4AW1A

Human pdk1 kinase domain in complex with allosteric compound ps210 bound to the pif-pocket
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
293
structure length
283
Chain Sequence
QHAQPPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate-Selective Inhibition of Protein Kinase Pdk1 by Small Compounds that Bind to the Pif-Pocket Allosteric Docking Site.
pubmed doi rcsb
molecule keywords 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
molecule tags Transferase
source organism Homo sapiens
total genus 77
structure length 283
sequence length 293
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4aw1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aw1A01
2BHHA 1YOLA 4PL5A 3G6GA 3PYYA 4DFXE 3ACJA 4YU2A 1OUKA 3BHVA 4KRDA 3VUKA 4HPUE 5DI1A 4C58A 4F1OA 4W9XA 5AR3A 3V6RA 1SZMA 3LFNA 2VWIA 4RMZA 4EL9A 2OF2A 2ZAZA 3LJ2A 2OBJA 2GDOA 4FKVA 4MYGA 4AE9A 3HMOA 3JUHA 2HW7A 1GIJA 5AP3A 1YWVA 3C0HA 2ERKA 1Y57A 1HCLA 4L68A 4MXZA 2X6DA 3DKGA 4Q9ZA 3A8XA 4Y8DA 1Y6BA 3Q4CA 3ENHA 2P2IA 2W99B 3I4BA 4TYJA 3RMFA 3MGYA 3W2SA 3TDVA 5HI2A 1GOLA 3CJGA 4RIWB 2G9XA 4AW1A 3ZTXA 2R7BA 4ASEA 5CI7A 2JKOA 5KNJA 2JLDA 4IB0A 4AOJA 3G0FA 3BEGA 3ZDIA 2GNLA 4DH8A 2ONLA 5KZIA 1FGIA 2BCJA 4MNEA 3QFVA 2VWZA 2B1PA 2VWBA 4K9YA 5IUIA 5KMNA 5JGBA 2KTYA 4TW9A 4Q9SA 5DR2A 1OGUA 4GVAA 4C38A 2R0IA 4M0YA 2Z7RA 5HG9A 2QKRA 3OUNB 3UBDA 4EJ7A 1L8TA 4WG5A 5L3AA 4BBMA 3AD5A 2REIA 2UZEA 1CDKA 4IB1A 5FDPA 4YP8A 2F4JA 1NVRA 2VX1A 3OY3A 4K8AA 5DT4A 4ONAA 4JOAA 2IW6A 5AUYA 5HVYA 4QMQA 3TUDA 3NW6A 5A3XA 4OBQA 4R3PA 5CU2A 2PE1A 5CVHA 5ANIA 2QG5A 4M12A 4AZTA 4BIBA 1FOTA 3EN9A 3D15A 4PDPA 4F0FA 3W16A 2PZRA 3BU3A 1YHVA 4DG0E 3R00A 4RLKA 1E1XA 2OI4X 2RG6A 3UP7A 3F3UA 2CKQA 2XK8A 3PXZA 4I3ZA 3VF9A 2ITQA 3F3VA 5AUTA 4KSQA 1U4DA 5ANKA 2Y6MA 4NM0A 2EXCX 3DK6A 2LAVA 5FP6A 5IQIA 4DTAA 3C4WA 4J71A 1Y6AA 3C4EA 4RVTA 4BL1A 1WBSA 5CEOA 2ZYBA 3DAKA 4R78A 4UMPA 4KAOA 3QHWA 3TEIA 3KA0A 4C33A 3CQUA 4EOPA 4RX8A 2BDWA 2XNOA 4WO5A 1ZYSA 5E92A 4D1ZA 1FMOE 4IBMA 3DY7A 4EH6A 2R5TA 4JDKA 3ORLA 4CV9A 4XLVA 4U97A 3Q2MA 3RM7A 4QYEA 4FKGA 3NUNA 2XYNA 3SDJA 2ZM4A 3VQUA 4FKUA 5M53A 3BHUA 2XNPA 3UIBA 3LLAA 2UZBA 3MTFA 5CX9A 1W7HA 5C1QB 3MB6A 3FE3A 4KS8A 4FV0A 4GEOA 4FEUA 2YDJA 5BYLA 4B7TA 4O0XA 3F3WA 4JLCA 4MTAA 2WTIA 3E5AA 3C50A 4OTDA 3MVJA 2PVRA 4L9IA 1EH4A 5EQYA 4H3BA 5KUPA 3RJCA 3FMNA 4BZNA 4RIWA 3RP9A 4L45A 3EL8A 1CSNA 1KV1A 2HY0A 3DBFA 4GSBA 5M4FA 3SVVA 3DBDA 4DEBA 2J90A 3O96A 4WOVA 3RWQA 3EHAA 3UVRA 3E93A 5C9CA 3OBJA 4MD7E 5L2SA 4BGHA 2J0JA 3PJ3A 4CFXA 4X2JA 3PXYA 3ZFYA 4S32A 4AGUA 4OTIA 2I7QA 5HCZA 4TT7A 3ROCA 3TKIA 3D83A 4RIXB 5EI2A 2RL5A 2OZOA 2V0DA 3QTIA 4FNYA 3FMJA 2QNJA 3LMHA 2OICA 3TNIA 4XG6A 4D4VA 5FEDA 2V62A 4RQVA 3EN6A 3UO4A 4E3CA 4IC8A 3CXWA 4CGAA 4EKKA 1Q3WA 2WTWA 3R7VA 4FNWA 4FV5A 4F6UA 4IMYA 3P4KA 3ZXTA 5FBNC 1YXVA 4CT1A 2HIWA 2QKWB 5DT0A 3QYWA 4RJ7A 5DN3A 1WVXA 2CHLA 3COHA 4NW6A 1R0EA 3C5IA 2UW6A 3GVUA 3FL5A 4M13A 3V5QA 4XG3A 2F2UA 4CT2A 4EK8A 4R5YA 1OIUA 4NU1A 2FGIA 4XRLA 3ZH8A 5C8MA 2J0LA 4WIHA 3LMIA 4C3FA 4F9YA 2IO6A 4FG8A 3UC4A 2IZRA 4G6OA 2XM8A 4G3EA 3LCKA 3ORMA 4BCMA 3O23A 4Z3VA 4L42A 4ZTNA 1YWNA 4CFVA 2QOCA 4C4JA 1WBOA 3R7YA 4KB8A 2Y4PA 5A4CA 3EQIA 5EDPA 4O1OA 2VTOA 3E87A 3HA6A 4YZ9A 3SG9A 3FZRA 2FSLX 3F7ZA 4IAYA 1Q62A 3DFCB 3GNIB 3PA5A 3FLNC 2BRNA 3UG1A 1KE7A 3OEZA 4QMLA 4GU9A 4NUSA 2G01A 5HE1A 3VIDA 5KMMA 3HDNA 2GHLA 4DAWA 3SLSA 4JIAA 3BYOA 2W1GA 3P7CA 1OIRA 1XR1A 3A4PA 3GB2A 3Q60A 5JGAA 1NVQA 4MBJA 3NYXA 2F7ZE 5AR8A 4FIFA 3I0QA 3DTWA 5IQAA 4I6BA 3BHTA 4EZ5A 4CQEA 2NPQA 3R8VA 4RQKA 5HG5A 2ACXA 4AT4A 1M7NA 2CN8A 3KN5A 3PLSA 3TV7A 3O7LD 4FZDB 3PPJA 3P1AA 3D5UA 3EKNA 2AUHA 5CF4A 3QTQA 5DNRA 4PL3A 5KMOA 4DHFA 4D2VA 2WTKC 3FQHA 4BIDA 3HGKA 4L67A 4ZY6A 5H8GA 5M07A 3R63A 3E7VA 3U6HA 2HK5A 4JDJA 1OPKA 3SQQA 3E88A 3ZDUA 3GU5A 3VO3A 4HCUA 4CG8A 3UZTA 3LFSA 4V0GA 5CAPA 4RIXA 4OBPA 4WUNA 4XG9A 1TQPA 2A0CX 4NEUA 5CVFA 4WUAA 5BVWA 4FL2A 3RNYA 4P5QA 4C61A 2XJ2A 4IACA 1U54A 3O17A 4XX9A 4ZTLA 1P5EA 4ZTMA 3FLQA 4IX6A 4AA5A 4BHZA 4FT3A 4I1ZA 4LV5A 4PWNA 4I22A 2GNIA 4MQ1A 4E6DA 5IA1A 1ZAOA 4TN6A 5E8TA 3ZO4A 2CLQA 2XZSA 3ATTA 3LVPA 4XV3A 2ITYA 3U51A 3WILA 4G34A 4BI0A 5KHWA 4WG4A 3BRBA 4EOJA 4TNBA 5L2QA 5I0BA 4YBJA 4WKQA 4AQCA 3ZC6A 3UG2A 3BWFA 2ZVAA 5DBXA 5IU2A 3KK8A 4AWIA 3CD3A 3G9LX 4EUTA 1OITA 1PKGA 3EQPA 4K2RA 2EWAA 1OVEA 3MA6A 3ZEPA 4BB4A 1RW8A 1YXSA 5JT2A 4FEQA 2OK1A 5LVNA 3AG9A 3ENMA 4FK6A 4AZWA 3PSBA 3OCGA 2P0CA 4UY9A 3LQ5A 4ZS4A 5JRQA 1LUFA 3DAJA 3FC2A 4O7WA 2BALA 4KIKB 1V0PA 5JFXA 5ETCA 2QR8A 4RFYA 1IAJA 2ZOQA 3DNEA 3UPXA 3V5LA 4PF4A 5IPJA 2OJFE 3W33A 4ALUA 3F3TA 4GIHA 2QVSE 3LQ3A 5A54A 5IKWA 3CPBA 2PZ5A 4U44A 5HZNA 3PJCA 2V5QA 2OF4A 4USFA 3M11A 2XVDA 1OKZA 3WF9A 4H1MA 2ITUA 4XBUA 4FMQA 5IZFA 2WKMA 2W5HA 3CTHA 4FV1A 4RZWA 2XEYA 5HIEA 1PW2A 2C6DA 1Q8TA 1FVTA 4K1BA 5AP7A 2B54A 3GCSA 3QGYA 1WAKA 5LMBA 4RWJA 4CQGA 2OXYA 5ETAA 5HHWA 3BBWA 3R7UA 3OW4A 3Q4ZA 4JAIA 2ITOA 4R1VA 3POZA 4JQ7A 5H9BA 4ZSAA 3L9MA 5H8EA 5BMMA 3R6XA 2UZLA 5DPVA 3E7OA 3AMYA 5FLFA 4C3RA 3Q9ZA 1SVGA 2XBAA 1ZMVA 5DWRA 1T45A 4BR3A 5IUGA 2AC3A 3UIMA 2ZMCA 3QCSA 4ZJVA 5BUJA 1M7QA 2Q83A 4M97A 3COKA 4EHZA 2XS0A 4AOIA 1Y91A 1ZARA 3BYVA 3LE6A 2B9IA 4D4YA 3C0GA 4FK3A 5D9HA 3A7IA 2V55A 5HX6A 5I9VA 5IEVA 2WPAA 4MBLA 5DR9A 4EC9A 2VGPA 4LV8A 4ASXA 5M51A 3P7BA 1VJYA 3PP0A 2VZ6A 4L00A 4MNFA 4YHFA 5HORA 3UIUA 5E4HA 3AD6A 2QI8A 5IDPA 5K4JA 4I5PA 3TV4A 3W2PA 4CD0A 4QQ5A 3KXNA 4G3GA 4E7WA 4R6VA 2FH9A 1GNGA 4ITIA 4J99A 2YITA 4XMOA 5AP0A 1XO2B 4UZHA 2YDKA 3A8WA 3UVQA 4FSZA 3E64A 4M68A 5CAQA 3K54A 4FSRA 3R01A 3NX8A 4WBOA 3IOPA 3D4QA 1PMVA 3FLYA 3QC9A 5TT7A 3VRZA 4BC6A 5HNIX 3VJNA 4ACMA 3L9LA 4FNZA 3POOA 3UVPA 5AJQA 3ZLXA 2WZJA 3A60A 3HX4A 3AOXA 4GT4A 4L53A 5KMJA 3AC8A 2IN6A 3MFTA 2RFDA 4PDSA 3QQLA 4EOMA 3WE8A 3CR0A 5CASA 2J50A 4KSPA 1XBAA 4ZJJA 2GQRA 3TNPC 3TI1A 3ZZWA 4EH3A 3GC9A 2HZIA 1YXXA 1R0PA 2PVMA 4M0ZA 4PTEA 5L2TA 4X6QC 4YBKA 4GYGA 4FIEA 1BI8A 2KULA 3BGQA 4F65A 4KIKA 4CSVA 4DFUA 3QRIA 4GG7A 4EH5A 1YW2A 1E9HA 1R3CA 2ITZA 3A7GA 4C4EA 1ATPE 4JT3A 3NCGA 4EWHA 3QD2B 2GTMA 3IO7A 3UOLA 5FXSA 5CEKA 1YHSA 3D5VA 2OH0E 1VEBA 4EUUA 1W84A 3DKFA 2UW9A 3BE9A 1UKHA 3GFWA 4YLKA 2C0IA 2CNQA 4J52A 4FTLA 5AM6A 4CCBA 3FZ1A 3GOKA 4S34A 4ASZA 4FGRA 2YFXA 3KK9A 3TCPA 3M42A 4EEVA 4AGWA 4J96A 2YM6A 2VTRA 4XG8A 4LL0A 5AUXA 3RK7A 4I6FA 4XHKB 3ZSGA 2PUPA 3GC0A 5KCVA 2PUUA 3I81A 2C6OA 4I6QA 2Z7LA 3Q53A 5M4IA 5BVNA 2C6TA 3KULB 4H3PA 4Y73A 4M14A 4UMTA 3H0ZA 2R4BA 4HVHA 3ZFXA 3BV2A 4B99A 2QOKA 4L46A 4EQCA 4HVSA 3PVWA 3EN7A 2XP2A 1ZOGA 1AD5A 3PLAE 3QX2A 5DOSA 3C1XA 4IEBA 5J9LA 3HAVA 3QKMA 5DMZA 3C4XA 1UU9A 5HD7A 3VF8A 4OTWA 5LVMA 3WF7A 5M4UA 1Z57A 3E3PA 3DV3A 4CZYB 3MYGA 3DT1A 3MH1A 5AV3A 3L8SA 5JQ5A 2R3RA 5ETIA 1WMKA 5ETFA 4F99A 4UB7A 3CIKA 3IG7A 4O0YA 5IDNA 4FKTA 2WTCA 3FQSA 2GSFA 4BYJA 3DBCA 4ERWA 4JRNA 4MF0A 4YHJA 4KIQA 4RT7A 3KKVA 4I24A 4F4PA 1BI7A 3C4CA 3FMHA 4FKRA 3KC3A 3FDNA 3QAME 1CMKE 4W9WA 5AV0A 5FQDC 3F2RA 3F82A 2NO3A 2PZIA 5CEIA 3VS6A 5AA8A 2ITPA 2YWPA 3DDQA 4TL0A 4D4RA 5FGKA 1R39A 4AF3A 2PUIA 5L4QA 4G3FA 2UUEA 4BDKA 5LVOA 3QTXA 1XKKA 4W4XA 3V8SA 5C26A 2Q0NA 2C3IB 2XK9A 3KU2A 2UVXA 3LXLA 1KWPA 3H4JA 3MDYA 4YJNA 3TNWA 5AV4A 2XJ1A 4IWPA 2PSQA 4FSTA 4I4FA 1JLUE 5J87A 3I7BA 3QCXA 4FTQA 4FVQA 1OUYA 5IH4A 4RFMA 3QLGA 4FC0A 3GCUA 2OJJA 3IECA 3LW0A 4NFNA 3TKUA 4AW0A 3B8QA 3LFAA 5LOHA 4IM3A 2P4IA 2UVYA 2WMRA 2WFYA 2NRYA 3UO5A 2VTJA 2J4ZA 4QMSA 3R28A 3P86A 2VTNA 4DGMA 4BVUA 5GJDA 1F5QA 3IOKA 5FRIA 4ERKA 2VTSA 1PXLA 2IZTA 3R1QA 3KCFA 3UNKA 4RWIA 3N4UA 3SD0A 4ZMFA 3OOMA 3KEXA 4TTHB 3CC6A 3Q5IA 3HYHA 4J7BA 4YNOA 5TR6A 1S9JA 2FB8A 1H1RA 3AC3A 3Q2JA 3EQBA 2C47A 4FVRA 4CTBA 3DCVA 4PPCA 3UOJA 2JD5A 3JVSA 2WU6A 1BMKA 2XIXA 3E8EA 2O0UA 3NYOA 5AP4A 2BUJA 4FIGA 2VTPA 3RI1A 3QTZA 4I93A 1XHAA 4HOKA 3F2AA 2QURA 4UEUA 2ZDUA 3A99A 4ZXTA 3QZHA 4HJOA 4RJ6A 1PYEA 2YIQA 4USEA 3D2IA 3I5ZA 4NW5A 1ZOHA 2VUWA 4YJPA 1QMZA 1PXMA 2GHMA 3IW5A 4P5ZA 1DAWA 2XBJA 3QZFA 2GS2A 2ZM3A 2O5KA 3QRUA 1JQHA 4C35A 1H07A 5DT3A 5J8IA 4BDGA 2E9OA 3AC1A 3PJ2A 5G6VA 3WF8A 3KRRA 3QU0A 5K5XA 1Q41A 2W4OA 2W1IA 5IQCA 1V0BA 2I40A 3PFQA 2ZDTA 2QCSA 5ACKA 1E1VA 3MESA 1J91A 2UVZA 4QP1A 5CSHA 2WMWA 3CGFA 5FEQA 2XKEA 3GU6A 5EYCA 2WIPA 2RIOA 4L7FA 2G15A 2HWPA 2WMXA 3RALA 3B2WA 4HVGA 5KMKA 1P4FA 1PF8A 4FODA 1MQ4A 3PIXA 2B9HA 4A9RA 2UZWE 4J95A 4YLLA 2ETMA 4BIEA 3QRKA 2BZIB 3V5WA 1JSTA 4A4OA 2C6EA 2YERA 3R8UA 4W8DA 3S2PA 3FMMA 5DH3A 3VUGA 3A7FA 4CMTA 1UNHA 1YDRE 5T68A 4H3QA 3OWLA 4F7NA 3EZRA 4S30A 3N4TA 4XH6A 5BYZA 1OIQA 5GJFA 2EXEA 4KA3A 4U7ZA 4BKYA 4D0XA 4TPTA 4U5JA 3C5UA 5IEXA 1OL2A 1YQJA 3MJ2A 5JFWA 4MNEB 4CV8A 5F94A 3KMWA 3QL8A 4OTFA 3WARA 5IA4A 3SKCA 4UWCA 3F3ZA 5IEYA 2YAKA 4NL0A 2J5FA 2R3FA 3DBEA 2YCRA 5A46A 3A2CA 4C4GA 4IB5A 3WE4A 4BDAA 2GPHA 3G15A 3GOPA 3GGFA 3PE1A 5J5SA 3G51A 4O7ZA 3FLWA 2J2IB 2O64A 3GCVA 4O0UA 2QOHA 5H3QA 4EHVA 4UBAA 2PZPA 2RFEA 4E5WA 3EQRA 5DEWA 3QQHA 4B4LA 4BCJA 1S9IA 3FYKX 5BNJA 5J9ZA 3QF9A 3FLSA 3W8LA 4GJ2A 4CKJA 3F7WA 4O6LA 2VTTA 3KVWA 5H8BA 3VQHA 4D1SA 2WELA 4KKHA 4GKIA 3MH3A 2XJ0A 3OWKA 4RFZA 4I0SA 2C5OA 3GCQA 5LMKA 3TNHA 3MFSA 4X2KA 3EWHA 3QD0A 1IG1A 2JC6A 3OEFX 5FBOA 2J0IA 5CEMA 4DC2A 5CZHA 2G2HA 2H96A 3A7HA 4U45A 2BZHB 4CLJA 5KMLA 2YWVA 3UZPA 3ZO3A 3DKCA 5HBJA 2Z8CA 4GFOA 4ANSA 2IVUA 4DINA 3G0EA 2GFSA 4JRVA 5EW9A 3QBNA 1UA2A 3QXPA 4I20A 3SHEA 2VGOA 2Z7SA 4QMOA 3LCDA 4HYUA 3QZIA 4Z16A 4WA9A 2BIYA 5HESA 3FPMA 4FKIA 4FR4A 3AGLA 3E8NA 5GHVA 2F57A 4TYHB 1OMWA 2ITWA 4P2KA 5HO6A 2Y4IB 2C3KA 4FGBA 1OL1A 5FDXA 4O7VA 4X3FC 2VWUA 3VUMA 3KY2A 1RQQA 3R7OA 4IB3A 3TN8A 3ZBXA 3UQFA 4YNEA 2X4ZA 4BI2A 4PP7A 4KRCA 3CLYA 3CY2A 4YSMA 3VJOA 3K3IA 4G6LA 4AGCA 3PY1A 1GIHA 2BIKB 2C0TA 4IVBA 1XWSA 1H26A 3RCDA 5JEBA 1Y8GA 4BCHA 4GYIA 2OIDA 4E6CA 5DEYA 3MIYA 2B0QA 1DS5A 4L8MA 2PYWA 2XUUA 2F9GA 5GZAA 3HMPA 4RIYA 4R7HA 4BKZA 1LPUA 3OUKA 2VWWA 5HO8A 4DCEA 4PPBA 4Q2AA 3DJ6A 3FZOA 2A1AB 2YM8A 4E26A 2EB3A 4O0WA 2JBOA 4XG2A 2BRMA 4N0SA 3OOGA 3QWKA 1U59A 4OTRA 3ZHPC 5JFVA 2C4GA 2QOBA 3VUHA 3VS4A 3VS1A 3A61A 4EOQA 1V0OA 4DFBA 2WB8A 3BZ3A 2WO6A 3HMNA 3QZGA 3I79A 2XNNA 5CXHA 5AAFA 1H27A 5FWKK 4ZP5A 2O65A 2NP8A 2OJGA 3RTPA 2R3IA 2PVLA 3NYNA 1JSVA 3PSDA 1CTPE 1QCFA 1REJA 2CSNA 3L9NA 4FSNA 4A4LA 5B7VA 1PMNA 1SVHA 4NCTA 2OFUA 4YZBA 3SX9A 1IR3A 2WMUA 5CXZA 3R7EA 2YIRA 2BTRA 5BUEA 3KGAA 4GRBA 4ORKA 3OHTA 1GZKA 4KNBA 4OUCA 4YUQA 2QD9A 4L43A 3GEQA 1W82A 4C2VA 5HE2A 4LMUA 4QMTA 4FKJA 5HVJA 1CKIA 3T3UA 4BWPA 2W0JA 1YI4A 3ZU7A 5HOAA 4QQJA 5ACBC 5CU0A 4CFFA 1XBBA 3ULZA 4TY1A 3DXNA 2WEVA 4CMOA 3NWWA 3OCTA 4O2PA 1LEZA 4F70A 4AXAA 4EZ3A 3EQFA 5EYKA 2H9VA 3RCJA 5JN2A 3LOKA 2QU6A 4GT3A 1GZOA 4HPTE 3KQ7A 3BLRA 2A2AA 2ETKA 5LCJA 4QQCA 4E5AX 2FSOX 2W5BA 3HV7A 3D7TA 5E8XA 3NLBA 2JKQA 4D58A 3PA3A 2FVDA 2XNBA 3TTJA 3IW7A 3OTVA 4JDIA 3EYGA 2C6KA 2WD1A 3H30A 4IAAA 2ESMA 3U9CA 5AR5A 4TYHA 3NSZA 3P9JA 4U41A 3ORKA 3Q6WA 3RPRA 2JIIA 5L8LA 2EVAA 1AQ1A 2WAJA 3FZPA 3QUEA 4NM5A 3W2CA 2J0KA 2B55A 3BYMA 3UDBA 3VWAA 3ORNA 2VU3A 2XCHA 2Y8OA 3KRXA 4PV0A 4F9WA 2ITTA 5LMAA 4YSJA 4C37A 4R3CA 3R9RA 1WVWA 5CAUA 4HZRA 3WF6A 4ZIMA 4G5JA 5L8JA 5HQ0A 1SMHA 3W32A 2CGVA 3OS3A 4QP6A 5IUHA 3Q9WA 5CEQA 2W7XA 4GFGA 3R8PA 3FV8A 5E8ZA 3WZUA 3SG8A 2QOOA 3O8UA 4I5MA 1H00A 4G9RA 5ANOA 3WZJA 2VTMA 3EN4A 3MVLA 3PJ1A 3ZO1A 2VTAA 5EFQA 5C03A 1WBPA 1OL6A 1JKKA 4O96A 5FXQA 4I0TA 4YJVA 5F20A 4QMMA 4D5HA 4BBFA 2P55A 5CF8A 4NYEA 4WG3A 5A4TA 4G31A 4HYSA 1PXPA 2OIBA 4MVFA 4DTBA 3TZMA 3OCBA 3DFAA 4D4SA 4V0GB 3OY1A 3MY0A 4Y83A 4BBEA 4HCTA 2ZB1A 3GP0A 3NVMB 5CAOA 4O7LA 4AG8A 4Y5QA 3LXPA 3CQWA 2YLEA 1U54B 5I9UA 4EBVA 4HGTA 3VS7A 3P0MA 3KN6A 4ZSJA 1VZOA 3R8MA 3U4UA 5CSVA 4XG7A 5K3YA 4JG7A 4BCPA 3ZM9A 3IONA 2IZSA 1PXOA 2C69A 4O91A 5EYMA 3ZO2A 3V51A 5HX8A 2R0UA 4BDBA 2X8IA 2JKMA 4U6RA 5F95A 3IKAA 4LUEA 4LL5A 5TO8A 3DXQA 4TYEA 3W18A 4KBKA 4QYGA 1PY5A 2P3GX 3ODZX 5M09A 3GFEA 4IW0A 3PP1A 4V04A 4DA5A 4GJ3A 5CVGA 1XH4A 5IQFA 4BRXA 4FF8A 5CZIA 3IPHA 3TKHA 5CF6A 5C8NA 1A9UA 2IZUA 4X3JA 1OL5A 2HY81 3LFQA 4CFUA 5F9EA 1OM1A 2OO8X 4RGJA 4W4VA 3N4VA 2QR7A 4J97A 2IVSA 2R3HA 2UW5A 3O50A 4EI4A 1Z5MA 5CANA 5CF5A 4OTHA 5IQDA 3U55A 5TKDA 3OC1A 1JAMA 3TM0A 2BHEA 4BTKA 4EK6A 2WTKB 3RM6A 2HW6A 5I3RA 3NEWA 4CLIA 2JDSA 5EG3A 3MWUA 3SXSA 3FKNA 2ZV7A 3SRVA 4ACDA 4DLIA 2OJ9A 5T6KA 1W0XC 2WOTA 4IJ9A 3DB6A 5EYDA 5BX0A 4NCTC 4DT9A 1K3AA 5CI6A 1ERKA 1W83A 2SRCA 3LCOA 4FTIA 2PVNA 5JRSA 3R04A 1HOWA 4W4YA 3W2QA 2HXQA 4MXYA 4BWKA 5DE2A 3TL8A 3PVBA 3KMMA 4PDYA 2YJRA 4YZCA 1ZZLA 3M2WA 3UMXA 3LHJA 4L7SA 3DAEA 4ENYA 4MXXA 3AT4A 3MIAA 3SV0A 5HU3A 3GENA 3EFKA 3RZBA 3F5UA 3O2MA 4TKSA 4RWLA 4I5CA 2WMSA 3RHKA 3HUCA 3MVMA 4O81A 2CN5A 4BCIA 3KL8A 5CLPA 3O71A 4JX3A 1K9AA 2BFYA 4O2ZA 1GY3A 3K5VA 4FSYA 2VO3A 5EW8A 3V8TA 4NSTA 3ZLSA 5LVPA 4EH4A 2J7TA 3G9NA 4X21A 3FC1X 4DLJA 4FBXA 1ZMWA 4AW2A 1GZNA 3Q4TA 2PULA 3U54A 3DK3A 3H3CA 3E8DA 2X4FA 1XBCA 3NR9A 1PYXA 4D2PA 2I0HA 4ZK5A 1UWHA 4JXFA 3IS5A 3L8PA 3S1HA 4RX7A 5M08A 1UU8A 4DEDA 2VNWA 5M56A 3H0YA 3WIKA 2Y6OA 2J9MA 4ZTQA 3TZ9A 3BX5A 4BCNA 3RPYA 3QYZA 2WHBA 4KS7A 4CYIA 4ZOGA 4QTCA 2GS6A 4FZAB 4BCKA 4PNKA 2IJMA 1QPCA 2GMXA 2I6LA 2RF9A 2B53A 2QLUA 3DLSA 5I9ZA 3NAXA 4C4FA 2CNUA 2ITVA 2PWLA 3QRTA 4BCOA 2OWBA 4LGHA 3HV3A 5D41A 4LM5A 4HYIA 4RJ8A 3FWQA 1I09A 4UN0C 1YDTE 2X7OA 2G2FA 2B52A 4APPA 1T46A 2GHGA 3BI6A 4DEHA 4IADA 3PZHA 4FTOA 4G2FA 3UC3A 1OBDA 3FXWA 3G90X 2VTQA 3MPMA 3E63A 4O86A 4JBVA 5DR6A 2BAJA 3DZQA 4RVKA 4O7SA 4Z7GA 4F9AA 1PHKA 3FMDA 4KIOA 1KUTA 4U3ZA 3HRBA 4EH2A 4U81A 3WZDA 5I3OA 5FM2A 2P2HA 1AGWA 2JFLA 2Q0BA 4QMXA 4F6WA 1NXKA 2YLFA 3EQGA 5HCXA 3Q52A 4TZRA 3SW7A 4IJPA 3TDWA 3II5A 2R2PA 4OLIA 1KOAA 2A27A 4BFMA 4CYJA 2VO7A 2YEXA 5JZNA 4IHPA 3BGZA 5I9WA 4FEVA 4QMUA 4B9DA 4WNMA 2PHKA 4ALWA 4TYGA 4PNIA 3FPQA 1YOJA 3R7IA 5FUTA 3CP9A 3KF7A 3R71A 5CQWA 4OBOA 3GU7A 2VN9A 4GK2A 4RPVA 3FEGA 4CG9A 5E1EA 2Y9QA 1G8AA 2CMWA 3MVHA 4ITJA 5KX8A 2ZV9A 3TIZA 4QP3A 4OAUC 3FHRA 4FOBA 4JX7A 2IG7A 3COIA 5AX9A 3IQ7A 2CKPA 2UW8A 2QOLA 5HBEA 5DVRA 4MQ2A 4ANOA 1FMKA 3HA8A 4I41A 3S3IA 2QO7A 1Q61A 1UNGA 5KE0A 2XNGA 3NIZA 3F88A 4C2WA 4AFJA 3ALNA 1QPEA 3FHIA 4EYMA 4F0IA 2QHMA 2UW7A 2PVJA 3F9NA 4EONA 2G2IA 1BLXA 3P79A 4EH8A 4GV1A 3C4ZA 3OT8A 4EOSA 1K2PA 3Q9YA 1Q8YA 2O63A 3PVUA 4FKSA 4FZ6A 4RC4A 4RVLA 2GQGA 2WQBA 3HP5A 3PIZA 2BRGA 4E8AA 3S4QA 5F1ZA 1IASA 1YXUA 4E6AA 4HNIA 3RZFA 3OFMA 3U6JA 4O22A 2PE0A 5IQEA 3FAAA 1DI8A 3TNQB 4Y72A 4RC3A 4F0GA 1PMUA 3FKOA 3QQKA 5EHOA 2Y0AA 4JIKA 4YJTA 1H8FA 2EB2A 3QUDA 4QTDA 1DI9A 4CMUA 5ANDA 3BLQA 3OCSA 3T3VA 2E9NA 3ZRKA 3DS6A 4J98A 4XEYA 3D2KA 3OF0A 4M7IA 2WMVA 4FT5A 4W8EA 5A9UA 3PZEA 5AX3A 3G6HA 4R5SA 3V5TA 4BWXA 4EZ7A 4LGDA 1H0VA 4ZS0A 2YHVA 3JPVA 1URCA 3BHYA 1TKIA 4KBCA 5AWMA 4AGDA 4FUXA 5IMEA 1MRYA 4IAZA 3N51A 4FV6A 2R7IA 4G17A 4IANA 5CEPA 1I44A 2W96B 4IWOA 4PRJA 4IZ7A 3FMEA 3HMMA 3HRCA 5K0KA 1F3MC 1KE9A 2H8HA 2VWVA 3GCPA 4GL9A 4ANNA 4PMMA 4EHGA 3E3BX 3DNDA 3FMKA 5HO7A 2HENA 3HV4A 3L9PA 4U3YA 2C68A 1UWJA 3PJ8A 3UTOA 4O0VA 3VNTA 1RJBA 4IX3A 1H0WA 3R9NA 2CPKE 4P7EA 4D5KA 3RINA 5M44A 4YJSA 2QOQA 2QU5A 3FQEA 3PSCA 5HLNA 3HL7A 3PRFA 4OGRA 5IMXA 3UE4A 4DYMA 4EWQA 3DQXA 2W4KA 1F0QA 4FVPA 4FYNA 3UIXA 2QONA 3P78A 3ZYAA 4ANBA 3Q3BA 3ZXZA 4RA4A 4L3PA 3PG1A 2FSTX 3GT8A 2BRHA 3PIYA 2CNVA 4UZDA 4XG4A 5LCKA 3FUPA 4MKCA 1M52A 1FPUA 3ZUVA 5GNKA 2X2MA 2XK7A 3CE3A 1XH5A 2F7EE 3D14A 2WXVA 4ARKA 4ZZNA 4OW8A 4F9CA 2W9ZB 3I0OA 5A14A 3QA0A 4A06A 4K77A 2W1EA 2YACA 5GINE 1NY3A 2JITA 3CGOA 3VHKA 3PG3A 4BCGA 3JYAA 4BI1A 4QTAA 3D7ZA 2XIRA 4FYOA 4AZEA 3EOCA 3UO6A 4GVJA 5KKRB 1FBNA 4AX8A 4DBXA 4AP7A 1IRKA 4NIFA 5GIPE 2H6DA 2XMYA 4C62A 4FKLA 4CRSA 1FVVA 3BYSA 2W4JA 3ZEWA 5ANJA 2VD5A 2BROA 4JBPA 1LP4A 5CNOA 3RBWA 4EOLA 1KE6A 2XF0A 5A4EA 4XBRA 2YCSA 3NRMA 3C7QA 3V8WA 2UZVA 2C1AA 3SGCA 5BVDA 3P7AA 3CD8A 5DRDA 4WNKA 4YLJA 5AUZA 5HG8A 4PDOA 1H1QA 4E20A 1ZZ2A 4JBOA 4F08A 2QHNA 4FIJA 4PY1A 2X7GA 5IF1A 4JR7A 3ZC5A 4X2NA 5TF9A 4LQMA 4DG3E 5IQGA 4YGAA 2X8EA 2JFMA 5CS6A 2XM9A 4M66A 5TE0A 4A7CA 5IA3A 2E9UA 3DOGA 4QNAA 1H08A 3DA6A 2PVYA 4BDHA 3VAPA 3CPCA 3DKOA 4BTJA 4EK3A 3BQCA 4FE2A 3VBVA 2XCKA 4L3JA 5EHLA 3PRIA 4FIHA 3EZVA 3MJ1A 1CKPA 2XK4A 4KKGA 4QP8A 3LQ8A 5CQUA 3KF4A 3RWPA 3EYHA 3GXLA 3NZ0A 3S0OA 3ZLYA 2H34A 4GCJA 4GG5A 3RAWA 4H05A 3SOAA 3IW6A 3QUPA 5M57A 5EI6A 5CU3A 4K11A 3BYUA 3MN3A 1MQBA 4GMYA 4FT9A 5AM7A 4OTGA 2YIYA 4C7TA 3PY0A 3FI3A 4QTEA 3R1YA 1W8CA 3DJ7A 4JG6A 3W8QA 5IA2A 4EQMA 4KD1A 4D55A 4E4XA 1X8BA 4R8QA 1P14A 2I1MA 4IVDA 3KB7A 4UXQA 5E91A 3TUBA 2I0VA 2HCKA 4YO4A 3WYYA 3ZLWA 3RAHA 3UNJA 4X6RA 2C5YA 4HGSA 3KMUA 4EH7A 5EM5A 3OP5A 3GU8A 4FV9A 4OR5A 2OJIA 1O6LA 2RFSA 4XNEA 3ROYA 4IDTA 4DEAA 1GJOA 4QMPA 1U5QA 2DS1A 4NZWB 5EKNA 3M1SA 4XOYA 3SA0A 1JWHA 2WTDA 3OTUA 3DJ5A 3KXMA 4HGLA 4XP0A 1PXKA 2W1DA 4DN5A 5CSXA 4EQUA 4FEWA 4GT5A 4FEXA 4FV2A 4DGOA 5K4IA 3E8CA 4KABA 4CKIA 1O6KA 3S00A 4O83A 3ZBFA 4FV7A 2JIUA 3ORXA 3EFLA 4O7YA 3VBXA 2GTNA 5AUVA 5CWZA 1PMEA 5HTBA 5HEZA 3NCZA 1GZ8A 3TJCA 4O7RA 3GUBA 3Q6UA 5ANGA 5K9IA 5K0XA 3FXXA 1NA7A 3BBTB 3FSFA 3NUUA 4IIRA 1PXNA 2R3NA 2R3KA 2WQMA 4UWBA 1ZY5A 1R78A 5EKOA 3DXPA 2VO6A 4MWHA 4BF2A 3MY1A 2PL0A 5E8VA 5LVLA 1SNUA 4IWDA 3EIDA 4R7IA 1M17A 3D5XA 2C6LA 5DGZA 4EORA 4QMZA 4BCQA 1JPAA 3Q9XA 4X7QA 5CY3A 4FTJA 2YIXA 4QPAA 4QP9A 3DPKA 2XKCA 3VUTA 2AYPA 2RSVA 2PMLX 4PTGA 3MY5A 1UV5A 4P90A 4EKLA 3TZ8A 2UZNA 2ZJWA 2HAKA 4FOCA 4QP2A 3E62A 2BFXA 4CZTA 3IK3A 3BU5A 5HGIA 3MV5A 4EYJA 5IH6A 5L2IA 3D94A 3QD3A 1BX6A 5BQ0A 4RIYB 1PXIA 5AUWA 5IQHA 5A6OA 2EUFB 1BL7A 3OWJA 4XLIA 5CNNA 3LFBA 2NNWB 4QMYA 2YJSA 5AUUA 2R3MA 5I9XA 2C6IA 5D10A 2J6MA 4MWIA 3AT3A 4M67A 4FTCA 1APME 1JNKA 4I94A 2GNJA 3LIJA 2GFCA 4YPSA 4DFYA 3HKOA 4EOKA 4DF3A 4TRLA 1R1WA 4D2TA 2BKKA 2F7XE 5I5ZA 1Q5KA 3CBLA 4IE9A 3NW5A 2OKRA 2XYUA 4BHNA 3G5DA 3VS0A 4CFMA 3V01A 3QCQA 4OT5A 4DH5A 4OTPA 2RKUA 5D1JA 4DITA 4DCAA 3IGOA 3QLFA 2VO0A 5H2UA 4G3DA 2UW4A 3MH2A 4CRLA 1XH9A 1M2RA 1SVEA 4BTFA 4UALA 4LGGA 4S31A 3WZKA 5TOZA 3D5WA 2C5NA 3MSSA 3NS9A 1TQIA 4HCVA 1U5RA 4I21A 4YO6A 4XP3A 2LGCA 4M69A 3REPA 3ZONA 4MK0A 3OROA 2C3LA 3G2FA 2WGJA 4ZY4A 2UW0A 2Z7QA 4GU6A 3TJDA 4M15A 4NM3A 4CXAA 4YURA 4D9UA 4U42A 1FVRA 2OXDA 2PMOX 5E7RA 3O7LB 5JGDA 4YJRA 4AN9A 2W1ZA 1Q8UA 3DLZA 1PJKA 2GNHA 3D0EA 3IW8A 4L6QA 4PMSA 1KV2A 5EI8A 5JFSA 5C01A 5A4LA 2PZYA 4FNXA 3NPCA 5DHJA 1MRVA 2JIVA 2DWBA 4F6SA 4BDDA 3D7TB 1ZWSA 4LMNA 3FL4A 4QRCA 5AFVA 5FTGA 4E6QA 1H28A 2V7OA 2QQ7A 4PMPA 3I6WA 2GS7A 4TXCA 5JKGA 3GC8A 2VTHA 5EQEA 4FTNA 3UYTA 2OW3A 5DRBA 3SAYA 2ONLC 4CVAA 2IVVA 3TUCA 4DE4A 1PRYA 1WBVA 3DBQA 4C3PA 4MXOA 4XJ0A 4A9TA 4DTKA 4U9AA 4UMRA 4TWOA 5LJJA 1FINA 4O6EA 1TVOA 4N4SA 3LM0A 3U8WA 3A62A 3LCTA 3NDMA 4YC6A 3ZUTA 3QALE 5M55A 3RKBA 2R3LA 3VVHA 4MH7A 4YTHA 3O8PA 2JDRA 4NKAA 3UOKA 4PTCA 2QLQA 2FYSA 4U43A 5FXRA 2PVKA 4NK9A 2PMNX 4FG9A 4G6NA 5GIOE 3AC5A 3LXKA 4LYNA 4MX9A 5G1XA 3FY0A 1KSWA 4G1WA 4RA5A 4O7NA 3TV6A 2PVFA 2V7AA 2HELA 5IG1A 2W1HA 5LARA 2RG5A 2WTVA 4TYIA 4KIPA 4HVDA 3BKBA 4NJDA 3ORPA 3R2BA 3VBTA 2C30A 2FUMA 3OXZA 4R3RA 3RNIA 1KE5A 4IZ5A 3ZFMA 4KWPA 4FTAA 5AEPA 1BL6A 1IEPA 3AC2A 4H58A 5E1SA 5E9EA 3JY0A 2X1NA 1SNXA 2JAVA 3GI3A 4TWCA 4LUDA 4O7TA 1DM2A 1HCKA 5E8UA 3FBVA 1B38A 5BUIA 5CAVA 3B2TA 4FTRA 5EDRA 5EW3A 3VULA 4D2WA 3CQEA 4YR8A 5HD4A 4FTUA 4X3FA 3VC4A 4F9BA 4BY9E 4AU8A 4DFZE 3CEKA 2UV2A 4RC2A 5CSWA 2Y4IC 4AZFA 3K3JA 3GBZA 2X2LA 3PWYA 4FL1A 5HCYA 4C4HA 5AP1A 3LFDA 3RPOA 4YC3A 5I9YA 1XJDA 3V3VA 5AA9A 1G8SA 4ZY5A 4ASDA 4QNYA 3HNGA 3LFEA 4J8NA 1QPJA 2J51A 1B6CB 4RG0A 3F5PA 2YDIA 1WVYA 5A6NA 3C4FA 1UKIA 1YXTA 2VV9A 4MD9E 1YOMA 4DGGA 1J7IA 4E4NA 4BDEA 2X8DA 2BPMA 2XA4A 4MF1A 3F69A 3MTLA 4FKOA 4GK4A 4RJ3A 5DLSA 1UU3A 5E8SA 2F2CB 5AP6A 4IFGA 4BN1A 5AMNA 5FM3A 5B2KA 4FKWA 4L01A 3VUIA 3SRVB 4FA2A 4JQEA 3PWDA 4K18A 5C4LA 1B39A 3PXFA 1Q3DA 2CKOA 3S95A 1WZYA 4XRJA 2UZUE 4K0YA 4J53A 4II5A 4UXLA 5D7VA 4FZFB 5GZ9A 4ZTHA 3ZM4A 1BYGA 5KHXA 4RIOA 4QO9A 3VS3A 4BICA 3KFAA 4YJQA 1M2QA 4YPDA 4USDA 4FTKA 2C6MA 2O2UA 4YZMA 3HP2A 1LR4A 4FKQA 2IW8A 3A4OX 5AP2A 4AFEA 5LWNA 4PL4A 3KRJA 3NYVA 2XKFA 2GQSA 3QC4A 4IH8A 4A9SA 5AV1A 5JH6A 4JNWA 2XIKA 3TIYA 3R30A 2GCDA 1TQMA 4HZSA 3HAMA 4F7JA 2EU9A 1G3NA 3L8VA 1UVRA 4F1MA 4O0RA 3HRFA 4F64A 3F66A 4LOQA 3EMGA 4YTCA 2PU8A 3U9NA 4BZDA 3BIZA 3WYXA 2VWXA 4LG4A 4ANQA 1J7UA 4UMQA 4FV3A 3QKLA 2X81A 4BGGA 4LOOA 4N6ZA 3W2OA 3U87A 4JI9A 3PPZA 4RSSA 1XH6A 3GQIA 4GFMA 3FI2A 4CFWA 3OXIA 3V5PA 1JVPP 4CZUA 3R73A 5J79A 4EK4A 2OZAB 4JJRA 4QPSA 4AT5A 3GU4A 2BAQA 1H1PA 1JSUA 1CKJA 2GNGA 2BTSA 1OL7A 4I4EA 2W9FB 3TZ7A 2XIYA 1NVSA 3HMIA 5HNGA 2ZB0A 4YZDA 1YVJA 3O0GA 3IDBA 2B7AA 3EKKA 4DH7A 4QMVA 1G5SA 2OFVA 4FKPA 3OG7A 3LAUA 3AGMA 1PXJA 3ITZA 4LI5A 5C4KA 2PTKA 3I5NA 2F49A 5CENA 3QTUA 3UPZA 3ZUUA 3UQGA 1BUHA 1J1CA 5BVEA 2CGWA 4QT1A 3UNZA 3QTSA 4PX6A 3QD4A 5J7BA 1FQ1B 3FKLA 4R7BA 5K5NA 5LWMA 5DYJA 4IM0A 4GK3A 1WCCA 5IISA 2BAKA 4LRMA 4NWMA 2A4LA 5ICPA 4BDJA 2QODA 3BLHA 4D2SA 2BZJA 2VX0A 3SOCA 4AA0A 5BYYA 4AA4A 4QTBA 5BPYA 4DBNA 3N9XA 1Q99A 2ERZE 3PTGA 4GKHA 1YHWA 3R9HA 3MFRA 4JR3A 3LFCA 1ZYLA 3G33A 4MBIA 1J7LA 2QOIA 3UQCA 5B0XA 2HZ4A 3JVRA 4RWKA 2HOGA 2C0OA 3FZTA 4CFNA 3LKMA 3ANRA 3QHRA 5J1WA 4YC8A 3OWPA 1STCE 1OKWA 3L8XA 5CT0A 5L6PA 3QRJA 4GUEA 3BEAA 2DYLA 4DEEA 2FSMX 3AMBA 1H24A 4AOTA 4RLLA 1WBNA 3MA3A 4DEGA 3KRLA 2WOUA 3NUXA 1P2AA 4ACCA 3R1SA 4NTTA 4UV0A 5AAGA 2HZ0A 5HTCA 2X2KA 3O51A 3RVGA 2YM3A 4GS6A 5BVFA 1IA9A 4FG7A 1Q8WA 4FSQA 4JVGA 2W5AA 3BPRA 2DQ7X 4C36A 5KBQA 3R2YA 3Q5ZA 3MPAA 4E4LA 1IAHA 5AIRA 2HZNA 3FLZA 3QQJA 4JL9A 4U0IA 3VS5A 4IZYA 3W1FA 2R3QA 3F5XA 1W98A 2B9JA 5HKMA 1DAYA 3VS2A 5EQPA 1VR2A 4IX5A 4NT4A 5DFPA 3R22A 3ORIA 4JQ8A 2PK9A 3UGCA 2WQNA 3V04A 4DH1A 4P4CA 3QX4A 4BDCA 1REKA 3ULIA 3F6XA 4MXAA 2VX3A 2OZAA 4FSUA 5EM6A 3BE2A 1VYWA 4DG2E 4ENXA 4XP2A 4EH9A 4XV1A 1OI9A 1XH8A 3K5UA 3LJ0A 4KUJA 5B2MA 5AP5A 4WRSA 4LRKA 4X0MA 4RJ4A 3R0TA 4ITHA 3OT3A 2GU8A 3VW8A 3OVVA 3IW4A 3W55A 3AQVA 1ZMUA 4ZSGA 3BGPA 2VRXA 3C13A 4JDHA 3SW4A 2XKDA 2ITNA 2X6EA 4RVMA 4DFLA 4F1TA 3SXRA 4XYFA 3WIGA 4IM2A 5EOLA 1OIYA 4XOZA 5HU9A 4G16A 3DB8A 3EQHA 3ERKA 1SYKA 5HE0A 4G9CA 2OSCA 3EQDA 1OECA 3IGGA 3QQGA 4OAVB 2XK3A 2YA9A 3NNWA 4D1XA 2WIHA 3CSVA 3BV3A 3COMA 3F5GA 1Q4LA 3CCNA 3E92A 2C1BA 2BVAA 3H9FA 2PY3A 2JKKA 3RAKA 4H36A 4YJOA 4QQTA 5CT7A 4C0TA 4EBWA 3F61A 3OMVA 4FZ7A 4QYFA 4WT6A 3VBYA 5HTIA 2UZDA 2GNFA 5EH0A 5JMSA 2WQOA 4FI1A 2YCFA 4C57A 4BDFA 4Y95A 3C0IA 5I4NA 3MPTA 4CEGA 5CSPA 5LQFA 3EL7A 1O9UA 2QO2A 4O27B 3ALOA 3ANQA 3CJFA 2UW3A 2YZLA 3PUPA 4TWPA 5FG8A 2ZV8A 1URWA 4DH3A 4ACGA 1P4OA 4MEDA 2Z60A 3RK5A 2R3JA 4QP4A 4RX5A 4Z55A 4IZAA 2W1CA 3ELJA 3K2LA 4BCFA 3THBA 5J5TA 4O1PA 4K33A 4QP7A 4WSQA 5AIKA 1YWRA 3Q32A 2X7FA 4IVAA 5FTOA 4YTFA 3ZMMA 4AUAA 4WD5A 2E9VA 2A19B 3KXHA 3BELA 2QOFA 3NVKI 4L44A 4WNPA 3R9OA 2W17A 5A4QA 5FP5A 3HV6A 1MP8A 2IWIA 3HEGA 3JS2A 4V05A 4EHEA 4Y5HA 3T8OA 3EFJA 3UP2A 5BMSA 5D11A 3U4WA 3WF5A 3LPBA 3QCYA 4I6HA 4U40A 5JZJA 4C02A 4NTSA 3ET7A 4NIFB 4M84A 2BDFA 2OG8A 2QO9A 2YN8A 3PXRA 4EK5A 3KXGA 3HZTA 4JG8A 4MAOA 4MHAA 5J9YA 1YI3A 3NIEA 5AR2A 2JDOA 3HV5A 4CNHA 4MCVA 3UJGA 1LEWA 2OXXA 3CTQA 3ORZA 4PP9A 3FI8A 3MW1A 3HUBA 4B8MA 4FICA 3H10A 1MRUA 1CM8A 4J1RA 4PQNA 3NGAA 2J0MB 4DGNA 4ID7A 3LCSA 4FTMA 3U6IA 3I60A 4AN3A 2QG7A 2PVHA 4IXPA 3LXNA 3OD6X 4E4MA 2YCQA 3RAIA 3PXKA 3OZ6A 2ZM1A 4UYAA 3H9RA 4AT3A 5AADA 4ZSEA 1IA8A 5JK3A 3ZOSA 4GH2A 1ZRZA 3NNUA 2FA2A 3KCKA 4KKEA 4QYYA 5E90A 4A9YA 2YABA 1YDSE 3MB7A 3PA4A 3HLLA 1RDQE 1ZOEA 4V01A 4F63A 3MFUA 3O8TA 4FUYA 2QC6A 5DG5A 2PPQA 2WMQA 3UMWA 4IAFA 4QD6A 3RK9A 4RJ5A 3FYJX 3QTWA 3WI6A 3R7GA 3MI9A 4ZLOA 3A7JA 3TXOA 5C27A 4B8LA 2BR1A 3FI4A 1OKYA 2I0EA 2W06A 3LM5A 4G3CA 4YMJA 4JBQA 3ACKA 4HW7A 4DFNA 1OZ1A 2YM4A 4I0RA 3CKXA 2O8YA 4FL3A 4C34A 3PE2A 2OIQA 4GUBA 3UOHA 3KXZA 4F09A 1NW1A 1FGKA 4L3LA 3H9OA 3HECA 3WOWA 1U46A 3C9WA 3DTCA 2IPXA 4W4WA 4ZSLA 1OBGA 4KINA 5EOBA 3EFWA 4AACA 2VTLA 4ZZMA 1XH7A 4UX9A 3HDMA 4QOXA 3QA8A 2R9SA 4Z7HA 1BKXA 5HICA 3NUAA 1YI6A 2BDJA 4DT8A 3Q96A 3PPKA 5CU4A 4WRGA 3TG1A 3AXWA 2C5VA 3P5KA 1WBWA 2G1TA 2HYYA 4S2ZA 5FEEA 4ANLA 5LXMA 3W2RA 5GJGA 5HE3A 5HLWA 2XB7A 2W05A 3BWJA 2Y7JA 4A4XA 2FO0A 3DU8A 2YM7A 5JSMA 1A48A 3EN5A 4EOIA 4NM7A 4E1ZA 4N70A 5CALA 3KXXA 3RHXA 2XEZA 2OLCA 4B6LA 3WBLA 4GW8A 2AC5A 1OPJA 1V1KA 3MBLA 5HNBA 5EM7A 1O6YA 3QTRA 5C8KA 4WBBB 4PMTA 2E9PA 1KE8A 4IAIA 5DIAA 3R83A 1KOBA 3ZCLA 1Q8ZA 1H1WA 3R9DA 5AAEA 4IAKA 3ID6C 4UWYA 3VW6A 5IA0A 1WFCA 3CKWA 1J1BA 4FT0A 4ZLZA 2CDZA 5HLPA 3RPVA 1Q97A 4J8MA 3QKKA 4A9UA 2WQEA 3IDCA 3NUSA 5AR7A 3P08A 3JXWA 4BYIA 3GQLA 2XRUA 1JOWB 4WHZA 4FSWA 3R8LA 1ZLTA 3AD4A 5E8YA 1ZYDA 4ZJIA 5J95A 2X9FA 2JBPA 5T3QA 4ZLYA 3CS9A 3TACA 5KBRA 4BZOA 1PKDA 3EB0A 4IQ6A 4O38A 4O21A 1ND4A 3EQCA 3DGKA 4AZSA 4D0WA 2VTIA 4YZNA 1MUOA 3VRYA 2CCIA 3NNVA 5DA3A 1WBTA 3KVXA 4H1JA 5HBHA 2OGVA 4A07A 3CTJA 2YISA 3FY2A 3R8ZA 5D12A 4IVCA 3GC7A 2BMCA 3QXOA 2B9FA 4TNDA 4AN2A 2X0GA 2DUVA 5IA5A 3NNXA 4R77A 5J1VA 5HIBA 4IDVA 4HNFA 2E2BA 1M2PA 2VWYA 1A06A 3V5JA 2CKEA 4M3QA 5KZ0A 4O0SA 5KKRC 2PE2A 3NUYA 4I23A 1Y8YA 3ODYX 2NRUA 1SM2A 4HYHA 4YTIA 3L1SA 1GAGA 1OPLA 2P33A 3ETAA 4XS2A 5ITAA 3EJ1A 4HVIA 3I1AA 1OB3A 4KBAA 3AT2A 3JR1A 4C8BA 3VBQA 5IH5A 3LMGA 2W1FA 3TT0A 4XV9A 4CKRA 4Q5HA 1H1SA 4M69B 2WMAA 4N57A 2ETRA 2JDVA 4NJ3A 2WTJA 4WNOA 5EM8A 2R3PA 1YRPA 4ZTSA 3RGFA 4FV8A 5CU6A 3ZSIA 3HVCA 4U80A 3IDPA 4G5PA 1H4LA 5EDQA 1YKRA 2UZOA 1OKVA 5AV2A 4IFCA 4U79A 4S33A 5EHYA 4X2FA 4EJNA 2OU7A 3FMLA 4RBLA 3V6SA 1ZYJA 3BQRA 2BRBA 3OBGA 2YZAA 4CTCA 5M4CA 3R1NA 4K6ZA 3DK7A 4I5HA 3QQFA 1H25A 4Q5EA 4LRJA 2WMTA 4NFMA 3TTIA 3LJ1A 1QL6A 4DEIA 3C51A 1L3RE 4U8ZA 3UYSA 5J7HA 1VYZA 1NT2A 1JBPE 4CCUA 3ATSA 3VUDA 5IQBA 5CYIA 3SXFA 4AZVA 4E5BA 4XUFA 1UU7A 1RE8A 4BDIA 4JAJA 4L52A 2CCHA 1H01A 2R64A 5FTQA 3KULA 3AC4A 3F2NA 4MXCA 5D7AA 1XQZA 3UODA 2XRWA 4O0TA 3ZSHA 4QPMA 2Z2WA 3T9IA 5B2LA 4D2RA 4FT7A 3NW7A 3NAYA 4O84A 2CJMA 4UYNA 3B8RA 3QQUA 4OT6A 2JAMA 2CLXA 2VNYA 4RX9A 4AS0A 3T9TA 4E93A 2XK6A 4GIIA 2CGUA 4FX3A 3DDPA 2HWOA 3TWJA 2JEDA 3D9VA 3I6UA 1Z9XA 4FTTA 2B4SB 4QMNA 3Q04A 2X9EA 4YJUA 2WEIA 4OTQA 5AR4A 3R02A 4ANMA 1JKTA 1M14A 5EK7A 4C4IA 2IW9A 2YIWA 3VHEA 5LMKC 4EOOA 3PXQA 4C59A 3FSKA 4DGLC 4FIIA 2OH4A 5BVKA 2JGZA 2RFNA 5HVKA 4E73A 4YHTA 2O3PA 4APCA 4RRVA 2XNEA 4IWQA 1ZY4A 2I0YA 4M8TA 3QGWA 3MH0A 3VBWA 2BZKB 4ZTRA 3LFFA 3SC1A 2EXMA 3DQWA 4XV2A 3UZRA 4ZAUA 5FD2A 3BCEA 2YAAA 5HIDA 5L8KA 1ZXEA 4QYHA 4ALVA 4Y85A 2BKZA 5L6OA 2VAGA 4QMWA 5E8WA 2J5EA 3ZRMA 4FSMA 4X3FB 1JKLA 4ZEGA 3I7CA 4Y46A 4EC8A 3KRWA 3WZEA 5ANEA 5KO1A 2WU7A 2X39A 3MS9A 3EH9A 3RPSA 2C3JA 2RGPA 4MD8E 3NUPA 4O82A 4ZMEA 4LFIA 5JQ8A 4NH1A 3Q4UA 1Q24A 2XH5A 5KMIA 2YM5A 2R3OA 4XCUA 4B0GA 3PY3A 3ZZEA 3QWJA 3LZBA 4PUZA 4D9TA 4R1YA 2IVTA 3ZS5A 2PUNA 3OW3A 2ZMDA 4IC7A 1UNLA 4Z9LA 4D28A 5M06A 3LLTA 2PMIA 2R3GA 4I92A 3FJQE 4FV4A 5F4NA 5GZ8A 2C5XA 3BHHA 3P23A 4WSYA 3W10A 4H39A 5BVOA 2ITXA 3DZOA 2BILB 2V22A 1J3HA 3FZSA 1ZYCA 5L6WL 4F7SA 2UZTA 4JS8A 2XIZA 2Z02A 2ZV2A 2WMBA 1JKSA 3AMAA 3PDTA 3NMUF 4N6YA 5CTPA 4PPAA 3ZRLA 4HGEA 2XNMA 3JY9A 5L2WA 4ZZOA 4LOPA 4BKJA 3ORTA 4RZVA 4AW5A 3BU6A 3R21A 3KREA 1GIIA 4BGQA 3PVGA 5HG7A 3CY3A 4F7LA 4UMUA 2HXLA 3FXZA 1QPDA 4IX4A 4TWNA 3VN9A 4AE6A 2WNTA 4NKSA 4ACHA 4BTMA 2CGXA 4AAAA 2JDTA 4X2GA 3OXTA
chains in the Genus database with same CATH superfamily
2BHHA 1YOLA 4PL5A 3G6GA 3PYYA 4DFXE 3ACJA 4YU2A 1OUKA 3BHVA 4KRDA 3VUKA 3W0OA 4HPUE 5DI1A 4C58A 4F1OA 4W9XA 5AR3A 4DHJA 3V6RA 1SZMA 3PFYA 3LFNA 2VWIA 4RMZA 4EL9A 2OF2A 2ZAZA 3LJ2A 2OBJA 2GDOA 4FKVA 4MYGA 4AE9A 3HMOA 3JUHA 2HW7A 1GIJA 5AP3A 1YWVA 3C0HA 2ERKA 1Y57A 1HCLA 4L68A 4F78A 4MXZA 2X6DA 3DKGA 4Q9ZA 3A8XA 4Y8DA 1Y6BA 3Q4CA 3ENHA 2P2IA 2W99B 3I4BA 4TYJA 3RMFA 3MGYA 3W2SA 3TDVA 5HI2A 1GOLA 3CJGA 4RIWB 2G9XA 4AW1A 3ZTXA 2R7BA 4ASEA 5CI7A 2JKOA 5KNJA 3AKLA 2JLDA 4IB0A 4AOJA 3G0FA 3BEGA 3ZDIA 2GNLA 4DH8A 2ONLA 5KZIA 1FGIA 2BCJA 4MNEA 3QFVA 2VWZA 2B1PA 2VWBA 4K9YA 5IUIA 5KMNA 5JGBA 2KTYA 4TW9A 4Q9SA 5DR2A 1OGUA 4GVAA 4C38A 2R0IA 4M0YA 2Z7RA 5HG9A 2QKRA 3OUNB 3UBDA 4EJ7A 1L8TA 4WG5A 5L3AA 4BBMA 3P5JC 3AD5A 2REIA 2UZEA 1CDKA 4IB1A 5FDPA 4YP8A 2F4JA 1NVRA 2VX1A 3OY3A 4K8AA 5DT4A 4ONAA 4JOAA 2IW6A 5AUYA 5HVYA 4QMQA 3TUDA 3NW6A 5A3XA 4OBQA 4R3PA 5CU2A 2PE1A 5CVHA 5ANIA 2QG5A 4M12A 4AZTA 4BIBA 1FOTA 4AXFA 3EN9A 3D15A 4PDPA 4F0FA 3W16A 2PZRA 3BU3A 1YHVA 4DG0E 3R00A 4RLKA 1E1XA 2OI4X 2RG6A 3UP7A 3F3UA 2CKQA 2XK8A 3PXZA 4I3ZA 3VF9A 2ITQA 3F3VA 5AUTA 4KSQA 1U4DA 5ANKA 2Y6MA 4NM0A 4FJVA 2EXCX 3DK6A 2LAVA 5FP6A 5IQIA 4DTAA 3C4WA 4J71A 1Y6AA 3C4EA 4RVTA 4BL1A 1WBSA 5CEOA 2ZYBA 3DAKA 4R78A 4UMPA 4KAOA 3QHWA 3TEIA 3KA0A 4C33A 3CQUA 4EOPA 4RX8A 2BDWA 2XNOA 4WO5A 1ZYSA 5E92A 4D1ZA 1FMOE 4IBMA 3DY7A 4EH6A 2R5TA 4JDKA 3ORLA 4CV9A 4XLVA 4U97A 3Q2MA 3RM7A 4QYEA 4FKGA 3NUNA 2XYNA 3SDJA 2ZM4A 3VQUA 4FKUA 5M53A 3BHUA 2XNPA 3UIBA 3LLAA 2UZBA 3MTFA 5CX9A 1W7HA 5C1QB 3MB6A 3FE3A 4KS8A 3W0MA 4FV0A 2ZFYA 4GEOA 4FEUA 2YDJA 5BYLA 4B7TA 4O0XA 3F3WA 4JLCA 4MTAA 2WTIA 3E5AA 3C50A 4OTDA 4DHIB 3MVJA 2PVRA 4L9IA 1EH4A 5EQYA 4H3BA 5KUPA 3RJCA 3FMNA 4BZNA 4RIWA 3RP9A 4L45A 3EL8A 1CSNA 1KV1A 2HY0A 3DBFA 2IEWA 4GSBA 5M4FA 3DBDA 3SVVA 4DEBA 2J90A 3O96A 4WOVA 3RWQA 3EHAA 3UVRA 3E93A 5C9CA 3OBJA 4MD7E 5L2SA 4BGHA 2J0JA 3PJ3A 4CFXA 4X2JA 3PXYA 3ZFYA 4S32A 4AGUA 4OTIA 2I7QA 5HCZA 4TT7A 3ROCA 3TKIA 3D83A 4RIXB 5EI2A 2RL5A 2OZOA 2V0DA 3QTIA 4FNYA 3FMJA 2QNJA 3LMHA 2OICA 3TNIA 4XG6A 4D4VA 5FEDA 2V62A 4RQVA 3EN6A 3UO4A 4E3CA 4IC8A 3CXWA 4CGAA 4EKKA 1Q3WA 2WTWA 3R7VA 4FNWA 4FV5A 4F6UA 4IMYA 3P4KA 3ZXTA 5FBNC 1YXVA 4CT1A 2HIWA 2QKWB 5DT0A 3QYWA 4RJ7A 5DN3A 1WVXA 2CHLA 3COHA 4NW6A 1R0EA 3C5IA 2UW6A 3GVUA 3FL5A 4M13A 3V5QA 4XG3A 2F2UA 4CT2A 4EK8A 4R5YA 1OIUA 4NU1A 2FGIA 4XRLA 3ZH8A 5C8MA 2J0LA 4WIHA 3LMIA 4C3FA 4F9YA 2IO6A 4FG8A 3UC4A 2IZRA 4G6OA 2XM8A 4G3EA 3LCKA 3ORMA 4BCMA 3O23A 4Z3VA 4L42A 4ZTNA 1YWNA 4CFVA 2QOCA 4C4JA 1WBOA 3R7YA 4KB8A 2Y4PA 5A4CA 3EQIA 5EDPA 4O1OA 2VTOA 3E87A 3HA6A 4YZ9A 3SG9A 3FZRA 2FSLX 3F7ZA 4IAYA 1Q62A 3DFCB 3GNIB 3PA5A 3FLNC 3NFGB 2BRNA 3UG1A 1KE7A 3OEZA 4QMLA 4GU9A 4NUSA 2G01A 5HE1A 3VIDA 5KMMA 3HDNA 2GHLA 4DAWA 3SLSA 4JIAA 3BYOA 2W1GA 3P7CA 1OIRA 1XR1A 3A4PA 3GB2A 3Q60A 5JGAA 1NVQA 4MBJA 3NYXA 2F7ZE 5AR8A 4FIFA 3I0QA 3DTWA 5IQAA 4I6BA 3BHTA 4QDEA 4EZ5A 4CQEA 2NPQA 3R8VA 4RQKA 5HG5A 2ACXA 4AT4A 1M7NA 4MUQA 2CN8A 3KN5A 3PLSA 3TV7A 3O7LD 4FZDB 3PPJA 3P1AA 3D5UA 3EKNA 2AUHA 5CF4A 3QTQA 5DNRA 4PL3A 5KMOA 4DHFA 4D2VA 2WTKC 3FQHA 4BIDA 3HGKA 4L67A 4ZY6A 5H8GA 5M07A 3R63A 3E7VA 3U6HA 2HK5A 4JDJA 1OPKA 3SQQA 3E88A 3ZDUA 3GU5A 3VO3A 4HCUA 4CG8A 3UZTA 3LFSA 4V0GA 5CAPA 4RIXA 4OBPA 4WUNA 4XG9A 1TQPA 2A0CX 4NEUA 5CVFA 4WUAA 5BVWA 4FL2A 3RNYA 4P5QA 4C61A 2XJ2A 4IACA 1U54A 1VLRA 3O17A 4XX9A 4ZTLA 1P5EA 4ZTMA 3FLQA 4IX6A 4AA5A 4BHZA 4FT3A 4I1ZA 4LV5A 4PWNA 4I22A 2GNIA 4MQ1A 4E6DA 5IA1A 1ZAOA 4TN6A 5E8TA 3ZO4A 2CLQA 2XZSA 3ATTA 3LVPA 4XV3A 2ITYA 3U51A 3WILA 4G34A 4BI0A 5KHWA 4WG4A 3BRBA 4EOJA 4TNBA 5L2QA 5I0BA 4YBJA 4WKQA 4AQCA 3ZC6A 3UG2A 3BWFA 2ZVAA 5DBXA 2AEGA 5IU2A 3KK8A 4AWIA 3CD3A 3G9LX 4EUTA 1OITA 1ST4A 1PKGA 3EQPA 4K2RA 2EWAA 1OVEA 3MA6A 3ZEPA 4BB4A 1RW8A 1YXSA 5JT2A 4FEQA 2OK1A 5LVNA 3AG9A 3ENMA 4FK6A 4AZWA 3PSBA 3OCGA 2P0CA 4UY9A 3LQ5A 4ZS4A 5JRQA 1LUFA 3DAJA 3FC2A 4O7WA 2BALA 4KIKB 1V0PA 5JFXA 5ETCA 2QR8A 4RFYA 1IAJA 2ZOQA 3DNEA 3BL7A 3UPXA 3V5LA 4PF4A 5IPJA 2OJFE 3W33A 4ALUA 3F3TA 4GIHA 2QVSE 3LQ3A 5A54A 5IKWA 3CPBA 2PZ5A 4U44A 5HZNA 3PJCA 2V5QA 2OF4A 4USFA 3M11A 2XVDA 1OKZA 3WF9A 4H1MA 2ITUA 4XBUA 4FMQA 5IZFA 2WKMA 2W5HA 3CTHA 4FV1A 4RZWA 2XEYA 5HIEA 1PW2A 2C6DA 1Q8TA 1FVTA 4K1BA 5AP7A 2B54A 2NYAA 3GCSA 3QGYA 1WAKA 5LMBA 4RWJA 4CQGA 2OXYA 5ETAA 5HHWA 4AAYA 3BBWA 3R7UA 3OW4A 3Q4ZA 4JAIA 2ITOA 4R1VA 3POZA 4JQ7A 5H9BA 4ZSAA 3L9MA 5H8EA 5BMMA 4JMQA 3R6XA 2UZLA 5DPVA 3E7OA 3AMYA 5FLFA 4C3RA 3Q9ZA 1SVGA 2XBAA 1ZMVA 5DWRA 1T45A 4BR3A 5IUGA 2AC3A 3UIMA 2ZMCA 3QCSA 4ZJVA 5BUJA 1M7QA 2Q83A 4M97A 3COKA 4EHZA 2XS0A 4AOIA 1Y91A 1ZARA 3BYVA 3LE6A 2B9IA 4D4YA 3C0GA 4FK3A 5D9HA 3A7IA 2V55A 5HX6A 5I9VA 5IEVA 2WPAA 4MBLA 5DR9A 4EC9A 2VGPA 4LV8A 4ASXA 5M51A 3P7BA 1VJYA 3PP0A 2VZ6A 4L00A 4MNFA 4YHFA 5HORA 3UIUA 5E4HA 3AD6A 4AQKA 2QI8A 5IDPA 5K4JA 4I5PA 3TV4A 3W2PA 4CD0A 4QQ5A 3KXNA 4G3GA 4E7WA 4R6VA 2FH9A 1GNGA 4ITIA 4J99A 2YITA 4XMOA 5AP0A 1XO2B 4UZHA 2YDKA 3A8WA 3UVQA 4FSZA 3E64A 4M68A 5CAQA 3K54A 4FSRA 3R01A 3NX8A 4WBOA 3IOPA 3D4QA 1PMVA 3FLYA 3QC9A 5TT7A 3VRZA 4BC6A 5HNIX 3VJNA 4ACMA 3L9LA 4FNZA 3POOA 3UVPA 5AJQA 3ZLXA 2WZJA 3A60A 3HX4A 3AOXA 4GT4A 4L53A 5KMJA 3AC8A 2IN6A 3MFTA 2RFDA 4PDSA 3QQLA 4EOMA 3WE8A 3CR0A 5CASA 2J50A 4KSPA 1XBAA 4ZJJA 2GQRA 3TNPC 3TI1A 3ZZWA 4EH3A 3GC9A 2HZIA 1YXXA 1R0PA 2PVMA 4M0ZA 4PTEA 2XARA 5L2TA 4X6QC 4YBKA 4GYGA 4FIEA 1BI8A 2KULA 3BGQA 4F65A 4KIKA 4CSVA 3UDSA 4DFUA 3QRIA 4GG7A 4EH5A 1YW2A 1E9HA 1R3CA 2ITZA 3A7GA 4C4EA 1ATPE 4JT3A 3NCGA 4EWHA 3QD2B 2GTMA 3IO7A 3UOLA 5FXSA 5CEKA 1YHSA 3D5VA 2OH0E 1VEBA 4EUUA 1W84A 3DKFA 2UW9A 3BE9A 1UKHA 3GFWA 4YLKA 2C0IA 2CNQA 4J52A 4FTLA 5AM6A 4CCBA 3FZ1A 4DDGA 3GOKA 4S34A 4ASZA 4FGRA 2YFXA 3KK9A 3TCPA 3M42A 4EEVA 4AGWA 4J96A 2YM6A 2VTRA 4XG8A 4LL0A 5AUXA 3RK7A 4I6FA 4XHKB 3ZSGA 2PUPA 3GC0A 5KCVA 2PUUA 3I81A 2C6OA 4I6QA 2Z7LA 3Q53A 5M4IA 5BVNA 2C6TA 3KULB 4H3PA 4Y73A 4M14A 4UMTA 3H0ZA 2R4BA 4HVHA 1XMMA 3ZFXA 3BV2A 4B99A 2QOKA 4L46A 4EQCA 4HVSA 3PVWA 3EN7A 2XP2A 1ZOGA 1AD5A 2XALA 3PLAE 3QX2A 5DOSA 3C1XA 4IEBA 5J9LA 3HAVA 3QKMA 5DMZA 3C4XA 1UU9A 5HD7A 3VF8A 4OTWA 5LVMA 3WF7A 5M4UA 1Z57A 3E3PA 3DV3A 4CZYB 3MYGA 3DT1A 3MH1A 5AV3A 3L8SA 5JQ5A 2R3RA 5ETIA 1WMKA 5ETFA 4F99A 4UB7A 3CIKA 3IG7A 4O0YA 5IDNA 4FKTA 2WTCA 3FQSA 2GSFA 2AQXA 3DBCA 4BYJA 4JRNA 4ERWA 4MF0A 4YHJA 4KIQA 4RT7A 3KKVA 4I24A 4F4PA 1BI7A 3C4CA 3FMHA 4FKRA 3KC3A 3FDNA 3QAME 1CMKE 4W9WA 5AV0A 5FQDC 3F2RA 3F82A 2NO3A 2PZIA 5CEIA 3VS6A 5AA8A 2ITPA 2YWPA 3DDQA 4QDVA 4TL0A 4D4RA 5FGKA 1R39A 4AF3A 2PUIA 5L4QA 4G3FA 5BV3A 2UUEA 4BDKA 5LVOA 3QTXA 1XKKA 4W4XA 3V8SA 5C26A 2Q0NA 2C3IB 2XK9A 3KU2A 2UVXA 3LXLA 1KWPA 3H4JA 3MDYA 4YJNA 3TNWA 5AV4A 2XJ1A 4IWPA 2PSQA 4FSTA 4I4FA 1JLUE 5J87A 3I7BA 3QCXA 4FTQA 4FVQA 1OUYA 5IH4A 4RFMA 3QLGA 4FC0A 3GCUA 2OJJA 3IECA 3LW0A 4NFNA 3TKUA 4AW0A 3B8QA 3LFAA 5LOHA 4IM3A 3VONA 2P4IA 2UVYA 2WMRA 2WFYA 2NRYA 3UO5A 2VTJA 2J4ZA 4QMSA 3R28A 3P86A 2VTNA 4DGMA 4BVUA 5GJDA 1F5QA 3IOKA 5FRIA 4ERKA 2VTSA 1PXLA 2IZTA 3R1QA 3KCFA 3UNKA 4RWIA 3N4UA 3SD0A 4ZMFA 3OOMA 3KEXA 4TTHB 3CC6A 4DHZA 3Q5IA 3HYHA 4J7BA 4YNOA 5TR6A 1S9JA 2FB8A 1H1RA 3AC3A 3Q2JA 3EQBA 2C47A 4FVRA 4CTBA 3DCVA 4PPCA 3UOJA 2JD5A 3JVSA 2WU6A 1BMKA 2XIXA 3E8EA 2O0UA 3NYOA 5AP4A 2BUJA 4FIGA 2VTPA 3UDZA 3RI1A 3QTZA 4I93A 1XHAA 4HOKA 3F2AA 2QURA 4UEUA 2ZDUA 3A99A 4ZXTA 3QZHA 4HJOA 4RJ6A 1PYEA 2YIQA 4USEA 3D2IA 3I5ZA 4NW5A 1ZOHA 2VUWA 4YJPA 1QMZA 1PXMA 2GHMA 3IW5A 4P5ZA 1DAWA 2XBJA 3QZFA 2GS2A 2ZM3A 2O5KA 3QRUA 1JQHA 4C35A 1H07A 5DT3A 5J8IA 4BDGA 2E9OA 3AC1A 3PJ2A 5G6VA 3WF8A 3KRRA 3QU0A 5K5XA 1Q41A 2W4OA 2W1IA 5IQCA 1V0BA 2I40A 3PFQA 2ZDTA 2QCSA 5ACKA 1E1VA 3MESA 1J91A 2UVZA 4QP1A 5CSHA 2WMWA 3CGFA 5FEQA 2XKEA 3GU6A 5EYCA 2WIPA 2RIOA 4L7FA 2G15A 2HWPA 2WMXA 3RALA 3B2WA 4HVGA 5KMKA 1P4FA 1PF8A 4FODA 1MQ4A 3PIXA 2B9HA 4A9RA 2UZWE 4J95A 4YLLA 2ETMA 4BIEA 3QRKA 2BZIB 3V5WA 1JSTA 4A4OA 2C6EA 2YERA 3R8UA 4W8DA 3S2PA 3FMMA 5DH3A 3VUGA 3A7FA 4CMTA 1UNHA 1YDRE 5T68A 4H3QA 3OWLA 4F7NA 3EZRA 4S30A 3N4TA 4XH6A 5BYZA 1OIQA 5GJFA 2EXEA 4KA3A 4U7ZA 4BKYA 4D0XA 4TPTA 1W2DA 4U5JA 3C5UA 5IEXA 1OL2A 1YQJA 3MJ2A 5JFWA 4MNEB 4CV8A 5F94A 3KMWA 3QL8A 4OTFA 3WARA 5IA4A 3SKCA 4UWCA 3UDTA 3F3ZA 5IEYA 2YAKA 4NL0A 2J5FA 2R3FA 3DBEA 2YCRA 5A46A 3A2CA 4C4GA 4IB5A 3WE4A 4BDAA 2GPHA 3G15A 3GOPA 3GGFA 3PE1A 5J5SA 3G51A 4O7ZA 3FLWA 2J2IB 2O64A 3GCVA 4O0UA 2QOHA 5H3QA 4EHVA 4UBAA 2PZPA 2RFEA 4E5WA 3EQRA 5DEWA 3QQHA 4B4LA 4BCJA 1S9IA 3FYKX 5BNJA 5J9ZA 3QF9A 3FLSA 3W8LA 4GJ2A 4CKJA 3F7WA 4O6LA 2VTTA 3KVWA 5H8BA 3VQHA 4D1SA 2WELA 4KKHA 4GKIA 3MH3A 2XJ0A 3OWKA 4RFZA 4I0SA 2C5OA 3GCQA 5LMKA 3TNHA 3MFSA 4X2KA 3EWHA 3QD0A 1IG1A 2JC6A 3OEFX 5FBOA 2J0IA 5CEMA 4DC2A 5CZHA 2G2HA 2H96A 3A7HA 4U45A 2BZHB 4CLJA 5KMLA 2YWVA 3UZPA 3ZO3A 4AXEA 3DKCA 5HBJA 2Z8CA 4GFOA 4ANSA 2IVUA 4DINA 3G0EA 2GFSA 4JRVA 5EW9A 3QBNA 1UA2A 3QXPA 4I20A 3SHEA 2VGOA 2Z7SA 4QMOA 3LCDA 4HYUA 3QZIA 4Z16A 4WA9A 2BIYA 5HESA 3FPMA 4FKIA 4FR4A 3AGLA 3E8NA 5GHVA 2F57A 4TYHB 1OMWA 2ITWA 4P2KA 5HO6A 2Y4IB 2C3KA 4FGBA 1OL1A 5FDXA 4O7VA 4X3FC 2VWUA 3VUMA 3KY2A 1RQQA 3R7OA 4IB3A 3TN8A 3ZBXA 3UQFA 4YNEA 2X4ZA 4BI2A 4PP7A 4KRCA 3CLYA 3CY2A 4YSMA 3VJOA 3K3IA 4G6LA 4AGCA 3PY1A 1GIHA 2BIKB 2C0TA 4AXCA 4IVBA 1XWSA 1H26A 3RCDA 5JEBA 1Y8GA 4BCHA 4GYIA 2OIDA 4E6CA 5DEYA 3MIYA 2B0QA 1DS5A 4L8MA 2PYWA 2XUUA 2F9GA 5GZAA 3HMPA 4RIYA 4R7HA 4BKZA 1LPUA 3OUKA 2VWWA 5HO8A 4DCEA 4PPBA 4Q2AA 3DJ6A 3FZOA 2A1AB 2YM8A 4E26A 2EB3A 4O0WA 2JBOA 4XG2A 2BRMA 4N0SA 3OOGA 3QWKA 1U59A 4OTRA 3ZHPC 5JFVA 2C4GA 2QOBA 3VUHA 3VS4A 3VS1A 3A61A 4EOQA 1V0OA 4DFBA 2WB8A 3BZ3A 2WO6A 3HMNA 3QZGA 3I79A 2XNNA 5CXHA 5AAFA 1H27A 5FWKK 4ZP5A 2O65A 2NP8A 2OJGA 3RTPA 2R3IA 2PVLA 3NYNA 1JSVA 3PSDA 1CTPE 1QCFA 1REJA 2CSNA 3L9NA 4FSNA 4A4LA 5B7VA 1PMNA 1SVHA 4NCTA 2OFUA 4YZBA 3SX9A 1G8JA 1IR3A 2WMUA 5CXZA 3R7EA 2YIRA 2BTRA 5BUEA 3KGAA 4GRBA 4ORKA 3OHTA 1GZKA 4KNBA 4OUCA 4YUQA 2QD9A 4L43A 3GEQA 1W82A 4C2VA 5HE2A 4LMUA 4QMTA 4FKJA 5HVJA 1CKIA 3T3UA 4BWPA 4I6LA 2W0JA 1YI4A 3ZU7A 5HOAA 4QQJA 5ACBC 5CU0A 4CFFA 1XBBA 3ULZA 4TY1A 3DXNA 2WEVA 4CMOA 3NWWA 3OCTA 4O2PA 1LEZA 4F70A 4AXAA 4EZ3A 3EQFA 5EYKA 2H9VA 3RCJA 5JN2A 3LOKA 2QU6A 4GT3A 1GZOA 4HPTE 3KQ7A 3BLRA 2A2AA 2ETKA 5LCJA 4QQCA 4E5AX 2FSOX 2W5BA 3HV7A 3D7TA 5E8XA 3NLBA 2JKQA 4D58A 3PA3A 2FVDA 2XNBA 3TTJA 3IW7A 3OTVA 4JDIA 3EYGA 2C6KA 2WD1A 3H30A 4IAAA 2ESMA 3U9CA 5AR5A 4TYHA 3NSZA 3P9JA 4U41A 3ORKA 3Q6WA 3RPRA 2JIIA 5L8LA 2EVAA 1AQ1A 2WAJA 3FZPA 3QUEA 4NM5A 3W2CA 2J0KA 2B55A 3BYMA 3UDBA 3VWAA 3ORNA 2VU3A 2XCHA 2Y8OA 3KRXA 4PV0A 4F9WA 3BLAA 2ITTA 5LMAA 4YSJA 4C37A 4R3CA 3R9RA 1WVWA 5CAUA 4HZRA 3WF6A 4ZIMA 4G5JA 5L8JA 5HQ0A 1SMHA 3W32A 2CGVA 3OS3A 4QP6A 5IUHA 3Q9WA 5CEQA 2W7XA 4GFGA 3R8PA 3FV8A 5E8ZA 3WZUA 3SG8A 2QOOA 3O8UA 4I5MA 1W2CA 1H00A 4G9RA 5ANOA 3WZJA 2VTMA 3EN4A 3MVLA 3PJ1A 3ZO1A 2VTAA 5EFQA 5C03A 1WBPA 1OL6A 1JKKA 4O96A 5FXQA 4I0TA 4YJVA 5F20A 3TYKA 4QMMA 4D5HA 4BBFA 2P55A 5CF8A 4NYEA 4O4CA 4WG3A 5A4TA 4G31A 4HYSA 1PXPA 2OIBA 4MVFA 3BL9A 3TZMA 3OCBA 3DFAA 4D4SA 4DTBA 4V0GB 3OY1A 3MY0A 4Y83A 4BBEA 4HCTA 2ZB1A 3GP0A 3NVMB 5CAOA 4O7LA 4AG8A 4Y5QA 3LXPA 3CQWA 2YLEA 1U54B 5I9UA 4EBVA 4HGTA 3VS7A 3P0MA 3KN6A 4ZSJA 1VZOA 3R8MA 3U4UA 5CSVA 4XG7A 5K3YA 4JG7A 4BCPA 3ZM9A 3IONA 2IZSA 1PXOA 2C69A 4O91A 5EYMA 3ZO2A 3V51A 5HX8A 2R0UA 4BDBA 2X8IA 2JKMA 4U6RA 5F95A 3IKAA 4LUEA 4LL5A 5TO8A 3DXQA 4TYEA 3W18A 4KBKA 4QYGA 1PY5A 2P3GX 3ODZX 5M09A 3GFEA 4IW0A 3PP1A 4V04A 4DA5A 4GJ3A 5CVGA 1XH4A 5IQFA 4BRXA 4FF8A 5CZIA 3IPHA 3TKHA 5CF6A 5C8NA 1A9UA 2IZUA 4X3JA 1OL5A 2HY81 3LFQA 4CFUA 5F9EA 1OM1A 2OO8X 4RGJA 4W4VA 3N4VA 2QR7A 4J97A 2IVSA 2R3HA 2UW5A 3O50A 4EI4A 1Z5MA 5CANA 5CF5A 4OTHA 5IQDA 3U55A 5TKDA 3OC1A 1JAMA 3TM0A 2BHEA 4BTKA 4EK6A 2WTKB 3RM6A 2HW6A 5I3RA 3NEWA 4CLIA 2JDSA 5EG3A 3MWUA 3SXSA 3FKNA 2ZV7A 3SRVA 4ACDA 4DLIA 2OJ9A 5T6KA 1W0XC 2WOTA 4IJ9A 3DB6A 5EYDA 5BX0A 4NCTC 4DT9A 1K3AA 5CI6A 1ERKA 1W83A 2SRCA 3LCOA 4FTIA 2PVNA 5JRSA 3R04A 1HOWA 4W4YA 3W2QA 2HXQA 4MXYA 4BWKA 5DE2A 3TL8A 3PVBA 3KMMA 4PDYA 2YJRA 4YZCA 1ZZLA 3M2WA 3UMXA 3LHJA 4L7SA 4AXDA 3DAEA 4ENYA 4MXXA 3AT4A 3MIAA 3SV0A 5HU3A 3GENA 1TZDA 3EFKA 3RZBA 3F5UA 3O2MA 4TKSA 4RWLA 4I5CA 1ST0A 2WMSA 3RHKA 3HUCA 3MVMA 4O81A 2CN5A 4BCIA 3KL8A 5CLPA 3O71A 4JX3A 1K9AA 2BFYA 4O2ZA 1GY3A 3K5VA 4FSYA 2VO3A 5EW8A 3V8TA 4NSTA 3ZLSA 5LVPA 4EH4A 2J7TA 3G9NA 4X21A 3FC1X 4DLJA 4FBXA 1ZMWA 4AW2A 1GZNA 3Q4TA 2PULA 3U54A 3DK3A 3H3CA 3E8DA 1W2FA 1XBCA 2X4FA 1PYXA 3NR9A 2I0HA 4ZK5A 4D2PA 1UWHA 4JXFA 3IS5A 3L8PA 3S1HA 4RX7A 5M08A 1UU8A 4DEDA 2VNWA 5M56A 3H0YA 3WIKA 2Y6OA 2J9MA 4ZTQA 3TZ9A 3BX5A 4BCNA 3RPYA 3QYZA 2WHBA 4KS7A 4CYIA 4ZOGA 4QTCA 2GS6A 4FZAB 4BCKA 4PNKA 2IJMA 1QPCA 2GMXA 2I6LA 2RF9A 2B53A 2QLUA 3DLSA 5I9ZA 3NAXA 4C4FA 2CNUA 2ITVA 2PWLA 3QRTA 4BCOA 2OWBA 4LGHA 3HV3A 5D41A 4LM5A 4HYIA 4RJ8A 3FWQA 1I09A 4UN0C 1YDTE 2X7OA 2G2FA 4DDIA 2B52A 4APPA 1T46A 2GHGA 3BI6A 4DEHA 4IADA 3PZHA 4FTOA 4G2FA 3UC3A 1OBDA 3FXWA 3G90X 2VTQA 3MPMA 3E63A 4O86A 4JBVA 5DR6A 2BAJA 3DZQA 4RVKA 4O7SA 4Z7GA 4F9AA 1PHKA 3FMDA 4KIOA 1KUTA 4U3ZA 3HRBA 4EH2A 4U81A 3WZDA 4O4EA 5I3OA 5FM2A 2P2HA 1AGWA 2JFLA 2Q0BA 4QMXA 4F6WA 1NXKA 2YLFA 3EQGA 5HCXA 3Q52A 4TZRA 3SW7A 4IJPA 3TDWA 3II5A 2R2PA 4OLIA 1KOAA 2A27A 4BFMA 4CYJA 2VO7A 2YEXA 5JZNA 4IHPA 3BGZA 5I9WA 4FEVA 4QMUA 4B9DA 4WNMA 2PHKA 4ALWA 4TYGA 4PNIA 3FPQA 1YOJA 3R7IA 5FUTA 3CP9A 3KF7A 3R71A 5CQWA 4OBOA 3GU7A 2VN9A 4GK2A 4RPVA 3FEGA 4CG9A 5E1EA 2Y9QA 3AKJA 1G8AA 2CMWA 3MVHA 4ITJA 5KX8A 2ZV9A 3TIZA 4QP3A 4OAUC 3FHRA 4FOBA 4JX7A 2IG7A 3COIA 5AX9A 3IQ7A 2CKPA 2UW8A 2QOLA 5HBEA 5DVRA 4MQ2A 4ANOA 1FMKA 3HA8A 4I41A 3S3IA 2QO7A 1Q61A 1UNGA 5KE0A 3ML1A 2XNGA 3NIZA 3F88A 4C2WA 4AFJA 3ALNA 1QPEA 3FHIA