZA 1YJ9B 4X1EA 3KEWA 2DFIA 1GV2A 1VQ8I 3L09A 2V4DA 2ZZEA 4UZFA 1OYYA 4CSWA 4GQNA 4P3YA 4A3DJ 2E5NA 1PLUA 2O0VA 1V5GA 2LY2A 4MFDA 3NAUA 1FT9A 2OF7A 3V7SA 4PGGA 1XB2A 2WR8A 1ETXA 4QPQA 2VJ4A 4Z03A 1GAWA 2CH0A 5B1BH 1QFYA 3FXUA 2BBYA 2L9NA 2UZKA 3CCSB 1R6RA 1FY7A 4G7WA 3B8HA 5EZGA 1Q1VA 1TW3A 1MJAA 2OZUA 5K5QA 3BR1A 3JTGA 5IYQA 2NT6A 4F93B 5J6XA 1RC9A 1AIRA 3EUHC 1W36C 5FA6A 5H20A 1SAXA 5FLVA 1D8TA 3JRGA 2A6HF 2QQAA 2DYSH 4RJLA 4CGZA 3K2AA 3O8GA 2QBYA 5IOYA 4P6VF 3CO7C 2BM6A 3TBIA 5BMZA 4Q47A 2K4BA 3CMMA 2LZJA 3PIPF 1U8BA 3HOXJ 3CC4I 3SZTA 1IDJA 3WE3A 3K4NA 1STZA 1YFHA 1G59A 2PX9A 3ONQA 2P5VA 1EP3B 3ZXSA 2Y9YA 1UG0A 1BIAA 2KHMA 2QVOA 2EV5A 3GVLA 1VNDA 4OOVA 1RETA 1YQAA 4TMZA 4YFXF 4L5IA 1FEXA 5CVUA 4IHWA 2H6BA 2W6JA 2BSAA 3V8JA 2RREA 3HUGA 2WAQN 2XROA 1VQKI 3GTGJ 3ASRA 2BE5F 3U1KA 5KAFC 3OSFA 3TP3A 4CZCA 3W2HA 4N3NA 4QIWN 1VQLI 1EH6A 2L4AA 3W2GA 3SJZA 1KGSA 2XSJC 3VSVA 2ZZGA 3OPOA 2EV0A 3HZJA 3CO6C 1KC8D 3ZBUA 4RM3A 2ME6A 4TSFA 2VFQA 4YIRX 1JJ2B 2LVSA 2Z2SB 1J9IA 5F04A 4DYQA 1TBXA 5FGMA 1Y56A 4PFPA 2XB5A 3CC2I 2V9KA 5JVTA 3LA2A 3WG9A 1JJ6C 1XE1A 3ASTA 1XSVA 2RVCA 3EETA 4HW0A 3JQRA 3LAPA 1I39A 4I2OA 4Z4VA 2VKHA 3TW6A 1LKXA 3Q3SA 1XCBA 2Q2EA 5FD6A 5M3MJ 4ZCMA 3GTLJ 2ZBUA 5J1UA 5E1WA 5E3MA 2C4TA 2QN6A 2LF7A 2JUCA 4BUPA 1RRJA 1VHOA 2D74A 3BG6A 3CXCB 4QVJA 3DPLC 3HAGA 1KMHA 2OA4A 2EZIA 2WY8Q 3FMQA 2XSDC 1I50J 3VNUA 3K4LA 3S2WA 4F3QA 1QVGB 1LEAA 3JQPA 1BN5A 1QHHD 2XPUA 1S7AA 2DMNA 1ZHFA 1XN7A 1G6NA 1ZGAA 3ZMZA 2BX6A 1PUFB 2NYXA 1UFMA 1KYZA 2EFQA 3ESWB 1YIJI 1FPQA 3S17J 3BCBA 2BPOA 5HS7A 1R00A 3PQKA 4RB0A 1K28D 3KX2A 2ZBVA 1JUPA 3LA7A 3C2GA 5GV8A 3TDUC 2V1NA 3OW2B 1SFOJ 1BJKA 2XNJA 2F1LA 1Q9SA 1X3WB 2R5YA 3LVBA 3QFCA 2Q2EB 1PP7U 4A3CJ 4OWRB 2LMDA 4XICA 5L3BA 2I10A 1ETYA 5E1ZB 1YTYA 4A3GJ 3LMWA 4HX4A 4XLAA 1LFUP 1EA3A 1MH4A 3WTVC 1F4KA 1E1QA 2XASA 3LNNA 4RPDA 3BQJA 2W00A 1FOKA 1E2XA 3IAS2 2V6EA 1FRNA 2LNBA 4AVPA 2BVMA 4XLPF 3IL2A 3M8EA 1O88A 2FOKA 3P9IA 4Y7CA 3CMYA 4YAFA 5LGTA 4A3JJ 1CQXA 2WJVA 3G05A 4D9JA 4A3MJ 1H9TA 3G71B 3PO2J 2L4MA 3FK7A 2GXGA 3KP6A 3CC7I 1R23A 1W7PA 1TWCJ 1B9NA 2RKHA 4FE7A 4U49A 2O0WA 2ZMEB 3ZZUA 3QFTA 2IGMA 2LKPA 1IXRC 4V19K 2GXBA 4L9JA 1A35A 3BR6A 1VQNB 1TNSA 4XN0A 2ZJPF 2QQ9A 5A2QK 2JA2A 3GVJA 5FO1A 4L9TA 1T56A 2XGCA 2O9LA 4RMNA 4M3GA 4DNTB 3OYGA 1FLIA 4Y33A 1UHWA 3F6VA 4RBOA 1AHDP 4DOZA 4WK8F 3CCMI 4HLYA 4UB8C 3KP2A 2PMZA 4PUSA 1WWXA 3GVAA 1S7OA 1QZZA 4CDGA 3NARA 2OZ6A 4BE1A 4IHYA 4DK0A 1J75A 2ID6A 4BBRJ 2WPDA 3CD6B 2MA3A 2X6XA 1OPCA 1F36A 4IOAF 2OTLB 1A8PA 3FKIJ 4ZTJA 3CCEB 2XZLA 2F48A 5F0HA 3P4GA 2GPJA 1IUFA 2YS9A 4RM0A 1PKVA 2B0RA 3I59A 3NE5B 1H80A 2V7QA 2DW4A 4XKCA 2XAGA 3SHFA 2F5VA 2VBEA 2ZZFA 3KYDB 2BGCA 1ETKA 1H0MA 3NWTA 1EF4A 2Z9OA 1X58A 3L2CA 2MLGA 3E3VA 2K9SA 4BHBA 3CMEI 1IC8A 3GRHA 1DQUA 1GUUA 2BY1A 3P9KA 2E36A 2WV1A 4MIMA 3ERED 1R1UA 1H85A 2HLDA 3PA2A 5BPDA 4EM2A 1TLLA 1LJ9A 1OGMX 1G2HA 3OIPA 1QNTA 1DU0A 3MVPA 3GTKJ 2XZOA 1ZYRF 3KP4A 3QE2A 2X9DA 4MHGA 4MR0A 3H1CA 3HOVJ 3GQBA 2DTZA 1JJ8C 2WB1N 3J80Z 1E3XA 3PJRA 3A4CA 2EZLA 2IA2A 4HV5A 3SZPA 4BY1J 4KKUA 4RLZA 1I18A 1QVTA 3EYYA 4HSTA 3MKLA 2VYQA 3M3YJ 3K2ZA 3RCOA 3ZRGA 1H8AC 2K40A 3OFNA 5FROA 1A31A 4QTRA 3GTJJ 5TY0A 4C3JJ 1WGXA 4HNUA 3AG1H 5L3FA 2E1CA 1WH7A 1U0JA 2HNHA 3RYRA 3OS2A 2JQ7A 1WQ2A 1G3TA 1VF9A 2R93J 3OYEA 2CO5A 2HTJA 4Z4UA 3A1PA 2QENA 3FM3A 3E7LA 3JU4A 3HOYJ 5TJJA 2E60A 2OCEA 3C2BA 3GW2A 3PFIA 5KVRA 3TOBA 3VSLA 4RD2A 1TT5B 1H42A 2EIJH 1I1SA 3LJYA 3SLDA 3G6EB 4Z1MA 2NXNB 3ZUGA 3L00A 3W2AA 3PETA 3PVDA 2CG4A 5GP9A 2Y48A 2HPIA 4PC1A 2NT9A 4W8QA 3M07A 2PBIA 3QYEA 1TC3C 3G73A 3PENA 1IRXA 3E6MA 4I84A 5KSWB 1WI9A 2M3AA 4IZZA 4E7LA 5LGUA 5HZAA 1IDYA 1H89C 1T38A 2J8IA 2XAHA 1YLOA 3ZQFA 1XG1A 1D1NA 2Y31A 5JLVC 3L2WA 2ZB9A 1YS6A 3HM5A 3DTIA 2MH9A 4ZYHA 3I0TA 3Q0UA 1HKQA 2IP2A 1Z05A 2D1HA 3GZ6A 1VJSA 3WNBA 2PJRB 2M7AA 1Z6TA 2DETA 2RC4A 1O8LA 5EZHA 2OAZA 4NBQA 4A93J 1E62A 2PLFA 2IQ7A 4HOBA 2L0KA 2KL4A 5D6EA 2EIXA 4PMHA 1SMYF 3B6AA 3VWBA 1W0JA 2LP0A 3C3WA 2PEXA 2X3UA 4II3A 3CCRI 5K7FA 3MMYB 1JHHA 3FPKA 4P55A 3IRRA 4QUZA 4A6EA 1FNNA 1KRHA 4M74A 1K8FA 2W4SA 4GYIA 4HQEA 4YZQA 4ACBA 5HNFA 2M1BA 1F9NA 1MGTA 2W24A 3DF8A 4TMXA 2JA8J 2NTPA 2DT6A 4S05A 4YZXA 2VJ5A 3ZQGA 3KRGA 3DBRB 2VBMA 4MYTA 4B09A 2M34A 1ON1A 2E1MB 2Z1DA 2B9SA 2DJNA 3CUQB 2WJYA 3GQAA 2FEZA 1MKMA 3N90A 1R36A 2QYOA 4UHTA 5J3OA 4ENJA 3LQQA 4FTHA 1N08A 1BI1A 5EMNA 3WNCA 2PECA 2A69F 3DBHB 2COMA 3HIFA 2V7FA 4RB1A 4ZYDA 3RKXA 1GAQA 4KICA 2K86A 3BNWA 1OB5A 3GF2A 4U0VA 3KL9A 2XGEA 1P7JA 3KEOA 3ZQQA 1N78A 1S8NA 1DDGA 4GO1A 2HKOA 2V7XA 1IB0A 1J0RA 2M5WA 4Q48A 4IXAA 4Y13A 1RUOA 3JCUC 1YJ9I 2ZTGA 3GX4X 1UMKA 2HVQA 3V7RA 3VSUA 2VOPA 2MLKA 1UD2A 1MZBA 3RIQA 3K69A 1SD4A 2WY7Q 4FASD 1YITI 2RNJA 1RI7A 4J0QA 3E1SA 2V26A 4MEXF 4KISA 1Z91A 1S6LA 5IT3A 2QA4I 2Y0MA 2QBYB 1YG2A 2DYRH 2MSYA 1Y1WJ 2GK7A 4DJAA 4N0BA 2ACJA 1G7TA 4ITVA 4XLHA 5CPRB 3CC4B 1VQMB 2QGUA 3KIOA 4MGRA 2O1DA 1JKOC 2A68F 2DMUA 3P9CA 3WHBA 1HXDA 4H4KC 4DW6A 4IHXA 3BCFA 3T51B 4Z4WA 1QVFB 1WH5A 4WZEA 2CMPA 3BC9A 2L54A 4PABA 3MCAA 1ZM4A 1WI3A 3ASNH 2W7ZA 4BBSJ 5E1XA 3F8FA 5BQTA 2BV3A 3T8RA 1WTHD 2BM4A 1NDHA 3ONYA 4BY7J 2K3FA 2OJED 3BP8A 4JYKA 2OC6A 3I55I 3CCEI 1EH8A 4HE5A 1FTTA 1B9MA 3GTMJ 3AL0C 4X06A 4XM3A 1TYVA 1X0CA 1IA5A 4AF7A 3RIRA 1LEBA 4Y9UA 1UD6A 2TCTA 4Z05A 2OQGA 2KMUA 1APLC 2WTEA 2EILH 4CYCB 2VN2A 2XT2A 3BR2A 4XRFA 2CF4A 4CQJA 3WU0A 1LM1A 4ENMA 4I99C 1O3RA 3BQZA 3GFMA 2H8RA 1FNCA 1GQ8A 3P5JA 2XV4S 5IP7J 3CCMB 1O8MA 3H3VK 2DT7B 2DMPA 1QGYA 4G12A 1SFUA 1Z3XA 5IK2A 3TP0A 4QLCU 3K70C 3TL4X 2VBSA 3G6EI 5FRNA 2GJRA 1KK2A 1GXQA 2XF6A 3CC2B 3CCUI 4OMYA 5DTDA 1MNDA 3JRBA 1X3UA 5HLIA 3F21A 1EXMA 5LEKA 4JX4A 3F8NA 1U2WA 3JTHA 1O8GA 1X1AA 3TOAA 1H9GA 5GAEJ 1ZM3A 3HG9A 3CW2A 2HQ5A 4RCZA 1D0YA 4XRSA 1ZG3A 3KLNA 1RQRA 3IC7A 1R5NA 4PC3A 1YRNA 2DA1A 3A35A 4NBSA 4NK6A 5D8LB 1JTYA 2FA5A 2OK7A 2A6EF 2YPRA 2GJPA 2EH3A 2OBSA 2BEOA 4M3EA 3CCVI 5FJ8J 5KCMA 4IKFA 1NRKA 2Q1ZB 2M45A 2M2EA 3H5AA 4HPQA 3KZIC 2E34A 2IEKA 1NK2P 1LUJB 2V31A 3E20A 5TR9A 3W2WA 3I55B 4DQ2A 2CV1A 3IWZA 1Q82D 3H35A 3ZQHA 2WAQA 2LK2A 4C43A 1BHEA 2N8GA 3CCVB 1QJVA 3FJOA 2H1LA 2IA1A 3MZYA 2HOSA 2AS5F 2EJRA 5TISC 4F92B 5H59A 3HL2A 3MN2A 2NTQA 2KDOA 2PI0A 2V7TA 4M6YA 4RLQA 3CMAB 2PYHA 2GIZA 1IHMA 3OIOA 3G1OA 4D1QA 1OFCX 3CCJI 2VLAA 4Z06A 2JN6A 5C3EJ 1K8AD 3VYTB 1XSXA 3PUMA 3CUQA 3BH6B 3L2QA 1U9OA 1R5BA 1IAWA 2XAUA 4L0YB 4IF4A 1DARA 2ECCA 1O7LA 4E7JA 4PK4A 5E3OA 1KONA 2R5YB 2CFXA 2K3PA 1MJ9A 2Z99A 2JMWA 1XPXA 3V7AA 3AVXA 2QY1A 3AG2H 2Q6IA 1ZN2A 2QSHX 1WP6A 4LLLA 5ILVA 1VLOA 3CC7B 3DU1X 2DA7A 3A02A 1N0UA 1X1DA 3F0CA 3JRDA 3QOPA 2J5OA 2H94A 1NG7A 4OINF 5HVQC 1BW5A 1VQ6B 4IRHA 3OL4A 1UD5A 3HJEA 1G7CA 3BG5A 5TGTA 3V8KA 4HQMA 3VOEA 5D5UB 1OQYA 2OBPA 4P96A 5J3LA 2FXAA 2Y0SN 4LB6B 1P6RA 4FE4A 4FX0A 4BGDA 2KJCA 2X48A 1OCOH 4C3IJ 5DSZA 3UW0A 5KNLA 1ZM9A 1NHCA 1ON2A 3GQ8A 4X05A 1D5YA 2R7FA 4U7BA 4BQAA 3DTKA 1RWRA 3LQ6A 2R7DA 3ABUA 1UCRA 3FMRA 3W3CA 5LGNA 3ZIAA 3U1DA 3SJMA 3BQYA 1Z7UA 2V1DA 2IJLA 3EUAA 4S04A 1SEUA 2DA6A 3IH3A 5BOXA 1JGGA 4G5GA 4H9GA 4W1UA 2FSWA 1WSUA 1VQ7B 1IRZA 4YEIA 2CUFA 4OPOA 1VQ4B 1W5SA 5LHGA 1FNBA 1RQPA 5E6TA 3JQQA 1VBLA 3QAHA 2XOKA 3WE2A 4BACA 2JPBA 2YWGA 3V42A 4JX5A 3D1NI 1DUXC 5IYCJ 4KH3A 5C1EA 2DAOA 2NVTJ 2QM3A 1UD8A 5M3FJ 4WZTA 1XCVA 2DOAA 4BDYA 1O8IA 2W82A 2WAEA 2OYNA 5GPCA 2ODLA 1WJAA 1BMFA 3NWSA 3K6GA 3VFZA 3BJOA 4I98B 4XNFA 5DYMA 2KRCA 1Q7YD 4LK1F 5DS9A 1MDMB 4P6YA 5LFAA 1IB4A 1QZYA 2JTVA 3HXLA 4JQFA 5F27A 1POGA 2HZTA 3TO7A 2DLLA 4YIIA 4AIDA 2O6WA 3LWFA 5HS9A 1AA7A 2F4OB 3Q5FA 1O8FA 3NRVA 2BM5A 3I54A 2EWEA 1Y8RB 2IS2A 3BTIA 2OV7A 2E19A 4KKTA 3S1RJ 5DEQA 4EJUA 4I0BA 4GCVA 1YE9A 4BEHA 4MTDA 3H92A 2BGIA 3PUBA 2HDNB 3F3XA 3HYIA 3DU5A 2M4GA 2XGDA 3DCFA 3GWZA 4YFKF 2FQ4A 5DS0A 2H09A 1SAUA 1EKEA 4YG2F 1IJEA 1QO0D 5F6FA 2VBYA 2JJ7A 2I1LA 1JTAA 1XD7A 4WX9A 2QKMB 1JKQC 2NTBA 5TV2A 2VQCA 3ERMA 4U88A 5CVVA 5IYNA 1T39A 2F43A 1WVRA 4XRMA 1SFEA 3KLOA 4G6QA 3O2PE 4E7KA 3QQAA 4A0ZA 2CRVA 2L9VA 4ESBA 3SYJA 3GCMA 3PL8A 2CW7A 1HSJA 1SVLA 3OS1A 2OTJI 1ZARA 1ZGJA 2HZDA 1EFTA 3BTLA 4CCOA 1YYVA 1JGSA 3GZNB 4BXXJ 1D8KA 3BTJA 2HYFA 3BG7A 1VTNC 2KFDA 2BHYA 2ELJA 3FXKA 4V2FA 1VQPB 3B8YA 4G1VA 1GR1A 2VASA 4KN4X 1R22A 1X19A 4ZH4F 1P4MA 3OZWA 4BEHB 4OZYA 4M6XA 2DBBA 4QPOA 1K78B 1N25A 4IJAA 3I3LA 1GHCA 4P3IA 4R1HA 5IP9J 2MD5A 4AWXB 4U0YA 1G8XA 2LY1A 4YAUA 3QYBA 1B72A 1V0FA 4Y17A 2ZFWA 3WTSC 3HHGA 4NQWB 1HSTA 3RSNA 3CZ6A 4B4CA 2PMZN 3M1EA 1WDTA 4DYCA 5LBQA 3S1MJ 3ZGKA 1HC8A 1U2RA 5FRMA 3JW4A 1FP1D 1XG2A 2VKDA 2ZO4A 3OYKA 2KRFA 2HS5A 4LK0F 1BPLA 4M53A 1O8HA 3B73A 1MMSA 3GVKA 2BXYA 4F55A 2QE7A 3A0BC 4R79A 1N07A 3ISXA 3BLYA 4CYDA 1KQ8A 1JB9A 2R7OA 3AGPA 1BJAA 3OR2C 5B3SH 4M72A 2OUMA 3M8JA 1ERDA 2HDDA 3SUCA 2LH9A 1F43A 3N4MA 1G4DA 3FKSA 2PLYA 1JTXA 3IAM2 1WU8A 3OR1C 1XMKA 1ZRDA 1O8JA 5F64A 2EK5A 3FDYA 3JSOA 3ZPNA 4ZCIA 2VFMA 4RGXA 2M7BA 1YIOA 4HX7A 2ZL7A 3AVWA 4EJTA 1FTZA 1LDKB 5AONA 3OV8A 2LRDA 3COAC 4XBFA 1S9HA 1YLFA 2IGNA 3KE2A 3FXRA 4RA2A 1IRFA 3FHZA 2PQ8A 3H3UA 4Y7NJ 3KP5A 2GWRA 4BJTA 3G1LA 3ZC3A 2KPMA 1KYWA 2ZJQF 4QHYA 4JX6A 1EE6A 3A1YA 3R61A 5K1YA 1UD4A 4UV8A 3Q9SA 4OOSA 4U0WA 3CCJB 2VXDA 4MQVA 3CCRB 1KQSB 1XC5A 2KIQA 4P9UA 2IS6A 2E71A 4Z4YA 5CDFA 3ZPLA 3H0DA 5C1CA 4OZZA 1BIBA 2EZHA 2TDXA 1NTCA 3FHNA 4TN1A 5GV7A 4ABZA 1VQKB 4Z2YA 4CCMA 2NOGA 2PE3A 2DERA 3ABTA 1LQ1A 4LGWA 1R4MB 1QGZA 4Z4ZA 1SANA 2PMDA 5EGOB 3WY9A 2M8EA 2VE9A 4M71A 1USTA 3CP2A 3MCZA 2IAIA 1DBOA 1B8IA 2GQQA 2QWWA 2GREA 5IYWA 5EJCA 4KFCA 2EA4A 1U6GA 2XB0X 2XVCA 2UXNA 2M5SA 2OD5A 3P26A 3KEQA 5ICCA 2DDBA 3HTUA 4RD6A 4G6IA 2F3LA 3BR5A 4RAGA 4KYWA 2ECBA 2ELHA 2DYIA 2ZJ2A 3FXOA 1OMIA 3HRMA 3OJWA 3A01B 3R6SA 3JRFA 5EEGA 5F08A 5A2QZ 1TL8A 1KQ0A 1CGPA 5HLGA 1DDIA 1FNMA 2CBXA 3DTEA 1JRGA 2CUJA 3FM5A 3PQJA 2MFZA 2QSGX 2K9LA 1QX4A 3LL7A 4FN5A 3B6CA 1BA5A 4HRIA 1YJNB 4IOCF 2ZNZA 4LIUA 4X7CA 4PFOA 3PSSA 3REOA 1PJ7A 3DBLB 2DA5A 2MW8A 4YXWA 5KW9A 5DNSA 5FLXK 1ZELA 3C18A 2CNDA 1QA2A 1HF2A 3KETA 5IYPA 1F5TA 3R6KA 2ZCWA 1SVMA 3H9JA 2JSCA 2ZSIB 3R4KA 4RAZA 3ZMSA 3MZHA 5BPIA 1PXZA 1MW7A 1WPKA 5J4YA 2VZLA 3LOCA 3I9V2 4LD5A 4BL0B 3OIQA 1K6OA 3W5VA 3CCLB 3MQ0A 1H88C 3V7CA 2HDCA 5GAGJ 4Y4RA 4IRIA 1DBGA 2FNPA 4GGGA 1FBUA 2QMUA 1UHSA 3F72A 4X0GA 3OYMA 1IV6A 3CB4A 3ZMTA 4WWVA 2XF5A 2CC2A 1D3YA 3CESA 4OAZA 3SQNA 3LSRA 1T5EA 4DK1A 1WJBA 3E5QA 1YOVB 3T1BA 3BR3A 3C2HA 2L7FP 4QVAA 3GFJA 3LYCA 1BX0A 3GTOJ 3VMWA 1A6IA 1BI0A 2VKEA 5JR3A 1ZAOA 1CNFA 4C30A 1GV5A 2G0EA 2MABA 3K10A 3QWLA 4BHPA 2KJBA 2A5WA 2VONA 4G7XA 4LLNA 1P9QC 4ON0A 4P2NA 2VBWA 3BG3A 3GMEA 4LG0A 4OIRF 4B1RA 4BJ5C 3OYBA 2DK5A 3BOQA 2HKXA 4BE0A 2LOOA 2P6SA 3BPXA 2ZL6A 3WQZA 2D9RA 1FRQA 5E18F 1QH0A 4MTEA 1WOPA 2BXZA 1J59A 3RI4A 4WCGA 1FZPB 5LEJA 1FNDA 3F8BA 3CPWB 3GTPJ 4IQJA 2VQGA 3SZEA 4P25A 4BS9A 3I5UA 2VL8A 4A3IJ 4FQGA 4B8XA 3AG3H 2BM7A 2CWEA 1MD0A 5E17F 1VQ4I 5JMCB 3IUOA 4EGYA 3H09A 4OJOA 2XKPA 2M0CA 3RPQA 1EZGA 3I4PA 2P81A 2CQQA 4E0FA 5H2FC 2YSRA 2NS7A 4BU2A 3S15J 2CQKA 5CYVA 3T5XA 3VYSB 3QPTA 3GXOA 4EEFG 4PAAA 1G3SA 1XMXA 2GAUA 4CCNA 3EQOA 3H9GA 2JPCA 4OMZA 3GFIA 5FKLA 1E3PA 3R0AA 2LF8A 4ZDOA 2FOWA 5DD4A 4Y52J 1H8EA 2C5BA 3OYHA 1SC7A 1L0OC 2CUZA 1AKHA 4NNJA 4KIGA 4PGOA 4A0XA 5IT9Z 4QV2A 1S5LC 2LREA 2NNNA 2DY1A 1E17A 2P7VB 4P5OA 3D5LA 4A0YA 1QRCA 2VPLA 4IRGA 1KCDA 1V5FA 1GDTA 5J1RA 1B8IB 5HNHA 1EP1B 3I1FA 1EH7A 5DN6A 5F4OA 1JXSA 3DEEA 3I59B 3GLXA 3WTXC 1XDSA 2XPWA 4ZYGA 1B1BA 4RPBA 2KISA 2VIXA 3QODA 4NC8A 3B4NA 2QKLB 4LMYA 4XOTA 3PM1A 1QU3A 2VT3A 1VQ5I 1QBJA 4E70A 1PVEA 3J81k 1A04A 3C7JA 2DFFA 4ZDPA 3DPTA 5B1AH 2R7UA 1NBMA 1OHHA 4P9SA 1HW5A 2NRAC 5JBQA 3RKYA 2J8KA 5B6IA 1XDUA 2DN0A 1VQ7I 4Q5SF 2HXIA 1SM4A 4DNRB 3G3ZA 3KYLA 3MZ8A 3S14J 4AIKA 4XD7A 1QPMA 2CGPA 4AIJA 3OOUA 3JRHA 2R9VA 3L2RA 2K85A 1HA3A 1Z9CA 2H27A 1HQCA 2MG4A 2WB1A 3OJXA 4WZLA 2QZAA 5K5OA 4URRA 2O0YA 1CNEA 1S0UA 1TSPA 2DQLA 2OTLI 2K5CA 3IV5A 2Z33A 3LMMA 2D1VA 4HX8A 4YAWA 1Q86D 1WHUA 1U8RA 1R5ID 1ZTRA 3Q0VA 5IT9K 2LD5A 1SD5A 1RR8C 2O6GE 3U2RA 1W0TA 1AMOA 1IW7F 4YIFA 2CRGA 3M8FA 4L0ZB 4CCJA 4X7DA 4D7MA 1FIPA 4IPAA 2M8GX 4PGHA 1Y0YA 3DKWA 4RD4A 4LB5A 2ZSHB 3M9AA 5L46A 4PC7A 1PE9A 1Q1HA 3SFZA 1YJWI 1L3LA 5BNGA 3W6KB 1J7KA 4EW9A 3AVTA 4HNTA 1I5ZA 3NEUA 4HV6A 1WMRA 2ZXHA 5EG0B 2LKSA 5CVRA 5B66C 2KP6A 1O4XA 3ZN0A 2VNKA 4X0CA 1TQPA 1QHGA 1TWFJ 4C3HJ 3VODA 2DEUA 2W1OA 3E0JB 3OS0A 4IO9F 1YIJB 3OY9A 2ISZA 4I09A 1WPCA 4A5MA 3WXMA 1FX7A 1T6SA 2TRTA 1I6HJ 1WSRA 5H5JA 2O17A 2VXZA 2L7MP 4B48A 5LMZA 5FL7A 1X2NA 2NNYA 3QSYA 4LIVA 2HDWA 3ZPPA 2VJIA 3CD6I 1JE8A 1TZLA 2KIMA 1ORKA 4GRIA 1BOBA 2HQAA 2M0MA 2WC2A 2PJRA 4XR6A 1YI2B 5FKNA 1N0VC 1OB0A 2BY2A 2WBMA 2X1DA 4G6TB 3OOCA 2EB7A 5J35A 4FT8A 3MHPA 2NS8A 4E7IA 3MKWB 1FDRA 4Z4TA 1K5CA 3PA1A 4LFUA 4KMUX 4UY8I 4KT6A 4RD3A 3W5HA 4QWQA 2AXLA 1X4PA 4LJZF 5C4JJ 3WTWC 1MMAA 2HMAA 2Q6OA 1A36A 2Z6BD 3Q0WA 3CCSI 4A3LJ 5D4RA 4CICA 2V4JC 3L7WA 5IPAA 5JI6A 3CCLI 1WRJA 2QCOA 4GYGA 2P7CB 1I7PA 2QTZA 4YDTA 4RLFA 3S8PA 1KCCA 1YS7A 2DFHA 3OYFA 2EIKH 1UJ8A 2FQ3A 2G7HA 3FZVA 3LSTA 4YZ0A 3FBNB 5FLXZ 4CCLA 1MMNA 2WV0A 5D8KB 2GIVA 1A6QA 2DMTA 4F7DA 3QRFF 2Z3YA 2DJIA 1HLVA 2F4IA 2ZMEA 3ZMDA 4G1BA 3D5SC 4N9IA 1HW2A 2JUGA 1IXCA 2MGQA 1ZG5A 5F0FA 2X1EA 1E64A 3K9TA 2O8XA 3SEJA 4MEYF 1E3OC 4YRVA 1WXRA 5ICGA 3FMSA 4BE2A 2VBTA 2BM1A 2QXZA 4P26A 2YUHA 4B3AA 3T9GA 2BV6A 2MH2A 2XDVA 1VQOI 3LNQA 5J4VA 4CH7A 3OEHA 3CUQC 4D0PA 2WZPP 1RPWA 2IBDA 3BY2A 4Y3OA 4RGRA 1CLWA 1BR2A 2COBA 1IN6A 1IGNA 4PC6A 1FC3A 3IP4B 1FYKA 3OZUA 4OAYA 1K83J 4J19A 4JMQA 4G7HF 3HOTA 4M73A 4XMYA 1VQMI 3TH0A 4XONA 1ETWA 2D5VA 1VQOB 1MSEC 3EQNA 1S29A 3JRCA 4U4BA 1VQ5B 5M5YJ 3SKBA 2F5DA 2XRLA 2ZXJA 4XK4A 4D5CA 4H0EA 4FK8A 3LSGA 4F7ZA 4Q7JB 3HHHA 4LG0B 5EEHA 4L5JA 2XNDA 5LRSA 1EFUA 1RNLA 2KRHA 4A5NA 4CCKA 1AOYA 2XEXA 3I58A 2AQEA 2HXOA 2XPVA 4HZFA 3BZCA 4MQ9F 5D5XB 2XKOA 3GLLA 1U9NA 1BC7C 4ZJZA 3R0JA 1Z0XA 4NC6A 2R7XA 1UB9A 1FOYA 3S2DJ 1X4OA 1BW6A 3P7NA 5D5WB 1NB0A 2QSFX 5B5EC 4PJMA 2E1RA 1VQNI 2LFBA 4RDLA 3HDDA 2MYSA 2VQHA 2CFOA 2A07F 2CV2A 5THXA 1OLTA 4G94A 2VBKA 4HF0A 3HB9A 5DM6F 1BBYA 2B7CA 4KJZA 3ZQIA 3U21A 3WGGA 2VC0A 1BLIA 4PCQA 1I8DA 4RD1A 1M1KD 3S3MA 1GLNA 1E63A 2OK8A 3BH7B 2GOMA 2R7TA 4FCYA 2EWNA 3WTUC 1K4ZA 3GTQJ 2HYGD 2Z8GA 5CQEA 1T95A 3DKXA 3FK6A 4CA0A 9ANTA 2G7UA 3B02A 4ZV4A 1WOOA 2E1BA 2V9PA 1OR7C 2X51A 3ELKA 5H6QA 4EJOA 1LPQA 2LG4A 2XT4A 4C2TA 2Y9ZA 3U2QA 5E8GA 4AC9A 4W8RA 2OPTA 3ISPA 3K4KA 1YJNI 4RDUA 2EBIA 1OFDA 1QA1A 1KTVA 2JIZA 1R5GA 5M5WJ 2HEOA 2R7WA 5EEAA 1O3SA 3DLLF 4AYBA 2VJJA 3CF2A 2X8KA 1XGMA 1K6YA 2RC6A 4ZTFA 1LVKA 1OCRH 2HFHA 1J5YA 3QPLA 4UZEA 2F1MA 4EGZA 2FF4A 1E3HA 1H8HA 5LD2C 1LFPA 3HEFA 1ZR4A 1Z7LA 3VB2A 4IHSA 3KZYA 3HSEA 2DMQA 3UNGC 5GADJ 2JA5J 2BY3A 2KIFA 3FXQA 3K4CA 4UV9A 2CK3A 5F1RA 1Z1DA 1ZKGA 2HU9A 2QTLA 3V4GA 1NK3P 1MSFC 4RB2C 1QZEA 1KU9A 3E6CC 2DPDA 2WWYA 4ZGQB 1JUSA 2D45A 4LC0A 1Q81D 2C78A 1QQ1A 2W84A 4M2LA 4RM2A 4NK8A 2H6CA 2IXSA 1V5VA 3OKXA 2NSTA 1ZR2A 3H5RA 1OOCA 3D5RC 4XORA 1VQ6I 3F6OA 2HTSA 3QPSA 4XKWA 5L3DA 4CO8A 1JA1A 1BN8A 1ZUNB 2X6OA 5HXBA 1K7AA 2KZVA 4I76A 1TYWA 5DUKA 1QA3A 3HC7A 4A2UA 1FMWA 1OFMA 2EQRA 1JA0A 2FU4A 2ELKA 3E6BA 3AVYA 4KT5C 1DPUA 4HDUA 1K61A 1VF7A 1HDDC 2KLOA 1S7EA 3FX3A 3RPUD 4OJPA 2V6CA 3NB2A 1KTWA 2KIUA 1D1CA 1I1GA 3CTAA 4Y15A 2VOOA 2V7UA 4E7SA 5JVGF 4XKBA 4WXCA 2C5HA 2K9QA 2AQFA 4ZDLA 3ROUA 2X6WA 3T8TA 4ENKA 3P27A 1BJZA 3ASPA 1F20A 2DFEA 1MMDA 4RAYA 4K1XA 2V5IA 3BC8A 2Y0SA 3FIWA 4XLNF 2XTYA 3F22A 4LBYA 2C4UA 3HRUA 3FXMA 1OGJA 5HOOA 2ZC2A 3DEWA 5EF6A 2OQRA 1KU3A 1RR7A 1IV8A 4ZYEA 5IYDJ 1EFRA 5D6FA 2O5RA 1K79A 2HQNA 1W7PB 1X1PA 2JVGA 3PO3J 1HG8A 1W9XA 2XNCA 1J09A 3PNTA 2RNGA 2FVGA 3CJTB 3A03A 1B4AA 1R5OA 2QGGA 4YFOA 4OPSA 4TMVA 2F5CA 3E5UA 3ZCOA 1QA6A 2EIMH 1QPIA 1XGSA 2XHKA 1W4MA 1IXSB 4UB6C 4EJWA 1ZG1A 4LG3A 3GEZA 4IX7A 4NDLA 4JP0A 3HOWJ 5JLWA 4A6DA 3A2KA 2R4GA 2BZTA 1HF0A 5F4JA 4RD0A 1K4TA 2XAFA 4LBZA 2VB6A 2L7ZA 2L5QA 3FISA 3JREA 4N9HA 3VO1A 1P92A 4B44A 2RQQA 1PJ5A 2A3SA 1UD3A 1MBEA 2YUSA 4NUBA 3B78A 2V7WA 5J40A 5FKKA 3HGGA 2W7NA 4HF1A 4PZJA 1QUEA 2LY9A 3PNYA 2ZJRF 3CUOA 4ANJA 4YFNF 3QFSA 5CQGA 1HDPA 1FP2A 3KFWX 4TKOB 2YX7A 2O7OA 2QEXB 1LLZA 2JWTA 3OYAA 3GQ7A 4XL9A 5EDNA 2F5FA 3CLQA 3ZQLA 1EP2B 1QFJA 1U5TC 2DT5A 3ZZTA 1W0UA 3VMFA 4YZAA 1XMAA 3GZ5A 4DQLA 2X0LA 4HNVA 3S32A 5KK1A 1P7IA 4I6ZA 5A89A 5IYRA 1B23P 4I7HA 4ESFA 2V9VA 2W25A 1YX3A 5GPAA 3GO5A 1VLYA 2H1KA 3MEXA 2VBXA 5E20A 3PSZA 2XZPA 3ML6A 2ID3A 3CJQB 1YW7A 3PUFA 1OFLA 3ZP5A 4Y9RA 4PJNA 1OYIA 2QZ8A 1YX2A 1SD7A 3FWEA 4JRAC 4HIZA 4BH9A 1HVXA 1UG2A 2R92J 2KQRA 2WSSA 2VBVA 3Q6RA 5FIUA 2HCJB 2CSOA 1D0XA 2HQRA 1ETOA 1KZLA 4MFEA 1YI2I 5BSXA 3ML3A 1IRGA 1FBQA 1RU4A 3PSIA 3FY3A 1OCTC 2I5UA 4HF2A 4R8HA 1BM9A 1MDMA 3ZQCA 3GQ9A 5J47A 1ZLKA 2AHQA 2ZBKA 2HYJA 3JR9A 1TWHJ 3E1YE 2VNHA 1E79A 5A88A 3LSJA 2GZWA 3BPVA 3GIRA 4B47A 1V4RA 5HDGA 3VYRB 1BC8C 1IF1A 1KK3A 3ZZ0A 1R4NB 1S72B 1U3EM 3AFHA 2Q6LA 5AMVA 4HDVA 2E1OA 1DDNA 2F2EA 1OYWA 2CQ7A 3I4MJ 3HUGB 3I64A 1HA8A 2L02A 4BQOA 2UV1A 1VQ9B 3FXLA 2NZMA 2DU9A 4DZJA 3TGNA 4DIQA 4KIFA 4ZZDA 3LO8A 4DBRA 4GDFA 2EA2A 2IGKA 4PJLA 3PIOF 1OB2A 5J8FA 2D3NA 3SZGA 3HOUJ 2ADUA 1ZQ3P 3OE7A 3O6BB 4AM3A 4X07A 1YO5C 2RGVA 4XKVA 3HOSA 3VYUB 2XTXA 3K70D 1RKTA 5ILUA 1IUYA 3DWLE 4O6JA 3S93A 1FMVA 2CQNA 1DP7P 3WBKA 3ULQB 1QUFA 2DA2A 2NSPA 5DDGA 2JZYA 1ZREA 1XTAA 3S1QJ 1F60A 3NAWA 3TW7A 2K9NA 2HVRA 4RB3C 3A8KA 4B4DA 1D0ZA 1Y6IA 4J01A 3BG9A 3WWGA 2ZXIA 2CQXA 3DFGA 3FBIB 2ZL5A 2YWHA 3ZSCA 2W57A 4M3BA 1E1RA 4UVAA 2IVMA 4N4OB 4TT3A 1TVCA 2IPQX 4W97A 4NHJA 2LR8A 3HBLA 1SKYB 2INUA 1QGPA 2FUG2 3W6JB 2AHOA 4E6KG 2VBZA 2R5ZB 3VSTA 1LVAA 2JRTA 1I27A 2MBFA 1O57A 2EV6A 2ME0A 5ICFA 2XC7A 2PIAA 4OM9A 1R5HA 4BXUA 4A12A 1KJZA 4HG2A 4A69C 3R6JA 1D1AA 2DI3A 4CZZA 2Y30A 2LBFB 2ISYA 4ZZLA 3I56I 2I8DA 2PN6A 3VMVA 3QPHA 3VEPA 1XFOA 3FXJA 4BNCA 2X3HA 3E6DA 5K7HA 3ZN1A 2X1CA 4L9VA 1D8JA 2ZXWH 2UVFA 2IRFG 3QP5A 4YEJA 4G6DA 1TQIA 4OU0A 3SFIA 3ZOBA 3OEEA 1LE8B 2VPRA 4XSZF 1TW2A 2O04A 3K4JA 5GTIC 1B72B 1K9MD 1JKPC 5E79C 2EZKA 3ABMH 4NQWA 1HBXG 3SJPA 2DPUA 3IWFA 3DDYA 3AAFA 5HDNA 3S3OA 5J8CA 2ZFUA 3QOEA 3W6VA 1V0EA 2Q0OA 1JT6A 4JBAA 4QFMA 4CHUA 1KK1A 4IHVA 2YWEA 5DUIA 4BQNA 2XAJA 4FETA 4E7HA 2H8WA 1JKRC 3RTRA 3BJ6A 2PYGA 4B3GA 2CU7A 5FB2A 3DXJF 3LSMA 3F23A 4LITA 4PJ0C 4ACAA 1WJDA 2HWVA 1VQ8B 4ASUA 1IN5A 3BDDA 1OCPA 2EFNA 3LA3A 1FSHA 1I3AA 1BR4A 2R7QA 1FWZA 4LOCA 2NVQJ 1OCCH 3HPHA 2HI3A 2K27A 4RS8A 3SDGA 1D2EA 2KVOA 1ZRFA 2PMHA 1FOWA 2WYRA 4O3MA 2RN7A 1JHFA 3J7AY 1LE8A 2IS1A 4S0HB 1NHAA 1RUNA 2AO9A 1IJWC 1IDZA 3DP7A 5C4XJ 3JRAA 2CW8A 1KU2A 3J7ZI 2EFGA 1MH3A 1UZCA 1EA0A 4RAFA 4OOIA 3WODF 3J81K 2P5LC 2FRHA 1COWA 3KCCA 5EGOA 3BR0A 2WAFA 1T6ZA 2A6TA 2XAQA 3A8IA 1F1ZA 2IOUG 4IL6C 2B5OA 1W87A 2VFOA 3UKGA 1MBKA 4W8SA 2STTA 2LTPA 2ZNYA 4UNOA 1LFBA 4EH1A 4F52A 1N75A 2VNIA 2R7RA 2ZMEC 2IGOA 2UWMA 2DODA 2XIGA 2FE3A 2F4MB 1IN7A 1WKMA 1OR7A 4I01A 5TRDA 4OIOF 1KK0A 2DK8A 2FJ1A 1TYUA 3WTTC 6PAXA 1JI8A 4U87A 2VODA 1KU7A 3MMPA 1DPRA 2HOAA 3VSKA 3S3NA 1MBHA 2X53S 1N77A 3CRZA 3SXYA 4P9FA 3Q39A 2OCCH 4AF6A 4P1WA 1SKQA 4EVIA 2K7LA 4LLGF 4MYUA 2FX3A 4UZUA 1Z77A 2JSPA 4II2A 5HODA 3AK5A 2FMYA 1X3ZB 2MD0A 1GO2A 1W35A 1B2RA 3H9NA 1RIOH 1S4MA 1LLWA 1NJID 1IO2A 1DGWY 2NOJB 3FPPA 3VO2A 2L9SA 3TO6A 4KKSA 1YITB 1Y0UA 1LDJA 3BZ6A 1T08B 5HLTA 3GFLA 1SD6A 1R1TA 2VUMJ 2OTJB 3OYJA 4JK1X 2Y2ZA 2ETHA 2GA1A 3CF5F 1QQIA 1MMGA 4HYEA 1YW8A 5LLQA 3IHUA 5F1JA 1P4AA 2QQ8A 5L3CA 1R7JA 1AKHB 2L7KA 1G7SA 1KQ5A 3WNDA 2BOLA 1IZ1A 2L01A 3ES9A 4AU7A 1HW1A 4NCNA 4TV7A 1VZ0A 1O3QA 3GUDA 1QFZA 5DCFA 5DD8A 3J80K 4EMSA 1TWAJ 3KP3A 1TUIA 3E97A 4U9UA 5FKMA 1KQ9A 4ETSA 3CJNA 4UXNA 3MAJA 4UUVA 4V2GA 5M5XJ 1W0KA 1FJLA 1REPC 4KMFA 5FFXA 1ZRCA 2NS0A 2BW3B 4CXFA 3F8MA 5LRRA 2VI6A 3LQRA 3G4SI 3OSGA 1PP8F 1SVOA 2X4HA 4N3GA 1TLHB 2VT2A 1IJFA 3BTCA 4B3XA 3AVVA 3CCQI 1GVHA 1D5VA 1OGOX 2W48A 1MABA 1W5TA 3MKZA 1E3ZA 2FMLA 2ESNA 1USSA 4HLXA 1GXPA 4BAYA 4ZYAA 2BF4A 4L5EA 4X7FA 1OISA 3WTZA 3OMYA 3G4SB 4RDJA 2XC1A 2VFPA 3CCYA 1ETVA 1NG6A 1MBGA 2YU3A 3U6BA 5ERIA 1W7PD 3F9KA 2CJJA 2Z5UA 1TQMA 4HSRA 3RJPA 5JLXA 1B59A 1PUFA 1NH3A 3PSFA 4QSHA 1DU6A 2DCUA 5GTHC 2UXXA 4M3FA 4XSXF 3IKTA 1LB2A 3LSIA 1HKSA 4E4HA 2L2OA 3OP1A 4XIDA 1MIJA 3RQIA 2C2WA 2B0LA 1T8IA 3M4OJ 2XGJA 3K1PA 3R60A 4EJVA 3BT9A 4F91B 2CV0A 1DP3A 1DABA 1T6YA 2QUFA 2OBRA 4CYCA 5IOZA 3SDBA 3CDHA 2ICWG 1WOSA 1MRZA 5LHHA 2YX4A 4OJ5A 4YC5A 3K1NA 4HWVA 2M87A 5HDKA 2E1NA 1P4WA 5H6RA 3Q6QA 1WJEA 3OZVA 1P4XA 1PJ6A 1R9TJ 2BY0A 4M0LA 3HRTA 3J7AO 2PMUA 4IQ4A 4PSXA 4KITB 1WZ2A 4RDKA 4RGUA 2KT0A 1R71A 4NC7A 3LFUA 5CLSA 4MO7A 2WADA 2WA0A 2QDXA 3S1NJ 1XS9A 2R7ZJ 1T2KA 2BSPA 4W8TA 3SYTA 3U9GA 4K2EA 4PDKA 2ESHA 3BJAA 2RC5A 2JDIA 1V55H 3LFKA 3T56B 1BL0A 2E2IJ 1WJ5A 3JSPA 4C9YA 4FISA 4Z4SA 3ECHA 3CDIA 1MBJA 5DM7F 2D3LA 4FX4A 2GM4A 3SEQA 3Q3AA 2IT0A 3TMOA 1ETQA 1HZEA 2OBTA 5ED4A 3RY8A 3SLNA 3PFYA 1QRYA 1TTTA 3PUNA 4YAOA 3ZBTA 4HBLA 3A3GA 4X8IA 2JVHA 1JT0A 2PG4A 1YX5A 3CMEB 3IKVA 1PJRA 5A8AA 3WU2C 1Y8QB 1QRBA 4KN7X 2YWFA 2E35A 4G7OF 5L3GA 1RESA 3CDLA 3I56B 2VE8A 3EUHA 3TDZC 3S2HJ 3JX8A 3CPXA 3J7YJ 2LDUA 1T6XA 4BQQA 1RMGA 4XOPA 3FF5A 1TP4A 1T0FC 4CUGA 2CYYA 3O8HA 2DA4A 3T0YA 2RDPA 3EQLF 4TMTA 1PDNC 1KA8A 2EFOA 3HKZN 1C0WA 1Z6RA 1KZHA 4WZKA 1FIAA 1A5JA 3G1MA 3M7GA 3QU6A 4C2MJ 1YHQI 4KUMA 3DV8A 2E7WA 3QU3A 1AU7A 1VHEA 1XQBA 1BI2A 2DIEA 3AVUA 3LSKA 3C1DA 5K7ZA 4WWCA 1JNYA 2P8TA 4BKXA 4D7NA 3RZOJ 3ONUA 3QYFA 1MNMC 2HOTA 5E3NA 1MBFA 2F4NA 3LSPA 5JFRA 1N06A 2RV8A 4AYBN 2BW3A 5IYBJ 2FBKA 5LHIA 2E2JJ 2F6CA 4XLEA 4AUXA 2R6HA 4P1VA 1WORA 2FBHA 1R49A 2NVYJ 2O3FA 3FKJA 5E8IA 3ASSA 5DCMB 2JJ2A 2DO7A 4Q4ZF 4EV0A 1W34A 2R0QC 1M1EB 3L9FA 3VDXA 2BN4A 3VR6A 5HZBA 4RCYA 2DOGA 1MNEA 4HEA2 1XGOA
chains in the Genus database with same CATH topology
2VXDA 4E7SA 4DOZA 4XKBA 2IS6A 2AQFA 4ZDLA 2PMZA 2X6WA 4PUSA 3H0DA 5CDFA 5C1CA 1Z3YA 4OZZA 1MMDA 3BC8A 4J00A 3BH4A 2Y0SA 3FHNA 2ZTNA 1BR1A 4CCMA 4BE1A 4DK0A 2WPDA 2X6XA 5HOOA 4DBQA 3GBGA 1EFRA 4ZTJA 2O5RA 2XZLA 3CP2A 1DBOA 2JVGA 1HG8A 1PKVA 3NE5B 4ZC3A 1H80A 1W9XA 1J09A 2V7QA 4XKCA 3PNTA 2RNGA 2M5SA 2F5VA 2VBEA 3BCDA 3DLAA 2ZZFA 3NWTA 4G6IA 3ZCOA 4EATA 3GRHA 1E43A 4LG3A 4IX7A 1DQUA 3A2KA 2HLDA 2E5ZA 2R4GA 1OGMX 3OIPA 3DTEA 2XZOA 2VB6A 3DPUA 2CUJA 2L5QA 3OYLA 1JRGA 4MR0A 2MFZA 2K9LA 3GQBA 3LL7A 4B44A 2JJ1A 4HRIA 2RQQA 3A4CA 3PJRA 1E3XA 1UD3A 4LIUA 4NUBA 4KKUA 1I18A 4PFOA 4HSTA 2W7NA 3K4BA 3PNYA 3RCOA 4ANJA 4TKOB 4YXWA 5CQGA 3ZRGA 2O0WA 3OFNA 3HKZA 5FROA 3OYAA 3GQ7A 4XL9A 4HNUA 3AKZA 1ZELA 2HVSA 4B43A 4YZAA 1U0JA 2HNHA 3OS2A 3H9JA 1E0EA 2ZSIB 3BCAA 1PXZA 1MW7A 3OYEA 3S32A 3I9V2 4BL0B 3OIQA 2IS4A 3OL3A 4XN3A 4XQFA 2W6IA 3JU4A 2E60A 1YX3A 4Y4RA 1VLYA 1DBGA 4N4NB 3VSLA 2XZPA 3MD2A 3T53B 4BDZA 4X0GA 2DXIA 3DU6A 3OYMA 3CJQB 4Z1MA 1O8EA 1OFLA 2XF5A 3W2AA 2GOXB 3EUKL 4PJNA 3DQVC 2HPIA 3CESA 4OAZA 4C2UA 4DK1A 1T5EA 3PNVA 1WJBA 2NT9A 3M1CA 3QYEA 4HIZA 4I84A 4W8QA 1HVXA 1IRXA 3C2HA 2KQRA 3OYNA 2WSSA 4IZZA 2M3AA 4E7LA 3JURA 1D0XA 1Z21A 1KZLA 3N05A 3VMWA 3G2BA 4DGWB 1RU4A 3PSIA 4C30A 3L2WA 3FY3A 4XLCA 2MABA 1WFXA 3K10A 3DTIA 2A5WA 4G7XA 3GQ9A 1P9QC 4BJ5C 4G7WA 3OYBA 2Z16A 2INVA 4BE0A 2LOOA 1E79A 3WQZA 1VJSA 1WJFA 4B47A 2M7AA 2PJRB 3VYRB 1O8LA 4IQJA 2VQGA 3AFHA 5AMVA 2GJKA 4BS9A 2IQ7A 4PMHA 2VL8A 2KL4A 3HPGA 3VWBA 3HUGB 1W0JA 1HA8A 4BQOA 2UV1A 3IUOA 4OJOA 4II3A 3MMYB 2NZMA 3EQOA 4DIQA 2X85A 4YELA 4BXFA 4DBRA 2IGKA 4PJLA 4E0FA 2W4SA 4BU2A 2LYCA 3SZGA 2D3NA 5HNFA 4YZQA 3VYSB 3OE7A 2NTPA 2DT6A 4YZXA 2VJ5A 3KRGA 3MKYB 2VBMA 4XKVA 4CCNA 3HOSA 3VYUB 1X1BA 1IDKA 2Z1DA 3DKYA 2E1MB 3H9GA 3K70D 2WJYA 3GQAA 3DWLE 2X6YA 3OYIA 1W36D 3S93A 1FMVA 4FXUA 4OJLA 4ZDOA 1H8EA 2PECA 3OYHA 2NSPA 2CUZA 2V7FA 4NNJA 3H5NA 2O0VA 2HVRA 2LREA 1D0ZA 2UUZA 1N78A 1Y6IA 3ZQQA 4J01A 3WWGA 4P5OA 1DGRM 4L8JA 3D5LA 4B3FX 2ZXIA 3FBIB 2VPLA 1KCDA 1V5FA 3ZSCA 1O8KA 2ZTGA 2HVQA 1E1RA 3VSUA 5HNHA 4N4OB 3H94A 4TT3A 2INUA 1UD2A 4MLOA 1SKYB 5DN6A 1PYVA 3OWTA 2WY7Q 3DEEA 4FASD 2FUG2 3E1SA 2V26A 2P0WA 3KEYA 4E6KG 3VSTA 2VIXA 3QODA 4NC8A 2XC7A 4KISA 3B4NA 2QKLB 4XOTA 4HG2A 1QU3A 2GK7A 4DJAA 3A3BA 2UVEA 1D1AA 2E1MC 2LBFB 4ITVA 4XLHA 5CPRB 1D1BA 2I8DA 3VMVA 4ZDPA 3DPTA 2O1DA 3BCFA 2R7UA 4H4KC 1NBMA 1OHHA 3T51B 2X3HA 2X1CA 2CMPA 3BC9A 4OJ6A 2UVFA 4DNRB 3OAAA 2MC4A 4BJ6C 3KYLA 1V5EA 4YEJA 3OEEA 4XD7A 3OYCA 1WTHD 1X1CA 3OOUA 2R9VA 3L2RA 2O04A 2WB1A 3K4JA 3L2VA 4URRA 2OC6A 3DDYA 3S3OA 1IA5A 3OW7A 2ZFUA 2K5CA 3QOEA 2DCEA 3H9QA 4XM3A 3LMMA 3AL0C 1V0EA 4E7ZA 1X0CA 1UD6A 4Z05A 2KMUA 4BQNA 2VQLA 4FETA 4E7HA 2R7VA 3RTRA 2PYGA 4B3GA 3LSMA 4MXNA 1GQ8A 3ZR8X 4LITA 3B90A 1O8MA 1WJDA 2DT7B 4ASUA 4CCJA 1Z3XA 5IK2A 4AVZA 4PJJA 1BR4A 2R7QA 3RQ4A 3K70C 3HPHA 3TL4X 2ZZQA 2LBFA 5FRNA 2GJRA 2ZSHB 2KVOA 2XF6A 1UAAA 1PE9A 5JHFA 3SEZA 1MNDA 1WJCA 3J7AY 2IS1A 4EW9A 4HNTA 1WMRA 2ZXHA 2R7SA 1O8GA 1X1AA 3LSHA 2CW8A 2KP6A 3K4MA 3HG9A 3CP8A 1QHGA 1D0YA 2BVLA 3OYDA 2W1OA 3A35A 1COWA 3E0JB 3OS0A 2WAFA 4NK6A 3OY9A 2A6TA 2GJPA 1UELB 1WPCA 5KCMA 4IKFA 1NRKA 2Q1ZB 2M4KA 2GK6A 4W8SA 3H5AA 2O17A 2VXZA 4HPQA 2QX3A 4B48A 4C2LA 2V31A 4F52A 1N75A 5FL7A 5CKTA 3W2WA 1SFKA 4LIVA 2CV1A 2HDWA 3H35A 2XF7A 2R7RA 1QCXA 3ZPPA 2WAQA 1BHEA 2IGOA 2VJIA 2UWMA 1TZLA 1QJVA 4GRIA 1BOBA 2HQAA 2M0MA 4F92B 2PJRA 4XR6A 4U87A 3HL2A 1JI8A 1PLUA 1OB0A 2NTQA 2KDOA 4G6TB 2WBMA 2X1DA 3VSKA 2HPMA 3OOCA 4P22A 4RLQA 3S3NA 2X53S 1N77A 3W2VA 1FX0A 4E7IA 3MKWB 2PYHA 2LC2A 4D1QA 1K5CA 2VLAA 4P1WA 1TT0A 4Z06A 4KT6A 4XLFA 4UZUA 2JSPA 4II2A 1O8DA 3CJRB 4PSWA 3VYTB 1X4PA 3L2QA 1CZFA 1MMAA 2MD0A 2Z6BD 2XAUA 4JOMA 1DGWY 2CS3A 2K9MA 2NOJB 4E7JA 2L9SA 3FPPA 4PK4A 2V4JC 1KONA 4KKSA 2K3PA 5KHDA 5HKKA 2QY1A 3UR3C 5HLTA 3L2UA 4RLFA 3S8PA 3AL0B 1WP6A 1KCCA 3OYFA 3EPZA 3OYJA 4YZ0A 3KEWA 3FBNB 4CCLA 1MMGA 1MMNA 1X1DA 4CSWA 2V4DA 2ZZEA 4GQNA 1NG7A 2E5NA 5HVQC 2DJIA 2L7KA 1V5GA 2F4IA 2LY2A 3OL4A 1UD5A 2BOLA 3D5SC 5TGTA 2JUGA 4AU7A 1VZ0A 2X1EA 4QPQA 2VJ4A 4Z03A 4BGDA 2CH0A 4YRVA 5KNLA 3UW0A 1NHCA 2L9NA 1R6RA 4BE2A 3GQ8A 4U7BA 2NT6A 3DTKA 4F93B 1RWRA 2QXZA 1AIRA 3T9GA 3EUHC 1W0KA 1W36C 2XDVA 3W3CA 2BW3B 3ZIAA 4CH7A 3OEHA 2WZPP 3EUAA 4B3XA 4Y3OA 1OGOX 1BR2A 3TBIA 1MABA 3IP4B 3MKZA 3CMMA 1E3ZA 2LZJA 4OAYA 4JMQA 1VBLA 4ZYAA 2XOKA 3HOTA 4BACA 4XMYA 1IDJA 4XONA 3OMYA 3K4NA 3EQNA 3V42A 1G59A 1NG6A 5C1EA 4U4BA 3ONQA 1UD8A 3ZXSA 1UG0A 3F9KA 2KHMA 2DOAA 4BDYA 3GVLA 1O8IA 2W82A 2WAEA 4HSRA 2ODLA 1WJAA 3PSFA 1BMFA 3NWSA 3K6GA 3LSGA 2W6JA 3LSIA 4XNFA 2KRCA 4E4HA 2L2OA 2RREA 2XNDA 1IB4A 5LFAA 3HXLA 2KRHA 4JQFA 4CCKA 4CZCA 2XGJA 2AQEA 2CV0A 4F91B 1DP3A 1AA7A 2XSJC 3VSVA 2ZZGA 1O8FA 3OPOA 2EWEA 3SDBA 2IS2A 4RM3A 4ZJZA 4TSFA 2OV7A 2R7XA 4KKTA 1X4OA 2Z2SB 1YE9A 4BEHA 4OJ5A 3PUBA 4HWVA 1Y56A 4PFPA 2V9KA 3DU5A 4PJMA 1WJEA 2M4GA 1SAUA 2MYSA 2VQHA 2CFOA 2CV2A 1OLTA 2VBKA 4IQ4A 4PSXA 4KITB 1JTAA 2VKHA 2QKMB 4KJZA 1LKXA 4NC7A 3LFUA 2NTBA 2VQCA 3U21A 1BLIA 1I8DA 2WADA 3S3MA 1GLNA 2WA0A 2F43A 2GOMA 2R7TA 4BUPA 4E7KA 2BSPA 4W8TA 3SYTA 3BG6A 2Z8GA 3DPLC 1T95A 5CQEA 3PL8A 2CW7A 2WY8Q 3DKXA 4CA0A 1KMHA 3HAGA 3OS1A 2JDIA 2E1BA 2HZDA 3K4LA 3T56B 1OR7C 2X51A 4F3QA 1WJ5A 2LG4A 4CCOA 4C2TA 1QHHD 4C9YA 3BG7A 4W8RA 3K4KA 2ELJA 2D3LA 3B8YA 2JIZA 2VASA 3SEQA 1X19A 3TMOA 2R7WA 1HZEA 4AYBA 4BEHB 4OZYA 2VJJA 3CF2A 3PFYA 4QPOA 2X8KA 1K6YA 4ZTFA 3I3LA 3BCBA 3A3GA 2JVHA 1LVKA 1G8XA 1YX5A 2LY1A 1K28D 1PJRA 3KX2A 2F1MA 1H8HA 5LD2C 3QYBA 1V0FA 1LFPA 3C2GA 1Z7LA 2V1NA 4NQWB 3RSNA 3CZ6A 3UNGC 1XG2A 3ZGKA 2Q2EB 5FRMA 3K4CA 2VKDA 3OYKA 2CK3A 2HU9A 1BPLA 4BQQA 4OWRB 3GVKA 1O8HA 4XOPA 1RMGA 3LMWA 4F55A 4XLAA 2QE7A 1T0FC 4R79A 4CUGA 1EA3A 3BLYA 2R7OA 1E1QA 3OR2C 3LNNA 2W00A 3IAS2 4RM2A 2V6EA 2OUMA 4NK8A 2IXSA 3M8JA 1ERDA 2BVMA 2LH9A 2NSTA 3SUCA 1O88A 3FKSA 3H5RA 1OOCA 3IAM2 3D5RC 3OR1C 4XORA 2DIEA 3LSKA 2WJVA 3G05A 1O8JA 4XKWA 4D9JA 3FDYA 3ZPNA 1BN8A 3QYFA 2M7BA 2KZVA 4U49A 3HC7A 1FMWA 1OFMA 2BW3A 1LDKB 2IGMA 2F6CA 4XLEA 1VF7A 2LRDA 1S9HA 2IGNA 4XN0A 3FKJA 2KLOA 3RPUD 2JA2A 3GVJA 4OJPA 2JJ2A 4BJTA 4DNTB 4RMNA 2KPMA 1KTWA 3OYGA 1EE6A 3A1YA 3VDXA 3VR6A 1UD4A 1D1CA 4Y33A 1MNEA 4HEA2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C1C A;  2X6W A;  4OJO A;  3VSV A;  1O8F A;  2NZM A;  2EWE A;  4OZZ A;  2X85 A;  4YEL A;  4NK6 A;  4YZQ A;  4OJ5 A;  4HWV A;  2X6X A;  2NTP A;  4W8S A;  4YZX A;  2O17 A;  3KRG A;  2QX3 A;  4C2L A;  2VBM A;  4XKV A;  3EQO A;  1IDK A;  1QCX A;  1DBO A;  2X6Y A;  3GQA A;  3ZPP A;  1BHE A;  2VJI A;  1HG8 A;  2VBK A;  1H80 A;  4OJL A;  2PEC A;  1JTA A;  1QJV A;  2NTB A;  2NSP A;  4XR6 A;  2VBE A;  2NTQ A;  2PYH A;  2BSP A;  4W8T A;  3WWG A;  1K5C A;  3GRH A;  2Z8G A;  1KCD A;  4Z06 A;  3ZSC A;  1O8K A;  1OGM X;  4XLF A;  1O8D A;  3VSU A;  2INU A;  1JRG A;  1CZF A;  4MR0 A;  4W8R A;  3B8Y A;  3VST A;  3B4N A;  4OZY A;  4XOT A;  2QY1 A;  2VJJ A;  1KCC A;  2UVE A;  4YZ0 A;  2O0W A;  4XLH A;  3VMV A;  2O1D A;  3GQ7 A;  4XL9 A;  2X3H A;  1PLU A;  2O0V A;  4YZA A;  4OJ6 A;  2UVF A;  1PXZ A;  1XG2 A;  4YEJ A;  4Z03 A;  4XN3 A;  4XQF A;  1O8H A;  1RMG A;  2O04 A;  4XOP A;  3UW0 A;  1NHC A;  1DBG A;  3LMW A;  4XLA A;  4URR A;  3GQ8 A;  2NT6 A;  1IA5 A;  1RWR A;  2QXZ A;  4XM3 A;  1AIR A;  1X0C A;  3T9G A;  1O8E A;  1OFL A;  4NK8 A;  4Z05 A;  2NT9 A;  2NST A;  4W8Q A;  3SUC A;  4I84 A;  1O88 A;  1OOC A;  4XOR A;  1OGO X;  2PYG A;  1O8J A;  3JUR A;  4MXN A;  4XKW A;  1GQ8 A;  1VBL A;  1BN8 A;  1O8M A;  3B90 A;  3VMW A;  4XMY A;  1IDJ A;  1RU4 A;  4XON A;  4U49 A;  3EQN A;  3FY3 A;  4XLC A;  1OFM A;  4U4B A;  5C1E A;  4AVZ A;  3GQ9 A;  4XLE A;  1O8I A;  2INV A;  4XN0 A;  2ODL A;  1PE9 A;  4OJP A;  4XNF A;  4EW9 A;  1O8L A;  1KTW A;  1IB4 A;  1WMR A;  1EE6 A;  5AMV A;  2IQ7 A;  4PMH A;  1O8G A; 
#chains in the Genus database with same CATH topology
 2P6T A;  1VQ9 I;  2IA0 A;  5EG0 A;  1M90 D;  5FLM J;  1VQL B;  3IH4 A;  1Z3Y A;  4M9S A;  3GSI A;  4NB5 A;  2XGX A;  2NV4 A;  2Q6K A;  4J00 A;  3BH4 A;  2Y69 H;  2ZTN A;  1S72 I;  4ENN A;  1BR1 A;  2V79 A;  4KDP A;  3I4N J;  5CVI A;  4DBQ A;  3GBG A;  3WU1 B;  1CF7 A;  1IG7 A;  5L3E A;  3AGQ A;  2L3D A;  2L9R A;  3F8C A;  3RKW A;  3L1P A;  3TED A;  2R3S A;  2HR3 A;  4P12 A;  3W5U A;  4M4S A;  4UUS A;  4ZC3 A;  4TMW A;  4WXH A;  4M9X A;  4ZCL A;  1OJL A;  1U78 A;  2QF7 A;  1ULY A;  1UMQ A;  3ZQ7 A;  3ZMU A;  3BCD A;  3DLA A;  3Q38 A;  2DQR A;  5DCM A;  2C77 A;  3CCQ B;  1QVU A;  3I53 A;  4EAT A;  4A3B J;  4MNU A;  5D4S A;  1E43 A;  1YW9 A;  5DV5 A;  5ICE A;  2E5Z A;  3OOP A;  1EWY A;  1XSD A;  1BX1 A;  3BZK A;  3TO9 A;  3RZD J;  1X2M A;  3DPU A;  3EDP A;  3OYL A;  1AWC A;  1LDD A;  4OPV A;  2RQP A;  2JJ1 A;  1G3Y A;  4M6V A;  1VQP I;  4Z6Y A;  1ITY A;  1Y39 A;  2V1U A;  3MWM A;  1XX5 A;  1O3T A;  5JHU A;  5HLH A;  2E7X A;  2V7V A;  3KPH A;  3A0H C;  2LKX A;  1WCM J;  3K4B A;  4EQQ A;  4OP7 A;  3HKZ A;  4OIP F;  1WSV A;  1FSE A;  4UUT A;  2WZN A;  3AKZ A;  2ZKZ A;  2HVS A;  4B43 A;  4ZGN B;  1IN8 A;  4OPW A;  1FYL A;  4OOX A;  2VFN A;  4FWT A;  3QFR A;  1E0E A;  3HSF A;  3BCA A;  2FX0 A;  1QGA A;  2W85 A;  4HE6 A;  1RKW A;  4G9Y A;  5FFZ A;  1W2B B;  2IS4 A;  2KDZ A;  3OL3 A;  2LLK A;  4XN3 A;  4XQF A;  3W2E A;  2W6I A;  2XRN A;  1RZ4 A;  4N4N B;  1KD1 D;  3I71 A;  3MD2 A;  3T53 B;  4BDZ A;  2DXI A;  3DU6 A;  4L9N A;  2GLO A;  1R58 A;  2STW A;  3W2F A;  1O8E A;  5EYR A;  2GXA A;  2GOX B;  3EUK L;  1T33 A;  4D5F A;  3DQV C;  4FHT A;  5FD5 A;  4C2U A;  3ASO H;  3PNV A;  3M1C A;  4C0S A;  2GQF A;  3RPU A;  3OYN A;  5FO5 A;  2OU2 A;  1QG0 A;  3JUR A;  3V76 A;  3BY6 A;  1Z21 A;  3WBJ A;  3N05 A;  3WGI A;  3G2B A;  3SY2 A;  4DGW B;  5AIP A;  1ODD A;  1J9Z A;  3N97 A;  4XLC A;  4DZP A;  1WFX A;  2VKV A;  1ZM2 A;  2BMW A;  1TWG J;  1Y0N A;  2V1X A;  2Z16 A;  4ROX A;  3WHC A;  2INV A;  4L18 B;  5GAH J;  1U5T A;  3JAM Z;  2JA7 J;  2XTW A;  1XGN A;  1WJF A;  2M9H A;  4M9Z A;  2KZG A;  2VNJ A;  2GA2 A;  2D2W A;  1TTY A;  3A8J A;  3RKQ A;  2GJK A;  2A05 A;  1ELO A;  3LAJ A;  2A5Y B;  3HPG A;  4LBV A;  2EIN H;  2P4W A;  4I02 A;  5BSY A;  1G3W A;  5FKO A;  2BVN A;  4XRS G;  2NPF A;  1SMT A;  1G7R A;  2X85 A;  4YEL A;  4BXF A;  4YHB A;  1JUM A;  3D26 A;  1ZK8 A;  3IH2 A;  3NQO A;  1FYM A;  5IP6 A;  4BPR A;  2YR2 A;  4DYR A;  1J2X A;  2LYC A;  2XUB A;  3MFK A;  4KA4 A;  1I3Q J;  3CCU B;  1GJR A;  2Q8K A;  2FNA A;  2BM0 A;  2DDA A;  3WG7 H;  4I0A A;  3MKY B;  1ENH A;  1X1B A;  1IDK A;  2O03 A;  3DKY A;  2MC3 A;  3OYI A;  2X6Y A;  1W36 D;  3S16 J;  4FXU A;  4YCQ A;  4OJL A;  1HOM A;  1BOA A;  1PUE E;  2E2H J;  3DEU A;  3H5N A;  3G71 I;  1ZH5 A;  2ZIT A;  5CJ9 A;  1ZLJ A;  1V3F A;  3CMA I;  4IVN A;  3ABL H;  1L1I A;  2UUZ A;  1T0F A;  2FD5 A;  2Y75 A;  3TKY A;  4L8J A;  1DGR M;  4B3F X;  1Y0R A;  5AIQ A;  2NVX J;  1BQE A;  2M30 A;  3HOZ J;  1O8K A;  4UUS B;  4KNY A;  4KIB A;  2JN9 A;  5HS8 A;  3H94 A;  2BGJ A;  4MLO A;  3JRI A;  2DOF A;  1PYV A;  2G9W A;  3OWT A;  2JRM A;  2F5E A;  3D0S A;  4DNC A;  2QYU A;  2C6Y A;  3KEY A;  2P0W A;  4X7E A;  4O5V A;  4ESJ A;  1ACI A;  3JAM K;  4HA8 A;  4M3D A;  1CF7 B;  4GXO A;  3H36 A;  3A3B A;  2O61 A;  2E1M C;  2UVE A;  3RDI A;  2QQB A;  1D1B A;  3BWG A;  1SFX A;  4UVB A;  5K5R A;  3E5X A;  4A3F J;  1K78 A;  1GVD A;  3HGY A;  3V8L A;  1CQT A;  4RGS A;  1VFC A;  4OJ6 A;  1BI3 A;  3X2Q H;  3IRQ A;  3OAA A;  2MC4 A;  4BJ6 C;  1HKT A;  4YAL A;  1V5E A;  3OYC A;  5FO0 A;  3LQE A;  1K73 D;  1NB9 A;  2QA4 B;  1X1C A;  1YJW B;  4G8X A;  3WTY C;  1TYX A;  1T98 A;  2J7K A;  1GVJ A;  1EV7 A;  5BS6 A;  3L2V A;  2B7E A;  4IHT A;  5D5V B;  3OW7 A;  2YU9 J;  4AC0 A;  2CW5 A;  2DCE A;  3H9Q A;  1N8R D;  4E7Z A;  1YRN B;  1IN4 A;  5ILS A;  3VNV A;  2CUE A;  2DTR A;  3H3Z A;  2VQL A;  2R7V A;  3O3K A;  1ZGW A;  4MXN A;  1FBS A;  2NAZ A;  3ZR8 X;  1V54 H;  3B90 A;  4AD9 A;  2QEX I;  3KYC B;  1I6X A;  4M1K A;  3J81 Z;  4OIQ F;  3CLO A;  2FBI A;  5F4M A;  2EPF A;  3SQV A;  2O8K A;  3B82 A;  1W5C C;  2KKO A;  4PJJ A;  4AVZ A;  4WF2 A;  1DG1 G;  3RQ4 A;  3K1M A;  1AIP A;  2ZZQ A;  3K0L A;  3HTS B;  2LBF A;  1GT0 C;  2B7B A;  5FNZ A;  3U6K A;  1Y1V J;  3BY1 A;  1UAA A;  2K4J A;  1VI0 A;  5JHF A;  3SEZ A;  1FOX A;  1WJC A;  4IW3 B;  4UVC A;  3N6Z A;  2DA3 A;  2CW0 F;  2P3M A;  3QP6 A;  4WQM A;  2LSO A;  2BYV E;  2JA6 J;  3ASQ A;  2R5Z A;  2RAE A;  2R7S A;  4EM0 B;  3RYP A;  4LBW A;  1W1W E;  3AG4 H;  2VC1 A;  3K4M A;  3LSH A;  3TQN A;  4U7D A;  3CP8 A;  1UHM A;  1EFC A;  1XB4 A;  1P2F A;  2AXT C;  2GBY A;  4G7Z F;  2BVL A;  3OYD A;  4A3K J;  1O7F A;  2K02 A;  2EFW A;  4AIH A;  5F0C A;  2P5K A;  3ABK H;  1YHQ B;  3KZZ A;  1K4S A;  1UEL B;  1U5T B;  3W2I A;  2QLZ A;  2M4K A;  4EM1 A;  2GK6 A;  5CVJ A;  3CQZ J;  2JT1 A;  3HSR A;  2NVU B;  2QX3 A;  4C2L A;  4R71 A;  5CKT A;  1N05 A;  2HOE A;  1SFK A;  2B63 J;  2BHZ A;  5KAI C;  3EYI A;  1QCX A;  2XF7 A;  5E3L A;  3WGH A;  5IY5 H;  2X0K A;  3H0G J;  1S3J A;  5J1Y A;  1R1V A;  1OGI A;  3Q9V A;  1MJB A;  2G0Y A;  2J5P A;  4X6A J;  1B6A A;  3K7A J;  3GYH X;  4BYY A;  1OKR A;  1LNW A;  2HPM A;  3A01 A;  4P22 A;  4PC2 A;  1FX0 A;  3W2V A;  2LC2 A;  2PFB A;  1TNT A;  4ASN A;  1OFE A;  2IW5 A;  4WXD A;  1EJ9 A;  1TT0 A;  4UAJ A;  1ONV A;  4XLF A;  3VPR A;  4Z4R A;  1O8D A;  3CJR B;  4PSW A;  2HGC A;  3KP7 A;  5C44 J;  4V02 C;  3WYA A;  2EFP A;  4HAM A;  2VBU A;  1HCR A;  1CZF A;  4DQK A;  2DOE A;  5AN9 A;  2JK3 A;  3HRS A;  4GFB A;  4JOM A;  4BHC A;  2PJP A;  2CS3 A;  2K9M A;  4IEJ A;  1Z67 A;  4A3E J;  5KHD A;  5HKK A;  3UR3 C;  3BRO A;  2A61 A;  3L2U A;  1OCZ H;  3AL0 B;  3ECO A;  3ZMV A;  3EPZ A;  1YJ9 B;  4X1E A;  3KEW A;  2DFI A;  1GV2 A;  1VQ8 I;  3L09 A;  2V4D A;  2ZZE A;  4UZF A;  1OYY A;  4CSW A;  4GQN A;  4P3Y A;  4A3D J;  2E5N A;  1PLU A;  2O0V A;  1V5G A;  2LY2 A;  4MFD A;  3NAU A;  1FT9 A;  2OF7 A;  3V7S A;  4PGG A;  1XB2 A;  2WR8 A;  1ETX A;  4QPQ A;  2VJ4 A;  4Z03 A;  1GAW A;  2CH0 A;  5B1B H;  1QFY A;  3FXU A;  2BBY A;  2L9N A;  2UZK A;  3CCS B;  1R6R A;  1FY7 A;  4G7W A;  3B8H A;  5EZG A;  1Q1V A;  1TW3 A;  1MJA A;  2OZU A;  5K5Q A;  3BR1 A;  3JTG A;  5IYQ A;  2NT6 A;  4F93 B;  5J6X A;  1RC9 A;  1AIR A;  3EUH C;  1W36 C;  5FA6 A;  5H20 A;  1SAX A;  5FLV A;  1D8T A;  3JRG A;  2A6H F;  2QQA A;  2DYS H;  4RJL A;  4CGZ A;  3K2A A;  3O8G A;  2QBY A;  5IOY A;  4P6V F;  3CO7 C;  2BM6 A;  3TBI A;  5BMZ A;  4Q47 A;  2K4B A;  3CMM A;  2LZJ A;  3PIP F;  1U8B A;  3HOX J;  3CC4 I;  3SZT A;  1IDJ A;  3WE3 A;  3K4N A;  1STZ A;  1YFH A;  1G59 A;  2PX9 A;  3ONQ A;  2P5V A;  1EP3 B;  3ZXS A;  2Y9Y A;  1UG0 A;  1BIA A;  2KHM A;  2QVO A;  2EV5 A;  3GVL A;  1VND A;  4OOV A;  1RET A;  1YQA A;  4TMZ A;  4YFX F;  4L5I A;  1FEX A;  5CVU A;  4IHW A;  2H6B A;  2W6J A;  2BSA A;  3V8J A;  2RRE A;  3HUG A;  2WAQ N;  2XRO A;  1VQK I;  3GTG J;  3ASR A;  2BE5 F;  3U1K A;  5KAF C;  3OSF A;  3TP3 A;  4CZC A;  3W2H A;  4N3N A;  4QIW N;  1VQL I;  1EH6 A;  2L4A A;  3W2G A;  3SJZ A;  1KGS A;  2XSJ C;  3VSV A;  2ZZG A;  3OPO A;  2EV0 A;  3HZJ A;  3CO6 C;  1KC8 D;  3ZBU A;  4RM3 A;  2ME6 A;  4TSF A;  2VFQ A;  4YIR X;  1JJ2 B;  2LVS A;  2Z2S B;  1J9I A;  5F04 A;  4DYQ A;  1TBX A;  5FGM A;  1Y56 A;  4PFP A;  2XB5 A;  3CC2 I;  2V9K A;  5JVT A;  3LA2 A;  3WG9 A;  1JJ6 C;  1XE1 A;  3AST A;  1XSV A;  2RVC A;  3EET A;  4HW0 A;  3JQR A;  3LAP A;  1I39 A;  4I2O A;  4Z4V A;  2VKH A;  3TW6 A;  1LKX A;  3Q3S A;  1XCB A;  2Q2E A;  5FD6 A;  5M3M J;  4ZCM A;  3GTL J;  2ZBU A;  5J1U A;  5E1W A;  5E3M A;  2C4T A;  2QN6 A;  2LF7 A;  2JUC A;  4BUP A;  1RRJ A;  1VHO A;  2D74 A;  3BG6 A;  3CXC B;  4QVJ A;  3DPL C;  3HAG A;  1KMH A;  2OA4 A;  2EZI A;  2WY8 Q;  3FMQ A;  2XSD C;  1I50 J;  3VNU A;  3K4L A;  3S2W A;  4F3Q A;  1QVG B;  1LEA A;  3JQP A;  1BN5 A;  1QHH D;  2XPU A;  1S7A A;  2DMN A;  1ZHF A;  1XN7 A;  1G6N A;  1ZGA A;  3ZMZ A;  2BX6 A;  1PUF B;  2NYX A;  1UFM A;  1KYZ A;  2EFQ A;  3ESW B;  1YIJ I;  1FPQ A;  3S17 J;  3BCB A;  2BPO A;  5HS7 A;  1R00 A;  3PQK A;  4RB0 A;  1K28 D;  3KX2 A;  2ZBV A;  1JUP A;  3LA7 A;  3C2G A;  5GV8 A;  3TDU C;  2V1N A;  3OW2 B;  1SFO J;  1BJK A;  2XNJ A;  2F1L A;  1Q9S A;  1X3W B;  2R5Y A;  3LVB A;  3QFC A;  2Q2E B;  1PP7 U;  4A3C J;  4OWR B;  2LMD A;  4XIC A;  5L3B A;  2I10 A;  1ETY A;  5E1Z B;  1YTY A;  4A3G J;  3LMW A;  4HX4 A;  4XLA A;  1LFU P;  1EA3 A;  1MH4 A;  3WTV C;  1F4K A;  1E1Q A;  2XAS A;  3LNN A;  4RPD A;  3BQJ A;  2W00 A;  1FOK A;  1E2X A;  3IAS 2;  2V6E A;  1FRN A;  2LNB A;  4AVP A;  2BVM A;  4XLP F;  3IL2 A;  3M8E A;  1O88 A;  2FOK A;  3P9I A;  4Y7C A;  3CMY A;  4YAF A;  5LGT A;  4A3J J;  1CQX A;  2WJV A;  3G05 A;  4D9J A;  4A3M J;  1H9T A;  3G71 B;  3PO2 J;  2L4M A;  3FK7 A;  2GXG A;  3KP6 A;  3CC7 I;  1R23 A;  1W7P A;  1TWC J;  1B9N A;  2RKH A;  4FE7 A;  4U49 A;  2O0W A;  2ZME B;  3ZZU A;  3QFT A;  2IGM A;  2LKP A;  1IXR C;  4V19 K;  2GXB A;  4L9J A;  1A35 A;  3BR6 A;  1VQN B;  1TNS A;  4XN0 A;  2ZJP F;  2QQ9 A;  5A2Q K;  2JA2 A;  3GVJ A;  5FO1 A;  4L9T A;  1T56 A;  2XGC A;  2O9L A;  4RMN A;  4M3G A;  4DNT B;  3OYG A;  1FLI A;  4Y33 A;  1UHW A;  3F6V A;  4RBO A;  1AHD P;  4DOZ A;  4WK8 F;  3CCM I;  4HLY A;  4UB8 C;  3KP2 A;  2PMZ A;  4PUS A;  1WWX A;  3GVA A;  1S7O A;  1QZZ A;  4CDG A;  3NAR A;  2OZ6 A;  4BE1 A;  4IHY A;  4DK0 A;  1J75 A;  2ID6 A;  4BBR J;  2WPD A;  3CD6 B;  2MA3 A;  2X6X A;  1OPC A;  1F36 A;  4IOA F;  2OTL B;  1A8P A;  3FKI J;  4ZTJ A;  3CCE B;  2XZL A;  2F48 A;  5F0H A;  3P4G A;  2GPJ A;  1IUF A;  2YS9 A;  4RM0 A;  1PKV A;  2B0R A;  3I59 A;  3NE5 B;  1H80 A;  2V7Q A;  2DW4 A;  4XKC A;  2XAG A;  3SHF A;  2F5V A;  2VBE A;  2ZZF A;  3KYD B;  2BGC A;  1ETK A;  1H0M A;  3NWT A;  1EF4 A;  2Z9O A;  1X58 A;  3L2C A;  2MLG A;  3E3V A;  2K9S A;  4BHB A;  3CME I;  1IC8 A;  3GRH A;  1DQU A;  1GUU A;  2BY1 A;  3P9K A;  2E36 A;  2WV1 A;  4MIM A;  3ERE D;  1R1U A;  1H85 A;  2HLD A;  3PA2 A;  5BPD A;  4EM2 A;  1TLL A;  1LJ9 A;  1OGM X;  1G2H A;  3OIP A;  1QNT A;  1DU0 A;  3MVP A;  3GTK J;  2XZO A;  1ZYR F;  3KP4 A;  3QE2 A;  2X9D A;  4MHG A;  4MR0 A;  3H1C A;  3HOV J;  3GQB A;  2DTZ A;  1JJ8 C;  2WB1 N;  3J80 Z;  1E3X A;  3PJR A;  3A4C A;  2EZL A;  2IA2 A;  4HV5 A;  3SZP A;  4BY1 J;  4KKU A;  4RLZ A;  1I18 A;  1QVT A;  3EYY A;  4HST A;  3MKL A;  2VYQ A;  3M3Y J;  3K2Z A;  3RCO A;  3ZRG A;  1H8A C;  2K40 A;  3OFN A;  5FRO A;  1A31 A;  4QTR A;  3GTJ J;  5TY0 A;  4C3J J;  1WGX A;  4HNU A;  3AG1 H;  5L3F A;  2E1C A;  1WH7 A;  1U0J A;  2HNH A;  3RYR A;  3OS2 A;  2JQ7 A;  1WQ2 A;  1G3T A;  1VF9 A;  2R93 J;  3OYE A;  2CO5 A;  2HTJ A;  4Z4U A;  3A1P A;  2QEN A;  3FM3 A;  3E7L A;  3JU4 A;  3HOY J;  5TJJ A;  2E60 A;  2OCE A;  3C2B A;  3GW2 A;  3PFI A;  5KVR A;  3TOB A;  3VSL A;  4RD2 A;  1TT5 B;  1H42 A;  2EIJ H;  1I1S A;  3LJY A;  3SLD A;  3G6E B;  4Z1M A;  2NXN B;  3ZUG A;  3L00 A;  3W2A A;  3PET A;  3PVD A;  2CG4 A;  5GP9 A;  2Y48 A;  2HPI A;  4PC1 A;  2NT9 A;  4W8Q A;  3M07 A;  2PBI A;  3QYE A;  1TC3 C;  3G73 A;  3PEN A;  1IRX A;  3E6M A;  4I84 A;  5KSW B;  1WI9 A;  2M3A A;  4IZZ A;  4E7L A;  5LGU A;  5HZA A;  1IDY A;  1H89 C;  1T38 A;  2J8I A;  2XAH A;  1YLO A;  3ZQF A;  1XG1 A;  1D1N A;  2Y31 A;  5JLV C;  3L2W A;  2ZB9 A;  1YS6 A;  3HM5 A;  3DTI A;  2MH9 A;  4ZYH A;  3I0T A;  3Q0U A;  1HKQ A;  2IP2 A;  1Z05 A;  2D1H A;  3GZ6 A;  1VJS A;  3WNB A;  2PJR B;  2M7A A;  1Z6T A;  2DET A;  2RC4 A;  1O8L A;  5EZH A;  2OAZ A;  4NBQ A;  4A93 J;  1E62 A;  2PLF A;  2IQ7 A;  4HOB A;  2L0K A;  2KL4 A;  5D6E A;  2EIX A;  4PMH A;  1SMY F;  3B6A A;  3VWB A;  1W0J A;  2LP0 A;  3C3W A;  2PEX A;  2X3U A;  4II3 A;  3CCR I;  5K7F A;  3MMY B;  1JHH A;  3FPK A;  4P55 A;  3IRR A;  4QUZ A;  4A6E A;  1FNN A;  1KRH A;  4M74 A;  1K8F A;  2W4S A;  4GYI A;  4HQE A;  4YZQ A;  4ACB A;  5HNF A;  2M1B A;  1F9N A;  1MGT A;  2W24 A;  3DF8 A;  4TMX A;  2JA8 J;  2NTP A;  2DT6 A;  4S05 A;  4YZX A;  2VJ5 A;  3ZQG A;  3KRG A;  3DBR B;  2VBM A;  4MYT A;  4B09 A;  2M34 A;  1ON1 A;  2E1M B;  2Z1D A;  2B9S A;  2DJN A;  3CUQ B;  2WJY A;  3GQA A;  2FEZ A;  1MKM A;  3N90 A;  1R36 A;  2QYO A;  4UHT A;  5J3O A;  4ENJ A;  3LQQ A;  4FTH A;  1N08 A;  1BI1 A;  5EMN A;  3WNC A;  2PEC A;  2A69 F;  3DBH B;  2COM A;  3HIF A;  2V7F A;  4RB1 A;  4ZYD A;  3RKX A;  1GAQ A;  4KIC A;  2K86 A;  3BNW A;  1OB5 A;  3GF2 A;  4U0V A;  3KL9 A;  2XGE A;  1P7J A;  3KEO A;  3ZQQ A;  1N78 A;  1S8N A;  1DDG A;  4GO1 A;  2HKO A;  2V7X A;  1IB0 A;  1J0R A;  2M5W A;  4Q48 A;  4IXA A;  4Y13 A;  1RUO A;  3JCU C;  1YJ9 I;  2ZTG A;  3GX4 X;  1UMK A;  2HVQ A;  3V7R A;  3VSU A;  2VOP A;  2MLK A;  1UD2 A;  1MZB A;  3RIQ A;  3K69 A;  1SD4 A;  2WY7 Q;  4FAS D;  1YIT I;  2RNJ A;  1RI7 A;  4J0Q A;  3E1S A;  2V26 A;  4MEX F;  4KIS A;  1Z91 A;  1S6L A;  5IT3 A;  2QA4 I;  2Y0M A;  2QBY B;  1YG2 A;  2DYR H;  2MSY A;  1Y1W J;  2GK7 A;  4DJA A;  4N0B A;  2ACJ A;  1G7T A;  4ITV A;  4XLH A;  5CPR B;  3CC4 B;  1VQM B;  2QGU A;  3KIO A;  4MGR A;  2O1D A;  1JKO C;  2A68 F;  2DMU A;  3P9C A;  3WHB A;  1HXD A;  4H4K C;  4DW6 A;  4IHX A;  3BCF A;  3T51 B;  4Z4W A;  1QVF B;  1WH5 A;  4WZE A;  2CMP A;  3BC9 A;  2L54 A;  4PAB A;  3MCA A;  1ZM4 A;  1WI3 A;  3ASN H;  2W7Z A;  4BBS J;  5E1X A;  3F8F A;  5BQT A;  2BV3 A;  3T8R A;  1WTH D;  2BM4 A;  1NDH A;  3ONY A;  4BY7 J;  2K3F A;  2OJE D;  3BP8 A;  4JYK A;  2OC6 A;  3I55 I;  3CCE I;  1EH8 A;  4HE5 A;  1FTT A;  1B9M A;  3GTM J;  3AL0 C;  4X06 A;  4XM3 A;  1TYV A;  1X0C A;  1IA5 A;  4AF7 A;  3RIR A;  1LEB A;  4Y9U A;  1UD6 A;  2TCT A;  4Z05 A;  2OQG A;  2KMU A;  1APL C;  2WTE A;  2EIL H;  4CYC B;  2VN2 A;  2XT2 A;  3BR2 A;  4XRF A;  2CF4 A;  4CQJ A;  3WU0 A;  1LM1 A;  4ENM A;  4I99 C;  1O3R A;  3BQZ A;  3GFM A;  2H8R A;  1FNC A;  1GQ8 A;  3P5J A;  2XV4 S;  5IP7 J;  3CCM B;  1O8M A;  3H3V K;  2DT7 B;  2DMP A;  1QGY A;  4G12 A;  1SFU A;  1Z3X A;  5IK2 A;  3TP0 A;  4QLC U;  3K70 C;  3TL4 X;  2VBS A;  3G6E I;  5FRN A;  2GJR A;  1KK2 A;  1GXQ A;  2XF6 A;  3CC2 B;  3CCU I;  4OMY A;  5DTD A;  1MND A;  3JRB A;  1X3U A;  5HLI A;  3F21 A;  1EXM A;  5LEK A;  4JX4 A;  3F8N A;  1U2W A;  3JTH A;  1O8G A;  1X1A A;  3TOA A;  1H9G A;  5GAE J;  1ZM3 A;  3HG9 A;  3CW2 A;  2HQ5 A;  4RCZ A;  1D0Y A;  4XRS A;  1ZG3 A;  3KLN A;  1RQR A;  3IC7 A;  1R5N A;  4PC3 A;  1YRN A;  2DA1 A;  3A35 A;  4NBS A;  4NK6 A;  5D8L B;  1JTY A;  2FA5 A;  2OK7 A;  2A6E F;  2YPR A;  2GJP A;  2EH3 A;  2OBS A;  2BEO A;  4M3E A;  3CCV I;  5FJ8 J;  5KCM A;  4IKF A;  1NRK A;  2Q1Z B;  2M45 A;  2M2E A;  3H5A A;  4HPQ A;  3KZI C;  2E34 A;  2IEK A;  1NK2 P;  1LUJ B;  2V31 A;  3E20 A;  5TR9 A;  3W2W A;  3I55 B;  4DQ2 A;  2CV1 A;  3IWZ A;  1Q82 D;  3H35 A;  3ZQH A;  2WAQ A;  2LK2 A;  4C43 A;  1BHE A;  2N8G A;  3CCV B;  1QJV A;  3FJO A;  2H1L A;  2IA1 A;  3MZY A;  2HOS A;  2AS5 F;  2EJR A;  5TIS C;  4F92 B;  5H59 A;  3HL2 A;  3MN2 A;  2NTQ A;  2KDO A;  2PI0 A;  2V7T A;  4M6Y A;  4RLQ A;  3CMA B;  2PYH A;  2GIZ A;  1IHM A;  3OIO A;  3G1O A;  4D1Q A;  1OFC X;  3CCJ I;  2VLA A;  4Z06 A;  2JN6 A;  5C3E J;  1K8A D;  3VYT B;  1XSX A;  3PUM A;  3CUQ A;  3BH6 B;  3L2Q A;  1U9O A;  1R5B A;  1IAW A;  2XAU A;  4L0Y B;  4IF4 A;  1DAR A;  2ECC A;  1O7L A;  4E7J A;  4PK4 A;  5E3O A;  1KON A;  2R5Y B;  2CFX A;  2K3P A;  1MJ9 A;  2Z99 A;  2JMW A;  1XPX A;  3V7A A;  3AVX A;  2QY1 A;  3AG2 H;  2Q6I A;  1ZN2 A;  2QSH X;  1WP6 A;  4LLL A;  5ILV A;  1VLO A;  3CC7 B;  3DU1 X;  2DA7 A;  3A02 A;  1N0U A;  1X1D A;  3F0C A;  3JRD A;  3QOP A;  2J5O A;  2H94 A;  1NG7 A;  4OIN F;  5HVQ C;  1BW5 A;  1VQ6 B;  4IRH A;  3OL4 A;  1UD5 A;  3HJE A;  1G7C A;  3BG5 A;  5TGT A;  3V8K A;  4HQM A;  3VOE A;  5D5U B;  1OQY A;  2OBP A;  4P96 A;  5J3L A;  2FXA A;  2Y0S N;  4LB6 B;  1P6R A;  4FE4 A;  4FX0 A;  4BGD A;  2KJC A;  2X48 A;  1OCO H;  4C3I J;  5DSZ A;  3UW0 A;  5KNL A;  1ZM9 A;  1NHC A;  1ON2 A;  3GQ8 A;  4X05 A;  1D5Y A;  2R7F A;  4U7B A;  4BQA A;  3DTK A;  1RWR A;  3LQ6 A;  2R7D A;  3ABU A;  1UCR A;  3FMR A;  3W3C A;  5LGN A;  3ZIA A;  3U1D A;  3SJM A;  3BQY A;  1Z7U A;  2V1D A;  2IJL A;  3EUA A;  4S04 A;  1SEU A;  2DA6 A;  3IH3 A;  5BOX A;  1JGG A;  4G5G A;  4H9G A;  4W1U A;  2FSW A;  1WSU A;  1VQ7 B;  1IRZ A;  4YEI A;  2CUF A;  4OPO A;  1VQ4 B;  1W5S A;  5LHG A;  1FNB A;  1RQP A;  5E6T A;  3JQQ A;  1VBL A;  3QAH A;  2XOK A;  3WE2 A;  4BAC A;  2JPB A;  2YWG A;  3V42 A;  4JX5 A;  3D1N I;  1DUX C;  5IYC J;  4KH3 A;  5C1E A;  2DAO A;  2NVT J;  2QM3 A;  1UD8 A;  5M3F J;  4WZT A;  1XCV A;  2DOA A;  4BDY A;  1O8I A;  2W82 A;  2WAE A;  2OYN A;  5GPC A;  2ODL A;  1WJA A;  1BMF A;  3NWS A;  3K6G A;  3VFZ A;  3BJO A;  4I98 B;  4XNF A;  5DYM A;  2KRC A;  1Q7Y D;  4LK1 F;  5DS9 A;  1MDM B;  4P6Y A;  5LFA A;  1IB4 A;  1QZY A;  2JTV A;  3HXL A;  4JQF A;  5F27 A;  1POG A;  2HZT A;  3TO7 A;  2DLL A;  4YII A;  4AID A;  2O6W A;  3LWF A;  5HS9 A;  1AA7 A;  2F4O B;  3Q5F A;  1O8F A;  3NRV A;  2BM5 A;  3I54 A;  2EWE A;  1Y8R B;  2IS2 A;  3BTI A;  2OV7 A;  2E19 A;  4KKT A;  3S1R J;  5DEQ A;  4EJU A;  4I0B A;  4GCV A;  1YE9 A;  4BEH A;  4MTD A;  3H92 A;  2BGI A;  3PUB A;  2HDN B;  3F3X A;  3HYI A;  3DU5 A;  2M4G A;  2XGD A;  3DCF A;  3GWZ A;  4YFK F;  2FQ4 A;  5DS0 A;  2H09 A;  1SAU A;  1EKE A;  4YG2 F;  1IJE A;  1QO0 D;  5F6F A;  2VBY A;  2JJ7 A;  2I1L A;  1JTA A;  1XD7 A;  4WX9 A;  2QKM B;  1JKQ C;  2NTB A;  5TV2 A;  2VQC A;  3ERM A;  4U88 A;  5CVV A;  5IYN A;  1T39 A;  2F43 A;  1WVR A;  4XRM A;  1SFE A;  3KLO A;  4G6Q A;  3O2P E;  4E7K A;  3QQA A;  4A0Z A;  2CRV A;  2L9V A;  4ESB A;  3SYJ A;  3GCM A;  3PL8 A;  2CW7 A;  1HSJ A;  1SVL A;  3OS1 A;  2OTJ I;  1ZAR A;  1ZGJ A;  2HZD A;  1EFT A;  3BTL A;  4CCO A;  1YYV A;  1JGS A;  3GZN B;  4BXX J;  1D8K A;  3BTJ A;  2HYF A;  3BG7 A;  1VTN C;  2KFD A;  2BHY A;  2ELJ A;  3FXK A;  4V2F A;  1VQP B;  3B8Y A;  4G1V A;  1GR1 A;  2VAS A;  4KN4 X;  1R22 A;  1X19 A;  4ZH4 F;  1P4M A;  3OZW A;  4BEH B;  4OZY A;  4M6X A;  2DBB A;  4QPO A;  1K78 B;  1N25 A;  4IJA A;  3I3L A;  1GHC A;  4P3I A;  4R1H A;  5IP9 J;  2MD5 A;  4AWX B;  4U0Y A;  1G8X A;  2LY1 A;  4YAU A;  3QYB A;  1B72 A;  1V0F A;  4Y17 A;  2ZFW A;  3WTS C;  3HHG A;  4NQW B;  1HST A;  3RSN A;  3CZ6 A;  4B4C A;  2PMZ N;  3M1E A;  1WDT A;  4DYC A;  5LBQ A;  3S1M J;  3ZGK A;  1HC8 A;  1U2R A;  5FRM A;  3JW4 A;  1FP1 D;  1XG2 A;  2VKD A;  2ZO4 A;  3OYK A;  2KRF A;  2HS5 A;  4LK0 F;  1BPL A;  4M53 A;  1O8H A;  3B73 A;  1MMS A;  3GVK A;  2BXY A;  4F55 A;  2QE7 A;  3A0B C;  4R79 A;  1N07 A;  3ISX A;  3BLY A;  4CYD A;  1KQ8 A;  1JB9 A;  2R7O A;  3AGP A;  1BJA A;  3OR2 C;  5B3S H;  4M72 A;  2OUM A;  3M8J A;  1ERD A;  2HDD A;  3SUC A;  2LH9 A;  1F43 A;  3N4M A;  1G4D A;  3FKS A;  2PLY A;  1JTX A;  3IAM 2;  1WU8 A;  3OR1 C;  1XMK A;  1ZRD A;  1O8J A;  5F64 A;  2EK5 A;  3FDY A;  3JSO A;  3ZPN A;  4ZCI A;  2VFM A;  4RGX A;  2M7B A;  1YIO A;  4HX7 A;  2ZL7 A;  3AVW A;  4EJT A;  1FTZ A;  1LDK B;  5AON A;  3OV8 A;  2LRD A;  3COA C;  4XBF A;  1S9H A;  1YLF A;  2IGN A;  3KE2 A;  3FXR A;  4RA2 A;  1IRF A;  3FHZ A;  2PQ8 A;  3H3U A;  4Y7N J;  3KP5 A;  2GWR A;  4BJT A;  3G1L A;  3ZC3 A;  2KPM A;  1KYW A;  2ZJQ F;  4QHY A;  4JX6 A;  1EE6 A;  3A1Y A;  3R61 A;  5K1Y A;  1UD4 A;  4UV8 A;  3Q9S A;  4OOS A;  4U0W A;  3CCJ B;  2VXD A;  4MQV A;  3CCR B;  1KQS B;  1XC5 A;  2KIQ A;  4P9U A;  2IS6 A;  2E71 A;  4Z4Y A;  5CDF A;  3ZPL A;  3H0D A;  5C1C A;  4OZZ A;  1BIB A;  2EZH A;  2TDX A;  1NTC A;  3FHN A;  4TN1 A;  5GV7 A;  4ABZ A;  1VQK B;  4Z2Y A;  4CCM A;  2NOG A;  2PE3 A;  2DER A;  3ABT A;  1LQ1 A;  4LGW A;  1R4M B;  1QGZ A;  4Z4Z A;  1SAN A;  2PMD A;  5EGO B;  3WY9 A;  2M8E A;  2VE9 A;  4M71 A;  1UST A;  3CP2 A;  3MCZ A;  2IAI A;  1DBO A;  1B8I A;  2GQQ A;  2QWW A;  2GRE A;  5IYW A;  5EJC A;  4KFC A;  2EA4 A;  1U6G A;  2XB0 X;  2XVC A;  2UXN A;  2M5S A;  2OD5 A;  3P26 A;  3KEQ A;  5ICC A;  2DDB A;  3HTU A;  4RD6 A;  4G6I A;  2F3L A;  3BR5 A;  4RAG A;  4KYW A;  2ECB A;  2ELH A;  2DYI A;  2ZJ2 A;  3FXO A;  1OMI A;  3HRM A;  3OJW A;  3A01 B;  3R6S A;  3JRF A;  5EEG A;  5F08 A;  5A2Q Z;  1TL8 A;  1KQ0 A;  1CGP A;  5HLG A;  1DDI A;  1FNM A;  2CBX A;  3DTE A;  1JRG A;  2CUJ A;  3FM5 A;  3PQJ A;  2MFZ A;  2QSG X;  2K9L A;  1QX4 A;  3LL7 A;  4FN5 A;  3B6C A;  1BA5 A;  4HRI A;  1YJN B;  4IOC F;  2ZNZ A;  4LIU A;  4X7C A;  4PFO A;  3PSS A;  3REO A;  1PJ7 A;  3DBL B;  2DA5 A;  2MW8 A;  4YXW A;  5KW9 A;  5DNS A;  5FLX K;  1ZEL A;  3C18 A;  2CND A;  1QA2 A;  1HF2 A;  3KET A;  5IYP A;  1F5T A;  3R6K A;  2ZCW A;  1SVM A;  3H9J A;  2JSC A;  2ZSI B;  3R4K A;  4RAZ A;  3ZMS A;  3MZH A;  5BPI A;  1PXZ A;  1MW7 A;  1WPK A;  5J4Y A;  2VZL A;  3LOC A;  3I9V 2;  4LD5 A;  4BL0 B;  3OIQ A;  1K6O A;  3W5V A;  3CCL B;  3MQ0 A;  1H88 C;  3V7C A;  2HDC A;  5GAG J;  4Y4R A;  4IRI A;  1DBG A;  2FNP A;  4GGG A;  1FBU A;  2QMU A;  1UHS A;  3F72 A;  4X0G A;  3OYM A;  1IV6 A;  3CB4 A;  3ZMT A;  4WWV A;  2XF5 A;  2CC2 A;  1D3Y A;  3CES A;  4OAZ A;  3SQN A;  3LSR A;  1T5E A;  4DK1 A;  1WJB A;  3E5Q A;  1YOV B;  3T1B A;  3BR3 A;  3C2H A;  2L7F P;  4QVA A;  3GFJ A;  3LYC A;  1BX0 A;  3GTO J;  3VMW A;  1A6I A;  1BI0 A;  2VKE A;  5JR3 A;  1ZAO A;  1CNF A;  4C30 A;  1GV5 A;  2G0E A;  2MAB A;  3K10 A;  3QWL A;  4BHP A;  2KJB A;  2A5W A;  2VON A;  4G7X A;  4LLN A;  1P9Q C;  4ON0 A;  4P2N A;  2VBW A;  3BG3 A;  3GME A;  4LG0 A;  4OIR F;  4B1R A;  4BJ5 C;  3OYB A;  2DK5 A;  3BOQ A;  2HKX A;  4BE0 A;  2LOO A;  2P6S A;  3BPX A;  2ZL6 A;  3WQZ A;  2D9R A;  1FRQ A;  5E18 F;  1QH0 A;  4MTE A;  1WOP A;  2BXZ A;  1J59 A;  3RI4 A;  4WCG A;  1FZP B;  5LEJ A;  1FND A;  3F8B A;  3CPW B;  3GTP J;  4IQJ A;  2VQG A;  3SZE A;  4P25 A;  4BS9 A;  3I5U A;  2VL8 A;  4A3I J;  4FQG A;  4B8X A;  3AG3 H;  2BM7 A;  2CWE A;  1MD0 A;  5E17 F;  1VQ4 I;  5JMC B;  3IUO A;  4EGY A;  3H09 A;  4OJO A;  2XKP A;  2M0C A;  3RPQ A;  1EZG A;  3I4P A;  2P81 A;  2CQQ A;  4E0F A;  5H2F C;  2YSR A;  2NS7 A;  4BU2 A;  3S15 J;  2CQK A;  5CYV A;  3T5X A;  3VYS B;  3QPT A;  3GXO A;  4EEF G;  4PAA A;  1G3S A;  1XMX A;  2GAU A;  4CCN A;  3EQO A;  3H9G A;  2JPC A;  4OMZ A;  3GFI A;  5FKL A;  1E3P A;  3R0A A;  2LF8 A;  4ZDO A;  2FOW A;  5DD4 A;  4Y52 J;  1H8E A;  2C5B A;  3OYH A;  1SC7 A;  1L0O C;  2CUZ A;  1AKH A;  4NNJ A;  4KIG A;  4PGO A;  4A0X A;  5IT9 Z;  4QV2 A;  1S5L C;  2LRE A;  2NNN A;  2DY1 A;  1E17 A;  2P7V B;  4P5O A;  3D5L A;  4A0Y A;  1QRC A;  2VPL A;  4IRG A;  1KCD A;  1V5F A;  1GDT A;  5J1R A;  1B8I B;  5HNH A;  1EP1 B;  3I1F A;  1EH7 A;  5DN6 A;  5F4O A;  1JXS A;  3DEE A;  3I59 B;  3GLX A;  3WTX C;  1XDS A;  2XPW A;  4ZYG A;  1B1B A;  4RPB A;  2KIS A;  2VIX A;  3QOD A;  4NC8 A;  3B4N A;  2QKL B;  4LMY A;  4XOT A;  3PM1 A;  1QU3 A;  2VT3 A;  1VQ5 I;  1QBJ A;  4E70 A;  1PVE A;  3J81 k;  1A04 A;  3C7J A;  2DFF A;  4ZDP A;  3DPT A;  5B1A H;  2R7U A;  1NBM A;  1OHH A;  4P9S A;  1HW5 A;  2NRA C;  5JBQ A;  3RKY A;  2J8K A;  5B6I A;  1XDU A;  2DN0 A;  1VQ7 I;  4Q5S F;  2HXI A;  1SM4 A;  4DNR B;  3G3Z A;  3KYL A;  3MZ8 A;  3S14 J;  4AIK A;  4XD7 A;  1QPM A;  2CGP A;  4AIJ A;  3OOU A;  3JRH A;  2R9V A;  3L2R A;  2K85 A;  1HA3 A;  1Z9C A;  2H27 A;  1HQC A;  2MG4 A;  2WB1 A;  3OJX A;  4WZL A;  2QZA A;  5K5O A;  4URR A;  2O0Y A;  1CNE A;  1S0U A;  1TSP A;  2DQL A;  2OTL I;  2K5C A;  3IV5 A;  2Z33 A;  3LMM A;  2D1V A;  4HX8 A;  4YAW A;  1Q86 D;  1WHU A;  1U8R A;  1R5I D;  1ZTR A;  3Q0V A;  5IT9 K;  2LD5 A;  1SD5 A;  1RR8 C;  2O6G E;  3U2R A;  1W0T A;  1AMO A;  1IW7 F;  4YIF A;  2CRG A;  3M8F A;  4L0Z B;  4CCJ A;  4X7D A;  4D7M A;  1FIP A;  4IPA A;  2M8G X;  4PGH A;  1Y0Y A;  3DKW A;  4RD4 A;  4LB5 A;  2ZSH B;  3M9A A;  5L46 A;  4PC7 A;  1PE9 A;  1Q1H A;  3SFZ A;  1YJW I;  1L3L A;  5BNG A;  3W6K B;  1J7K A;  4EW9 A;  3AVT A;  4HNT A;  1I5Z A;  3NEU A;  4HV6 A;  1WMR A;  2ZXH A;  5EG0 B;  2LKS A;  5CVR A;  5B66 C;  2KP6 A;  1O4X A;  3ZN0 A;  2VNK A;  4X0C A;  1TQP A;  1QHG A;  1TWF J;  4C3H J;  3VOD A;  2DEU A;  2W1O A;  3E0J B;  3OS0 A;  4IO9 F;  1YIJ B;  3OY9 A;  2ISZ A;  4I09 A;  1WPC A;  4A5M A;  3WXM A;  1FX7 A;  1T6S A;  2TRT A;  1I6H J;  1WSR A;  5H5J A;  2O17 A;  2VXZ A;  2L7M P;  4B48 A;  5LMZ A;  5FL7 A;  1X2N A;  2NNY A;  3QSY A;  4LIV A;  2HDW A;  3ZPP A;  2VJI A;  3CD6 I;  1JE8 A;  1TZL A;  2KIM A;  1ORK A;  4GRI A;  1BOB A;  2HQA A;  2M0M A;  2WC2 A;  2PJR A;  4XR6 A;  1YI2 B;  5FKN A;  1N0V C;  1OB0 A;  2BY2 A;  2WBM A;  2X1D A;  4G6T B;  3OOC A;  2EB7 A;  5J35 A;  4FT8 A;  3MHP A;  2NS8 A;  4E7I A;  3MKW B;  1FDR A;  4Z4T A;  1K5C A;  3PA1 A;  4LFU A;  4KMU X;  4UY8 I;  4KT6 A;  4RD3 A;  3W5H A;  4QWQ A;  2AXL A;  1X4P A;  4LJZ F;  5C4J J;  3WTW C;  1MMA A;  2HMA A;  2Q6O A;  1A36 A;  2Z6B D;  3Q0W A;  3CCS I;  4A3L J;  5D4R A;  4CIC A;  2V4J C;  3L7W A;  5IPA A;  5JI6 A;  3CCL I;  1WRJ A;  2QCO A;  4GYG A;  2P7C B;  1I7P A;  2QTZ A;  4YDT A;  4RLF A;  3S8P A;  1KCC A;  1YS7 A;  2DFH A;  3OYF A;  2EIK H;  1UJ8 A;  2FQ3 A;  2G7H A;  3FZV A;  3LST A;  4YZ0 A;  3FBN B;  5FLX Z;  4CCL A;  1MMN A;  2WV0 A;  5D8K B;  2GIV A;  1A6Q A;  2DMT A;  4F7D A;  3QRF F;  2Z3Y A;  2DJI A;  1HLV A;  2F4I A;  2ZME A;  3ZMD A;  4G1B A;  3D5S C;  4N9I A;  1HW2 A;  2JUG A;  1IXC A;  2MGQ A;  1ZG5 A;  5F0F A;  2X1E A;  1E64 A;  3K9T A;  2O8X A;  3SEJ A;  4MEY F;  1E3O C;  4YRV A;  1WXR A;  5ICG A;  3FMS A;  4BE2 A;  2VBT A;  2BM1 A;  2QXZ A;  4P26 A;  2YUH A;  4B3A A;  3T9G A;  2BV6 A;  2MH2 A;  2XDV A;  1VQO I;  3LNQ A;  5J4V A;  4CH7 A;  3OEH A;  3CUQ C;  4D0P A;  2WZP P;  1RPW A;  2IBD A;  3BY2 A;  4Y3O A;  4RGR A;  1CLW A;  1BR2 A;  2COB A;  1IN6 A;  1IGN A;  4PC6 A;  1FC3 A;  3IP4 B;  1FYK A;  3OZU A;  4OAY A;  1K83 J;  4J19 A;  4JMQ A;  4G7H F;  3HOT A;  4M73 A;  4XMY A;  1VQM I;  3TH0 A;  4XON A;  1ETW A;  2D5V A;  1VQO B;  1MSE C;  3EQN A;  1S29 A;  3JRC A;  4U4B A;  1VQ5 B;  5M5Y J;  3SKB A;  2F5D A;  2XRL A;  2ZXJ A;  4XK4 A;  4D5C A;  4H0E A;  4FK8 A;  3LSG A;  4F7Z A;  4Q7J B;  3HHH A;  4LG0 B;  5EEH A;  4L5J A;  2XND A;  5LRS A;  1EFU A;  1RNL A;  2KRH A;  4A5N A;  4CCK A;  1AOY A;  2XEX A;  3I58 A;  2AQE A;  2HXO A;  2XPV A;  4HZF A;  3BZC A;  4MQ9 F;  5D5X B;  2XKO A;  3GLL A;  1U9N A;  1BC7 C;  4ZJZ A;  3R0J A;  1Z0X A;  4NC6 A;  2R7X A;  1UB9 A;  1FOY A;  3S2D J;  1X4O A;  1BW6 A;  3P7N A;  5D5W B;  1NB0 A;  2QSF X;  5B5E C;  4PJM A;  2E1R A;  1VQN I;  2LFB A;  4RDL A;  3HDD A;  2MYS A;  2VQH A;  2CFO A;  2A07 F;  2CV2 A;  5THX A;  1OLT A;  4G94 A;  2VBK A;  4HF0 A;  3HB9 A;  5DM6 F;  1BBY A;  2B7C A;  4KJZ A;  3ZQI A;  3U21 A;  3WGG A;  2VC0 A;  1BLI A;  4PCQ A;  1I8D A;  4RD1 A;  1M1K D;  3S3M A;  1GLN A;  1E63 A;  2OK8 A;  3BH7 B;  2GOM A;  2R7T A;  4FCY A;  2EWN A;  3WTU C;  1K4Z A;  3GTQ J;  2HYG D;  2Z8G A;  5CQE A;  1T95 A;  3DKX A;  3FK6 A;  4CA0 A;  9ANT A;  2G7U A;  3B02 A;  4ZV4 A;  1WOO A;  2E1B A;  2V9P A;  1OR7 C;  2X51 A;  3ELK A;  5H6Q A;  4EJO A;  1LPQ A;  2LG4 A;  2XT4 A;  4C2T A;  2Y9Z A;  3U2Q A;  5E8G A;  4AC9 A;  4W8R A;  2OPT A;  3ISP A;  3K4K A;  1YJN I;  4RDU A;  2EBI A;  1OFD A;  1QA1 A;  1KTV A;  2JIZ A;  1R5G A;  5M5W J;  2HEO A;  2R7W A;  5EEA A;  1O3S A;  3DLL F;  4AYB A;  2VJJ A;  3CF2 A;  2X8K A;  1XGM A;  1K6Y A;  2RC6 A;  4ZTF A;  1LVK A;  1OCR H;  2HFH A;  1J5Y A;  3QPL A;  4UZE A;  2F1M A;  4EGZ A;  2FF4 A;  1E3H A;  1H8H A;  5LD2 C;  1LFP A;  3HEF A;  1ZR4 A;  1Z7L A;  3VB2 A;  4IHS A;  3KZY A;  3HSE A;  2DMQ A;  3UNG C;  5GAD J;  2JA5 J;  2BY3 A;  2KIF A;  3FXQ A;  3K4C A;  4UV9 A;  2CK3 A;  5F1R A;  1Z1D A;  1ZKG A;  2HU9 A;  2QTL A;  3V4G A;  1NK3 P;  1MSF C;  4RB2 C;  1QZE A;  1KU9 A;  3E6C C;  2DPD A;  2WWY A;  4ZGQ B;  1JUS A;  2D45 A;  4LC0 A;  1Q81 D;  2C78 A;  1QQ1 A;  2W84 A;  4M2L A;  4RM2 A;  4NK8 A;  2H6C A;  2IXS A;  1V5V A;  3OKX A;  2NST A;  1ZR2 A;  3H5R A;  1OOC A;  3D5R C;  4XOR A;  1VQ6 I;  3F6O A;  2HTS A;  3QPS A;  4XKW A;  5L3D A;  4CO8 A;  1JA1 A;  1BN8 A;  1ZUN B;  2X6O A;  5HXB A;  1K7A A;  2KZV A;  4I76 A;  1TYW A;  5DUK A;  1QA3 A;  3HC7 A;  4A2U A;  1FMW A;  1OFM A;  2EQR A;  1JA0 A;  2FU4 A;  2ELK A;  3E6B A;  3AVY A;  4KT5 C;  1DPU A;  4HDU A;  1K61 A;  1VF7 A;  1HDD C;  2KLO A;  1S7E A;  3FX3 A;  3RPU D;  4OJP A;  2V6C A;  3NB2 A;  1KTW A;  2KIU A;  1D1C A;  1I1G A;  3CTA A;  4Y15 A;  2VOO A;  2V7U A;  4E7S A;  5JVG F;  4XKB A;  4WXC A;  2C5H A;  2K9Q A;  2AQF A;  4ZDL A;  3ROU A;  2X6W A;  3T8T A;  4ENK A;  3P27 A;  1BJZ A;  3ASP A;  1F20 A;  2DFE A;  1MMD A;  4RAY A;  4K1X A;  2V5I A;  3BC8 A;  2Y0S A;  3FIW A;  4XLN F;  2XTY A;  3F22 A;  4LBY A;  2C4U A;  3HRU A;  3FXM A;  1OGJ A;  5HOO A;  2ZC2 A;  3DEW A;  5EF6 A;  2OQR A;  1KU3 A;  1RR7 A;  1IV8 A;  4ZYE A;  5IYD J;  1EFR A;  5D6F A;  2O5R A;  1K79 A;  2HQN A;  1W7P B;  1X1P A;  2JVG A;  3PO3 J;  1HG8 A;  1W9X A;  2XNC A;  1J09 A;  3PNT A;  2RNG A;  2FVG A;  3CJT B;  3A03 A;  1B4A A;  1R5O A;  2QGG A;  4YFO A;  4OPS A;  4TMV A;  2F5C A;  3E5U A;  3ZCO A;  1QA6 A;  2EIM H;  1QPI A;  1XGS A;  2XHK A;  1W4M A;  1IXS B;  4UB6 C;  4EJW A;  1ZG1 A;  4LG3 A;  3GEZ A;  4IX7 A;  4NDL A;  4JP0 A;  3HOW J;  5JLW A;  4A6D A;  3A2K A;  2R4G A;  2BZT A;  1HF0 A;  5F4J A;  4RD0 A;  1K4T A;  2XAF A;  4LBZ A;  2VB6 A;  2L7Z A;  2L5Q A;  3FIS A;  3JRE A;  4N9H A;  3VO1 A;  1P92 A;  4B44 A;  2RQQ A;  1PJ5 A;  2A3S A;  1UD3 A;  1MBE A;  2YUS A;  4NUB A;  3B78 A;  2V7W A;  5J40 A;  5FKK A;  3HGG A;  2W7N A;  4HF1 A;  4PZJ A;  1QUE A;  2LY9 A;  3PNY A;  2ZJR F;  3CUO A;  4ANJ A;  4YFN F;  3QFS A;  5CQG A;  1HDP A;  1FP2 A;  3KFW X;  4TKO B;  2YX7 A;  2O7O A;  2QEX B;  1LLZ A;  2JWT A;  3OYA A;  3GQ7 A;  4XL9 A;  5EDN A;  2F5F A;  3CLQ A;  3ZQL A;  1EP2 B;  1QFJ A;  1U5T C;  2DT5 A;  3ZZT A;  1W0U A;  3VMF A;  4YZA A;  1XMA A;  3GZ5 A;  4DQL A;  2X0L A;  4HNV A;  3S32 A;  5KK1 A;  1P7I A;  4I6Z A;  5A89 A;  5IYR A;  1B23 P;  4I7H A;  4ESF A;  2V9V A;  2W25 A;  1YX3 A;  5GPA A;  3GO5 A;  1VLY A;  2H1K A;  3MEX A;  2VBX A;  5E20 A;  3PSZ A;  2XZP A;  3ML6 A;  2ID3 A;  3CJQ B;  1YW7 A;  3PUF A;  1OFL A;  3ZP5 A;  4Y9R A;  4PJN A;  1OYI A;  2QZ8 A;  1YX2 A;  1SD7 A;  3FWE A;  4JRA C;  4HIZ A;  4BH9 A;  1HVX A;  1UG2 A;  2R92 J;  2KQR A;  2WSS A;  2VBV A;  3Q6R A;  5FIU A;  2HCJ B;  2CSO A;  1D0X A;  2HQR A;  1ETO A;  1KZL A;  4MFE A;  1YI2 I;  5BSX A;  3ML3 A;  1IRG A;  1FBQ A;  1RU4 A;  3PSI A;  3FY3 A;  1OCT C;  2I5U A;  4HF2 A;  4R8H A;  1BM9 A;  1MDM A;  3ZQC A;  3GQ9 A;  5J47 A;  1ZLK A;  2AHQ A;  2ZBK A;  2HYJ A;  3JR9 A;  1TWH J;  3E1Y E;  2VNH A;  1E79 A;  5A88 A;  3LSJ A;  2GZW A;  3BPV A;  3GIR A;  4B47 A;  1V4R A;  5HDG A;  3VYR B;  1BC8 C;  1IF1 A;  1KK3 A;  3ZZ0 A;  1R4N B;  1S72 B;  1U3E M;  3AFH A;  2Q6L A;  5AMV A;  4HDV A;  2E1O A;  1DDN A;  2F2E A;  1OYW A;  2CQ7 A;  3I4M J;  3HUG B;  3I64 A;  1HA8 A;  2L02 A;  4BQO A;  2UV1 A;  1VQ9 B;  3FXL A;  2NZM A;  2DU9 A;  4DZJ A;  3TGN A;  4DIQ A;  4KIF A;  4ZZD A;  3LO8 A;  4DBR A;  4GDF A;  2EA2 A;  2IGK A;  4PJL A;  3PIO F;  1OB2 A;  5J8F A;  2D3N A;  3SZG A;  3HOU J;  2ADU A;  1ZQ3 P;  3OE7 A;  3O6B B;  4AM3 A;  4X07 A;  1YO5 C;  2RGV A;  4XKV A;  3HOS A;  3VYU B;  2XTX A;  3K70 D;  1RKT A;  5ILU A;  1IUY A;  3DWL E;  4O6J A;  3S93 A;  1FMV A;  2CQN A;  1DP7 P;  3WBK A;  3ULQ B;  1QUF A;  2DA2 A;  2NSP A;  5DDG A;  2JZY A;  1ZRE A;  1XTA A;  3S1Q J;  1F60 A;  3NAW A;  3TW7 A;  2K9N A;  2HVR A;  4RB3 C;  3A8K A;  4B4D A;  1D0Z A;  1Y6I A;  4J01 A;  3BG9 A;  3WWG A;  2ZXI A;  2CQX A;  3DFG A;  3FBI B;  2ZL5 A;  2YWH A;  3ZSC A;  2W57 A;  4M3B A;  1E1R A;  4UVA A;  2IVM A;  4N4O B;  4TT3 A;  1TVC A;  2IPQ X;  4W97 A;  4NHJ A;  2LR8 A;  3HBL A;  1SKY B;  2INU A;  1QGP A;  2FUG 2;  3W6J B;  2AHO A;  4E6K G;  2VBZ A;  2R5Z B;  3VST A;  1LVA A;  2JRT A;  1I27 A;  2MBF A;  1O57 A;  2EV6 A;  2ME0 A;  5ICF A;  2XC7 A;  2PIA A;  4OM9 A;  1R5H A;  4BXU A;  4A12 A;  1KJZ A;  4HG2 A;  4A69 C;  3R6J A;  1D1A A;  2DI3 A;  4CZZ A;  2Y30 A;  2LBF B;  2ISY A;  4ZZL A;  3I56 I;  2I8D A;  2PN6 A;  3VMV A;  3QPH A;  3VEP A;  1XFO A;  3FXJ A;  4BNC A;  2X3H A;  3E6D A;  5K7H A;  3ZN1 A;  2X1C A;  4L9V A;  1D8J A;  2ZXW H;  2UVF A;  2IRF G;  3QP5 A;  4YEJ A;  4G6D A;  1TQI A;  4OU0 A;  3SFI A;  3ZOB A;  3OEE A;  1LE8 B;  2VPR A;  4XSZ F;  1TW2 A;  2O04 A;  3K4J A;  5GTI C;  1B72 B;  1K9M D;  1JKP C;  5E79 C;  2EZK A;  3ABM H;  4NQW A;  1HBX G;  3SJP A;  2DPU A;  3IWF A;  3DDY A;  3AAF A;  5HDN A;  3S3O A;  5J8C A;  2ZFU A;  3QOE A;  3W6V A;  1V0E A;  2Q0O A;  1JT6 A;  4JBA A;  4QFM A;  4CHU A;  1KK1 A;  4IHV A;  2YWE A;  5DUI A;  4BQN A;  2XAJ A;  4FET A;  4E7H A;  2H8W A;  1JKR C;  3RTR A;  3BJ6 A;  2PYG A;  4B3G A;  2CU7 A;  5FB2 A;  3DXJ F;  3LSM A;  3F23 A;  4LIT A;  4PJ0 C;  4ACA A;  1WJD A;  2HWV A;  1VQ8 B;  4ASU A;  1IN5 A;  3BDD A;  1OCP A;  2EFN A;  3LA3 A;  1FSH A;  1I3A A;  1BR4 A;  2R7Q A;  1FWZ A;  4LOC A;  2NVQ J;  1OCC H;  3HPH A;  2HI3 A;  2K27 A;  4RS8 A;  3SDG A;  1D2E A;  2KVO A;  1ZRF A;  2PMH A;  1FOW A;  2WYR A;  4O3M A;  2RN7 A;  1JHF A;  3J7A Y;  1LE8 A;  2IS1 A;  4S0H B;  1NHA A;  1RUN A;  2AO9 A;  1IJW C;  1IDZ A;  3DP7 A;  5C4X J;  3JRA A;  2CW8 A;  1KU2 A;  3J7Z I;  2EFG A;  1MH3 A;  1UZC A;  1EA0 A;  4RAF A;  4OOI A;  3WOD F;  3J81 K;  2P5L C;  2FRH A;  1COW A;  3KCC A;  5EGO A;  3BR0 A;  2WAF A;  1T6Z A;  2A6T A;  2XAQ A;  3A8I A;  1F1Z A;  2IOU G;  4IL6 C;  2B5O A;  1W87 A;  2VFO A;  3UKG A;  1MBK A;  4W8S A;  2STT A;  2LTP A;  2ZNY A;  4UNO A;  1LFB A;  4EH1 A;  4F52 A;  1N75 A;  2VNI A;  2R7R A;  2ZME C;  2IGO A;  2UWM A;  2DOD A;  2XIG A;  2FE3 A;  2F4M B;  1IN7 A;  1WKM A;  1OR7 A;  4I01 A;  5TRD A;  4OIO F;  1KK0 A;  2DK8 A;  2FJ1 A;  1TYU A;  3WTT C;  6PAX A;  1JI8 A;  4U87 A;  2VOD A;  1KU7 A;  3MMP A;  1DPR A;  2HOA A;  3VSK A;  3S3N A;  1MBH A;  2X53 S;  1N77 A;  3CRZ A;  3SXY A;  4P9F A;  3Q39 A;  2OCC H;  4AF6 A;  4P1W A;  1SKQ A;  4EVI A;  2K7L A;  4LLG F;  4MYU A;  2FX3 A;  4UZU A;  1Z77 A;  2JSP A;  4II2 A;  5HOD A;  3AK5 A;  2FMY A;  1X3Z B;  2MD0 A;  1GO2 A;  1W35 A;  1B2R A;  3H9N A;  1RIO H;  1S4M A;  1LLW A;  1NJI D;  1IO2 A;  1DGW Y;  2NOJ B;  3FPP A;  3VO2 A;  2L9S A;  3TO6 A;  4KKS A;  1YIT B;  1Y0U A;  1LDJ A;  3BZ6 A;  1T08 B;  5HLT A;  3GFL A;  1SD6 A;  1R1T A;  2VUM J;  2OTJ B;  3OYJ A;  4JK1 X;  2Y2Z A;  2ETH A;  2GA1 A;  3CF5 F;  1QQI A;  1MMG A;  4HYE A;  1YW8 A;  5LLQ A;  3IHU A;  5F1J A;  1P4A A;  2QQ8 A;  5L3C A;  1R7J A;  1AKH B;  2L7K A;  1G7S A;  1KQ5 A;  3WND A;  2BOL A;  1IZ1 A;  2L01 A;  3ES9 A;  4AU7 A;  1HW1 A;  4NCN A;  4TV7 A;  1VZ0 A;  1O3Q A;  3GUD A;  1QFZ A;  5DCF A;  5DD8 A;  3J80 K;  4EMS A;  1TWA J;  3KP3 A;  1TUI A;  3E97 A;  4U9U A;  5FKM A;  1KQ9 A;  4ETS A;  3CJN A;  4UXN A;  3MAJ A;  4UUV A;  4V2G A;  5M5X J;  1W0K A;  1FJL A;  1REP C;  4KMF A;  5FFX A;  1ZRC A;  2NS0 A;  2BW3 B;  4CXF A;  3F8M A;  5LRR A;  2VI6 A;  3LQR A;  3G4S I;  3OSG A;  1PP8 F;  1SVO A;  2X4H A;  4N3G A;  1TLH B;  2VT2 A;  1IJF A;  3BTC A;  4B3X A;  3AVV A;  3CCQ I;  1GVH A;  1D5V A;  1OGO X;  2W48 A;  1MAB A;  1W5T A;  3MKZ A;  1E3Z A;  2FML A;  2ESN A;  1USS A;  4HLX A;  1GXP A;  4BAY A;  4ZYA A;  2BF4 A;  4L5E A;  4X7F A;  1OIS A;  3WTZ A;  3OMY A;  3G4S B;  4RDJ A;  2XC1 A;  2VFP A;  3CCY A;  1ETV A;  1NG6 A;  1MBG A;  2YU3 A;  3U6B A;  5ERI A;  1W7P D;  3F9K A;  2CJJ A;  2Z5U A;  1TQM A;  4HSR A;  3RJP A;  5JLX A;  1B59 A;  1PUF A;  1NH3 A;  3PSF A;  4QSH A;  1DU6 A;  2DCU A;  5GTH C;  2UXX A;  4M3F A;  4XSX F;  3IKT A;  1LB2 A;  3LSI A;  1HKS A;  4E4H A;  2L2O A;  3OP1 A;  4XID A;  1MIJ A;  3RQI A;  2C2W A;  2B0L A;  1T8I A;  3M4O J;  2XGJ A;  3K1P A;  3R60 A;  4EJV A;  3BT9 A;  4F91 B;  2CV0 A;  1DP3 A;  1DAB A;  1T6Y A;  2QUF A;  2OBR A;  4CYC A;  5IOZ A;  3SDB A;  3CDH A;  2ICW G;  1WOS A;  1MRZ A;  5LHH A;  2YX4 A;  4OJ5 A;  4YC5 A;  3K1N A;  4HWV A;  2M87 A;  5HDK A;  2E1N A;  1P4W A;  5H6R A;  3Q6Q A;  1WJE A;  3OZV A;  1P4X A;  1PJ6 A;  1R9T J;  2BY0 A;  4M0L A;  3HRT A;  3J7A O;  2PMU A;  4IQ4 A;  4PSX A;  4KIT B;  1WZ2 A;  4RDK A;  4RGU A;  2KT0 A;  1R71 A;  4NC7 A;  3LFU A;  5CLS A;  4MO7 A;  2WAD A;  2WA0 A;  2QDX A;  3S1N J;  1XS9 A;  2R7Z J;  1T2K A;  2BSP A;  4W8T A;  3SYT A;  3U9G A;  4K2E A;  4PDK A;  2ESH A;  3BJA A;  2RC5 A;  2JDI A;  1V55 H;  3LFK A;  3T56 B;  1BL0 A;  2E2I J;  1WJ5 A;  3JSP A;  4C9Y A;  4FIS A;  4Z4S A;  3ECH A;  3CDI A;  1MBJ A;  5DM7 F;  2D3L A;  4FX4 A;  2GM4 A;  3SEQ A;  3Q3A A;  2IT0 A;  3TMO A;  1ETQ A;  1HZE A;  2OBT A;  5ED4 A;  3RY8 A;  3SLN A;  3PFY A;  1QRY A;  1TTT A;  3PUN A;  4YAO A;  3ZBT A;  4HBL A;  3A3G A;  4X8I A;  2JVH A;  1JT0 A;  2PG4 A;  1YX5 A;  3CME B;  3IKV A;  1PJR A;  5A8A A;  3WU2 C;  1Y8Q B;  1QRB A;  4KN7 X;  2YWF A;  2E35 A;  4G7O F;  5L3G A;  1RES A;  3CDL A;  3I56 B;  2VE8 A;  3EUH A;  3TDZ C;  3S2H J;  3JX8 A;  3CPX A;  3J7Y J;  2LDU A;  1T6X A;  4BQQ A;  1RMG A;  4XOP A;  3FF5 A;  1TP4 A;  1T0F C;  4CUG A;  2CYY A;  3O8H A;  2DA4 A;  3T0Y A;  2RDP A;  3EQL F;  4TMT A;  1PDN C;  1KA8 A;  2EFO A;  3HKZ N;  1C0W A;  1Z6R A;  1KZH A;  4WZK A;  1FIA A;  1A5J A;  3G1M A;  3M7G A;  3QU6 A;  4C2M J;  1YHQ I;  4KUM A;  3DV8 A;  2E7W A;  3QU3 A;  1AU7 A;  1VHE A;  1XQB A;  1BI2 A;  2DIE A;  3AVU A;  3LSK A;  3C1D A;  5K7Z A;  4WWC A;  1JNY A;  2P8T A;  4BKX A;  4D7N A;  3RZO J;  3ONU A;  3QYF A;  1MNM C;  2HOT A;  5E3N A;  1MBF A;  2F4N A;  3LSP A;  5JFR A;  1N06 A;  2RV8 A;  4AYB N;  2BW3 A;  5IYB J;  2FBK A;  5LHI A;  2E2J J;  2F6C A;  4XLE A;  4AUX A;  2R6H A;  4P1V A;  1WOR A;  2FBH A;  1R49 A;  2NVY J;  2O3F A;  3FKJ A;  5E8I A;  3ASS A;  5DCM B;  2JJ2 A;  2DO7 A;  4Q4Z F;  4EV0 A;  1W34 A;  2R0Q C;  1M1E B;  3L9F A;  3VDX A;  2BN4 A;  3VR6 A;  5HZB A;  4RCY A;  2DOG A;  1MNE A;  4HEA 2;  1XGO A; 
#chains in the Genus database with same CATH homology
 2VXD A;  4E7S A;  4DOZ A;  4XKB A;  2IS6 A;  2AQF A;  4ZDL A;  2PMZ A;  2X6W A;  4PUS A;  3H0D A;  5CDF A;  5C1C A;  1Z3Y A;  4OZZ A;  1MMD A;  3BC8 A;  4J00 A;  3BH4 A;  2Y0S A;  3FHN A;  2ZTN A;  1BR1 A;  4CCM A;  4BE1 A;  4DK0 A;  2WPD A;  2X6X A;  5HOO A;  4DBQ A;  3GBG A;  1EFR A;  4ZTJ A;  2O5R A;  2XZL A;  3CP2 A;  1DBO A;  2JVG A;  1HG8 A;  1PKV A;  3NE5 B;  4ZC3 A;  1H80 A;  1W9X A;  1J09 A;  2V7Q A;  4XKC A;  3PNT A;  2RNG A;  2M5S A;  2F5V A;  2VBE A;  3BCD A;  3DLA A;  2ZZF A;  3NWT A;  4G6I A;  3ZCO A;  4EAT A;  3GRH A;  1E43 A;  4LG3 A;  4IX7 A;  1DQU A;  3A2K A;  2HLD A;  2E5Z A;  2R4G A;  1OGM X;  3OIP A;  3DTE A;  2XZO A;  2VB6 A;  3DPU A;  2CUJ A;  2L5Q A;  3OYL A;  1JRG A;  4MR0 A;  2MFZ A;  2K9L A;  3GQB A;  3LL7 A;  4B44 A;  2JJ1 A;  4HRI A;  2RQQ A;  3A4C A;  3PJR A;  1E3X A;  1UD3 A;  4LIU A;  4NUB A;  4KKU A;  1I18 A;  4PFO A;  4HST A;  2W7N A;  3K4B A;  3PNY A;  3RCO A;  4ANJ A;  4TKO B;  4YXW A;  5CQG A;  3ZRG A;  2O0W A;  3OFN A;  3HKZ A;  5FRO A;  3OYA A;  3GQ7 A;  4XL9 A;  4HNU A;  3AKZ A;  1ZEL A;  2HVS A;  4B43 A;  4YZA A;  1U0J A;  2HNH A;  3OS2 A;  3H9J A;  1E0E A;  2ZSI B;  3BCA A;  1PXZ A;  1MW7 A;  3OYE A;  3S32 A;  3I9V 2;  4BL0 B;  3OIQ A;  2IS4 A;  3OL3 A;  4XN3 A;  4XQF A;  2W6I A;  3JU4 A;  2E60 A;  1YX3 A;  4Y4R A;  1VLY A;  1DBG A;  4N4N B;  3VSL A;  2XZP A;  3MD2 A;  3T53 B;  4BDZ A;  4X0G A;  2DXI A;  3DU6 A;  3OYM A;  3CJQ B;  4Z1M A;  1O8E A;  1OFL A;  2XF5 A;  3W2A A;  2GOX B;  3EUK L;  4PJN A;  3DQV C;  2HPI A;  3CES A;  4OAZ A;  4C2U A;  4DK1 A;  1T5E A;  3PNV A;  1WJB A;  2NT9 A;  3M1C A;  3QYE A;  4HIZ A;  4I84 A;  4W8Q A;  1HVX A;  1IRX A;  3C2H A;  2KQR A;  3OYN A;  2WSS A;  4IZZ A;  2M3A A;  4E7L A;  3JUR A;  1D0X A;  1Z21 A;  1KZL A;  3N05 A;  3VMW A;  3G2B A;  4DGW B;  1RU4 A;  3PSI A;  4C30 A;  3L2W A;  3FY3 A;  4XLC A;  2MAB A;  1WFX A;  3K10 A;  3DTI A;  2A5W A;  4G7X A;  3GQ9 A;  1P9Q C;  4BJ5 C;  4G7W A;  3OYB A;  2Z16 A;  2INV A;  4BE0 A;  2LOO A;  1E79 A;  3WQZ A;  1VJS A;  1WJF A;  4B47 A;  2M7A A;  2PJR B;  3VYR B;  1O8L A;  4IQJ A;  2VQG A;  3AFH A;  5AMV A;  2GJK A;  4BS9 A;  2IQ7 A;  4PMH A;  2VL8 A;  2KL4 A;  3HPG A;  3VWB A;  3HUG B;  1W0J A;  1HA8 A;  4BQO A;  2UV1 A;  3IUO A;  4OJO A;  4II3 A;  3MMY B;  2NZM A;  3EQO A;  4DIQ A;  2X85 A;  4YEL A;  4BXF A;  4DBR A;  2IGK A;  4PJL A;  4E0F A;  2W4S A;  4BU2 A;  2LYC A;  3SZG A;  2D3N A;  5HNF A;  4YZQ A;  3VYS B;  3OE7 A;  2NTP A;  2DT6 A;  4YZX A;  2VJ5 A;  3KRG A;  3MKY B;  2VBM A;  4XKV A;  4CCN A;  3HOS A;  3VYU B;  1X1B A;  1IDK A;  2Z1D A;  3DKY A;  2E1M B;  3H9G A;  3K70 D;  2WJY A;  3GQA A;  3DWL E;  2X6Y A;  3OYI A;  1W36 D;  3S93 A;  1FMV A;  4FXU A;  4OJL A;  4ZDO A;  1H8E A;  2PEC A;  3OYH A;  2NSP A;  2CUZ A;  2V7F A;  4NNJ A;  3H5N A;  2O0V A;  2HVR A;  2LRE A;  1D0Z A;  2UUZ A;  1N78 A;  1Y6I A;  3ZQQ A;  4J01 A;  3WWG A;  4P5O A;  1DGR M;  4L8J A;  3D5L A;  4B3F X;  2ZXI A;  3FBI B;  2VPL A;  1KCD A;  1V5F A;  3ZSC A;  1O8K A;  2ZTG A;  2HVQ A;  1E1R A;  3VSU A;  5HNH A;  4N4O B;  3H94 A;  4TT3 A;  2INU A;  1UD2 A;  4MLO A;  1SKY B;  5DN6 A;  1PYV A;  3OWT A;  2WY7 Q;  3DEE A;  4FAS D;  2FUG 2;  3E1S A;  2V26 A;  2P0W A;  3KEY A;  4E6K G;  3VST A;  2VIX A;  3QOD A;  4NC8 A;  2XC7 A;  4KIS A;  3B4N A;  2QKL B;  4XOT A;  4HG2 A;  1QU3 A;  2GK7 A;  4DJA A;  3A3B A;  2UVE A;  1D1A A;  2E1M C;  2LBF B;  4ITV A;  4XLH A;  5CPR B;  1D1B A;  2I8D A;  3VMV A;  4ZDP A;  3DPT A;  2O1D A;  3BCF A;  2R7U A;  4H4K C;  1NBM A;  1OHH A;  3T51 B;  2X3H A;  2X1C A;  2CMP A;  3BC9 A;  4OJ6 A;  2UVF A;  4DNR B;  3OAA A;  2MC4 A;  4BJ6 C;  3KYL A;  1V5E A;  4YEJ A;  3OEE A;  4XD7 A;  3OYC A;  1WTH D;  1X1C A;  3OOU A;  2R9V A;  3L2R A;  2O04 A;  2WB1 A;  3K4J A;  3L2V A;  4URR A;  2OC6 A;  3DDY A;  3S3O A;  1IA5 A;  3OW7 A;  2ZFU A;  2K5C A;  3QOE A;  2DCE A;  3H9Q A;  4XM3 A;  3LMM A;  3AL0 C;  1V0E A;  4E7Z A;  1X0C A;  1UD6 A;  4Z05 A;  2KMU A;  4BQN A;  2VQL A;  4FET A;  4E7H A;  2R7V A;  3RTR A;  2PYG A;  4B3G A;  3LSM A;  4MXN A;  1GQ8 A;  3ZR8 X;  4LIT A;  3B90 A;  1O8M A;  1WJD A;  2DT7 B;  4ASU A;  4CCJ A;  1Z3X A;  5IK2 A;  4AVZ A;  4PJJ A;  1BR4 A;  2R7Q A;  3RQ4 A;  3K70 C;  3HPH A;  3TL4 X;  2ZZQ A;  2LBF A;  5FRN A;  2GJR A;  2ZSH B;  2KVO A;  2XF6 A;  1UAA A;  1PE9 A;  5JHF A;  3SEZ A;  1MND A;  1WJC A;  3J7A Y;  2IS1 A;  4EW9 A;  4HNT A;  1WMR A;  2ZXH A;  2R7S A;  1O8G A;  1X1A A;  3LSH A;  2CW8 A;  2KP6 A;  3K4M A;  3HG9 A;  3CP8 A;  1QHG A;  1D0Y A;  2BVL A;  3OYD A;  2W1O A;  3A35 A;  1COW A;  3E0J B;  3OS0 A;  2WAF A;  4NK6 A;  3OY9 A;  2A6T A;  2GJP A;  1UEL B;  1WPC A;  5KCM A;  4IKF A;  1NRK A;  2Q1Z B;  2M4K A;  2GK6 A;  4W8S A;  3H5A A;  2O17 A;  2VXZ A;  4HPQ A;  2QX3 A;  4B48 A;  4C2L A;  2V31 A;  4F52 A;  1N75 A;  5FL7 A;  5CKT A;  3W2W A;  1SFK A;  4LIV A;  2CV1 A;  2HDW A;  3H35 A;  2XF7 A;  2R7R A;  1QCX A;  3ZPP A;  2WAQ A;  1BHE A;  2IGO A;  2VJI A;  2UWM A;  1TZL A;  1QJV A;  4GRI A;  1BOB A;  2HQA A;  2M0M A;  4F92 B;  2PJR A;  4XR6 A;  4U87 A;  3HL2 A;  1JI8 A;  1PLU A;  1OB0 A;  2NTQ A;  2KDO A;  4G6T B;  2WBM A;  2X1D A;  3VSK A;  2HPM A;  3OOC A;  4P22 A;  4RLQ A;  3S3N A;  2X53 S;  1N77 A;  3W2V A;  1FX0 A;  4E7I A;  3MKW B;  2PYH A;  2LC2 A;  4D1Q A;  1K5C A;  2VLA A;  4P1W A;  1TT0 A;  4Z06 A;  4KT6 A;  4XLF A;  4UZU A;  2JSP A;  4II2 A;  1O8D A;  3CJR B;  4PSW A;  3VYT B;  1X4P A;  3L2Q A;  1CZF A;  1MMA A;  2MD0 A;  2Z6B D;  2XAU A;  4JOM A;  1DGW Y;  2CS3 A;  2K9M A;  2NOJ B;  4E7J A;  2L9S A;  3FPP A;  4PK4 A;  2V4J C;  1KON A;  4KKS A;  2K3P A;  5KHD A;  5HKK A;  2QY1 A;  3UR3 C;  5HLT A;  3L2U A;  4RLF A;  3S8P A;  3AL0 B;  1WP6 A;  1KCC A;  3OYF A;  3EPZ A;  3OYJ A;  4YZ0 A;  3KEW A;  3FBN B;  4CCL A;  1MMG A;  1MMN A;  1X1D A;  4CSW A;  2V4D A;  2ZZE A;  4GQN A;  1NG7 A;  2E5N A;  5HVQ C;  2DJI A;  2L7K A;  1V5G A;  2F4I A;  2LY2 A;  3OL4 A;  1UD5 A;  2BOL A;  3D5S C;  5TGT A;  2JUG A;  4AU7 A;  1VZ0 A;  2X1E A;  4QPQ A;  2VJ4 A;  4Z03 A;  4BGD A;  2CH0 A;  4YRV A;  5KNL A;  3UW0 A;  1NHC A;  2L9N A;  1R6R A;  4BE2 A;  3GQ8 A;  4U7B A;  2NT6 A;  3DTK A;  4F93 B;  1RWR A;  2QXZ A;  1AIR A;  3T9G A;  3EUH C;  1W0K A;  1W36 C;  2XDV A;  3W3C A;  2BW3 B;  3ZIA A;  4CH7 A;  3OEH A;  2WZP P;  3EUA A;  4B3X A;  4Y3O A;  1OGO X;  1BR2 A;  3TBI A;  1MAB A;  3IP4 B;  3MKZ A;  3CMM A;  1E3Z A;  2LZJ A;  4OAY A;  4JMQ A;  1VBL A;  4ZYA A;  2XOK A;  3HOT A;  4BAC A;  4XMY A;  1IDJ A;  4XON A;  3OMY A;  3K4N A;  3EQN A;  3V42 A;  1G59 A;  1NG6 A;  5C1E A;  4U4B A;  3ONQ A;  1UD8 A;  3ZXS A;  1UG0 A;  3F9K A;  2KHM A;  2DOA A;  4BDY A;  3GVL A;  1O8I A;  2W82 A;  2WAE A;  4HSR A;  2ODL A;  1WJA A;  3PSF A;  1BMF A;  3NWS A;  3K6G A;  3LSG A;  2W6J A;  3LSI A;  4XNF A;  2KRC A;  4E4H A;  2L2O A;  2RRE A;  2XND A;  1IB4 A;  5LFA A;  3HXL A;  2KRH A;  4JQF A;  4CCK A;  4CZC A;  2XGJ A;  2AQE A;  2CV0 A;  4F91 B;  1DP3 A;  1AA7 A;  2XSJ C;  3VSV A;  2ZZG A;  1O8F A;  3OPO A;  2EWE A;  3SDB A;  2IS2 A;  4RM3 A;  4ZJZ A;  4TSF A;  2OV7 A;  2R7X A;  4KKT A;  1X4O A;  2Z2S B;  1YE9 A;  4BEH A;  4OJ5 A;  3PUB A;  4HWV A;  1Y56 A;  4PFP A;  2V9K A;  3DU5 A;  4PJM A;  1WJE A;  2M4G A;  1SAU A;  2MYS A;  2VQH A;  2CFO A;  2CV2 A;  1OLT A;  2VBK A;  4IQ4 A;  4PSX A;  4KIT B;  1JTA A;  2VKH A;  2QKM B;  4KJZ A;  1LKX A;  4NC7 A;  3LFU A;  2NTB A;  2VQC A;  3U21 A;  1BLI A;  1I8D A;  2WAD A;  3S3M A;  1GLN A;  2WA0 A;  2F43 A;  2GOM A;  2R7T A;  4BUP A;  4E7K A;  2BSP A;  4W8T A;  3SYT A;  3BG6 A;  2Z8G A;  3DPL C;  1T95 A;  5CQE A;  3PL8 A;  2CW7 A;  2WY8 Q;  3DKX A;  4CA0 A;  1KMH A;  3HAG A;  3OS1 A;  2JDI A;  2E1B A;  2HZD A;  3K4L A;  3T56 B;  1OR7 C;  2X51 A;  4F3Q A;  1WJ5 A;  2LG4 A;  4CCO A;  4C2T A;  1QHH D;  4C9Y A;  3BG7 A;  4W8R A;  3K4K A;  2ELJ A;  2D3L A;  3B8Y A;  2JIZ A;  2VAS A;  3SEQ A;  1X19 A;  3TMO A;  2R7W A;  1HZE A;  4AYB A;  4BEH B;  4OZY A;  2VJJ A;  3CF2 A;  3PFY A;  4QPO A;  2X8K A;  1K6Y A;  4ZTF A;  3I3L A;  3BCB A;  3A3G A;  2JVH A;  1LVK A;  1G8X A;  1YX5 A;  2LY1 A;  1K28 D;  1PJR A;  3KX2 A;  2F1M A;  1H8H A;  5LD2 C;  3QYB A;  1V0F A;  1LFP A;  3C2G A;  1Z7L A;  2V1N A;  4NQW B;  3RSN A;  3CZ6 A;  3UNG C;  1XG2 A;  3ZGK A;  2Q2E B;  5FRM A;  3K4C A;  2VKD A;  3OYK A;  2CK3 A;  2HU9 A;  1BPL A;  4BQQ A;  4OWR B;  3GVK A;  1O8H A;  4XOP A;  1RMG A;  3LMW A;  4F55 A;  4XLA A;  2QE7 A;  1T0F C;  4R79 A;  4CUG A;  1EA3 A;  3BLY A;  2R7O A;  1E1Q A;  3OR2 C;  3LNN A;  2W00 A;  3IAS 2;  4RM2 A;  2V6E A;  2OUM A;  4NK8 A;  2IXS A;  3M8J A;  1ERD A;  2BVM A;  2LH9 A;  2NST A;  3SUC A;  1O88 A;  3FKS A;  3H5R A;  1OOC A;  3IAM 2;  3D5R C;  3OR1 C;  4XOR A;  2DIE A;  3LSK A;  2WJV A;  3G05 A;  1O8J A;  4XKW A;  4D9J A;  3FDY A;  3ZPN A;  1BN8 A;  3QYF A;  2M7B A;  2KZV A;  4U49 A;  3HC7 A;  1FMW A;  1OFM A;  2BW3 A;  1LDK B;  2IGM A;  2F6C A;  4XLE A;  1VF7 A;  2LRD A;  1S9H A;  2IGN A;  4XN0 A;  3FKJ A;  2KLO A;  3RPU D;  2JA2 A;  3GVJ A;  4OJP A;  2JJ2 A;  4BJT A;  4DNT B;  4RMN A;  2KPM A;  1KTW A;  3OYG A;  1EE6 A;  3A1Y A;  3VDX A;  3VR6 A;  1UD4 A;  1D1C A;  4Y33 A;  1MNE A;  4HEA 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...