4AVZA

Tailspike protein mutant e372q of e. coli bacteriophage hk620
Total Genus 226
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
226
sequence length
598
structure length
598
Chain Sequence
b'DQFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNADHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAIL SPIKE PROTEIN
publication title Single Amino Acid Exchange in Bacteriophage Hk620 Tailspike Protein Results in Thousand-Fold Increase of its Oligosaccharide Affinity.
pubmed doi rcsb
source organism Salmonella phage hk620
molecule tags Viral protein
total genus 226
structure length 598
sequence length 598
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4avzA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4avzA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4avzA02
4XM3A 4AVZA 1KTWA 2NT6A 3VMVA 3B4NA 4XNFA 3LMWA 2O0WA 4YZ0A 4XN3A 2BSPA 4W8RA 4OZYA 4W8TA 4URRA 4OJLA 4U4BA 2VJIA 1WMRA 4XN0A 4OZZA 4XORA 1O8KA 3FY3A 4C2LA 3VSUA 2QX3A 4XONA 3WWGA 1O8LA 1DBOA 1QJVA 2UVFA 2NT9A 4XLCA 4W8SA 1K5CA 1OFMA 1O8MA 5C1EA 4MXNA 2O1DA 2NTBA 4XKWA 1O8HA 3GQAA 4XMYA 3VSTA 1RWRA 3VSVA 1O8JA 1DBGA 4MR0A 4EW9A 4XLEA 3KRGA 3SUCA 2NSPA 1AIRA 1IDKA 2O04A 1IB4A 4Z05A 1PE9A 1BHEA 4XLAA 1GQ8A 2VBMA 4XQFA 3JURA 1O8EA 1O8FA 1X0CA 3VMWA 2X85A 1IDJA 1PXZA 2X3HA 1IA5A 1JRGA 1OOCA 2NTQA 4OJOA 1EE6A 4XLHA 1O8GA 3ZSCA 4OJ5A 2INUA 4XOPA 1RMGA 3ZPPA 2O0VA 4XL9A 2VBKA 3T9GA 2X6WA 1O88A 1XG2A 2NTPA 4XLFA 2QY1A 4YZAA 4Z06A 1OFLA 4XOTA 2ODLA 2INVA 4OJ6A 4YZXA 3B90A 2QXZA 2VBEA 3UW0A 3GQ8A 4YELA 4W8QA 1NHCA 2NSTA 2NZMA 4HWVA 2X6YA 1OGMX 4OJPA 4YZQA 1VBLA 2Z8GA 2X6XA 1BN8A 1KCDA 1RU4A 1O8IA 5AMVA 3EQNA 3GRHA 2O17A 1HG8A 3B8YA 2EWEA 2PYGA 3GQ9A 4XKVA 4PMHA 4NK8A 3GQ7A 3EQOA 4Z03A 2VJJA 2UVEA 2IQ7A 4XR6A 1H80A 1KCCA 5C1CA 2PYHA 1O8DA 1JTAA 1PLUA 2PECA 4I84A 1CZFA 4U49A 1OGOX 4NK6A 4YEJA 1QCXA
chains in the Genus database with same CATH superfamily
3QFTA 3C1DA 4C9YA 3AGPA 3E6DA 1JKPC 1H8AC 1VQMB 4O3MA 2R5YB 3I1FA 3VOEA 3OW2B 5M3FJ 3I9V2 3OZUA 4EJTA 5DDGA 4UZEA 4G6QA 2YUHA 4OZYA 3ZCOA 2VBXA 4OPWA 4BHPA 1A31A 4G1VA 2BM6A 2Z2SB 4DYQA 1WJDA 4AF6A 1BOAA 4XKCA 1QVFB 4I02A 1J0RA 2DT5A 1CF7A 4F93B 2RC6A 4BE1A 3SEJA 1E1QA 2EFQA 3EPZA 3U21A 5K7ZA 2PIAA 2VFNA 3BR1A 1RPWA 1MNEA 2VOOA 1SMTA 1Y56A 4MIMA 2NTBA 3L2WA 1GXPA 4XKWA 3GQAA 4HW0A 2GOMA 3H92A 1V5GA 1ELOA 2EIXA 3VSTA 1XGMA 2GAUA 4JRAC 1UD4A 2ISYA 2FBIA 2BHZA 4BQQA 1I27A 2Y69H 2WZPP 2LK2A 2PJPA 3MKLA 4PJMA 1LDDA 1HBXG 2IW5A 4EMSA 1IXRC 2EFNA 3KE2A 4LIVA 2ZBKA 1XSVA 4D5FA 2Q2EA 2OBPA 1B2RA 1QNTA 3TO6A 3FF5A 4E0FA 1FMVA 1ORKA 3K1NA 3K4BA 4L9JA 5K7HA 3GSIA 2CO5A 4FN5A 4G9YA 4R8HA 2CQ7A 4RDLA 3S15J 2JUGA 3DQVC 3I59A 2R7OA 3QODA 4LOCA 3J80K 3H9GA 5JVTA 1G8XA 3DTIA 1ETOA 2WSSA 2WWYA 2DU9A 2MLGA 1T6YA 1D5VA 3HTSB 2V5IA 2XIGA 1ETVA 4WXHA 5JR3A 2K86A 5F0CA 1ZRCA 4IHYA 1GO2A 4F3QA 4BXUA 3Q3AA 4M1KA 3RIRA 3BDDA 5J1YA 2QTLA 3LL7A 4P3IA 2BVNA 5LGUA 4XLFA 2M5SA 1O88A 4OP7A 3IHUA 1YFHA 3GWZA 2W48A 4AM3A 1SVLA 2X1DA 5DM7F 3N6ZA 3T51B 3NWTA 2G0YA 1DQUA 2JUCA 3ASOH 4FTHA 2OTJI 4AIDA 4HX4A 4A12A 2HQAA 3Q6RA 3F23A 4RCYA 3PM1A 1W35A 3LA7A 1WQ2A 5D5VB 2Y31A 2P6TA 1LEBA 2BGJA 3BNWA 1E2XA 3VR6A 1Z7UA 1MMAA 3RYRA 1QA3A 1IRZA 1BN8A 1KRHA 2ADUA 2OUMA 2B7BA 3VO2A 4P6YA 3T1BA 1T0FA 5D5XB 2E1BA 1O8IA 2DPUA 4I2OA 2HDDA 5H59A 1ACIA 4OOIA 2HXIA 4RLFA 4DK1A 1MBEA 3L2VA 1XE1A 3MEXA 4U9UA 3GQ9A 1U0JA 4A3IJ 2JPCA 3FWEA 4UVCA 2Z3YA 5DCMA 5FKMA 2CUEA 3BG7A 5DN6A 4ACAA 2V1XA 3IUOA 1IN6A 4Y15A 2F2EA 1QPMA 5TRDA 1OYYA 1ZG1A 3GUDA 1PLUA 3OIPA 2BEOA 3GFMA 2NPFA 2V26A 2PBIA 1A5JA 4U49A 4RD6A 2GXAA 1ULYA 3ECHA 4NK6A 2Q6IA 5FA6A 2B63J 1WJFA 5B1AH 3CPWB 4ENJA 1YE9A 2ZITA 1KQ0A 3FK7A 2DTRA 3H3VK 1WOSA 1VQLI 1Q82D 3LSJA 2LR8A 3HEFA 2QMUA 2YSRA 4G7HF 3ERMA 4BE2A 5HDKA 1R71A 2QYOA 2W7ZA 1OGIA 4URRA 1BI1A 1K61A 4XN0A 3FKSA 4Y3OA 3G1LA 3OR1C 3X2QH 3CC7B 4X7EA 3ZC3A 2XGDA 3OYKA 5D5UB 2CNDA 3N4MA 3GZ5A 2QX3A 4O6JA 2VE9A 1XMXA 1QJVA 3FM3A 4IO9F 2BGCA 2MSYA 1HW1A 2VT2A 4JP0A 3BTLA 2NVYJ 3I4PA 4BYYA 3AAFA 1YO5C 1B72B 1SMYF 1YLFA 4A0ZA 2YU9J 4RD0A 3KYDB 3CP8A 3OOUA 2JA7J 2XTYA 2L7FP 3FHNA 5H6RA 1H9TA 3TQNA 2IS4A 5IYDJ 3BJAA 4PC6A 4X7DA 4ZC3A 1FRQA 3QU6A 3ZOBA 1D0XA 4FXUA 2BVLA 3ZQLA 2OTLB 3VSVA 3HRTA 2HYFA 4Z6YA 4DGWB 1WKMA 2P5VA 2IOUG 1U9OA 4M6VA 4A6DA 1AA7A 4M72A 2ICWG 2H27A 3SUCA 3BTCA 4U0WA 5D8LB 2VKVA 2XF5A 4E7ZA 4U0YA 2DA3A 5AIQA 3BG9A 1XSXA 4PJLA 1MH4A 2IGOA 1R5HA 2A68F 5F0FA 1BLIA 2DMTA 1YJ9I 3QAHA 5JHFA 4B3AA 4YIRX 1U9NA 2WY8Q 3CJTB 5BOXA 1YJNI 3EUHA 1FX7A 1QO0D 4FE4A 4TMZA 1U8RA 3ZBUA 3WNCA 2W6IA 1T98A 3EQLF 3VO1A 1DABA 1F43A 4BBRJ 2N8GA 2LKPA 4IJAA 2QENA 4IHXA 2PI0A 5DS9A 1ZR4A 4CZCA 1JGSA 2RC4A 3U9GA 3CUQC 1OKRA 3S14J 3E6MA 3HXLA 4BU2A 3WTVC 2ODLA 4HV5A 1K8FA 4EM2A 1J75A 2AS5F 1JJ8C 5E20A 4G94A 4RAFA 4MGRA 4M9XA 4CCKA 4PJJA 3HUGB 3QP5A 2PMZN 4PGOA 1FIAA 1TYWA 2BM4A 4FISA 4BAYA 1VQ8I 4E7IA 1DU6A 4RGUA 3VSKA 2BSAA 4ZYEA 1XDSA 2C4UA 4OMYA 1MBGA 5J1RA 3ABKH 2WADA 2IXSA 4U87A 1B8IB 1KCDA 2LY9A 3CW2A 2STWA 4G12A 1BX1A 4RD2A 5A88A 2KQRA 2VL8A 3CCVB 2NNNA 4D1QA 4QTRA 1Z9CA 1VTNC 1X4OA 3EQNA 3Q0VA 2QBYA 4JX4A 2A61A 4M3FA 1DGWY 3HAGA 4B09A 1OYIA 2VBWA 4HF0A 3S3OA 2JVGA 2X9DA 2WTEA 5IT9K 2EIJH 5L3GA 2PLFA 2PYHA 4YC5A 1UMQA 3V7AA 2VUMJ 3PFIA 2GIVA 4XM3A 4C2MJ 5E1XA 2OCCH 1S6LA 3NRVA 1FOXA 2NT6A 4L18B 3W2HA 4BY7J 1VF9A 4CGZA 5F4OA 3CLQA 3PSSA 3BP8A 5LHHA 2KKOA 4XKBA 2R92J 5GV8A 2PQ8A 4N4OB 4V2FA 1X3ZB 3DWLE 2M7BA 3S16J 3JCUC 2GBYA 1P92A 1GDTA 3AKZA 3DPTA 1K6YA 4M3DA 1LJ9A 1P4XA 4JOMA 2GM4A 5HOOA 1OMIA 2V1NA 4C2LA 3S3NA 4FCYA 2DFFA 3LVBA 5J3LA 1FY7A 2Y0SN 4FT8A 1Q9SA 2E34A 3F8FA 1RR7A 1UHMA 1PP8F 4AC9A 3IL2A 3F8BA 1ZK8A 1USSA 3FKIJ 4C30A 2XEXA 2XF7A 2HKXA 4AVPA 3RI4A 2KZVA 4XIDA 4QWQA 5KW9A 2RNJA 3H0DA 3BR2A 5HS8A 3S32A 4U7DA 2OBSA 3ZPNA 2VYQA 4IQJA 1P7JA 1QVTA 1ZGWA 4XLEA 4P2NA 3WTYC 2CS3A 3GVAA 3DLAA 2ZZQA 2DCEA 2ZJRF 4C2UA 4P12A 4UHTA 4EVIA 3RSNA 5HNHA 3AGQA 4M0LA 1SFKA 3S2WA 4XQFA 3E6CC 1KK0A 5CQGA 3QYFA 1HSTA 2KLOA 4CCMA 3AG3H 2HGCA 4HSRA 4IPAA 2DMPA 4Q4ZF 4JQFA 5B3SH 5BPIA 1MDMB 2CV0A 2K9NA 5LFAA 1MD0A 2A05A 3BQYA 4Q5SF 1YITB 2B7CA 1SFOJ 3QPTA 1HA3A 2CU7A 4MEXF 2O0VA 1NG7A 4XLNF 2L02A 3HZJA 3E5XA 3K1MA 4XL9A 4P9FA 1UD2A 1VQ9B 1O7LA 4Z06A 1KONA 2NOGA 2HOTA 4OJ6A 3P7NA 2LNBA 3KZIC 4BH9A 1R9TJ 2DW4A 3DKWA 3GFIA 4KDPA 2V7VA 4X05A 2EIMH 2YX4A 2VONA 1YHQI 2XGCA 2H1KA 1Z6TA 3HDDA 1SAUA 2DODA 2IGKA 2R4GA 1LKXA 3OOPA 3O3KA 3PUBA 4RB0A 5AN9A 1KQ9A 4CCNA 1DG1G 1IN7A 3BJ6A 1QGZA 1FNDA 3O2PE 3OYAA 2V31A 3HOUJ 1Y0RA 1EA0A 4HLXA 1Y0UA 2F4MB 1ZH5A 4PAAA 1VZ0A 3OS2A 2R7SA 5CJ9A 1QA6A 2Y2ZA 4LGWA 5IYCJ 4P1VA 1REPC 1OCRH 1CQXA 2GPJA 3ZN0A 1S5LC 3LMMA 1JKRC 4ZZLA 1LFBA 2FMLA 1ZARA 2HWVA 5DD8A 4YALA 3G3ZA 2X0KA 5FLXK 4YAOA 2PE3A 2NVQJ 1EP2B 1Z1DA 1KU3A 1R58A 4MFDA 4CA0A 2QZ8A 2TDXA 2EWNA 1U8BA 1VLYA 3LWFA 1U6GA 2RV8A 1VQ4B 3HHGA 3OFNA 1D5YA 1QBJA 3JREA 4NNJA 3WU0A 2VPLA 4YAUA 1YX2A 1KQSB 4NHJA 3WG7H 2VFPA 2M3AA 1PVEA 3RDIA 3RZDJ 2ZSIB 1BR1A 4PCQA 1RUNA 1Q1VA 2HKOA 4ZYHA 5J8FA 1KQ8A 5E3LA 4MNUA 1OCPA 1VNDA 3O8HA 4OJLA 1SANA 3B8HA 2VT3A 2HTJA 2ZXIA 3A2KA 1FLIA 1WMRA 1MJAA 2QSHX 3VODA 1G2HA 3OOCA 4DZJA 3PL8A 1X3UA 1G3WA 2M34A 2Z5UA 4HQEA 4KFCA 3E20A 4HIZA 1K79A 2WV1A 2UVFA 1ZRDA 1HZEA 2YWHA 2NT9A 4A3MJ 3GQBA 2CWEA 4HAMA 3QU3A 5BPDA 2NNYA 3KL9A 1OPCA 4YFKF 2E36A 5E3OA 1ZGJA 1XGOA 1G3TA 2G7UA 3FXMA 1F5TA 1O8HA 3P9CA 2ME6A 2DI3A 1IZ1A 4HNUA 2E2JJ 4M3EA 4HLYA 2JN9A 4PC1A 3A0HC 1O8JA 3K7AJ 5FNZA 4BBSJ 3MKWB 3EUAA 1R49A 1VQKI 1K4SA 1K9MD 4G6TB 2JSCA 5F1RA 2B0RA 2ZO4A 2RVCA 3CCEB 1IB4A 1CF7B 4V2GA 2ZXJA 2G9WA 2O8KA 3OEEA 4ZYAA 5FKNA 4Q7JB 2W6JA 3A8KA 1JTYA 1V54H 2D2WA 4EGYA 3RKXA 1N05A 1ZN2A 3CDIA 2CW0F 3VMWA 1X4PA 1Y6IA 2DMQA 2VBZA 3VYUB 4LIUA 1ERDA 2F1LA 3M1EA 3NAUA 1I3QJ 4Y13A 3CCRB 3G1MA 3ASPA 2UZKA 1O8GA 4LK0F 5E17F 4EJUA 5TV2A 1TTYA 4XICA 2IS6A 3U1DA 1R00A 3BPXA 1A36A 1GJRA 2CUZA 2QQBA 2ZFWA 2WAEA 3MCZA 2GQQA 3RKQA 2Q2EB 4UV9A 2CG4A 4GRIA 5IT3A 4KISA 2K3PA 1JA1A 3UR3C 1WSRA 1N8RD 3B90A 5FKOA 2FQ3A 3G4SI 1USTA 3A01A 3I59B 2DOGA 2A5YB 4M71A 4BL0B 1ZQ3P 2F4OB 2NAZA 2Y0MA 2M4GA 2X4HA 1V5EA 1G7CA 1FX0A 1W0UA 2FUG2 1ZG3A 2JRTA 3WGGA 1FMWA 4EM1A 2DEUA 3OV8A 4ENKA 2XB0X 1W0TA 3MKYB 2MABA 1B4AA 1POGA 1RKWA 4HQMA 2A6HF 4ESJA 2O17A 3A8IA 5DTDA 3DEWA 3U2QA 5FLMJ 3SY2A 1E3HA 2BYVE 3ASNH 6PAXA 1FPQA 4II2A 3VMFA 1YOVB 3HIFA 3CCQI 3ZZUA 1IW7F 1YQAA 3CJRB 4IL6C 2LSOA 4MLOA 5LHIA 2VNIA 4FWTA 5LHGA 2EA4A 2F5FA 4LG0A 3MZHA 1GHCA 4YHBA 2ZKZA 3W2GA 1EWYA 2WJYA 4RD3A 1IUYA 1MZBA 4NQWA 2JIZA 3ZQIA 4D5CA 2MYSA 1QCXA 1AHDP 3F8MA 2TCTA 4MEYF 1TP4A 2HI3A 2K4JA 1A6QA 1BIAA 3LSRA 3SZPA 2DA6A 2IGMA 3ZQGA 1J59A 2V1DA 5DCMB 3HOTA 4XN3A 4C0SA 4KYWA 3K4CA 1E43A 3E1YE 4M73A 4GGGA 3BC9A 1N0UA 1IAWA 1J2XA 3K6GA 1BR2A 3SQNA 2IJLA 2K3FA 3ZMDA 3CCSB 4FX0A 2C4TA 3BR6A 1OJLA 4P9UA 2M87A 1YW7A 2G0EA 3AG1H 3ZMTA 3HOVJ 3IRRA 4B3XA 2R7UA 1IF1A 1QVUA 2FRHA 1UB9A 4DZPA 2XUBA 3GX4X 3M4OJ 4PJNA 3AVVA 2CSOA 2IGNA 5CYVA 1SD6A 2OAZA 4E7JA 4IRHA 4X6AJ 4BY1J 4HPQA 1BI2A 2VXZA 2OA4A 2NS7A 5K5QA 1ZGAA 3JR9A 4QHYA 1OFMA 4BJTA 5C1EA 3JRIA 2FNPA 2W00A 2EA2A 2VBSA 3UKGA 1QZZA 2ID6A 2X1CA 5JVGF 2VNKA 1MH3A 2VC0A 4KIFA 1TQPA 2I1LA 3D1NI 5M5XJ 3HGYA 3V8JA 1KA8A 4MR0A 5TGTA 2DETA 2MFZA 1JJ6C 1TVCA 3OYLA 3ML3A 4UY8I 2IRFG 3LNQA 5LGNA 4WXDA 1IV6A 4P6VF 2ZBUA 2QEXI 2IEKA 3IWZA 4Y33A 4PSXA 3MD2A 3MZYA 3NWSA 3VNVA 4K2EA 4I0BA 3F72A 4BXFA 2YWGA 1Y1WJ 2HDWA 4G7OF 3KZZA 3Q38A 2K5CA 2R5ZA 3I58A 2HS5A 1HKTA 2KZGA 1VQMI 2E71A 3PA1A 4PABA 4OIRF 4M2LA 4MFEA 2XV4S 2F4NA 1LM1A 2VFMA 2CJJA 2L9SA 4KIGA 3FDYA 1XB4A 2KRCA 5DYMA 5A8AA 2NOJB 1W87A 1Z91A 2L0KA 3HJEA 2BF4A 1BM9A 2QY1A 4XOTA 3AFHA 2ACJA 3I55B 1S3JA 2P81A 2Y75A 1T5EA 2B5OA 4BQAA 2HMAA 2HYGD 1WORA 3ABLH 3FJOA 3RY8A 1ODDA 1MNDA 3I53A 4HF1A 3QYEA 3R6SA 2A07F 5GPCA 1YI2I 3CCMI 3KYCB 1WCMJ 1DP7P 4FETA 4NC6A 2VN2A 4MQ9F 2JA5J 1WP6A 2ZFUA 1B6AA 2XF6A 3V4GA 4ZYGA 1C0WA 1WZ2A 2VKDA 4BHBA 3HPGA 1KZHA 5C4XJ 2IA0A 4G1BA 4HE6A 1K83J 1XQBA 4KT5C 4ENMA 4ZTJA 2V7WA 1HW5A 1ETXA 4XKVA 5ILSA 2FEZA 5FO0A 1S9HA 2LF7A 2GZWA 4CUGA 3WODF 5C4JJ 3J7AO 2ZBVA 5HZAA 3W3CA 3OSFA 4OIOF 2QDXA 2M8GX 4EJWA 2EV0A 3S2DJ 2X53S 1SKQA 4I84A 1KMHA 1T39A 3OS0A 2ZZGA 3BCFA 4A93J 3W2FA 3KP7A 4JYKA 4YEJA 4ANJA 4AVZA 1UELB 3QRFF 2HZDA 2F43A 1EKEA 2QBYB 1W5CC 5CPRB 2YWEA 2D1VA 1FOKA 3MFKA 4KT6A 3H3UA 1XGNA 2R7FA 2CMPA 2UV1A 4P22A 5BSYA 2Z9OA 1WXRA 2J8KA 4W8RA 2OJED 4DBRA 3WXMA 3GTQJ 3KPHA 4CHUA 2PMDA 3K4MA 4CZZA 5IYNA 1FC3A 2KRFA 4YCQA 2F5DA 4IQ4A 2EB7A 2DOFA 4BNCA 2UWMA 1RZ4A 4F52A 2OBTA 1W36C 2ZC2A 4UVAA 2YPRA 3GTMJ 1TSPA 3H3ZA 3LSHA 2FE3A 4GFBA 1GVHA 1U2RA 4QLCU 3VYTB 3JRFA 1Z3XA 2B7EA 5ERIA 4EJOA 3KLNA 1K5CA 1O4XA 3SDBA 4WZLA 4RB3C 4OINF 2R7VA 1SD7A 2BOLA 1WTHD 1JT6A 3FMSA 4PUSA 3U2RA 4OPOA 3G2BA 1Q86D 3DBHB 4I98B 1UHWA 4YAWA 2AXTC 5F04A 4DJAA 1JNYA 2I10A 3BQZA 1GAWA 1VQ7B 5FFXA 2ISZA 1O3RA 1XC5A 3E97A 2CQNA 2E1NA 5FO5A 2RKHA 1X1DA 2DA1A 4LJZF 1T8IA 1PE9A 1BHEA 1UG2A 3PIOF 1NBMA 4S04A 3GO5A 4L8JA 2X85A 4ZH4F 3HC7A 3CC2B 3ZQQA 1M1KD 2XNCA 3JRBA 3FXJA 3M8FA 5FIUA 3F3XA 4DNTB 1UZCA 2H8RA 2F5CA 4PDKA 3KEWA 3MHPA 3WE3A 3OL4A 3GIRA 1YIJB 4Q48A 2Y9ZA 4WZTA 1TTTA 2DAOA 1Z7LA 3W5VA 1VQPB 4R1HA 4ZCLA 5TR9A 1FSEA 4TMVA 4A3GJ 1KZLA 4X07A 4HDVA 1R22A 2W82A 2X48A 4UB8C 5H6QA 1NDHA 2CV2A 3ECOA 3ISXA 2QXZA 1BIBA 2QQAA 1KU9A 2Z1DA 5IP9J 4LD5A 1QZYA 3I71A 4P9SA 2YR2A 3LQQA 1WRJA 1WI9A 4A6EA 4BDYA 4DYRA 4DNRB 2AHQA 2GLOA 1T6XA 2VFQA 1TW3A 4W8QA 2NZMA 1KJZA 3HBLA 4HWVA 1D1NA 2FJ1A 5DNSA 2XGXA 1B9NA 3R61A 4C3JJ 3C7JA 3BTJA 2Z8GA 2DMUA 4TV7A 3T5XA 1GR1A 5KVRA 4AIJA 3C2BA 1HDDC 4NC8A 3CCLI 5IOZA 2WAFA 2EIKH 3ASSA 4Z4VA 3QPHA 2DCUA 3Q0UA 5KCMA 1HG8A 3DKYA 4IRGA 1QUEA 3DEEA 2HR3A 2HQRA 4RDKA 3L2CA 4ACBA 3P5JA 2EFWA 2QF7A 1EH8A 4DQLA 3BY6A 4PZJA 4XRMA 2KDZA 3PETA 1TC3C 2P6SA 3SZGA 4UUSA 3DKXA 1T2KA 1FNMA 2Y9YA 5LBQA 5E8GA 1MMDA 1FIPA 3J80Z 1MBJA 4HG2A 3HYIA 1Y0YA 3K70C 1VQNB 3SZEA 4KMFA 2RDPA 2WC2A 2ELHA 2L4AA 3E5QA 3LSPA 2ZJ2A 1KQ5A 3OS1A 2O61A 1MJ9A 1KK1A 2YX7A 1ZTRA 4YZ0A 1N0VC 1LVKA 4X06A 2DFEA 1ZLJA 2UUZA 2M45A 2MH2A 1R5ID 2LY1A 2OYNA 3DTEA 5IP6A 3CF5F 1U78A 1IN8A 2ZB9A 3ERED 1S7OA 2NVXJ 4KIBA 2VQLA 2RGVA 4XRSG 3OY9A 1UD3A 4XORA 1MBHA 3Q9VA 1MSEC 2E1MC 4MTDA 1DDGA 4G7WA 4LK1F 3V76A 3VB2A 3WWGA 2UXNA 4ZDOA 2FMYA 2KVOA 2QUFA 5CKTA 1I6XA 3FXOA 4IF4A 5L3DA 4F55A 3MCAA 1Q81D 1IRGA 4L9TA 5LRRA 2O1DA 4LFUA 2OZ6A 2CYYA 3T56B 3LO8A 4DIQA 5KNLA 1DUXC 5JLWA 1T6SA 1J9IA 1QG0A 1WH5A 2KMUA 1S8NA 3V8KA 4RDUA 2Z16A 3R0AA 1X2NA 5J47A 5J6XA 3J7ZI 4IXAA 2EZHA 3OPOA 4HZFA 4PC7A 2R7ZJ 2VQGA 1VQ6I 4XLAA 1WFXA 1OFEA 3Q3SA 2LY2A 5LEKA 2HQNA 2VOPA 1ZUNB 1ONVA 3JAMK 3DBRB 5GTIC 1OCTC 4ROXA 5EG0A 1FNCA 3VDXA 2LDUA 1S72I 3H9NA 3HOZJ 3ASQA 1H8EA 1KYWA 2VBYA 1EFCA 2OZUA 4HYEA 4KH3A 3OL3A 4PK4A 4C3IJ 3SEZA 1FT9A 3GLLA 4BHCA 4B48A 2MD0A 2HOAA 4ZYDA 3S1MJ 5BQTA 3ZPPA 2ZMEC 1UHSA 3SZTA 2QTZA 1RQPA 3GFJA 4OOXA 2GJRA 1WSVA 1XG2A 2NTPA 3TOAA 1FYMA 4OIPF 3MAJA 2V7TA 3F6VA 3G05A 5J3OA 5M3MJ 2DIEA 2JA6J 4J0QA 2LMDA 4GYGA 1SVOA 2DJIA 3M07A 1E3PA 4A3CJ 2H8WA 2XRLA 1PP7U 2EINH 3KYLA 4OJPA 2PMUA 4YZQA 4BEHA 4HE5A 3VWBA 3CUQA 2Q1ZB 3LQRA 4ON0A 2LFBA 3SFIA 4UAJA 4KKUA 1EFTA 2OQRA 1WJAA 2QM3A 5F4MA 3P27A 1ETYA 2J5OA 2XB5A 4HX7A 1T08B 4PSWA 3EQOA 1R4MB 1WOOA 3RZOJ 3ONYA 4PGHA 2DQRA 5F6FA 1FNNA 2PYGA 2ZL7A 1ON2A 2XAHA 4KUMA 3ZR8X 3A01B 4W97A 1XN7A 1XG1A 4Z2YA 4OWRB 2OTJB 2OU2A 3DPUA 2DMNA 2FU4A 3IH3A 2GOXB 2HU9A 3TOBA 1WWXA 3WE2A 3FXUA 2WBMA 3EDPA 3JQQA 2BY2A 3LAPA 3AVWA 3SQVA 4IHWA 4G6IA 2PFBA 1D3YA 4N4NB 3A4CA 5LLQA 5EEAA 2HVQA 1E3ZA 3ZQ7A 3CMEI 2EZKA 3Q6QA 1YYVA 2DA5A 3I56I 2KL4A 4KN4X 2IS1A 4KMUX 1B59A 1FTTA 2D1HA 4I6ZA 1YLOA 2QYUA 4M6XA 5HVQC 4A3FJ 3KP5A 3GYHX 4QPQA 4JMQA 2VE8A 3OYGA 4LG0B 4X7CA 2M2EA 1MBFA 3PNTA 4OZZA 1TUIA 5E3NA 2ELJA 1DDIA 3I64A 4KKSA 1TLHB 2V9VA 4NQWB 1PUEE 1I1GA 2XNJA 3HRMA 3G6EI 2COBA 1D8JA 2M1BA 4UUVA 5J8CA 2A6EF 2DOEA 1U5TA 3GVJA 1K28D 4L5IA 1COWA 5IYQA 2HYJA 3CB4A 1VQLB 4XSZF 1JA0A 1AWCA 4Y7CA 2F6CA 3PQJA 4YG2F 1RUOA 5CVVA 5HLIA 2KRHA 1BR4A 3CC4I 2M7AA 1MKMA 1U5TC 3WBJA 3OSGA 5ICCA 1QRCA 1X3WB 1IRFA 3K1PA 1EJ9A 3U1KA 2JJ2A 1APLC 5DUKA 3ASRA 4H0EA 1WSUA 2V7XA 3DFGA 3JX8A 4A3DJ 4J01A 3DU1X 4Z05A 1ZRFA 2BVMA 1XS9A 1NH3A 2E19A 2XAUA 1VQOI 1UD5A 1GQ8A 4LBWA 3OYHA 3MZ8A 1AMOA 3PSIA 2P5KA 1PUFA 1D0ZA 1H8HA 2VKEA 2KFDA 1FRNA 4OU0A 3HPHA 2F3LA 1FBSA 1W1WE 3LSIA 5KAFC 1H0MA 1FYKA 2KP6A 3A03A 2E2HJ 4QVAA 2XT4A 1L3LA 2R6HA 1F4KA 2L3DA 3FPKA 2INUA 3JRHA 3H35A 1SEUA 1O3TA 2XDVA 2V4DA 4Z4TA 2VC1A 3CTAA 3CJQB 3OZWA 2INVA 4B4DA 2ETHA 3FXQA 3L2RA 1B1BA 3T0YA 1ZM4A 2ZTNA 3WTUC 2OQGA 2DERA 3K4LA 4GXOA 4RJLA 1YJ9B 1EV7A 4Z4ZA 4F7DA 2PMHA 3IV5A 2R5ZB 2GA1A 2BW3A 1D1AA 3HSFA 1G6NA 2KPMA 3GW2A 1GAQA 1FWZA 1Z6RA 2PLYA 2YWFA 4TMTA 1RESA 2CFOA 2K40A 3GMEA 3GRHA 3MMYB 5H5JA 3COAC 1OQYA 3GTGJ 4BPRA 3MN2A 1R1TA 1FSHA 3S2HJ 2BPOA 1BPLA 2QVOA 1YS7A 2QE7A 2QLZA 1CGPA 4L9NA 4XR6A 2ZZFA 3OYJA 2DK8A 5KAIC 1WJBA 1G3SA 3GVKA 2BY1A 1VQ8B 3OJWA 4RB1A 5FO1A 4CXFA 3UNGC 3CCUI 1OLTA 2IVMA 2F5EA 4XLPF 5DSZA 2OF7A 3MVPA 2B0LA 2PEXA 3CCRI 3OIQA 5GAEJ 1R1VA 3GXOA 3LMWA 3C3WA 1NK2P 1FP2A 2DYRH 3JU4A 1BJAA 3CCJI 1VFCA 2FX3A 3PNVA 2XRNA 1A35A 4TN1A 2L5QA 3B02A 4RGXA 4WQMA 4EQQA 2H94A 3JTGA 1S4MA 2ECBA 2OC6A 1KTVA 2M5WA 2P8TA 1GUUA 1O8KA 4X0CA 1MW7A 2PX9A 3BR0A 4XRFA 1O8LA 4JX6A 3Q5FA 4B44A 1JB9A 1X1PA 4UB6C 3IWFA 4UV8A 1PKVA 1JHFA 2VI6A 2W84A 3CMAI 2AHOA 2NRAC 2CRVA 1EH6A 2GJPA 4G7ZF 5FKLA 2R93J 2E5ZA 2H6CA 2GK7A 3ML6A 1IGNA 2W57A 2WR8A 1AKHA 4A0YA 1QGPA 1Z3YA 3T8RA 4EW9A 2VNJA 1E3XA 3LNNA 1P6RA 1BI3A 1MSFC 4IHVA 2BV3A 4I01A 3ZZTA 5FLXZ 3BY1A 3A1YA 1P2FA 3TDUC 2R7RA 1ETKA 1U3EM 1GVDA 1D8TA 3N05A 4JK1X 1W5SA 3A02A 4XRSA 3HOYJ 3KCCA 2XC7A 1O8EA 4N3NA 1SFEA 2PG4A 1YS6A 3DDYA 1RI7A 2WPDA 2QZAA 2JJ1A 2FOWA 3AVYA 4YRVA 1MJBA 4OAZA 3ZMSA 4EH1A 2NTQA 1EE6A 1M1EB 4KN7X 5CVJA 5EEGA 1HF0A 2VQHA 2PJRA 3CQZJ 1QGAA 3FM5A 1T6ZA 4GO1A 1UD6A 1D0YA 3BG5A 3BCBA 2BZTA 1LDJA 1M90D 2X6WA 2WZNA 1OFCX 1WPKA 3W6KB 3D5LA 3IKTA 3CCSI 1XPXA 1FDRA 1V55H 3K0LA 4YAFA 2JVHA 5GV7A 2BBYA 3IKVA 2O7OA 1XCBA 3IH2A 5FD5A 3F22A 5FLVA 2C2WA 5ICFA 2V9PA 1HSJA 3GBGA 3OIOA 3EUKL 3GLXA 3MQ0A 2J5PA 1IB0A 2FVGA 1X2MA 5HDNA 5DUIA 3RJPA 4RD4A 1IXSB 2ZNYA 3TMOA 4Z4WA 1AU7A 4P96A 2IA2A 4MQVA 1BOBA 4XD7A 2DDAA 1O57A 4BKXA 1ZELA 3EETA 3H9QA 3LSKA 5GP9A 1BC8C 1JXSA 2LLKA 1BJKA 2ZTGA 3PVDA 3QFSA 3AG4H 1G7TA 2M8EA 3TW6A 1N08A 2CK3A 1QA1A 5H20A 1ZLKA 4D0PA 4Z4SA 1Y0NA 1JKQC 5AMVA 2GWRA 1V5FA 4AWXB 3BG3A 2DY1A 3B78A 3W5UA 4XBFA 3H0GJ 4AYBA 2W24A 4ZV4A 2X6OA 1ETQA 5BMZA 1JE8A 1V3FA 2GXGA 1XD7A 4RAGA 4XSXF 3G71I 1YHQB 3VSLA 2BM5A 1XSDA 2C5BA 3LYCA 2E35A 3VNUA 2PECA 1TYUA 2STTA 1LVAA 4C2TA 3OZVA 2P3MA 1Z77A 4U0VA 3A3BA 1YJWI 2BY0A 1KTWA 1WHUA 3BCAA 2HFHA 3ZQHA 1SFUA 2EPFA 2E60A 3IH4A 4IEJA 2EZLA 3F8NA 4HDUA 1VQ5I 4LBYA 4EV0A 2FOKA 3GZNB 2CBXA 2WAQA 4HV6A 2BV6A 4Y17A 4EM0B 1LPQA 5D4SA 2JRMA 3WG9A 3Q9SA 2JSPA 4U4BA 4PC2A 2EFOA 1YX3A 2M4KA 4PJ0C 4UUSB 4IKFA 5LGTA 3M7GA 4RGSA 3L2QA 3FISA 4LLLA 1UJ8A 1RIOH 2ESNA 4L5JA 4E7LA 4E7SA 2QSGX 3CDHA 3ZXSA 1TW2A 5IYRA 1F36A 3ABUA 1K73D 1D1BA 2E1MB 3HGGA 2DT6A 3TBIA 3ULQB 1V4RA 4EGZA 1WOPA 4BS9A 4OPVA 1IO2A 2QKLB 1X58A 1FTZA 2NV4A 2Q0OA 1JHHA 2AQFA 4CQJA 4BGDA 1G3YA 3BR3A 1LE8A 2BY3A 4CCJA 2JA8J 4OM9A 4YFNF 1Z05A 1VHOA 1AIRA 2MH9A 3KX2A 2K02A 3T53B 1QUFA 1FZPB 3WTWC 2ZL6A 4RAZA 3SDGA 4AIHA 1A8PA 1TYVA 5JLXA 1K78A 3ZMZA 2K27A 5BSXA 3ZQFA 2UXXA 4IVNA 2IAIA 2VIXA 3LFUA 3OYFA 3RIQA 2D3NA 4GCVA 2MA3A 4HOBA 1IUFA 3DTKA 4GYIA 5E1ZB 4ZTFA 2XT2A 1MIJA 2ZJPF 4K1XA 4NB5A 1Y8QB 3CZ6A 2MC3A 4QFMA 2BGIA 3V7CA 4OJ5A 3GTPJ 2LH9A 1TWCJ 3TDZC 4E4HA 4X0GA 2HVRA 4Y9UA 1VQKB 1W36D 5EZGA 1SVMA 1FBQA 4ASNA 2V6EA 3KP6A 4YZXA 2FX0A 1SFXA 4G6DA 3KEOA 2DQLA 5J1UA 1TYXA 1ZHFA 1SKYB 1VI0A 3LSTA 5EG0B 2Y30A 2ZXWH 4AIKA 1G59A 2QKMB 2E2IJ 5FGMA 1NHCA 2XVCA 1J9ZA 2GQFA 3O8GA 2IPQX 4OAYA 3QQAA 3LA2A 1E62A 5JFRA 1P4MA 2X6XA 2QWWA 2C5HA 2CW5A 3CXCB 2TRTA 1YW9A 3PSZA 1MMNA 1G4DA 1JT0A 2WYRA 1N77A 1XFOA 2XZLA 4I76A 4LMYA 3OW7A 5HLHA 3CDLA 2E1RA 1QFYA 1X19A 1FNBA 3BPVA 5IOYA 3OYEA 3JTHA 2DN0A 4DW6A 3G4SB 2VJJA 4DK0A 4OOVA 3HKZN 1KU7A 4CSWA 5AIPA 4DNCA 3CESA 4M74A 1H89C 2OBRA 3CD6B 4BEHB 5K1YA 5EDNA 1LFUP 4ESFA 1TQIA 3CUQB 4WZEA 1WVRA 4QV2A 1W34A 4M3GA 2LG4A 5KK1A 4X1EA 3HOSA 1QFJA 4OPSA 2XZPA 4E70A 5KHDA 1E3OC 2LRDA 3LQ6A 4ZGNB 4AD9A 2FF4A 4XNFA 4LB5A 2XPWA 2O0WA 1I39A 3SXYA 3CO7C 1HKQA 3LA3A 4EATA 3BCDA 3LJYA 1GVJA 2XSDC 3OR2C 2NS0A 4MHGA 1VQPI 2ELKA 2BHYA 2DT7B 3JRGA 2DJNA 2WB1A 3RTRA 3CCQB 4QSHA 3OAAA 3VFZA 2NS8A 3BC8A 3JRCA 2XOKA 4M4SA 3J81K 2QA4B 2H1LA 1TNSA 3RQIA 2VBUA 3FY3A 1XMKA 1W5TA 3PUMA 3K10A 5L3CA 5F08A 4JX5A 1IN4A 4BJ5C 4ASUA 1DBOA 4S0HB 2NVTJ 3Q39A 2EILH 1FP1D 2JK3A 3MWMA 5CDFA 4DQKA 2ZL5A 3GF2A 5J4VA 2VB6A 4CO8A 2EBIA 3EYYA 4KICA 3JW4A 2CQKA 2HPIA 5B1BH 4AUXA 1WJCA 3RPQA 4BUPA 3OYMA 3F21A 3I54A 1LQ1A 2COMA 1BN5A 4A69C 5A89A 1KK3A 1QZEA 2HXOA 2KIFA 4RM2A 3CLOA 3WGHA 2O6WA 5E18F 3AL0C 1RRJA 3W6VA 2Q8KA 3CF2A 3K70D 1T38A 3ES9A 1LB2A 1LNWA 2A6TA 5HS9A 1U5TB 3S8PA 3E7LA 4ZDPA 2X8KA 3CRZA 1DARA 1BW5A 1JTXA 4A3JJ 2DLLA 4CCOA 3L9FA 2CRGA 2CV1A 1SAXA 2CQQA 4CDGA 1R5NA 2L9NA 1X0CA 3M1CA 3QWLA 2DXIA 1WJEA 1OOCA 5EEHA 5A2QZ 2H6BA 4OJOA 4BDZA 3IAM2 2V1UA 4HNVA 4QUZA 3FPPA 2AQEA 2FSWA 1IXCA 3OMYA 3U6BA 1NB9A 4M9ZA 4WXCA 1IDYA 3TGNA 1WH7A 3H5AA 2JJ7A 2HCJB 3RPUD 2VBKA 2JN6A 4G8XA 1CLWA 1F60A 2W1OA 2CFXA 1P4WA 2VQCA 2QEXB 2NVUB 1PUFB 3R6JA 1R1UA 3HOWJ 4ZCMA 2ZCWA 2C78A 3ONQA 4M53A 1ITYA 1FEXA 4TMWA 2GIZA 2X6YA 3TL4X 1FJLA 4Z4RA 3DBLB 1CNFA 3WNDA 4A0XA 1E64A 2KT0A 3OYIA 3GEZA 1TT5B 1OGJA 1WDTA 2CH0A 2VBTA 4BJ6C 5L3BA 2XAQA 2VPRA 5L3EA 2LOOA 4B47A 4LBZA 1OFDA 3GQ7A 3KIOA 1FBUA 2D45A 4GDFA 1OYWA 4TMXA 2ESHA 1D2EA 2M30A 1NJID 2EQRA 1T33A 3ESWB 3LSGA 3R4KA 3CMYA 2IQ7A 1H80A 2LP0A 3P9IA 3LAJA 4WX9A 3CC7I 3KZYA 2M0CA 5FB2A 1JTAA 2BW3B 2QGUA 3HKZA 2CGPA 2FBHA 1MNMC 1MMSA 1R5BA 5F27A 3HRUA 2W85A 1W7PD 3SYTA 3NE5B 4IX7A 3CCMB 2L2OA 1YI2B 1UG0A 2BXYA 2ZSHB 5D5WB 3WTSC 3B82A 4F92B 3BR5A 5F64A 3RKYA 2P4WA 4HX8A 3PQKA 2EFPA 3BY2A 5B66C 1N75A 3BZ6A 1GT0C 3R0JA 4RCZA 2OTLI 4W8TA 2O8XA 2RQPA 2C6YA 1FOYA 5EZHA 1MRZA 4UUTA 1IJFA 4W1UA 3RYPA 1F9NA 2VJIA 2BM7A 2VKHA 1TWAJ 2OK7A 2WY7Q 1Y8RB 4NC7A 3TH0A 5DEQA 2LBFA 2DYIA 2MGQA 1RQRA 3NAWA 2IBDA 4L5EA 3TP3A 1OCCH 2KIQA 1NTCA 3QPSA 3GVLA 3ZIAA 1O8MA 4P1WA 2LVSA 4V02C 3WY9A 2QSFX 3CP2A 2V79A 1K6OA 1EF4A 4J00A 3SYJA 2HDNB 2FQ4A 5IPAA 3RPUA 5D4RA 2LD5A 2D74A 3KRGA 2O04A 3TKYA 3PSFA 1DGRM 4O5VA 5ICGA 2XGJA 3QYBA 1H9GA 2XAFA 3K4JA 2AXLA 4CYCA 2BX6A 2VBMA 4D7NA 5LEJA 3M3YJ 2F4IA 1ZG5A 2OPTA 1LEAA 3CO6C 1IA5A 2VJ5A 2HNHA 4F7ZA 2HDCA 4P3YA 4CH7A 4N3GA 4I99C 1AKHB 1QU3A 4RLZA 3H9JA 1T56A 3ZP5A 1QQIA 2YUSA 3W2AA 3CCVI 1RMGA 2VODA 2VASA 1SD4A 2K9SA 2O03A 4YDTA 1A04A 4WF2A 3DU5A 3TW7A 2ZJQF 2XAGA 1OFLA 2NXNB 4H4KC 5CVUA 1W9XA 4KNYA 1T0FC 2DPDA 2VBEA 4PFPA 4F91B 2VNHA 3OKXA 1UCRA 5D8KB 4WCGA 3FHZA 3HRSA 1ZYRF 1H42A 5EJCA 1W7PA 4D7MA 3H1CA 5D6EA 1W0KA 2W7NA 3BTIA 3V42A 2ZMEA 3W6JB 3VYSB 5J4YA 5IY5H 1G7RA 1WPCA 1UAAA 4YEIA 4QIWN 2PJRB 3AVTA 3E0JB 1ON1A 2I5UA 3OE7A 3GTOJ 3FXKA 3PJRA 3SJPA 1E79A 2A3SA 2MW8A 5DCFA 2V7UA 1K4ZA 1ZM2A 3CUOA 3BT9A 5EGOA 1H85A 2GK6A 3A1PA 5HZBA 1MGTA 2R7QA 4Y7NJ 2K9QA 3J7YJ 3WBKA 1OR7A 1KK2A 2VJ4A 3ZPLA 3JAMZ 1X1AA 4RGRA 1O7FA 2V9KA 2D9RA 3OWTA 5IK2A 3WQZA 2CC2A 3CCLB 2HOEA 2RN7A 1DPRA 2BXZA 3OYNA 1R5OA 3KP2A 2O5RA 1OR7C 2EV5A 1EP1B 4RM0A 1V0EA 3VPRA 4P55A 3QFRA 2CUFA 4BXXJ 2DOAA 1GXQA 5DV5A 3R60A 4YIIA 4NUBA 3F9KA 1I5ZA 3ZMUA 1AIPA 4HSTA 3WHCA 1QH0A 3FMRA 4UZUA 3ZRGA 4X8IA 3DXJF 1P7IA 1X1CA 1NK3P 3PENA 1ZM9A 3HSEA 4BACA 3E1SA 4KITB 5L3FA 3I4NJ 2Q6LA 4P5OA 1J7KA 2K9MA 4D9JA 5ILVA 2WV0A 2QGGA 3I3LA 3JQPA 1N78A 2AO9A 4DOZA 2CW7A 3D0SA 3BQJA 4IZZA 1TQMA 4U7BA 1JGGA 4HRIA 2KJBA 1P9QC 3HTUA 3BZCA 2DA7A 4XMYA 2X3UA 4UVBA 3NQOA 2L7KA 2H09A 3L09A 3SJMA 1YITI 3PUNA 2ID3A 4E7KA 1DBGA 4A3BJ 5HS7A 2KJCA 3EUHC 2XTXA 2NYXA 5FROA 2W25A 1IC8A 2WA0A 1VQ9I 1PJ6A 1VF7A 4FK8A 3ZSCA 3AVUA 2O3FA 1HKSA 3JQRA 2KISA 2IA1A 4RA2A 5FJ8J 5E6TA 4P26A 2DO7A 1ENHA 1QHGA 2K4BA 1XB2A 2P0WA 3K9TA 2OV7A 4BE0A 5GPAA 2Q6OA 3KEQA 2X3HA 1EP3B 1EXMA 2E7WA 5TJJA 3V7RA 2XASA 4RB2C 3A3GA 3ONUA 1TWGJ 3GFLA 1LFPA 3WTTC 1LE8B 3K69A 5DS0A 3NB2A 2J7KA 3SEQA 2RNGA 3B6CA 4J19A 2QCOA 3M8JA 1OB0A 4FHTA 1IG7A 4A2UA 1QHHD 1I18A 1V0FA 1YRNA 1IN5A 3OEHA 1K78B 2BM0A 2E1OA 1QRBA 1PJ7A 4ENNA 3PO3J 1V5VA 3OYBA 2VXDA 4AC0A 5IT9Z 1VQ6B 4M3BA 3M9AA 4HF2A 3OP1A 1JUPA 4YELA 3CMMA 4B43A 2RAEA 4PFOA 2LTPA 3I5UA 1S72B 2BM1A 5KSWB 2R7XA 4CCLA 4RD1A 2Q6KA 1VQ4I 1VBLA 4FASD 2G7HA 3D5SC 2V4JC 3ROUA 1BW6A 1S29A 1RC9A 2P7CB 1QA2A 1RU4A 3CCYA 5K5RA 3W2VA 1NHAA 5IP7J 1CQTA 3GTKJ 4I7HA 1UD8A 2DA2A 4ZCIA 2GXBA 3WTXC 3B8YA 1A6IA 2DK5A 1QPIA 3I0TA 2GREA 4TSFA 1QGYA 2R5YA 2L01A 4FQGA 2OCEA 3FZVA 4FE7A 5E3MA 3S1RJ 2L9RA 1E1RA 2F1MA 2QN6A 2VZLA 2XGEA 1IJEA 3A35A 4WWVA 1R6RA 2R7DA 1KCCA 1F1ZA 3HB9A 3WU2C 5F0HA 3PO2J 5FFZA 3SHFA 4EEFG 1S0UA 1G7SA 1I7PA 1O3SA 5GTHC 1YJNB 5F4JA 4NBQA 1Y1VJ 3PA2A 2DDBA 4HBLA 5B5EC 2MLKA 3RQ4A 4BQOA 2XTWA 1NG6A 3PNYA 2BN4A 3U6KA 4HNTA 2Z6BD 2IP2A 3DP7A 3QOEA 5CVIA 3K4NA 3EYIA 1SD5A 4AYBN 3PUFA 3SLDA 1L0OC 5JMCB 2EV6A 3DCFA 5HODA 3L1PA 2EFGA 5E1WA 1K8AD 4JBAA 1B9MA 3B73A 3PFYA 5EMNA 1L1IA 3CCEI 5HNFA 1KU2A 2FBKA 3QSYA 2PN6A 3VSUA 4Y52J 1WJ5A 3FMQA 1HF2A 3MMPA 4YXWA 1JJ2B 3ABMH 2L7ZA 4V19K 2BE5F 2CQXA 1I1SA 4W8SA 3FX3A 5DD4A 3SLNA 5JLVC 3GCMA 2ECCA 3I4MJ 3CMEB 4ABZA 1DU0A 3DPLC 2K9LA 1QX4A 4RPDA 1OISA 4RMNA 3I56B 1W2BB 1S7AA 2WAQN 4N9HA 5HDGA 2EH3A 2E5NA 1RWRA 3K4KA 3QE2A 2HPMA 3KFWX 2DFHA 4L0ZB 2DBBA 4B3FX 1WI3A 2FA5A 1N25A 3BOQA 1R23A 1XDUA 3J81k 1RNLA 4II3A 2DFIA 4Z1MA 3P9KA 1DP3A 2BMWA 3KP3A 2Z33A 1BMFA 2Y48A 3KLOA 3BH7B 4E6KG 5EF6A 4A3KJ 4YIFA 2KDOA 1XMAA 2KIMA 4M9SA 3G6EB 3JURA 3E5UA 1W0JA 2X51A 5C44J 1GV5A 2CW8A 4DQ2A 3GTJJ 3AL0B 2XKOA 2PMZA 3L2UA 4IOAF 1WU8A 1AOYA 1IDJA 3TP0A 1JRGA 1J5YA 5K7FA 5THXA 5LRSA 3L7WA 1E17A 3D5RC 3A0BC 1Z67A 4OOSA 4RLQA 4RS8A 5IYPA 1R5GA 3CC4B 2HOSA 4XOPA 2LF8A 1J09A 2I8DA 3D26A 1OCZH 3F0CA 3T9GA 3QFCA 3ASTA 3N97A 4R79A 4TT3A 4YZAA 5H2FC 5FRMA 1TWFJ 5FRNA 3K2AA 4MYTA 2VLAA 3W2EA 2YU3A 1VQOB 1R4NB 3ZUGA 4I09A 5F1JA 2C77A 3BWGA 3P4GA 5CLSA 5EYRA 1VLOA 4MYUA 2NSTA 4QPOA 3V8LA 2LKXA 3AG2H 5J35A 1NRKA 1RKTA 3V7SA 4A3LJ 1KC8D 3QP6A 2RC5A 1OGMX 1D8KA 3VYRB 1Y39A 2O6GE 5FD6A 2ME0A 2ZXHA 5C3EJ 2ZNZA 2WJVA 1T95A 2X1EA 4ESBA 1I8DA 3W2IA 4ITVA 1CNEA 2EWEA 2V7FA 5IYBJ 5BNGA 3ZQCA 1HCRA 3DV8A 2R7TA 1ZREA 3FK6A 4LG3A 2MD5A 2XSJC 3IAS2 1EZGA 2JT1A 4LITA 3FBIB 1CZFA 2DA4A 1BL0A 4FX4A 4DYCA 4Y9RA 3ISPA 1IHMA 2OK8A 2Y0SA 2L7MP 3BLYA 3VMVA 3B4NA 1Q7YD 5ILUA 1EFUA 1B72A 3F6OA 4IHTA 2BSPA 3G73A 4PGGA 2B9SA 2ZZEA 4IW3B 5IYWA 4DBQA 5ICEA 3RCOA 3KETA 1IRXA 2HTSA 2JWTA 3BZKA 2XKPA 4ZJZA 1NB0A 1TBXA 1JKOC 3DF8A 5J40A 4LB6B 1ZKGA 3CCUB 5HXBA 3GZ6A 2VFOA 1XCVA 1K7AA 3FXRA 3GTLJ 2XNDA 2A69F 4MXNA 3ZGKA 1MMGA 3FXLA 1TL8A 2JMWA 3H5RA 4AU7A 2D5VA 5CQEA 2W4SA 1HOMA 3CCJB 2O9LA 4WWCA 1TT0A 4IOCF 5DM6F 3E6BA 5E8IA 4RBOA 1EH7A 2WB1N 3BG6A 1P4AA 1OHHA 4U88A 3TO9A 1WGXA 3KP4A 1IJWC 1IDKA 5GADJ 1IV8A 5L46A 2M9HA 4KA4A 5M5WJ 5D6FA 2LBFB 5TY0A 2E7XA 1STZA 1TZLA 3BROA 3SKBA 3MKZA 3I55I 1PYVA 3WGIA 1DDNA 2EJRA 2XAJA 3CD6I 1OB5A 1XGSA 2EZIA 3A8JA 1K4TA 5HLGA 2R7WA 1R7JA 4B4CA 3IP4B 2LREA 3LQEA 5JHUA 3CMAB 3HUGA 4G5GA 2FD5A 2X0LA 2KIUA 3FBNB 3JSPA 3N90A 1QQ1A 4XLHA 1XX5A 3W2WA 1HVXA 2FXAA 4ZGQB 3CPXA 2XPUA 1YX5A 3HM5A 1B8IA 1KYZA 1LUJB 3SJZA 3JRDA 1HW2A 2LC2A 3H5NA 3JSOA 2MBFA 1ZR2A 4E7HA 4OIQF 2KHMA 3WHBA 3TEDA 2VBVA 5HKKA 4A3EJ 2JDIA 3HG9A 3WU1B 1BA5A 4CYCB 3H94A 1W4MA 1D1CA 1TWHJ 4HEA2 4ZZDA 3S17J 1VHEA 3UW0A 4S05A 1JUSA 5HLTA 3BJOA 4RDJA 3NEUA 4OMZA 4N0BA 2QA4I 2QQ8A 3GQ8A 1EFRA 2MC4A 4GQNA 1ZAOA 3IRQA 1E63A 4B1RA 3WYAA 4B3GA 1DPUA 1BBYA 2EK5A 3SFZA 1LDKB 1YIOA 1HC8A 3PIPF 1GLNA 1SM4A 1BJZA 2LZJA 2GA2A 2DTZA 4A5NA 1BI0A 2HVSA 3W5HA 4Z4UA 3H09A 2MG4A 1YG2A 1IDZA 4N9IA 5CVRA 3BH4A 3E3VA 3AVXA 1O3QA 3RKWA 2K7LA 4CICA 4LLNA 4Z03A 4LBVA 4ETSA 1QFZA 1LLZA 1VJSA 2UVEA 4NBSA 2OD5A 1W7PB 1O8DA 2ZMEB 3O6BB 1ZM3A 3S1NJ 2LKSA 3C18A 2YS9A 4L9VA 5FKKA 4C43A 2J8IA 5LD2C 3AK5A 1GV2A 4HA8A 4ZDLA 3DLLF 2JQ7A 2XZOA 1HDPA 1TLLA 4A5MA 1MABA 4KKTA 2XC1A 2FNAA 1TNTA 4C3HJ 9ANTA 4P25A 2IS2A 2HQ5A 2HZTA 1Z21A 1FOWA 5EGOB 1SC7A 3FKJA 1HA8A 3QPLA 3C2HA 3JRAA 1HXDA 4RAYA 2XROA 1VQ7I 2F5VA 3WTZA 4WK8F 2A5WA 3G71B 1HQCA 2XPVA 4CYDA 3ZN1A 3DU6A 3VEPA 3HL2A 3P26A 4Z4YA 1I3AA 2M0MA 2P7VB 3H36A 4XONA 4NCNA 2XHKA 1FYLA 1YJWB 4XLCA 3S3MA 4RPBA 3OJXA 5JI6A 1QRYA 4G7XA 4YFXF 3CC2I 3LOCA 1PJ5A 5FL7A 2JPBA 1Q1HA 1VQ5B 4M6YA 3G1OA 2L4MA 3LSMA 3IC7A 1MDMA 1YIJI 3L00A 1KD1D 2HLDA 5LMZA 3OYDA 3KEYA 3DEUA 2NSPA 4TKOB 1BC7C 1RETA 2K85A 4LC0A 1OB2A 3ZZ0A 5JBQA 5M5YJ 3T8TA 4H9GA 1EA3A 2Z99A 4R71A 5B6IA 2QQ9A 4UNOA 4WZKA 1S7EA 1R36A 2JZYA 2L9VA 3J7AY 3ZBTA 1O8FA 1PXZA 1YW8A 4UZFA 3K2ZA 1F20A 5GAGJ 4EJVA 1PJRA 2R9VA 5ED4A 4IRIA 5AONA 3S93A 1RR8C 4IHSA 1BQEA 2E1CA 4RM3A 5K5OA 2D3LA 5BS6A 3C2GA 1LLWA 2LYCA 1XTAA 1HLVA 1E0EA 2DYSH 2RREA 1U2WA 1B23P 1JI8A 1JUMA 4MTEA 3REOA 3ZMVA 3J81Z 2R0QC 1ETWA 3F8CA 3TO7A 4Y4RA 4B8XA 2V7QA 4X7FA 4BQNA 1X1BA 1Z0XA 2P5LC 4QVJA 2R3SA 2CUJA 3CJNA 5GAHJ 4AF7A 4LLGF 5E79C 3OYCA 3LFKA 3HOXJ 1N07A 2L54A 5A2QK 2GJKA 3BH6B 1I50J 2RQQA 1VQNI 1OCOH 1UMKA 3NARA 1YTYA 1YRNB 2O0YA 4Q47A 2V6CA 2JA2A 3B6AA 4L0YB 4MO7A 4I0AA 4PMHA 3Q0WA 2JTVA 1H88C 4NDLA 4NK8A 4UXNA 2HEOA 5TISC 1I6HJ 1N06A 3QOPA 3HSRA 2IT0A 1BX0A 5C1CA 2CF4A 4PC3A 4XK4A 3ABTA 3S1QJ 2F48A 3ELKA 3R6KA 3FIWA 1UFMA 3WNBA 1KGSA 1MBKA 3HHHA 4KJZA 3M8EA 1QVGB 1OGOX 4YFOA 1PDNC
chains in the Genus database with same CATH topology
5IK2A 3WQZA 4C9YA 3OIQA 3OYNA 2O5RA 1OR7C 2IGMA 3LMWA 3JU4A 3HOTA 1V0EA 4XN3A 3K4CA 3I9V2 3PNVA 1E43A 3BC9A 2L5QA 2DOAA 4OZYA 3K6GA 3ZCOA 1BR2A 4NUBA 3F9KA 4HSTA 2R7UA 4UZUA 2Z2SB 3ZRGA 1X1CA 4B3XA 2OC6A 1WJDA 3E1SA 4KITB 4BACA 1O8KA 4P5OA 1MW7A 2K9MA 4XKCA 4D9JA 4PJNA 4F93B 3I3LA 2IGNA 4BE1A 1E1QA 1N78A 1O8LA 4DOZA 2CW7A 3EPZA 3U21A 4B44A 4E7JA 4HPQA 4IZZA 2VXZA 1PKVA 1OFMA 4U7BA 1MNEA 4BJTA 4HRIA 1Y56A 2NTBA 1P9QC 3L2WA 5C1EA 2W00A 4XKWA 2GJPA 3GQAA 4XMYA 2X1CA 2GOMA 1V5GA 3VSTA 2L7KA 2E5ZA 1UD4A 2GK7A 4E7KA 4BQQA 1DBGA 1Z3YA 2WZPP 4MR0A 5TGTA 3EUHC 4EW9A 2MFZA 1E3XA 3LNNA 4PJMA 5FROA 1VF7A 2WA0A 3OYLA 3A1YA 4LIVA 2R7RA 3N05A 1QHGA 2XC7A 4E0FA 1O8EA 4Y33A 1FMVA 3K4BA 2P0WA 4PSXA 2OV7A 4BE0A 3MD2A 3NWSA 3DDYA 2JUGA 3DQVC 2X3HA 2R7OA 3QODA 3H9GA 2WPDA 1G8XA 3DTIA 4BXFA 2JJ1A 2HDWA 3A3GA 4YRVA 4OAZA 2K5CA 2WSSA 1LFPA 2NTQA 1EE6A 3ZSCA 3SEQA 2RNGA 2VQHA 2PJRA 2L9SA 3M8JA 4F3QA 3FDYA 2KRCA 1OB0A 2NOJB 1UD6A 1D0YA 3BCBA 1QHHD 1I18A 1V0FA 3OEHA 2X6WA 3LL7A 4FXUA 1O88A 4XLFA 3D5LA 2M5SA 1QCXA 2QY1A 4XOTA 2JVHA 2X1DA 3AFHA 3OYBA 2VXDA 3T51B 3GBGA 1T5EA 3NWTA 3EUKL 1DQUA 4YELA 2HQAA 3CMMA 3TMOA 4B43A 4PFOA 1MNDA 3VR6A 1BOBA 4XD7A 3QYEA 2R7XA 4CCLA 1ZELA 3H9QA 3LSKA 1MMAA 2ZTGA 4FASD 1VBLA 3D5SC 1BN8A 2V4JC 2OUMA 4FETA 1RU4A 1WP6A 2CK3A 2ZFUA 2XF6A 3W2VA 2E1BA 1O8IA 2VKDA 1UD8A 3HPGA 5AMVA 1V5FA 4RLFA 4DK1A 3B8YA 3L2VA 4TSFA 4ZTJA 3GQ9A 1U0JA 4XKVA 5DN6A 4AYBA 3BG7A 1S9HA 4CUGA 3IUOA 1E1RA 3EQOA 2F1MA 3W3CA 3A35A 1R6RA 1KCCA 3VSLA 2X53S 1PLUA 2PECA 3OIPA 4I84A 2V26A 1KMHA 4C2TA 2ZZGA 3OS0A 3A3BA 3BCFA 4U49A 4YEJA 4ANJA 4NK6A 1WJFA 4AVZA 1UELB 1KTWA 2HZDA 3BCAA 2F43A 1YE9A 5CPRB 3RQ4A 4BQOA 1NG6A 3PNYA 2E60A 4KT6A 2UV1A 2CMPA 4HNTA 4P22A 2Z6BD 3QOEA 3K4NA 4W8RA 2WAQA 4BE2A 4DBRA 4URRA 2JSPA 3K4MA 4U4BA 3PFYA 4IQ4A 1YX3A 2M4KA 4XN0A 3OR1C 4Y3OA 5HNFA 4IKFA 3FKSA 2UWMA 4F52A 3OYKA 1W36C 3L2QA 3VSUA 2QX3A 1WJ5A 3LSHA 4YXWA 3VYTB 1QJVA 1Z3XA 4E7LA 4E7SA 4W8SA 3ZXSA 1K5CA 3SDBA 3OOUA 1D1BA 2E1MB 3CP8A 2DT6A 3TBIA 3DPLC 2K9LA 3FHNA 4RMNA 4BS9A 2IS4A 2R7VA 2QKLB 2BOLA 4ZC3A 1WTHD 1D0XA 2AQFA 4PUSA 4BGDA 2BVLA 2E5NA 3G2BA 3K4KA 1RWRA 3VSVA 2HPMA 4CCJA 4DGWB 4DJAA 3SUCA 4B3FX 1AA7A 1AIRA 3T53B 3KX2A 4II3A 2XF5A 4E7ZA 4Z1MA 1DP3A 1BMFA 4E6KG 1X1DA 1PE9A 1BHEA 2KDOA 4PJLA 2IGOA 3JURA 1BLIA 1W0JA 2X51A 2VIXA 3LFUA 2CW8A 5JHFA 1NBMA 4L8JA 3OYFA 2X85A 2WY8Q 3L2UA 2PMZA 3AL0B 1IDJA 2D3NA 3HC7A 3ZQQA 1JRGA 4DNTB 3DTKA 4ZTFA 2W6IA 3KEWA 3CZ6A 3D5RC 3OL4A 4RLQA 4OJ5A 2LH9A 4XOPA 1Z7LA 4E4HA 4X0GA 2HVRA 1J09A 4CZCA 2I8DA 1W36D 3T9GA 1KZLA 2V6EA 4YZAA 4R79A 4TT3A 3HXLA 2W82A 5FRMA 4BU2A 4YZXA 2ODLA 2CV2A 5FRNA 2QXZA 2Z1DA 2VLAA 1SKYB 4DNRB 4BDYA 1G59A 4W8QA 1NHCA 2QKMB 4CCKA 4PJJA 3HUGB 2NSTA 2NZMA 4QPOA 4HWVA 4OAYA 4E7IA 3VSKA 1NRKA 1OGMX 2Z8GA 2X6XA 3VYRB 2WADA 2IXSA 4U87A 1KCDA 2ZXHA 4NC8A 2WJVA 1T95A 1MMNA 2X1EA 2KQRA 2VL8A 2WAFA 4D1QA 1N77A 1I8DA 1X4OA 2XZLA 3EQNA 4ITVA 5KCMA 1HG8A 3DKYA 3OW7A 2EWEA 2V7FA 3DEEA 1DGWY 3HAGA 1X19A 3OYEA 3S3OA 2R7TA 2JVGA 2VJJA 4DK0A 4LG3A 2XSJC 4CSWA 3IAS2 3CESA 2PYHA 4BEHB 3SZGA 3DKXA 4LITA 3FBIB 1CZFA 1MMDA 2LG4A 4HG2A 3HOSA 3K70C 4XM3A 2XZPA 2Y0SA 2NT6A 3BLYA 5KHDA 3VMVA 3B4NA 2LRDA 3OS1A 4XNFA 2O0WA 4YZ0A 1LVKA 4EATA 2BSPA 3BCDA 4XKBA 3OR2C 2UUZA 4N4OB 2ZZEA 2DT7B 4DBQA 2LY1A 3RCOA 3DTEA 3DWLE 1IRXA 2WB1A 3RTRA 3OAAA 2M7BA 2XOKA 2VQLA 3BC8A 1UD3A 3OY9A 4XORA 3AKZA 4ZJZA 3DPTA 1K6YA 4JOMA 3FY3A 2E1MC 5HOOA 2V1NA 4C2LA 4G7WA 3S3NA 3K10A 3WWGA 4ZDOA 4BJ5C 2KVOA 4ASUA 1DBOA 5CKTA 4F55A 5CDFA 2XNDA 2VB6A 4MXNA 4C30A 3ZGKA 2O1DA 1MMGA 2XF7A 3H5RA 2KZVA 4AU7A 5CQEA 2W4SA 2HPIA 1WJCA 3OYMA 4BUPA 3H0DA 3T56B 1TT0A 3S32A 4DIQA 5KNLA 3ZPNA 4IQJA 3BG6A 1OHHA 2KMUA 4XLEA 2CS3A 2Z16A 3DLAA 4RM2A 1IDKA 2ZZQA 2DCEA 4C2UA 3AL0C 2LBFB 3RSNA 3CF2A 5HNHA 3K70D 3OPOA 1TZLA 2VQGA 2A6TA 4ZDPA 2X8KA 3MKZA 3S8PA 1PYVA 1SFKA 4XLAA 4XQFA 1WFXA 2LY2A 4CCOA 2CV1A 5CQGA 3QYFA 2KLOA 4CCMA 1X0CA 2L9NA 2R7WA 3VDXA 3IP4B 2LREA 3M1CA 4HSRA 2DXIA 1WJEA 4JQFA 1OOCA 1H8EA 3FBNB 2CV0A 4OJOA 3OL3A 3IAM2 4PK4A 4XLHA 3W2WA 5LFAA 4BDZA 3SEZA 1HVXA 3FPPA 2AQEA 4B48A 2MD0A 3OMYA 1YX5A 3ZPPA 3H5AA 3H5NA 2LC2A 1NG7A 2O0VA 3RPUD 4XL9A 2KHMA 4E7HA 1UD2A 2GJRA 5HKKA 1XG2A 2NTPA 2JDIA 2VBKA 3HG9A 4Z06A 1KONA 3H94A 4OJ6A 2W1OA 4HEA2 1D1CA 3G05A 3UW0A 2DIEA 5HLTA 2VQCA 3GQ8A 2DJIA 1EFRA 2MC4A 4GQNA 3ONQA 1SAUA 2IGKA 2R4GA 2X6YA 1LKXA 3PUBA 3KYLA 4B3GA 3TL4X 4CCNA 4OJPA 4YZQA 4BEHA 3OYAA 3VWBA 1LDKB 2V31A 2Q1ZB 1GLNA 1VZ0A 3OS2A 3OYIA 2R7SA 2LZJA 4KKUA 1WJAA 2HVSA 4PSWA 2CH0A 3LMMA 3BH4A 4BJ6C 2PYGA 3ZR8X 2LOOA 4B47A 3GQ7A 4Z03A 4OWRB 2UVEA 3LSGA 1VJSA 3DPUA 2IQ7A 1H80A 4CA0A 2GOXB 1O8DA 1VLYA 1JTAA 2HU9A 2BW3B 3HKZA 2WBMA 3SYTA 3NE5B 4IX7A 5LD2C 2L2OA 4ZDLA 3OFNA 2XZOA 4G6IA 1UG0A 2ZSHB 4NNJA 2VPLA 4F92B 4N4NB 3A4CA 1MABA 4KKTA 2HVQA 1E3ZA 2IS2A 2KL4A 2M3AA 1N75A 2IS1A 1Z21A 2ZSIB 1BR1A 5HVQC 3FKJA 1HA8A 3C2HA 4W8TA 4QPQA 4JMQA 4OJLA 3OYGA 2VJIA 2ZXIA 2F5VA 3PNTA 3A2KA 2A5WA 1WMRA 4OZZA 2ELJA 3OOCA 2VKHA 3DU6A 4KKSA 3PL8A 2WY7Q 3HL2A 4NQWB 4NC7A 4HIZA 2M0MA 2LBFA 4XONA 2UVFA 1HZEA 4XLCA 3S3MA 2NT9A 3GVJA 3GQBA 1K28D 3GVLA 4G7XA 1COWA 3ZIAA 1O8MA 4P1WA 5FL7A 1O8HA 2F6CA 3CP2A 3LSMA 4HNUA 4J00A 2KRHA 1BR4A 2M7AA 1O8JA 2HLDA 3MKWB 3EUAA 3KEYA 3OYDA 3KRGA 4G6TB 2NSPA 4TKOB 2O04A 3PSFA 2JJ2A 1IB4A 4Z05A 1DGRM 4J01A 3OEEA 4ZYAA 1EA3A 2BVMA 2XGJA 3QYBA 2W6JA 2XAUA 3K4JA 1UD5A 1GQ8A 2VBMA 3OYHA 3PSIA 3J7AY 1O8FA 1H8HA 3VMWA 1D0ZA 2F4IA 1X4PA 1PXZA 1Y6IA 3VYUB 3HPHA 1IA5A 4LIUA 3LSIA 1ERDA 2VJ5A 2HNHA 1PJRA 4CH7A 2R9VA 2KP6A 1O8GA 1QU3A 3H9JA 2IS6A 3W2AA 3S93A 2INUA 2CUZA 4RM3A 2D3LA 1RMGA 2WAEA 3H35A 3C2GA 2LYCA 2VASA 2XDVA 1E0EA 2V4DA 2RREA 2Q2EB 3DU5A 4KISA 4GRIA 1OFLA 3CJQB 2K3PA 4H4KC 1JI8A 2INVA 3UR3C 3L2RA 1W9XA 3B90A 1T0FC 2VBEA 4PFPA 4F91B 2ZTNA 3K4LA 4Y4RA 2V7QA 4BQNA 1X1BA 4BL0B 2M4GA 2CUJA 1W0KA 1V5EA 2W7NA 3VYSB 3V42A 3OYCA 1FX0A 1WPCA 2GJKA 2FUG2 2BW3A 1D1AA 1UAAA 2PJRB 2KPMA 1FMWA 2RQQA 3E0JB 3OE7A 3MKYB 2MABA 3PJRA 2CFOA 1E79A 3GRHA 2JA2A 2O17A 3MMYB 4PMHA 4NK8A 2GK6A 4II2A 2R7QA 1BPLA 2QE7A 3CJRB 4MLOA 4XR6A 5C1CA 2ZZFA 3OYJA 2VJ4A 1WJBA 3GVKA 2WJYA 1X1AA 1OGOX 2JIZA 3UNGC 4KJZA 1OLTA 2V9KA 3OWTA 2MYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XM3 A;  4AVZ A;  1KTW A;  2NT6 A;  3VMV A;  3B4N A;  4XNF A;  3LMW A;  2O0W A;  4YZ0 A;  4XN3 A;  2BSP A;  4W8R A;  4OZY A;  4W8T A;  4URR A;  4OJL A;  4U4B A;  2VJI A;  1WMR A;  4XN0 A;  4OZZ A;  4XOR A;  1O8K A;  3FY3 A;  4C2L A;  3VSU A;  2QX3 A;  4XON A;  3WWG A;  1O8L A;  1DBO A;  1QJV A;  2UVF A;  2NT9 A;  4XLC A;  4W8S A;  1K5C A;  1OFM A;  1O8M A;  5C1E A;  4MXN A;  2O1D A;  2NTB A;  4XKW A;  1O8H A;  3GQA A;  4XMY A;  3VST A;  1RWR A;  3VSV A;  1O8J A;  1DBG A;  4MR0 A;  4EW9 A;  4XLE A;  3KRG A;  3SUC A;  2NSP A;  1AIR A;  1IDK A;  2O04 A;  1IB4 A;  4Z05 A;  1PE9 A;  1BHE A;  4XLA A;  1GQ8 A;  2VBM A;  4XQF A;  3JUR A;  1O8E A;  1O8F A;  1X0C A;  3VMW A;  2X85 A;  1IDJ A;  1PXZ A;  2X3H A;  1IA5 A;  1JRG A;  1OOC A;  2NTQ A;  4OJO A;  1EE6 A;  4XLH A;  1O8G A;  3ZSC A;  4OJ5 A;  2INU A;  4XOP A;  1RMG A;  3ZPP A;  2O0V A;  4XL9 A;  2VBK A;  3T9G A;  2X6W A;  1O88 A;  1XG2 A;  2NTP A;  4XLF A;  2QY1 A;  4YZA A;  4Z06 A;  1OFL A;  4XOT A;  2ODL A;  2INV A;  4OJ6 A;  4YZX A;  3B90 A;  2QXZ A;  2VBE A;  3UW0 A;  3GQ8 A;  4YEL A;  4W8Q A;  1NHC A;  2NST A;  2NZM A;  4HWV A;  2X6Y A;  1OGM X;  4OJP A;  4YZQ A;  1VBL A;  2Z8G A;  2X6X A;  1BN8 A;  1KCD A;  1RU4 A;  1O8I A;  5AMV A;  3EQN A;  3GRH A;  2O17 A;  1HG8 A;  3B8Y A;  2EWE A;  2PYG A;  3GQ9 A;  4XKV A;  4PMH A;  4NK8 A;  3GQ7 A;  3EQO A;  4Z03 A;  2VJJ A;  2UVE A;  2IQ7 A;  4XR6 A;  1H80 A;  1KCC A;  5C1C A;  2PYH A;  1O8D A;  1JTA A;  1PLU A;  2PEC A;  4I84 A;  1CZF A;  4U49 A;  1OGO X;  4NK6 A;  4YEJ A;  1QCX A; 
#chains in the Genus database with same CATH topology
 3QFT A;  3C1D A;  4C9Y A;  3AGP A;  3E6D A;  1JKP C;  1H8A C;  1VQM B;  4O3M A;  2R5Y B;  3I1F A;  3VOE A;  3OW2 B;  5M3F J;  3I9V 2;  3OZU A;  4EJT A;  5DDG A;  4UZE A;  4G6Q A;  2YUH A;  4OZY A;  3ZCO A;  2VBX A;  4OPW A;  4BHP A;  1A31 A;  4G1V A;  2BM6 A;  2Z2S B;  4DYQ A;  1WJD A;  4AF6 A;  1BOA A;  4XKC A;  1QVF B;  4I02 A;  1J0R A;  2DT5 A;  1CF7 A;  4F93 B;  2RC6 A;  4BE1 A;  3SEJ A;  1E1Q A;  2EFQ A;  3EPZ A;  3U21 A;  5K7Z A;  2PIA A;  2VFN A;  3BR1 A;  1RPW A;  1MNE A;  2VOO A;  1SMT A;  1Y56 A;  4MIM A;  2NTB A;  3L2W A;  1GXP A;  4XKW A;  3GQA A;  4HW0 A;  2GOM A;  3H92 A;  1V5G A;  1ELO A;  2EIX A;  3VST A;  1XGM A;  2GAU A;  4JRA C;  1UD4 A;  2ISY A;  2FBI A;  2BHZ A;  4BQQ A;  1I27 A;  2Y69 H;  2WZP P;  2LK2 A;  2PJP A;  3MKL A;  4PJM A;  1LDD A;  1HBX G;  2IW5 A;  4EMS A;  1IXR C;  2EFN A;  3KE2 A;  4LIV A;  2ZBK A;  1XSV A;  4D5F A;  2Q2E A;  2OBP A;  1B2R A;  1QNT A;  3TO6 A;  3FF5 A;  4E0F A;  1FMV A;  1ORK A;  3K1N A;  3K4B A;  4L9J A;  5K7H A;  3GSI A;  2CO5 A;  4FN5 A;  4G9Y A;  4R8H A;  2CQ7 A;  4RDL A;  3S15 J;  2JUG A;  3DQV C;  3I59 A;  2R7O A;  3QOD A;  4LOC A;  3J80 K;  3H9G A;  5JVT A;  1G8X A;  3DTI A;  1ETO A;  2WSS A;  2WWY A;  2DU9 A;  2MLG A;  1T6Y A;  1D5V A;  3HTS B;  2V5I A;  2XIG A;  1ETV A;  4WXH A;  5JR3 A;  2K86 A;  5F0C A;  1ZRC A;  4IHY A;  1GO2 A;  4F3Q A;  4BXU A;  3Q3A A;  4M1K A;  3RIR A;  3BDD A;  5J1Y A;  2QTL A;  3LL7 A;  4P3I A;  2BVN A;  5LGU A;  4XLF A;  2M5S A;  1O88 A;  4OP7 A;  3IHU A;  1YFH A;  3GWZ A;  2W48 A;  4AM3 A;  1SVL A;  2X1D A;  5DM7 F;  3N6Z A;  3T51 B;  3NWT A;  2G0Y A;  1DQU A;  2JUC A;  3ASO H;  4FTH A;  2OTJ I;  4AID A;  4HX4 A;  4A12 A;  2HQA A;  3Q6R A;  3F23 A;  4RCY A;  3PM1 A;  1W35 A;  3LA7 A;  1WQ2 A;  5D5V B;  2Y31 A;  2P6T A;  1LEB A;  2BGJ A;  3BNW A;  1E2X A;  3VR6 A;  1Z7U A;  1MMA A;  3RYR A;  1QA3 A;  1IRZ A;  1BN8 A;  1KRH A;  2ADU A;  2OUM A;  2B7B A;  3VO2 A;  4P6Y A;  3T1B A;  1T0F A;  5D5X B;  2E1B A;  1O8I A;  2DPU A;  4I2O A;  2HDD A;  5H59 A;  1ACI A;  4OOI A;  2HXI A;  4RLF A;  4DK1 A;  1MBE A;  3L2V A;  1XE1 A;  3MEX A;  4U9U A;  3GQ9 A;  1U0J A;  4A3I J;  2JPC A;  3FWE A;  4UVC A;  2Z3Y A;  5DCM A;  5FKM A;  2CUE A;  3BG7 A;  5DN6 A;  4ACA A;  2V1X A;  3IUO A;  1IN6 A;  4Y15 A;  2F2E A;  1QPM A;  5TRD A;  1OYY A;  1ZG1 A;  3GUD A;  1PLU A;  3OIP A;  2BEO A;  3GFM A;  2NPF A;  2V26 A;  2PBI A;  1A5J A;  4U49 A;  4RD6 A;  2GXA A;  1ULY A;  3ECH A;  4NK6 A;  2Q6I A;  5FA6 A;  2B63 J;  1WJF A;  5B1A H;  3CPW B;  4ENJ A;  1YE9 A;  2ZIT A;  1KQ0 A;  3FK7 A;  2DTR A;  3H3V K;  1WOS A;  1VQL I;  1Q82 D;  3LSJ A;  2LR8 A;  3HEF A;  2QMU A;  2YSR A;  4G7H F;  3ERM A;  4BE2 A;  5HDK A;  1R71 A;  2QYO A;  2W7Z A;  1OGI A;  4URR A;  1BI1 A;  1K61 A;  4XN0 A;  3FKS A;  4Y3O A;  3G1L A;  3OR1 C;  3X2Q H;  3CC7 B;  4X7E A;  3ZC3 A;  2XGD A;  3OYK A;  5D5U B;  2CND A;  3N4M A;  3GZ5 A;  2QX3 A;  4O6J A;  2VE9 A;  1XMX A;  1QJV A;  3FM3 A;  4IO9 F;  2BGC A;  2MSY A;  1HW1 A;  2VT2 A;  4JP0 A;  3BTL A;  2NVY J;  3I4P A;  4BYY A;  3AAF A;  1YO5 C;  1B72 B;  1SMY F;  1YLF A;  4A0Z A;  2YU9 J;  4RD0 A;  3KYD B;  3CP8 A;  3OOU A;  2JA7 J;  2XTY A;  2L7F P;  3FHN A;  5H6R A;  1H9T A;  3TQN A;  2IS4 A;  5IYD J;  3BJA A;  4PC6 A;  4X7D A;  4ZC3 A;  1FRQ A;  3QU6 A;  3ZOB A;  1D0X A;  4FXU A;  2BVL A;  3ZQL A;  2OTL B;  3VSV A;  3HRT A;  2HYF A;  4Z6Y A;  4DGW B;  1WKM A;  2P5V A;  2IOU G;  1U9O A;  4M6V A;  4A6D A;  1AA7 A;  4M72 A;  2ICW G;  2H27 A;  3SUC A;  3BTC A;  4U0W A;  5D8L B;  2VKV A;  2XF5 A;  4E7Z A;  4U0Y A;  2DA3 A;  5AIQ A;  3BG9 A;  1XSX A;  4PJL A;  1MH4 A;  2IGO A;  1R5H A;  2A68 F;  5F0F A;  1BLI A;  2DMT A;  1YJ9 I;  3QAH A;  5JHF A;  4B3A A;  4YIR X;  1U9N A;  2WY8 Q;  3CJT B;  5BOX A;  1YJN I;  3EUH A;  1FX7 A;  1QO0 D;  4FE4 A;  4TMZ A;  1U8R A;  3ZBU A;  3WNC A;  2W6I A;  1T98 A;  3EQL F;  3VO1 A;  1DAB A;  1F43 A;  4BBR J;  2N8G A;  2LKP A;  4IJA A;  2QEN A;  4IHX A;  2PI0 A;  5DS9 A;  1ZR4 A;  4CZC A;  1JGS A;  2RC4 A;  3U9G A;  3CUQ C;  1OKR A;  3S14 J;  3E6M A;  3HXL A;  4BU2 A;  3WTV C;  2ODL A;  4HV5 A;  1K8F A;  4EM2 A;  1J75 A;  2AS5 F;  1JJ8 C;  5E20 A;  4G94 A;  4RAF A;  4MGR A;  4M9X A;  4CCK A;  4PJJ A;  3HUG B;  3QP5 A;  2PMZ N;  4PGO A;  1FIA A;  1TYW A;  2BM4 A;  4FIS A;  4BAY A;  1VQ8 I;  4E7I A;  1DU6 A;  4RGU A;  3VSK A;  2BSA A;  4ZYE A;  1XDS A;  2C4U A;  4OMY A;  1MBG A;  5J1R A;  3ABK H;  2WAD A;  2IXS A;  4U87 A;  1B8I B;  1KCD A;  2LY9 A;  3CW2 A;  2STW A;  4G12 A;  1BX1 A;  4RD2 A;  5A88 A;  2KQR A;  2VL8 A;  3CCV B;  2NNN A;  4D1Q A;  4QTR A;  1Z9C A;  1VTN C;  1X4O A;  3EQN A;  3Q0V A;  2QBY A;  4JX4 A;  2A61 A;  4M3F A;  1DGW Y;  3HAG A;  4B09 A;  1OYI A;  2VBW A;  4HF0 A;  3S3O A;  2JVG A;  2X9D A;  2WTE A;  5IT9 K;  2EIJ H;  5L3G A;  2PLF A;  2PYH A;  4YC5 A;  1UMQ A;  3V7A A;  2VUM J;  3PFI A;  2GIV A;  4XM3 A;  4C2M J;  5E1X A;  2OCC H;  1S6L A;  3NRV A;  1FOX A;  2NT6 A;  4L18 B;  3W2H A;  4BY7 J;  1VF9 A;  4CGZ A;  5F4O A;  3CLQ A;  3PSS A;  3BP8 A;  5LHH A;  2KKO A;  4XKB A;  2R92 J;  5GV8 A;  2PQ8 A;  4N4O B;  4V2F A;  1X3Z B;  3DWL E;  2M7B A;  3S16 J;  3JCU C;  2GBY A;  1P92 A;  1GDT A;  3AKZ A;  3DPT A;  1K6Y A;  4M3D A;  1LJ9 A;  1P4X A;  4JOM A;  2GM4 A;  5HOO A;  1OMI A;  2V1N A;  4C2L A;  3S3N A;  4FCY A;  2DFF A;  3LVB A;  5J3L A;  1FY7 A;  2Y0S N;  4FT8 A;  1Q9S A;  2E34 A;  3F8F A;  1RR7 A;  1UHM A;  1PP8 F;  4AC9 A;  3IL2 A;  3F8B A;  1ZK8 A;  1USS A;  3FKI J;  4C30 A;  2XEX A;  2XF7 A;  2HKX A;  4AVP A;  3RI4 A;  2KZV A;  4XID A;  4QWQ A;  5KW9 A;  2RNJ A;  3H0D A;  3BR2 A;  5HS8 A;  3S32 A;  4U7D A;  2OBS A;  3ZPN A;  2VYQ A;  4IQJ A;  1P7J A;  1QVT A;  1ZGW A;  4XLE A;  4P2N A;  3WTY C;  2CS3 A;  3GVA A;  3DLA A;  2ZZQ A;  2DCE A;  2ZJR F;  4C2U A;  4P12 A;  4UHT A;  4EVI A;  3RSN A;  5HNH A;  3AGQ A;  4M0L A;  1SFK A;  3S2W A;  4XQF A;  3E6C C;  1KK0 A;  5CQG A;  3QYF A;  1HST A;  2KLO A;  4CCM A;  3AG3 H;  2HGC A;  4HSR A;  4IPA A;  2DMP A;  4Q4Z F;  4JQF A;  5B3S H;  5BPI A;  1MDM B;  2CV0 A;  2K9N A;  5LFA A;  1MD0 A;  2A05 A;  3BQY A;  4Q5S F;  1YIT B;  2B7C A;  1SFO J;  3QPT A;  1HA3 A;  2CU7 A;  4MEX F;  2O0V A;  1NG7 A;  4XLN F;  2L02 A;  3HZJ A;  3E5X A;  3K1M A;  4XL9 A;  4P9F A;  1UD2 A;  1VQ9 B;  1O7L A;  4Z06 A;  1KON A;  2NOG A;  2HOT A;  4OJ6 A;  3P7N A;  2LNB A;  3KZI C;  4BH9 A;  1R9T J;  2DW4 A;  3DKW A;  3GFI A;  4KDP A;  2V7V A;  4X05 A;  2EIM H;  2YX4 A;  2VON A;  1YHQ I;  2XGC A;  2H1K A;  1Z6T A;  3HDD A;  1SAU A;  2DOD A;  2IGK A;  2R4G A;  1LKX A;  3OOP A;  3O3K A;  3PUB A;  4RB0 A;  5AN9 A;  1KQ9 A;  4CCN A;  1DG1 G;  1IN7 A;  3BJ6 A;  1QGZ A;  1FND A;  3O2P E;  3OYA A;  2V31 A;  3HOU J;  1Y0R A;  1EA0 A;  4HLX A;  1Y0U A;  2F4M B;  1ZH5 A;  4PAA A;  1VZ0 A;  3OS2 A;  2R7S A;  5CJ9 A;  1QA6 A;  2Y2Z A;  4LGW A;  5IYC J;  4P1V A;  1REP C;  1OCR H;  1CQX A;  2GPJ A;  3ZN0 A;  1S5L C;  3LMM A;  1JKR C;  4ZZL A;  1LFB A;  2FML A;  1ZAR A;  2HWV A;  5DD8 A;  4YAL A;  3G3Z A;  2X0K A;  5FLX K;  4YAO A;  2PE3 A;  2NVQ J;  1EP2 B;  1Z1D A;  1KU3 A;  1R58 A;  4MFD A;  4CA0 A;  2QZ8 A;  2TDX A;  2EWN A;  1U8B A;  1VLY A;  3LWF A;  1U6G A;  2RV8 A;  1VQ4 B;  3HHG A;  3OFN A;  1D5Y A;  1QBJ A;  3JRE A;  4NNJ A;  3WU0 A;  2VPL A;  4YAU A;  1YX2 A;  1KQS B;  4NHJ A;  3WG7 H;  2VFP A;  2M3A A;  1PVE A;  3RDI A;  3RZD J;  2ZSI B;  1BR1 A;  4PCQ A;  1RUN A;  1Q1V A;  2HKO A;  4ZYH A;  5J8F A;  1KQ8 A;  5E3L A;  4MNU A;  1OCP A;  1VND A;  3O8H A;  4OJL A;  1SAN A;  3B8H A;  2VT3 A;  2HTJ A;  2ZXI A;  3A2K A;  1FLI A;  1WMR A;  1MJA A;  2QSH X;  3VOD A;  1G2H A;  3OOC A;  4DZJ A;  3PL8 A;  1X3U A;  1G3W A;  2M34 A;  2Z5U A;  4HQE A;  4KFC A;  3E20 A;  4HIZ A;  1K79 A;  2WV1 A;  2UVF A;  1ZRD A;  1HZE A;  2YWH A;  2NT9 A;  4A3M J;  3GQB A;  2CWE A;  4HAM A;  3QU3 A;  5BPD A;  2NNY A;  3KL9 A;  1OPC A;  4YFK F;  2E36 A;  5E3O A;  1ZGJ A;  1XGO A;  1G3T A;  2G7U A;  3FXM A;  1F5T A;  1O8H A;  3P9C A;  2ME6 A;  2DI3 A;  1IZ1 A;  4HNU A;  2E2J J;  4M3E A;  4HLY A;  2JN9 A;  4PC1 A;  3A0H C;  1O8J A;  3K7A J;  5FNZ A;  4BBS J;  3MKW B;  3EUA A;  1R49 A;  1VQK I;  1K4S A;  1K9M D;  4G6T B;  2JSC A;  5F1R A;  2B0R A;  2ZO4 A;  2RVC A;  3CCE B;  1IB4 A;  1CF7 B;  4V2G A;  2ZXJ A;  2G9W A;  2O8K A;  3OEE A;  4ZYA A;  5FKN A;  4Q7J B;  2W6J A;  3A8K A;  1JTY A;  1V54 H;  2D2W A;  4EGY A;  3RKX A;  1N05 A;  1ZN2 A;  3CDI A;  2CW0 F;  3VMW A;  1X4P A;  1Y6I A;  2DMQ A;  2VBZ A;  3VYU B;  4LIU A;  1ERD A;  2F1L A;  3M1E A;  3NAU A;  1I3Q J;  4Y13 A;  3CCR B;  3G1M A;  3ASP A;  2UZK A;  1O8G A;  4LK0 F;  5E17 F;  4EJU A;  5TV2 A;  1TTY A;  4XIC A;  2IS6 A;  3U1D A;  1R00 A;  3BPX A;  1A36 A;  1GJR A;  2CUZ A;  2QQB A;  2ZFW A;  2WAE A;  3MCZ A;  2GQQ A;  3RKQ A;  2Q2E B;  4UV9 A;  2CG4 A;  4GRI A;  5IT3 A;  4KIS A;  2K3P A;  1JA1 A;  3UR3 C;  1WSR A;  1N8R D;  3B90 A;  5FKO A;  2FQ3 A;  3G4S I;  1UST A;  3A01 A;  3I59 B;  2DOG A;  2A5Y B;  4M71 A;  4BL0 B;  1ZQ3 P;  2F4O B;  2NAZ A;  2Y0M A;  2M4G A;  2X4H A;  1V5E A;  1G7C A;  1FX0 A;  1W0U A;  2FUG 2;  1ZG3 A;  2JRT A;  3WGG A;  1FMW A;  4EM1 A;  2DEU A;  3OV8 A;  4ENK A;  2XB0 X;  1W0T A;  3MKY B;  2MAB A;  1B4A A;  1POG A;  1RKW A;  4HQM A;  2A6H F;  4ESJ A;  2O17 A;  3A8I A;  5DTD A;  3DEW A;  3U2Q A;  5FLM J;  3SY2 A;  1E3H A;  2BYV E;  3ASN H;  6PAX A;  1FPQ A;  4II2 A;  3VMF A;  1YOV B;  3HIF A;  3CCQ I;  3ZZU A;  1IW7 F;  1YQA A;  3CJR B;  4IL6 C;  2LSO A;  4MLO A;  5LHI A;  2VNI A;  4FWT A;  5LHG A;  2EA4 A;  2F5F A;  4LG0 A;  3MZH A;  1GHC A;  4YHB A;  2ZKZ A;  3W2G A;  1EWY A;  2WJY A;  4RD3 A;  1IUY A;  1MZB A;  4NQW A;  2JIZ A;  3ZQI A;  4D5C A;  2MYS A;  1QCX A;  1AHD P;  3F8M A;  2TCT A;  4MEY F;  1TP4 A;  2HI3 A;  2K4J A;  1A6Q A;  1BIA A;  3LSR A;  3SZP A;  2DA6 A;  2IGM A;  3ZQG A;  1J59 A;  2V1D A;  5DCM B;  3HOT A;  4XN3 A;  4C0S A;  4KYW A;  3K4C A;  1E43 A;  3E1Y E;  4M73 A;  4GGG A;  3BC9 A;  1N0U A;  1IAW A;  1J2X A;  3K6G A;  1BR2 A;  3SQN A;  2IJL A;  2K3F A;  3ZMD A;  3CCS B;  4FX0 A;  2C4T A;  3BR6 A;  1OJL A;  4P9U A;  2M87 A;  1YW7 A;  2G0E A;  3AG1 H;  3ZMT A;  3HOV J;  3IRR A;  4B3X A;  2R7U A;  1IF1 A;  1QVU A;  2FRH A;  1UB9 A;  4DZP A;  2XUB A;  3GX4 X;  3M4O J;  4PJN A;  3AVV A;  2CSO A;  2IGN A;  5CYV A;  1SD6 A;  2OAZ A;  4E7J A;  4IRH A;  4X6A J;  4BY1 J;  4HPQ A;  1BI2 A;  2VXZ A;  2OA4 A;  2NS7 A;  5K5Q A;  1ZGA A;  3JR9 A;  4QHY A;  1OFM A;  4BJT A;  5C1E A;  3JRI A;  2FNP A;  2W00 A;  2EA2 A;  2VBS A;  3UKG A;  1QZZ A;  2ID6 A;  2X1C A;  5JVG F;  2VNK A;  1MH3 A;  2VC0 A;  4KIF A;  1TQP A;  2I1L A;  3D1N I;  5M5X J;  3HGY A;  3V8J A;  1KA8 A;  4MR0 A;  5TGT A;  2DET A;  2MFZ A;  1JJ6 C;  1TVC A;  3OYL A;  3ML3 A;  4UY8 I;  2IRF G;  3LNQ A;  5LGN A;  4WXD A;  1IV6 A;  4P6V F;  2ZBU A;  2QEX I;  2IEK A;  3IWZ A;  4Y33 A;  4PSX A;  3MD2 A;  3MZY A;  3NWS A;  3VNV A;  4K2E A;  4I0B A;  3F72 A;  4BXF A;  2YWG A;  1Y1W J;  2HDW A;  4G7O F;  3KZZ A;  3Q38 A;  2K5C A;  2R5Z A;  3I58 A;  2HS5 A;  1HKT A;  2KZG A;  1VQM I;  2E71 A;  3PA1 A;  4PAB A;  4OIR F;  4M2L A;  4MFE A;  2XV4 S;  2F4N A;  1LM1 A;  2VFM A;  2CJJ A;  2L9S A;  4KIG A;  3FDY A;  1XB4 A;  2KRC A;  5DYM A;  5A8A A;  2NOJ B;  1W87 A;  1Z91 A;  2L0K A;  3HJE A;  2BF4 A;  1BM9 A;  2QY1 A;  4XOT A;  3AFH A;  2ACJ A;  3I55 B;  1S3J A;  2P81 A;  2Y75 A;  1T5E A;  2B5O A;  4BQA A;  2HMA A;  2HYG D;  1WOR A;  3ABL H;  3FJO A;  3RY8 A;  1ODD A;  1MND A;  3I53 A;  4HF1 A;  3QYE A;  3R6S A;  2A07 F;  5GPC A;  1YI2 I;  3CCM I;  3KYC B;  1WCM J;  1DP7 P;  4FET A;  4NC6 A;  2VN2 A;  4MQ9 F;  2JA5 J;  1WP6 A;  2ZFU A;  1B6A A;  2XF6 A;  3V4G A;  4ZYG A;  1C0W A;  1WZ2 A;  2VKD A;  4BHB A;  3HPG A;  1KZH A;  5C4X J;  2IA0 A;  4G1B A;  4HE6 A;  1K83 J;  1XQB A;  4KT5 C;  4ENM A;  4ZTJ A;  2V7W A;  1HW5 A;  1ETX A;  4XKV A;  5ILS A;  2FEZ A;  5FO0 A;  1S9H A;  2LF7 A;  2GZW A;  4CUG A;  3WOD F;  5C4J J;  3J7A O;  2ZBV A;  5HZA A;  3W3C A;  3OSF A;  4OIO F;  2QDX A;  2M8G X;  4EJW A;  2EV0 A;  3S2D J;  2X53 S;  1SKQ A;  4I84 A;  1KMH A;  1T39 A;  3OS0 A;  2ZZG A;  3BCF A;  4A93 J;  3W2F A;  3KP7 A;  4JYK A;  4YEJ A;  4ANJ A;  4AVZ A;  1UEL B;  3QRF F;  2HZD A;  2F43 A;  1EKE A;  2QBY B;  1W5C C;  5CPR B;  2YWE A;  2D1V A;  1FOK A;  3MFK A;  4KT6 A;  3H3U A;  1XGN A;  2R7F A;  2CMP A;  2UV1 A;  4P22 A;  5BSY A;  2Z9O A;  1WXR A;  2J8K A;  4W8R A;  2OJE D;  4DBR A;  3WXM A;  3GTQ J;  3KPH A;  4CHU A;  2PMD A;  3K4M A;  4CZZ A;  5IYN A;  1FC3 A;  2KRF A;  4YCQ A;  2F5D A;  4IQ4 A;  2EB7 A;  2DOF A;  4BNC A;  2UWM A;  1RZ4 A;  4F52 A;  2OBT A;  1W36 C;  2ZC2 A;  4UVA A;  2YPR A;  3GTM J;  1TSP A;  3H3Z A;  3LSH A;  2FE3 A;  4GFB A;  1GVH A;  1U2R A;  4QLC U;  3VYT B;  3JRF A;  1Z3X A;  2B7E A;  5ERI A;  4EJO A;  3KLN A;  1K5C A;  1O4X A;  3SDB A;  4WZL A;  4RB3 C;  4OIN F;  2R7V A;  1SD7 A;  2BOL A;  1WTH D;  1JT6 A;  3FMS A;  4PUS A;  3U2R A;  4OPO A;  3G2B A;  1Q86 D;  3DBH B;  4I98 B;  1UHW A;  4YAW A;  2AXT C;  5F04 A;  4DJA A;  1JNY A;  2I10 A;  3BQZ A;  1GAW A;  1VQ7 B;  5FFX A;  2ISZ A;  1O3R A;  1XC5 A;  3E97 A;  2CQN A;  2E1N A;  5FO5 A;  2RKH A;  1X1D A;  2DA1 A;  4LJZ F;  1T8I A;  1PE9 A;  1BHE A;  1UG2 A;  3PIO F;  1NBM A;  4S04 A;  3GO5 A;  4L8J A;  2X85 A;  4ZH4 F;  3HC7 A;  3CC2 B;  3ZQQ A;  1M1K D;  2XNC A;  3JRB A;  3FXJ A;  3M8F A;  5FIU A;  3F3X A;  4DNT B;  1UZC A;  2H8R A;  2F5C A;  4PDK A;  3KEW A;  3MHP A;  3WE3 A;  3OL4 A;  3GIR A;  1YIJ B;  4Q48 A;  2Y9Z A;  4WZT A;  1TTT A;  2DAO A;  1Z7L A;  3W5V A;  1VQP B;  4R1H A;  4ZCL A;  5TR9 A;  1FSE A;  4TMV A;  4A3G J;  1KZL A;  4X07 A;  4HDV A;  1R22 A;  2W82 A;  2X48 A;  4UB8 C;  5H6Q A;  1NDH A;  2CV2 A;  3ECO A;  3ISX A;  2QXZ A;  1BIB A;  2QQA A;  1KU9 A;  2Z1D A;  5IP9 J;  4LD5 A;  1QZY A;  3I71 A;  4P9S A;  2YR2 A;  3LQQ A;  1WRJ A;  1WI9 A;  4A6E A;  4BDY A;  4DYR A;  4DNR B;  2AHQ A;  2GLO A;  1T6X A;  2VFQ A;  1TW3 A;  4W8Q A;  2NZM A;  1KJZ A;  3HBL A;  4HWV A;  1D1N A;  2FJ1 A;  5DNS A;  2XGX A;  1B9N A;  3R61 A;  4C3J J;  3C7J A;  3BTJ A;  2Z8G A;  2DMU A;  4TV7 A;  3T5X A;  1GR1 A;  5KVR A;  4AIJ A;  3C2B A;  1HDD C;  4NC8 A;  3CCL I;  5IOZ A;  2WAF A;  2EIK H;  3ASS A;  4Z4V A;  3QPH A;  2DCU A;  3Q0U A;  5KCM A;  1HG8 A;  3DKY A;  4IRG A;  1QUE A;  3DEE A;  2HR3 A;  2HQR A;  4RDK A;  3L2C A;  4ACB A;  3P5J A;  2EFW A;  2QF7 A;  1EH8 A;  4DQL A;  3BY6 A;  4PZJ A;  4XRM A;  2KDZ A;  3PET A;  1TC3 C;  2P6S A;  3SZG A;  4UUS A;  3DKX A;  1T2K A;  1FNM A;  2Y9Y A;  5LBQ A;  5E8G A;  1MMD A;  1FIP A;  3J80 Z;  1MBJ A;  4HG2 A;  3HYI A;  1Y0Y A;  3K70 C;  1VQN B;  3SZE A;  4KMF A;  2RDP A;  2WC2 A;  2ELH A;  2L4A A;  3E5Q A;  3LSP A;  2ZJ2 A;  1KQ5 A;  3OS1 A;  2O61 A;  1MJ9 A;  1KK1 A;  2YX7 A;  1ZTR A;  4YZ0 A;  1N0V C;  1LVK A;  4X06 A;  2DFE A;  1ZLJ A;  2UUZ A;  2M45 A;  2MH2 A;  1R5I D;  2LY1 A;  2OYN A;  3DTE A;  5IP6 A;  3CF5 F;  1U78 A;  1IN8 A;  2ZB9 A;  3ERE D;  1S7O A;  2NVX J;  4KIB A;  2VQL A;  2RGV A;  4XRS G;  3OY9 A;  1UD3 A;  4XOR A;  1MBH A;  3Q9V A;  1MSE C;  2E1M C;  4MTD A;  1DDG A;  4G7W A;  4LK1 F;  3V76 A;  3VB2 A;  3WWG A;  2UXN A;  4ZDO A;  2FMY A;  2KVO A;  2QUF A;  5CKT A;  1I6X A;  3FXO A;  4IF4 A;  5L3D A;  4F55 A;  3MCA A;  1Q81 D;  1IRG A;  4L9T A;  5LRR A;  2O1D A;  4LFU A;  2OZ6 A;  2CYY A;  3T56 B;  3LO8 A;  4DIQ A;  5KNL A;  1DUX C;  5JLW A;  1T6S A;  1J9I A;  1QG0 A;  1WH5 A;  2KMU A;  1S8N A;  3V8K A;  4RDU A;  2Z16 A;  3R0A A;  1X2N A;  5J47 A;  5J6X A;  3J7Z I;  4IXA A;  2EZH A;  3OPO A;  4HZF A;  4PC7 A;  2R7Z J;  2VQG A;  1VQ6 I;  4XLA A;  1WFX A;  1OFE A;  3Q3S A;  2LY2 A;  5LEK A;  2HQN A;  2VOP A;  1ZUN B;  1ONV A;  3JAM K;  3DBR B;  5GTI C;  1OCT C;  4ROX A;  5EG0 A;  1FNC A;  3VDX A;  2LDU A;  1S72 I;  3H9N A;  3HOZ J;  3ASQ A;  1H8E A;  1KYW A;  2VBY A;  1EFC A;  2OZU A;  4HYE A;  4KH3 A;  3OL3 A;  4PK4 A;  4C3I J;  3SEZ A;  1FT9 A;  3GLL A;  4BHC A;  4B48 A;  2MD0 A;  2HOA A;  4ZYD A;  3S1M J;  5BQT A;  3ZPP A;  2ZME C;  1UHS A;  3SZT A;  2QTZ A;  1RQP A;  3GFJ A;  4OOX A;  2GJR A;  1WSV A;  1XG2 A;  2NTP A;  3TOA A;  1FYM A;  4OIP F;  3MAJ A;  2V7T A;  3F6V A;  3G05 A;  5J3O A;  5M3M J;  2DIE A;  2JA6 J;  4J0Q A;  2LMD A;  4GYG A;  1SVO A;  2DJI A;  3M07 A;  1E3P A;  4A3C J;  2H8W A;  2XRL A;  1PP7 U;  2EIN H;  3KYL A;  4OJP A;  2PMU A;  4YZQ A;  4BEH A;  4HE5 A;  3VWB A;  3CUQ A;  2Q1Z B;  3LQR A;  4ON0 A;  2LFB A;  3SFI A;  4UAJ A;  4KKU A;  1EFT A;  2OQR A;  1WJA A;  2QM3 A;  5F4M A;  3P27 A;  1ETY A;  2J5O A;  2XB5 A;  4HX7 A;  1T08 B;  4PSW A;  3EQO A;  1R4M B;  1WOO A;  3RZO J;  3ONY A;  4PGH A;  2DQR A;  5F6F A;  1FNN A;  2PYG A;  2ZL7 A;  1ON2 A;  2XAH A;  4KUM A;  3ZR8 X;  3A01 B;  4W97 A;  1XN7 A;  1XG1 A;  4Z2Y A;  4OWR B;  2OTJ B;  2OU2 A;  3DPU A;  2DMN A;  2FU4 A;  3IH3 A;  2GOX B;  2HU9 A;  3TOB A;  1WWX A;  3WE2 A;  3FXU A;  2WBM A;  3EDP A;  3JQQ A;  2BY2 A;  3LAP A;  3AVW A;  3SQV A;  4IHW A;  4G6I A;  2PFB A;  1D3Y A;  4N4N B;  3A4C A;  5LLQ A;  5EEA A;  2HVQ A;  1E3Z A;  3ZQ7 A;  3CME I;  2EZK A;  3Q6Q A;  1YYV A;  2DA5 A;  3I56 I;  2KL4 A;  4KN4 X;  2IS1 A;  4KMU X;  1B59 A;  1FTT A;  2D1H A;  4I6Z A;  1YLO A;  2QYU A;  4M6X A;  5HVQ C;  4A3F J;  3KP5 A;  3GYH X;  4QPQ A;  4JMQ A;  2VE8 A;  3OYG A;  4LG0 B;  4X7C A;  2M2E A;  1MBF A;  3PNT A;  4OZZ A;  1TUI A;  5E3N A;  2ELJ A;  1DDI A;  3I64 A;  4KKS A;  1TLH B;  2V9V A;  4NQW B;  1PUE E;  1I1G A;  2XNJ A;  3HRM A;  3G6E I;  2COB A;  1D8J A;  2M1B A;  4UUV A;  5J8C A;  2A6E F;  2DOE A;  1U5T A;  3GVJ A;  1K28 D;  4L5I A;  1COW A;  5IYQ A;  2HYJ A;  3CB4 A;  1VQL B;  4XSZ F;  1JA0 A;  1AWC A;  4Y7C A;  2F6C A;  3PQJ A;  4YG2 F;  1RUO A;  5CVV A;  5HLI A;  2KRH A;  1BR4 A;  3CC4 I;  2M7A A;  1MKM A;  1U5T C;  3WBJ A;  3OSG A;  5ICC A;  1QRC A;  1X3W B;  1IRF A;  3K1P A;  1EJ9 A;  3U1K A;  2JJ2 A;  1APL C;  5DUK A;  3ASR A;  4H0E A;  1WSU A;  2V7X A;  3DFG A;  3JX8 A;  4A3D J;  4J01 A;  3DU1 X;  4Z05 A;  1ZRF A;  2BVM A;  1XS9 A;  1NH3 A;  2E19 A;  2XAU A;  1VQO I;  1UD5 A;  1GQ8 A;  4LBW A;  3OYH A;  3MZ8 A;  1AMO A;  3PSI A;  2P5K A;  1PUF A;  1D0Z A;  1H8H A;  2VKE A;  2KFD A;  1FRN A;  4OU0 A;  3HPH A;  2F3L A;  1FBS A;  1W1W E;  3LSI A;  5KAF C;  1H0M A;  1FYK A;  2KP6 A;  3A03 A;  2E2H J;  4QVA A;  2XT4 A;  1L3L A;  2R6H A;  1F4K A;  2L3D A;  3FPK A;  2INU A;  3JRH A;  3H35 A;  1SEU A;  1O3T A;  2XDV A;  2V4D A;  4Z4T A;  2VC1 A;  3CTA A;  3CJQ B;  3OZW A;  2INV A;  4B4D A;  2ETH A;  3FXQ A;  3L2R A;  1B1B A;  3T0Y A;  1ZM4 A;  2ZTN A;  3WTU C;  2OQG A;  2DER A;  3K4L A;  4GXO A;  4RJL A;  1YJ9 B;  1EV7 A;  4Z4Z A;  4F7D A;  2PMH A;  3IV5 A;  2R5Z B;  2GA1 A;  2BW3 A;  1D1A A;  3HSF A;  1G6N A;  2KPM A;  3GW2 A;  1GAQ A;  1FWZ A;  1Z6R A;  2PLY A;  2YWF A;  4TMT A;  1RES A;  2CFO A;  2K40 A;  3GME A;  3GRH A;  3MMY B;  5H5J A;  3COA C;  1OQY A;  3GTG J;  4BPR A;  3MN2 A;  1R1T A;  1FSH A;  3S2H J;  2BPO A;  1BPL A;  2QVO A;  1YS7 A;  2QE7 A;  2QLZ A;  1CGP A;  4L9N A;  4XR6 A;  2ZZF A;  3OYJ A;  2DK8 A;  5KAI C;  1WJB A;  1G3S A;  3GVK A;  2BY1 A;  1VQ8 B;  3OJW A;  4RB1 A;  5FO1 A;  4CXF A;  3UNG C;  3CCU I;  1OLT A;  2IVM A;  2F5E A;  4XLP F;  5DSZ A;  2OF7 A;  3MVP A;  2B0L A;  2PEX A;  3CCR I;  3OIQ A;  5GAE J;  1R1V A;  3GXO A;  3LMW A;  3C3W A;  1NK2 P;  1FP2 A;  2DYR H;  3JU4 A;  1BJA A;  3CCJ I;  1VFC A;  2FX3 A;  3PNV A;  2XRN A;  1A35 A;  4TN1 A;  2L5Q A;  3B02 A;  4RGX A;  4WQM A;  4EQQ A;  2H94 A;  3JTG A;  1S4M A;  2ECB A;  2OC6 A;  1KTV A;  2M5W A;  2P8T A;  1GUU A;  1O8K A;  4X0C A;  1MW7 A;  2PX9 A;  3BR0 A;  4XRF A;  1O8L A;  4JX6 A;  3Q5F A;  4B44 A;  1JB9 A;  1X1P A;  4UB6 C;  3IWF A;  4UV8 A;  1PKV A;  1JHF A;  2VI6 A;  2W84 A;  3CMA I;  2AHO A;  2NRA C;  2CRV A;  1EH6 A;  2GJP A;  4G7Z F;  5FKL A;  2R93 J;  2E5Z A;  2H6C A;  2GK7 A;  3ML6 A;  1IGN A;  2W57 A;  2WR8 A;  1AKH A;  4A0Y A;  1QGP A;  1Z3Y A;  3T8R A;  4EW9 A;  2VNJ A;  1E3X A;  3LNN A;  1P6R A;  1BI3 A;  1MSF C;  4IHV A;  2BV3 A;  4I01 A;  3ZZT A;  5FLX Z;  3BY1 A;  3A1Y A;  1P2F A;  3TDU C;  2R7R A;  1ETK A;  1U3E M;  1GVD A;  1D8T A;  3N05 A;  4JK1 X;  1W5S A;  3A02 A;  4XRS A;  3HOY J;  3KCC A;  2XC7 A;  1O8E A;  4N3N A;  1SFE A;  2PG4 A;  1YS6 A;  3DDY A;  1RI7 A;  2WPD A;  2QZA A;  2JJ1 A;  2FOW A;  3AVY A;  4YRV A;  1MJB A;  4OAZ A;  3ZMS A;  4EH1 A;  2NTQ A;  1EE6 A;  1M1E B;  4KN7 X;  5CVJ A;  5EEG A;  1HF0 A;  2VQH A;  2PJR A;  3CQZ J;  1QGA A;  3FM5 A;  1T6Z A;  4GO1 A;  1UD6 A;  1D0Y A;  3BG5 A;  3BCB A;  2BZT A;  1LDJ A;  1M90 D;  2X6W A;  2WZN A;  1OFC X;  1WPK A;  3W6K B;  3D5L A;  3IKT A;  3CCS I;  1XPX A;  1FDR A;  1V55 H;  3K0L A;  4YAF A;  2JVH A;  5GV7 A;  2BBY A;  3IKV A;  2O7O A;  1XCB A;  3IH2 A;  5FD5 A;  3F22 A;  5FLV A;  2C2W A;  5ICF A;  2V9P A;  1HSJ A;  3GBG A;  3OIO A;  3EUK L;  3GLX A;  3MQ0 A;  2J5P A;  1IB0 A;  2FVG A;  1X2M A;  5HDN A;  5DUI A;  3RJP A;  4RD4 A;  1IXS B;  2ZNY A;  3TMO A;  4Z4W A;  1AU7 A;  4P96 A;  2IA2 A;  4MQV A;  1BOB A;  4XD7 A;  2DDA A;  1O57 A;  4BKX A;  1ZEL A;  3EET A;  3H9Q A;  3LSK A;  5GP9 A;  1BC8 C;  1JXS A;  2LLK A;  1BJK A;  2ZTG A;  3PVD A;  3QFS A;  3AG4 H;  1G7T A;  2M8E A;  3TW6 A;  1N08 A;  2CK3 A;  1QA1 A;  5H20 A;  1ZLK A;  4D0P A;  4Z4S A;  1Y0N A;  1JKQ C;  5AMV A;  2GWR A;  1V5F A;  4AWX B;  3BG3 A;  2DY1 A;  3B78 A;  3W5U A;  4XBF A;  3H0G J;  4AYB A;  2W24 A;  4ZV4 A;  2X6O A;  1ETQ A;  5BMZ A;  1JE8 A;  1V3F A;  2GXG A;  1XD7 A;  4RAG A;  4XSX F;  3G71 I;  1YHQ B;  3VSL A;  2BM5 A;  1XSD A;  2C5B A;  3LYC A;  2E35 A;  3VNU A;  2PEC A;  1TYU A;  2STT A;  1LVA A;  4C2T A;  3OZV A;  2P3M A;  1Z77 A;  4U0V A;  3A3B A;  1YJW I;  2BY0 A;  1KTW A;  1WHU A;  3BCA A;  2HFH A;  3ZQH A;  1SFU A;  2EPF A;  2E60 A;  3IH4 A;  4IEJ A;  2EZL A;  3F8N A;  4HDU A;  1VQ5 I;  4LBY A;  4EV0 A;  2FOK A;  3GZN B;  2CBX A;  2WAQ A;  4HV6 A;  2BV6 A;  4Y17 A;  4EM0 B;  1LPQ A;  5D4S A;  2JRM A;  3WG9 A;  3Q9S A;  2JSP A;  4U4B A;  4PC2 A;  2EFO A;  1YX3 A;  2M4K A;  4PJ0 C;  4UUS B;  4IKF A;  5LGT A;  3M7G A;  4RGS A;  3L2Q A;  3FIS A;  4LLL A;  1UJ8 A;  1RIO H;  2ESN A;  4L5J A;  4E7L A;  4E7S A;  2QSG X;  3CDH A;  3ZXS A;  1TW2 A;  5IYR A;  1F36 A;  3ABU A;  1K73 D;  1D1B A;  2E1M B;  3HGG A;  2DT6 A;  3TBI A;  3ULQ B;  1V4R A;  4EGZ A;  1WOP A;  4BS9 A;  4OPV A;  1IO2 A;  2QKL B;  1X58 A;  1FTZ A;  2NV4 A;  2Q0O A;  1JHH A;  2AQF A;  4CQJ A;  4BGD A;  1G3Y A;  3BR3 A;  1LE8 A;  2BY3 A;  4CCJ A;  2JA8 J;  4OM9 A;  4YFN F;  1Z05 A;  1VHO A;  1AIR A;  2MH9 A;  3KX2 A;  2K02 A;  3T53 B;  1QUF A;  1FZP B;  3WTW C;  2ZL6 A;  4RAZ A;  3SDG A;  4AIH A;  1A8P A;  1TYV A;  5JLX A;  1K78 A;  3ZMZ A;  2K27 A;  5BSX A;  3ZQF A;  2UXX A;  4IVN A;  2IAI A;  2VIX A;  3LFU A;  3OYF A;  3RIQ A;  2D3N A;  4GCV A;  2MA3 A;  4HOB A;  1IUF A;  3DTK A;  4GYI A;  5E1Z B;  4ZTF A;  2XT2 A;  1MIJ A;  2ZJP F;  4K1X A;  4NB5 A;  1Y8Q B;  3CZ6 A;  2MC3 A;  4QFM A;  2BGI A;  3V7C A;  4OJ5 A;  3GTP J;  2LH9 A;  1TWC J;  3TDZ C;  4E4H A;  4X0G A;  2HVR A;  4Y9U A;  1VQK B;  1W36 D;  5EZG A;  1SVM A;  1FBQ A;  4ASN A;  2V6E A;  3KP6 A;  4YZX A;  2FX0 A;  1SFX A;  4G6D A;  3KEO A;  2DQL A;  5J1U A;  1TYX A;  1ZHF A;  1SKY B;  1VI0 A;  3LST A;  5EG0 B;  2Y30 A;  2ZXW H;  4AIK A;  1G59 A;  2QKM B;  2E2I J;  5FGM A;  1NHC A;  2XVC A;  1J9Z A;  2GQF A;  3O8G A;  2IPQ X;  4OAY A;  3QQA A;  3LA2 A;  1E62 A;  5JFR A;  1P4M A;  2X6X A;  2QWW A;  2C5H A;  2CW5 A;  3CXC B;  2TRT A;  1YW9 A;  3PSZ A;  1MMN A;  1G4D A;  1JT0 A;  2WYR A;  1N77 A;  1XFO A;  2XZL A;  4I76 A;  4LMY A;  3OW7 A;  5HLH A;  3CDL A;  2E1R A;  1QFY A;  1X19 A;  1FNB A;  3BPV A;  5IOY A;  3OYE A;  3JTH A;  2DN0 A;  4DW6 A;  3G4S B;  2VJJ A;  4DK0 A;  4OOV A;  3HKZ N;  1KU7 A;  4CSW A;  5AIP A;  4DNC A;  3CES A;  4M74 A;  1H89 C;  2OBR A;  3CD6 B;  4BEH B;  5K1Y A;  5EDN A;  1LFU P;  4ESF A;  1TQI A;  3CUQ B;  4WZE A;  1WVR A;  4QV2 A;  1W34 A;  4M3G A;  2LG4 A;  5KK1 A;  4X1E A;  3HOS A;  1QFJ A;  4OPS A;  2XZP A;  4E70 A;  5KHD A;  1E3O C;  2LRD A;  3LQ6 A;  4ZGN B;  4AD9 A;  2FF4 A;  4XNF A;  4LB5 A;  2XPW A;  2O0W A;  1I39 A;  3SXY A;  3CO7 C;  1HKQ A;  3LA3 A;  4EAT A;  3BCD A;  3LJY A;  1GVJ A;  2XSD C;  3OR2 C;  2NS0 A;  4MHG A;  1VQP I;  2ELK A;  2BHY A;  2DT7 B;  3JRG A;  2DJN A;  2WB1 A;  3RTR A;  3CCQ B;  4QSH A;  3OAA A;  3VFZ A;  2NS8 A;  3BC8 A;  3JRC A;  2XOK A;  4M4S A;  3J81 K;  2QA4 B;  2H1L A;  1TNS A;  3RQI A;  2VBU A;  3FY3 A;  1XMK A;  1W5T A;  3PUM A;  3K10 A;  5L3C A;  5F08 A;  4JX5 A;  1IN4 A;  4BJ5 C;  4ASU A;  1DBO A;  4S0H B;  2NVT J;  3Q39 A;  2EIL H;  1FP1 D;  2JK3 A;  3MWM A;  5CDF A;  4DQK A;  2ZL5 A;  3GF2 A;  5J4V A;  2VB6 A;  4CO8 A;  2EBI A;  3EYY A;  4KIC A;  3JW4 A;  2CQK A;  2HPI A;  5B1B H;  4AUX A;  1WJC A;  3RPQ A;  4BUP A;  3OYM A;  3F21 A;  3I54 A;  1LQ1 A;  2COM A;  1BN5 A;  4A69 C;  5A89 A;  1KK3 A;  1QZE A;  2HXO A;  2KIF A;  4RM2 A;  3CLO A;  3WGH A;  2O6W A;  5E18 F;  3AL0 C;  1RRJ A;  3W6V A;  2Q8K A;  3CF2 A;  3K70 D;  1T38 A;  3ES9 A;  1LB2 A;  1LNW A;  2A6T A;  5HS9 A;  1U5T B;  3S8P A;  3E7L A;  4ZDP A;  2X8K A;  3CRZ A;  1DAR A;  1BW5 A;  1JTX A;  4A3J J;  2DLL A;  4CCO A;  3L9F A;  2CRG A;  2CV1 A;  1SAX A;  2CQQ A;  4CDG A;  1R5N A;  2L9N A;  1X0C A;  3M1C A;  3QWL A;  2DXI A;  1WJE A;  1OOC A;  5EEH A;  5A2Q Z;  2H6B A;  4OJO A;  4BDZ A;  3IAM 2;  2V1U A;  4HNV A;  4QUZ A;  3FPP A;  2AQE A;  2FSW A;  1IXC A;  3OMY A;  3U6B A;  1NB9 A;  4M9Z A;  4WXC A;  1IDY A;  3TGN A;  1WH7 A;  3H5A A;  2JJ7 A;  2HCJ B;  3RPU D;  2VBK A;  2JN6 A;  4G8X A;  1CLW A;  1F60 A;  2W1O A;  2CFX A;  1P4W A;  2VQC A;  2QEX B;  2NVU B;  1PUF B;  3R6J A;  1R1U A;  3HOW J;  4ZCM A;  2ZCW A;  2C78 A;  3ONQ A;  4M53 A;  1ITY A;  1FEX A;  4TMW A;  2GIZ A;  2X6Y A;  3TL4 X;  1FJL A;  4Z4R A;  3DBL B;  1CNF A;  3WND A;  4A0X A;  1E64 A;  2KT0 A;  3OYI A;  3GEZ A;  1TT5 B;  1OGJ A;  1WDT A;  2CH0 A;  2VBT A;  4BJ6 C;  5L3B A;  2XAQ A;  2VPR A;  5L3E A;  2LOO A;  4B47 A;  4LBZ A;  1OFD A;  3GQ7 A;  3KIO A;  1FBU A;  2D45 A;  4GDF A;  1OYW A;  4TMX A;  2ESH A;  1D2E A;  2M30 A;  1NJI D;  2EQR A;  1T33 A;  3ESW B;  3LSG A;  3R4K A;  3CMY A;  2IQ7 A;  1H80 A;  2LP0 A;  3P9I A;  3LAJ A;  4WX9 A;  3CC7 I;  3KZY A;  2M0C A;  5FB2 A;  1JTA A;  2BW3 B;  2QGU A;  3HKZ A;  2CGP A;  2FBH A;  1MNM C;  1MMS A;  1R5B A;  5F27 A;  3HRU A;  2W85 A;  1W7P D;  3SYT A;  3NE5 B;  4IX7 A;  3CCM B;  2L2O A;  1YI2 B;  1UG0 A;  2BXY A;  2ZSH B;  5D5W B;  3WTS C;  3B82 A;  4F92 B;  3BR5 A;  5F64 A;  3RKY A;  2P4W A;  4HX8 A;  3PQK A;  2EFP A;  3BY2 A;  5B66 C;  1N75 A;  3BZ6 A;  1GT0 C;  3R0J A;  4RCZ A;  2OTL I;  4W8T A;  2O8X A;  2RQP A;  2C6Y A;  1FOY A;  5EZH A;  1MRZ A;  4UUT A;  1IJF A;  4W1U A;  3RYP A;  1F9N A;  2VJI A;  2BM7 A;  2VKH A;  1TWA J;  2OK7 A;  2WY7 Q;  1Y8R B;  4NC7 A;  3TH0 A;  5DEQ A;  2LBF A;  2DYI A;  2MGQ A;  1RQR A;  3NAW A;  2IBD A;  4L5E A;  3TP3 A;  1OCC H;  2KIQ A;  1NTC A;  3QPS A;  3GVL A;  3ZIA A;  1O8M A;  4P1W A;  2LVS A;  4V02 C;  3WY9 A;  2QSF X;  3CP2 A;  2V79 A;  1K6O A;  1EF4 A;  4J00 A;  3SYJ A;  2HDN B;  2FQ4 A;  5IPA A;  3RPU A;  5D4R A;  2LD5 A;  2D74 A;  3KRG A;  2O04 A;  3TKY A;  3PSF A;  1DGR M;  4O5V A;  5ICG A;  2XGJ A;  3QYB A;  1H9G A;  2XAF A;  3K4J A;  2AXL A;  4CYC A;  2BX6 A;  2VBM A;  4D7N A;  5LEJ A;  3M3Y J;  2F4I A;  1ZG5 A;  2OPT A;  1LEA A;  3CO6 C;  1IA5 A;  2VJ5 A;  2HNH A;  4F7Z A;  2HDC A;  4P3Y A;  4CH7 A;  4N3G A;  4I99 C;  1AKH B;  1QU3 A;  4RLZ A;  3H9J A;  1T56 A;  3ZP5 A;  1QQI A;  2YUS A;  3W2A A;  3CCV I;  1RMG A;  2VOD A;  2VAS A;  1SD4 A;  2K9S A;  2O03 A;  4YDT A;  1A04 A;  4WF2 A;  3DU5 A;  3TW7 A;  2ZJQ F;  2XAG A;  1OFL A;  2NXN B;  4H4K C;  5CVU A;  1W9X A;  4KNY A;  1T0F C;  2DPD A;  2VBE A;  4PFP A;  4F91 B;  2VNH A;  3OKX A;  1UCR A;  5D8K B;  4WCG A;  3FHZ A;  3HRS A;  1ZYR F;  1H42 A;  5EJC A;  1W7P A;  4D7M A;  3H1C A;  5D6E A;  1W0K A;  2W7N A;  3BTI A;  3V42 A;  2ZME A;  3W6J B;  3VYS B;  5J4Y A;  5IY5 H;  1G7R A;  1WPC A;  1UAA A;  4YEI A;  4QIW N;  2PJR B;  3AVT A;  3E0J B;  1ON1 A;  2I5U A;  3OE7 A;  3GTO J;  3FXK A;  3PJR A;  3SJP A;  1E79 A;  2A3S A;  2MW8 A;  5DCF A;  2V7U A;  1K4Z A;  1ZM2 A;  3CUO A;  3BT9 A;  5EGO A;  1H85 A;  2GK6 A;  3A1P A;  5HZB A;  1MGT A;  2R7Q A;  4Y7N J;  2K9Q A;  3J7Y J;  3WBK A;  1OR7 A;  1KK2 A;  2VJ4 A;  3ZPL A;  3JAM Z;  1X1A A;  4RGR A;  1O7F A;  2V9K A;  2D9R A;  3OWT A;  5IK2 A;  3WQZ A;  2CC2 A;  3CCL B;  2HOE A;  2RN7 A;  1DPR A;  2BXZ A;  3OYN A;  1R5O A;  3KP2 A;  2O5R A;  1OR7 C;  2EV5 A;  1EP1 B;  4RM0 A;  1V0E A;  3VPR A;  4P55 A;  3QFR A;  2CUF A;  4BXX J;  2DOA A;  1GXQ A;  5DV5 A;  3R60 A;  4YII A;  4NUB A;  3F9K A;  1I5Z A;  3ZMU A;  1AIP A;  4HST A;  3WHC A;  1QH0 A;  3FMR A;  4UZU A;  3ZRG A;  4X8I A;  3DXJ F;  1P7I A;  1X1C A;  1NK3 P;  3PEN A;  1ZM9 A;  3HSE A;  4BAC A;  3E1S A;  4KIT B;  5L3F A;  3I4N J;  2Q6L A;  4P5O A;  1J7K A;  2K9M A;  4D9J A;  5ILV A;  2WV0 A;  2QGG A;  3I3L A;  3JQP A;  1N78 A;  2AO9 A;  4DOZ A;  2CW7 A;  3D0S A;  3BQJ A;  4IZZ A;  1TQM A;  4U7B A;  1JGG A;  4HRI A;  2KJB A;  1P9Q C;  3HTU A;  3BZC A;  2DA7 A;  4XMY A;  2X3U A;  4UVB A;  3NQO A;  2L7K A;  2H09 A;  3L09 A;  3SJM A;  1YIT I;  3PUN A;  2ID3 A;  4E7K A;  1DBG A;  4A3B J;  5HS7 A;  2KJC A;  3EUH C;  2XTX A;  2NYX A;  5FRO A;  2W25 A;  1IC8 A;  2WA0 A;  1VQ9 I;  1PJ6 A;  1VF7 A;  4FK8 A;  3ZSC A;  3AVU A;  2O3F A;  1HKS A;  3JQR A;  2KIS A;  2IA1 A;  4RA2 A;  5FJ8 J;  5E6T A;  4P26 A;  2DO7 A;  1ENH A;  1QHG A;  2K4B A;  1XB2 A;  2P0W A;  3K9T A;  2OV7 A;  4BE0 A;  5GPA A;  2Q6O A;  3KEQ A;  2X3H A;  1EP3 B;  1EXM A;  2E7W A;  5TJJ A;  3V7R A;  2XAS A;  4RB2 C;  3A3G A;  3ONU A;  1TWG J;  3GFL A;  1LFP A;  3WTT C;  1LE8 B;  3K69 A;  5DS0 A;  3NB2 A;  2J7K A;  3SEQ A;  2RNG A;  3B6C A;  4J19 A;  2QCO A;  3M8J A;  1OB0 A;  4FHT A;  1IG7 A;  4A2U A;  1QHH D;  1I18 A;  1V0F A;  1YRN A;  1IN5 A;  3OEH A;  1K78 B;  2BM0 A;  2E1O A;  1QRB A;  1PJ7 A;  4ENN A;  3PO3 J;  1V5V A;  3OYB A;  2VXD A;  4AC0 A;  5IT9 Z;  1VQ6 B;  4M3B A;  3M9A A;  4HF2 A;  3OP1 A;  1JUP A;  4YEL A;  3CMM A;  4B43 A;  2RAE A;  4PFO A;  2LTP A;  3I5U A;  1S72 B;  2BM1 A;  5KSW B;  2R7X A;  4CCL A;  4RD1 A;  2Q6K A;  1VQ4 I;  1VBL A;  4FAS D;  2G7H A;  3D5S C;  2V4J C;  3ROU A;  1BW6 A;  1S29 A;  1RC9 A;  2P7C B;  1QA2 A;  1RU4 A;  3CCY A;  5K5R A;  3W2V A;  1NHA A;  5IP7 J;  1CQT A;  3GTK J;  4I7H A;  1UD8 A;  2DA2 A;  4ZCI A;  2GXB A;  3WTX C;  3B8Y A;  1A6I A;  2DK5 A;  1QPI A;  3I0T A;  2GRE A;  4TSF A;  1QGY A;  2R5Y A;  2L01 A;  4FQG A;  2OCE A;  3FZV A;  4FE7 A;  5E3M A;  3S1R J;  2L9R A;  1E1R A;  2F1M A;  2QN6 A;  2VZL A;  2XGE A;  1IJE A;  3A35 A;  4WWV A;  1R6R A;  2R7D A;  1KCC A;  1F1Z A;  3HB9 A;  3WU2 C;  5F0H A;  3PO2 J;  5FFZ A;  3SHF A;  4EEF G;  1S0U A;  1G7S A;  1I7P A;  1O3S A;  5GTH C;  1YJN B;  5F4J A;  4NBQ A;  1Y1V J;  3PA2 A;  2DDB A;  4HBL A;  5B5E C;  2MLK A;  3RQ4 A;  4BQO A;  2XTW A;  1NG6 A;  3PNY A;  2BN4 A;  3U6K A;  4HNT A;  2Z6B D;  2IP2 A;  3DP7 A;  3QOE A;  5CVI A;  3K4N A;  3EYI A;  1SD5 A;  4AYB N;  3PUF A;  3SLD A;  1L0O C;  5JMC B;  2EV6 A;  3DCF A;  5HOD A;  3L1P A;  2EFG A;  5E1W A;  1K8A D;  4JBA A;  1B9M A;  3B73 A;  3PFY A;  5EMN A;  1L1I A;  3CCE I;  5HNF A;  1KU2 A;  2FBK A;  3QSY A;  2PN6 A;  3VSU A;  4Y52 J;  1WJ5 A;  3FMQ A;  1HF2 A;  3MMP A;  4YXW A;  1JJ2 B;  3ABM H;  2L7Z A;  4V19 K;  2BE5 F;  2CQX A;  1I1S A;  4W8S A;  3FX3 A;  5DD4 A;  3SLN A;  5JLV C;  3GCM A;  2ECC A;  3I4M J;  3CME B;  4ABZ A;  1DU0 A;  3DPL C;  2K9L A;  1QX4 A;  4RPD A;  1OIS A;  4RMN A;  3I56 B;  1W2B B;  1S7A A;  2WAQ N;  4N9H A;  5HDG A;  2EH3 A;  2E5N A;  1RWR A;  3K4K A;  3QE2 A;  2HPM A;  3KFW X;  2DFH A;  4L0Z B;  2DBB A;  4B3F X;  1WI3 A;  2FA5 A;  1N25 A;  3BOQ A;  1R23 A;  1XDU A;  3J81 k;  1RNL A;  4II3 A;  2DFI A;  4Z1M A;  3P9K A;  1DP3 A;  2BMW A;  3KP3 A;  2Z33 A;  1BMF A;  2Y48 A;  3KLO A;  3BH7 B;  4E6K G;  5EF6 A;  4A3K J;  4YIF A;  2KDO A;  1XMA A;  2KIM A;  4M9S A;  3G6E B;  3JUR A;  3E5U A;  1W0J A;  2X51 A;  5C44 J;  1GV5 A;  2CW8 A;  4DQ2 A;  3GTJ J;  3AL0 B;  2XKO A;  2PMZ A;  3L2U A;  4IOA F;  1WU8 A;  1AOY A;  1IDJ A;  3TP0 A;  1JRG A;  1J5Y A;  5K7F A;  5THX A;  5LRS A;  3L7W A;  1E17 A;  3D5R C;  3A0B C;  1Z67 A;  4OOS A;  4RLQ A;  4RS8 A;  5IYP A;  1R5G A;  3CC4 B;  2HOS A;  4XOP A;  2LF8 A;  1J09 A;  2I8D A;  3D26 A;  1OCZ H;  3F0C A;  3T9G A;  3QFC A;  3AST A;  3N97 A;  4R79 A;  4TT3 A;  4YZA A;  5H2F C;  5FRM A;  1TWF J;  5FRN A;  3K2A A;  4MYT A;  2VLA A;  3W2E A;  2YU3 A;  1VQO B;  1R4N B;  3ZUG A;  4I09 A;  5F1J A;  2C77 A;  3BWG A;  3P4G A;  5CLS A;  5EYR A;  1VLO A;  4MYU A;  2NST A;  4QPO A;  3V8L A;  2LKX A;  3AG2 H;  5J35 A;  1NRK A;  1RKT A;  3V7S A;  4A3L J;  1KC8 D;  3QP6 A;  2RC5 A;  1OGM X;  1D8K A;  3VYR B;  1Y39 A;  2O6G E;  5FD6 A;  2ME0 A;  2ZXH A;  5C3E J;  2ZNZ A;  2WJV A;  1T95 A;  2X1E A;  4ESB A;  1I8D A;  3W2I A;  4ITV A;  1CNE A;  2EWE A;  2V7F A;  5IYB J;  5BNG A;  3ZQC A;  1HCR A;  3DV8 A;  2R7T A;  1ZRE A;  3FK6 A;  4LG3 A;  2MD5 A;  2XSJ C;  3IAS 2;  1EZG A;  2JT1 A;  4LIT A;  3FBI B;  1CZF A;  2DA4 A;  1BL0 A;  4FX4 A;  4DYC A;  4Y9R A;  3ISP A;  1IHM A;  2OK8 A;  2Y0S A;  2L7M P;  3BLY A;  3VMV A;  3B4N A;  1Q7Y D;  5ILU A;  1EFU A;  1B72 A;  3F6O A;  4IHT A;  2BSP A;  3G73 A;  4PGG A;  2B9S A;  2ZZE A;  4IW3 B;  5IYW A;  4DBQ A;  5ICE A;  3RCO A;  3KET A;  1IRX A;  2HTS A;  2JWT A;  3BZK A;  2XKP A;  4ZJZ A;  1NB0 A;  1TBX A;  1JKO C;  3DF8 A;  5J40 A;  4LB6 B;  1ZKG A;  3CCU B;  5HXB A;  3GZ6 A;  2VFO A;  1XCV A;  1K7A A;  3FXR A;  3GTL J;  2XND A;  2A69 F;  4MXN A;  3ZGK A;  1MMG A;  3FXL A;  1TL8 A;  2JMW A;  3H5R A;  4AU7 A;  2D5V A;  5CQE A;  2W4S A;  1HOM A;  3CCJ B;  2O9L A;  4WWC A;  1TT0 A;  4IOC F;  5DM6 F;  3E6B A;  5E8I A;  4RBO A;  1EH7 A;  2WB1 N;  3BG6 A;  1P4A A;  1OHH A;  4U88 A;  3TO9 A;  1WGX A;  3KP4 A;  1IJW C;  1IDK A;  5GAD J;  1IV8 A;  5L46 A;  2M9H A;  4KA4 A;  5M5W J;  5D6F A;  2LBF B;  5TY0 A;  2E7X A;  1STZ A;  1TZL A;  3BRO A;  3SKB A;  3MKZ A;  3I55 I;  1PYV A;  3WGI A;  1DDN A;  2EJR A;  2XAJ A;  3CD6 I;  1OB5 A;  1XGS A;  2EZI A;  3A8J A;  1K4T A;  5HLG A;  2R7W A;  1R7J A;  4B4C A;  3IP4 B;  2LRE A;  3LQE A;  5JHU A;  3CMA B;  3HUG A;  4G5G A;  2FD5 A;  2X0L A;  2KIU A;  3FBN B;  3JSP A;  3N90 A;  1QQ1 A;  4XLH A;  1XX5 A;  3W2W A;  1HVX A;  2FXA A;  4ZGQ B;  3CPX A;  2XPU A;  1YX5 A;  3HM5 A;  1B8I A;  1KYZ A;  1LUJ B;  3SJZ A;  3JRD A;  1HW2 A;  2LC2 A;  3H5N A;  3JSO A;  2MBF A;  1ZR2 A;  4E7H A;  4OIQ F;  2KHM A;  3WHB A;  3TED A;  2VBV A;  5HKK A;  4A3E J;  2JDI A;  3HG9 A;  3WU1 B;  1BA5 A;  4CYC B;  3H94 A;  1W4M A;  1D1C A;  1TWH J;  4HEA 2;  4ZZD A;  3S17 J;  1VHE A;  3UW0 A;  4S05 A;  1JUS A;  5HLT A;  3BJO A;  4RDJ A;  3NEU A;  4OMZ A;  4N0B A;  2QA4 I;  2QQ8 A;  3GQ8 A;  1EFR A;  2MC4 A;  4GQN A;  1ZAO A;  3IRQ A;  1E63 A;  4B1R A;  3WYA A;  4B3G A;  1DPU A;  1BBY A;  2EK5 A;  3SFZ A;  1LDK B;  1YIO A;  1HC8 A;  3PIP F;  1GLN A;  1SM4 A;  1BJZ A;  2LZJ A;  2GA2 A;  2DTZ A;  4A5N A;  1BI0 A;  2HVS A;  3W5H A;  4Z4U A;  3H09 A;  2MG4 A;  1YG2 A;  1IDZ A;  4N9I A;  5CVR A;  3BH4 A;  3E3V A;  3AVX A;  1O3Q A;  3RKW A;  2K7L A;  4CIC A;  4LLN A;  4Z03 A;  4LBV A;  4ETS A;  1QFZ A;  1LLZ A;  1VJS A;  2UVE A;  4NBS A;  2OD5 A;  1W7P B;  1O8D A;  2ZME B;  3O6B B;  1ZM3 A;  3S1N J;  2LKS A;  3C18 A;  2YS9 A;  4L9V A;  5FKK A;  4C43 A;  2J8I A;  5LD2 C;  3AK5 A;  1GV2 A;  4HA8 A;  4ZDL A;  3DLL F;  2JQ7 A;  2XZO A;  1HDP A;  1TLL A;  4A5M A;  1MAB A;  4KKT A;  2XC1 A;  2FNA A;  1TNT A;  4C3H J;  9ANT A;  4P25 A;  2IS2 A;  2HQ5 A;  2HZT A;  1Z21 A;  1FOW A;  5EGO B;  1SC7 A;  3FKJ A;  1HA8 A;  3QPL A;  3C2H A;  3JRA A;  1HXD A;  4RAY A;  2XRO A;  1VQ7 I;  2F5V A;  3WTZ A;  4WK8 F;  2A5W A;  3G71 B;  1HQC A;  2XPV A;  4CYD A;  3ZN1 A;  3DU6 A;  3VEP A;  3HL2 A;  3P26 A;  4Z4Y A;  1I3A A;  2M0M A;  2P7V B;  3H36 A;  4XON A;  4NCN A;  2XHK A;  1FYL A;  1YJW B;  4XLC A;  3S3M A;  4RPB A;  3OJX A;  5JI6 A;  1QRY A;  4G7X A;  4YFX F;  3CC2 I;  3LOC A;  1PJ5 A;  5FL7 A;  2JPB A;  1Q1H A;  1VQ5 B;  4M6Y A;  3G1O A;  2L4M A;  3LSM A;  3IC7 A;  1MDM A;  1YIJ I;  3L00 A;  1KD1 D;  2HLD A;  5LMZ A;  3OYD A;  3KEY A;  3DEU A;  2NSP A;  4TKO B;  1BC7 C;  1RET A;  2K85 A;  4LC0 A;  1OB2 A;  3ZZ0 A;  5JBQ A;  5M5Y J;  3T8T A;  4H9G A;  1EA3 A;  2Z99 A;  4R71 A;  5B6I A;  2QQ9 A;  4UNO A;  4WZK A;  1S7E A;  1R36 A;  2JZY A;  2L9V A;  3J7A Y;  3ZBT A;  1O8F A;  1PXZ A;  1YW8 A;  4UZF A;  3K2Z A;  1F20 A;  5GAG J;  4EJV A;  1PJR A;  2R9V A;  5ED4 A;  4IRI A;  5AON A;  3S93 A;  1RR8 C;  4IHS A;  1BQE A;  2E1C A;  4RM3 A;  5K5O A;  2D3L A;  5BS6 A;  3C2G A;  1LLW A;  2LYC A;  1XTA A;  1HLV A;  1E0E A;  2DYS H;  2RRE A;  1U2W A;  1B23 P;  1JI8 A;  1JUM A;  4MTE A;  3REO A;  3ZMV A;  3J81 Z;  2R0Q C;  1ETW A;  3F8C A;  3TO7 A;  4Y4R A;  4B8X A;  2V7Q A;  4X7F A;  4BQN A;  1X1B A;  1Z0X A;  2P5L C;  4QVJ A;  2R3S A;  2CUJ A;  3CJN A;  5GAH J;  4AF7 A;  4LLG F;  5E79 C;  3OYC A;  3LFK A;  3HOX J;  1N07 A;  2L54 A;  5A2Q K;  2GJK A;  3BH6 B;  1I50 J;  2RQQ A;  1VQN I;  1OCO H;  1UMK A;  3NAR A;  1YTY A;  1YRN B;  2O0Y A;  4Q47 A;  2V6C A;  2JA2 A;  3B6A A;  4L0Y B;  4MO7 A;  4I0A A;  4PMH A;  3Q0W A;  2JTV A;  1H88 C;  4NDL A;  4NK8 A;  4UXN A;  2HEO A;  5TIS C;  1I6H J;  1N06 A;  3QOP A;  3HSR A;  2IT0 A;  1BX0 A;  5C1C A;  2CF4 A;  4PC3 A;  4XK4 A;  3ABT A;  3S1Q J;  2F48 A;  3ELK A;  3R6K A;  3FIW A;  1UFM A;  3WNB A;  1KGS A;  1MBK A;  3HHH A;  4KJZ A;  3M8E A;  1QVG B;  1OGO X;  4YFO A;  1PDN C; 
#chains in the Genus database with same CATH homology
 5IK2 A;  3WQZ A;  4C9Y A;  3OIQ A;  3OYN A;  2O5R A;  1OR7 C;  2IGM A;  3LMW A;  3JU4 A;  3HOT A;  1V0E A;  4XN3 A;  3K4C A;  3I9V 2;  3PNV A;  1E43 A;  3BC9 A;  2L5Q A;  2DOA A;  4OZY A;  3K6G A;  3ZCO A;  1BR2 A;  4NUB A;  3F9K A;  4HST A;  2R7U A;  4UZU A;  2Z2S B;  3ZRG A;  1X1C A;  4B3X A;  2OC6 A;  1WJD A;  3E1S A;  4KIT B;  4BAC A;  1O8K A;  4P5O A;  1MW7 A;  2K9M A;  4XKC A;  4D9J A;  4PJN A;  4F93 B;  3I3L A;  2IGN A;  4BE1 A;  1E1Q A;  1N78 A;  1O8L A;  4DOZ A;  2CW7 A;  3EPZ A;  3U21 A;  4B44 A;  4E7J A;  4HPQ A;  4IZZ A;  2VXZ A;  1PKV A;  1OFM A;  4U7B A;  1MNE A;  4BJT A;  4HRI A;  1Y56 A;  2NTB A;  1P9Q C;  3L2W A;  5C1E A;  2W00 A;  4XKW A;  2GJP A;  3GQA A;  4XMY A;  2X1C A;  2GOM A;  1V5G A;  3VST A;  2L7K A;  2E5Z A;  1UD4 A;  2GK7 A;  4E7K A;  4BQQ A;  1DBG A;  1Z3Y A;  2WZP P;  4MR0 A;  5TGT A;  3EUH C;  4EW9 A;  2MFZ A;  1E3X A;  3LNN A;  4PJM A;  5FRO A;  1VF7 A;  2WA0 A;  3OYL A;  3A1Y A;  4LIV A;  2R7R A;  3N05 A;  1QHG A;  2XC7 A;  4E0F A;  1O8E A;  4Y33 A;  1FMV A;  3K4B A;  2P0W A;  4PSX A;  2OV7 A;  4BE0 A;  3MD2 A;  3NWS A;  3DDY A;  2JUG A;  3DQV C;  2X3H A;  2R7O A;  3QOD A;  3H9G A;  2WPD A;  1G8X A;  3DTI A;  4BXF A;  2JJ1 A;  2HDW A;  3A3G A;  4YRV A;  4OAZ A;  2K5C A;  2WSS A;  1LFP A;  2NTQ A;  1EE6 A;  3ZSC A;  3SEQ A;  2RNG A;  2VQH A;  2PJR A;  2L9S A;  3M8J A;  4F3Q A;  3FDY A;  2KRC A;  1OB0 A;  2NOJ B;  1UD6 A;  1D0Y A;  3BCB A;  1QHH D;  1I18 A;  1V0F A;  3OEH A;  2X6W A;  3LL7 A;  4FXU A;  1O88 A;  4XLF A;  3D5L A;  2M5S A;  1QCX A;  2QY1 A;  4XOT A;  2JVH A;  2X1D A;  3AFH A;  3OYB A;  2VXD A;  3T51 B;  3GBG A;  1T5E A;  3NWT A;  3EUK L;  1DQU A;  4YEL A;  2HQA A;  3CMM A;  3TMO A;  4B43 A;  4PFO A;  1MND A;  3VR6 A;  1BOB A;  4XD7 A;  3QYE A;  2R7X A;  4CCL A;  1ZEL A;  3H9Q A;  3LSK A;  1MMA A;  2ZTG A;  4FAS D;  1VBL A;  3D5S C;  1BN8 A;  2V4J C;  2OUM A;  4FET A;  1RU4 A;  1WP6 A;  2CK3 A;  2ZFU A;  2XF6 A;  3W2V A;  2E1B A;  1O8I A;  2VKD A;  1UD8 A;  3HPG A;  5AMV A;  1V5F A;  4RLF A;  4DK1 A;  3B8Y A;  3L2V A;  4TSF A;  4ZTJ A;  3GQ9 A;  1U0J A;  4XKV A;  5DN6 A;  4AYB A;  3BG7 A;  1S9H A;  4CUG A;  3IUO A;  1E1R A;  3EQO A;  2F1M A;  3W3C A;  3A35 A;  1R6R A;  1KCC A;  3VSL A;  2X53 S;  1PLU A;  2PEC A;  3OIP A;  4I84 A;  2V26 A;  1KMH A;  4C2T A;  2ZZG A;  3OS0 A;  3A3B A;  3BCF A;  4U49 A;  4YEJ A;  4ANJ A;  4NK6 A;  1WJF A;  4AVZ A;  1UEL B;  1KTW A;  2HZD A;  3BCA A;  2F43 A;  1YE9 A;  5CPR B;  3RQ4 A;  4BQO A;  1NG6 A;  3PNY A;  2E60 A;  4KT6 A;  2UV1 A;  2CMP A;  4HNT A;  4P22 A;  2Z6B D;  3QOE A;  3K4N A;  4W8R A;  2WAQ A;  4BE2 A;  4DBR A;  4URR A;  2JSP A;  3K4M A;  4U4B A;  3PFY A;  4IQ4 A;  1YX3 A;  2M4K A;  4XN0 A;  3OR1 C;  4Y3O A;  5HNF A;  4IKF A;  3FKS A;  2UWM A;  4F52 A;  3OYK A;  1W36 C;  3L2Q A;  3VSU A;  2QX3 A;  1WJ5 A;  3LSH A;  4YXW A;  3VYT B;  1QJV A;  1Z3X A;  4E7L A;  4E7S A;  4W8S A;  3ZXS A;  1K5C A;  3SDB A;  3OOU A;  1D1B A;  2E1M B;  3CP8 A;  2DT6 A;  3TBI A;  3DPL C;  2K9L A;  3FHN A;  4RMN A;  4BS9 A;  2IS4 A;  2R7V A;  2QKL B;  2BOL A;  4ZC3 A;  1WTH D;  1D0X A;  2AQF A;  4PUS A;  4BGD A;  2BVL A;  2E5N A;  3G2B A;  3K4K A;  1RWR A;  3VSV A;  2HPM A;  4CCJ A;  4DGW B;  4DJA A;  3SUC A;  4B3F X;  1AA7 A;  1AIR A;  3T53 B;  3KX2 A;  4II3 A;  2XF5 A;  4E7Z A;  4Z1M A;  1DP3 A;  1BMF A;  4E6K G;  1X1D A;  1PE9 A;  1BHE A;  2KDO A;  4PJL A;  2IGO A;  3JUR A;  1BLI A;  1W0J A;  2X51 A;  2VIX A;  3LFU A;  2CW8 A;  5JHF A;  1NBM A;  4L8J A;  3OYF A;  2X85 A;  2WY8 Q;  3L2U A;  2PMZ A;  3AL0 B;  1IDJ A;  2D3N A;  3HC7 A;  3ZQQ A;  1JRG A;  4DNT B;  3DTK A;  4ZTF A;  2W6I A;  3KEW A;  3CZ6 A;  3D5R C;  3OL4 A;  4RLQ A;  4OJ5 A;  2LH9 A;  4XOP A;  1Z7L A;  4E4H A;  4X0G A;  2HVR A;  1J09 A;  4CZC A;  2I8D A;  1W36 D;  3T9G A;  1KZL A;  2V6E A;  4YZA A;  4R79 A;  4TT3 A;  3HXL A;  2W82 A;  5FRM A;  4BU2 A;  4YZX A;  2ODL A;  2CV2 A;  5FRN A;  2QXZ A;  2Z1D A;  2VLA A;  1SKY B;  4DNR B;  4BDY A;  1G59 A;  4W8Q A;  1NHC A;  2QKM B;  4CCK A;  4PJJ A;  3HUG B;  2NST A;  2NZM A;  4QPO A;  4HWV A;  4OAY A;  4E7I A;  3VSK A;  1NRK A;  1OGM X;  2Z8G A;  2X6X A;  3VYR B;  2WAD A;  2IXS A;  4U87 A;  1KCD A;  2ZXH A;  4NC8 A;  2WJV A;  1T95 A;  1MMN A;  2X1E A;  2KQR A;  2VL8 A;  2WAF A;  4D1Q A;  1N77 A;  1I8D A;  1X4O A;  2XZL A;  3EQN A;  4ITV A;  5KCM A;  1HG8 A;  3DKY A;  3OW7 A;  2EWE A;  2V7F A;  3DEE A;  1DGW Y;  3HAG A;  1X19 A;  3OYE A;  3S3O A;  2R7T A;  2JVG A;  2VJJ A;  4DK0 A;  4LG3 A;  2XSJ C;  4CSW A;  3IAS 2;  3CES A;  2PYH A;  4BEH B;  3SZG A;  3DKX A;  4LIT A;  3FBI B;  1CZF A;  1MMD A;  2LG4 A;  4HG2 A;  3HOS A;  3K70 C;  4XM3 A;  2XZP A;  2Y0S A;  2NT6 A;  3BLY A;  5KHD A;  3VMV A;  3B4N A;  2LRD A;  3OS1 A;  4XNF A;  2O0W A;  4YZ0 A;  1LVK A;  4EAT A;  2BSP A;  3BCD A;  4XKB A;  3OR2 C;  2UUZ A;  4N4O B;  2ZZE A;  2DT7 B;  4DBQ A;  2LY1 A;  3RCO A;  3DTE A;  3DWL E;  1IRX A;  2WB1 A;  3RTR A;  3OAA A;  2M7B A;  2XOK A;  2VQL A;  3BC8 A;  1UD3 A;  3OY9 A;  4XOR A;  3AKZ A;  4ZJZ A;  3DPT A;  1K6Y A;  4JOM A;  3FY3 A;  2E1M C;  5HOO A;  2V1N A;  4C2L A;  4G7W A;  3S3N A;  3K10 A;  3WWG A;  4ZDO A;  4BJ5 C;  2KVO A;  4ASU A;  1DBO A;  5CKT A;  4F55 A;  5CDF A;  2XND A;  2VB6 A;  4MXN A;  4C30 A;  3ZGK A;  2O1D A;  1MMG A;  2XF7 A;  3H5R A;  2KZV A;  4AU7 A;  5CQE A;  2W4S A;  2HPI A;  1WJC A;  3OYM A;  4BUP A;  3H0D A;  3T56 B;  1TT0 A;  3S32 A;  4DIQ A;  5KNL A;  3ZPN A;  4IQJ A;  3BG6 A;  1OHH A;  2KMU A;  4XLE A;  2CS3 A;  2Z16 A;  3DLA A;  4RM2 A;  1IDK A;  2ZZQ A;  2DCE A;  4C2U A;  3AL0 C;  2LBF B;  3RSN A;  3CF2 A;  5HNH A;  3K70 D;  3OPO A;  1TZL A;  2VQG A;  2A6T A;  4ZDP A;  2X8K A;  3MKZ A;  3S8P A;  1PYV A;  1SFK A;  4XLA A;  4XQF A;  1WFX A;  2LY2 A;  4CCO A;  2CV1 A;  5CQG A;  3QYF A;  2KLO A;  4CCM A;  1X0C A;  2L9N A;  2R7W A;  3VDX A;  3IP4 B;  2LRE A;  3M1C A;  4HSR A;  2DXI A;  1WJE A;  4JQF A;  1OOC A;  1H8E A;  3FBN B;  2CV0 A;  4OJO A;  3OL3 A;  3IAM 2;  4PK4 A;  4XLH A;  3W2W A;  5LFA A;  4BDZ A;  3SEZ A;  1HVX A;  3FPP A;  2AQE A;  4B48 A;  2MD0 A;  3OMY A;  1YX5 A;  3ZPP A;  3H5A A;  3H5N A;  2LC2 A;  1NG7 A;  2O0V A;  3RPU D;  4XL9 A;  2KHM A;  4E7H A;  1UD2 A;  2GJR A;  5HKK A;  1XG2 A;  2NTP A;  2JDI A;  2VBK A;  3HG9 A;  4Z06 A;  1KON A;  3H94 A;  4OJ6 A;  2W1O A;  4HEA 2;  1D1C A;  3G05 A;  3UW0 A;  2DIE A;  5HLT A;  2VQC A;  3GQ8 A;  2DJI A;  1EFR A;  2MC4 A;  4GQN A;  3ONQ A;  1SAU A;  2IGK A;  2R4G A;  2X6Y A;  1LKX A;  3PUB A;  3KYL A;  4B3G A;  3TL4 X;  4CCN A;  4OJP A;  4YZQ A;  4BEH A;  3OYA A;  3VWB A;  1LDK B;  2V31 A;  2Q1Z B;  1GLN A;  1VZ0 A;  3OS2 A;  3OYI A;  2R7S A;  2LZJ A;  4KKU A;  1WJA A;  2HVS A;  4PSW A;  2CH0 A;  3LMM A;  3BH4 A;  4BJ6 C;  2PYG A;  3ZR8 X;  2LOO A;  4B47 A;  3GQ7 A;  4Z03 A;  4OWR B;  2UVE A;  3LSG A;  1VJS A;  3DPU A;  2IQ7 A;  1H80 A;  4CA0 A;  2GOX B;  1O8D A;  1VLY A;  1JTA A;  2HU9 A;  2BW3 B;  3HKZ A;  2WBM A;  3SYT A;  3NE5 B;  4IX7 A;  5LD2 C;  2L2O A;  4ZDL A;  3OFN A;  2XZO A;  4G6I A;  1UG0 A;  2ZSH B;  4NNJ A;  2VPL A;  4F92 B;  4N4N B;  3A4C A;  1MAB A;  4KKT A;  2HVQ A;  1E3Z A;  2IS2 A;  2KL4 A;  2M3A A;  1N75 A;  2IS1 A;  1Z21 A;  2ZSI B;  1BR1 A;  5HVQ C;  3FKJ A;  1HA8 A;  3C2H A;  4W8T A;  4QPQ A;  4JMQ A;  4OJL A;  3OYG A;  2VJI A;  2ZXI A;  2F5V A;  3PNT A;  3A2K A;  2A5W A;  1WMR A;  4OZZ A;  2ELJ A;  3OOC A;  2VKH A;  3DU6 A;  4KKS A;  3PL8 A;  2WY7 Q;  3HL2 A;  4NQW B;  4NC7 A;  4HIZ A;  2M0M A;  2LBF A;  4XON A;  2UVF A;  1HZE A;  4XLC A;  3S3M A;  2NT9 A;  3GVJ A;  3GQB A;  1K28 D;  3GVL A;  4G7X A;  1COW A;  3ZIA A;  1O8M A;  4P1W A;  5FL7 A;  1O8H A;  2F6C A;  3CP2 A;  3LSM A;  4HNU A;  4J00 A;  2KRH A;  1BR4 A;  2M7A A;  1O8J A;  2HLD A;  3MKW B;  3EUA A;  3KEY A;  3OYD A;  3KRG A;  4G6T B;  2NSP A;  4TKO B;  2O04 A;  3PSF A;  2JJ2 A;  1IB4 A;  4Z05 A;  1DGR M;  4J01 A;  3OEE A;  4ZYA A;  1EA3 A;  2BVM A;  2XGJ A;  3QYB A;  2W6J A;  2XAU A;  3K4J A;  1UD5 A;  1GQ8 A;  2VBM A;  3OYH A;  3PSI A;  3J7A Y;  1O8F A;  1H8H A;  3VMW A;  1D0Z A;  2F4I A;  1X4P A;  1PXZ A;  1Y6I A;  3VYU B;  3HPH A;  1IA5 A;  4LIU A;  3LSI A;  1ERD A;  2VJ5 A;  2HNH A;  1PJR A;  4CH7 A;  2R9V A;  2KP6 A;  1O8G A;  1QU3 A;  3H9J A;  2IS6 A;  3W2A A;  3S93 A;  2INU A;  2CUZ A;  4RM3 A;  2D3L A;  1RMG A;  2WAE A;  3H35 A;  3C2G A;  2LYC A;  2VAS A;  2XDV A;  1E0E A;  2V4D A;  2RRE A;  2Q2E B;  3DU5 A;  4KIS A;  4GRI A;  1OFL A;  3CJQ B;  2K3P A;  4H4K C;  1JI8 A;  2INV A;  3UR3 C;  3L2R A;  1W9X A;  3B90 A;  1T0F C;  2VBE A;  4PFP A;  4F91 B;  2ZTN A;  3K4L A;  4Y4R A;  2V7Q A;  4BQN A;  1X1B A;  4BL0 B;  2M4G A;  2CUJ A;  1W0K A;  1V5E A;  2W7N A;  3VYS B;  3V42 A;  3OYC A;  1FX0 A;  1WPC A;  2GJK A;  2FUG 2;  2BW3 A;  1D1A A;  1UAA A;  2PJR B;  2KPM A;  1FMW A;  2RQQ A;  3E0J B;  3OE7 A;  3MKY B;  2MAB A;  3PJR A;  2CFO A;  1E79 A;  3GRH A;  2JA2 A;  2O17 A;  3MMY B;  4PMH A;  4NK8 A;  2GK6 A;  4II2 A;  2R7Q A;  1BPL A;  2QE7 A;  3CJR B;  4MLO A;  4XR6 A;  5C1C A;  2ZZF A;  3OYJ A;  2VJ4 A;  1WJB A;  3GVK A;  2WJY A;  1X1A A;  1OGO X;  2JIZ A;  3UNG C;  4KJZ A;  1OLT A;  2V9K A;  3OWT A;  2MYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...