4AW1A

Human pdk1 kinase domain in complex with allosteric compound ps210 bound to the pif-pocket
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
293
structure length
283
Chain Sequence
QHAQPPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
publication title Substrate-Selective Inhibition of Protein Kinase Pdk1 by Small Compounds that Bind to the Pif-Pocket Allosteric Docking Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 77
structure length 283
sequence length 293
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4aw1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4aw1A01
2A0CX 2P55A 4RPVA 2JIIA 4QMSA 5K4IA 4U79A 3I5NA 2XK3A 3LFDA 3UNJA 5AX9A 3ACJA 1KE5A 2BTSA 4JQ7A 3QGWA 3CD3A 5FEDA 5I9VA 4G6NA 3MVMA 5EDRA 4BCFA 2QONA 1CDKA 3MGYA 2BCJA 3MN3A 4M13A 3UVPA 4CRSA 4D0WA 4EOKA 5BYYA 2IZTA 3IOKA 2JKKA 3A7GA 5FP6A 5I9UA 3QALE 2BRHA 4HVSA 3I1AA 3LFSA 3C51A 4CZYB 1XHAA 3ZCLA 1W83A 3HA8A 3NYOA 4PF4A 1U4DA 3ZSIA 4MXAA 2B9HA 2PWLA 3QQUA 4RIXA 3HNGA 2YERA 3OWJA 4NJDA 4CFUA 4FKVA 1OL1A 1OZ1A 4M7IA 4O2PA 4IHPA 3FHRA 3BCEA 3RKBA 3ZFXA 4O7WA 5M44A 5FXSA 3LCSA 2X7OA 5HHWA 5K5NA 5FM3A 2BRNA 3QF9A 5EQPA 1YWNA 3UOKA 4IWDA 2OJGA 4AF3A 3OY3A 3CKXA 1T46A 4LG4A 5AR2A 5JQ8A 4HVHA 4QMZA 1FVRA 3O0GA 1XO2B 4RWJA 4AGDA 4GT4A 3MY0A 2PHKA 5AMNA 3HMMA 4AE6A 4E1ZA 3C5IA 2G2IA 3COIA 3TM0A 3RPRA 4WOVA 4BGQA 1Q99A 4J97A 4I6BA 2HWOA 2C30A 2GNIA 3FMJA 2EVAA 4DGLC 5L6PA 3BGPA 4LOPA 4PTCA 2XK7A 5C26A 1GZ8A 1JOWB 4CTBA 5A4LA 3A60A 1TQIA 3HECA 3NZ0A 3DDPA 4KNBA 3ZUUA 1FINA 2GNFA 2CGUA 2BZIB 3LXLA 4ITJA 3KXXA 4IAAA 4QMYA 4ALWA 2VWUA 2PVJA 4HZRA 3F5XA 3QCYA 4RVMA 4IVCA 3U9CA 2IVUA 4C36A 4HNIA 4KBCA 4BF2A 1BX6A 4XG7A 3UE4A 4C7TA 3TKIA 2J5EA 2WD1A 3SG9A 4DGGA 4HPUE 4NTSA 3UYTA 4QP4A 3VS5A 4O7TA 3DNEA 3UO6A 4BFMA 4EH4A 3G0FA 1ERKA 2ITUA 3NUYA 5A4QA 3KQ7A 3UIMA 4C8BA 2KULA 3OVVA 1J1CA 4G3EA 3FI2A 4NFNA 5FGKA 3I7CA 4O7VA 5E91A 1YOJA 4I5HA 4RJ3A 4ANOA 3IOPA 3P1AA 4C61A 3Q2MA 4N6ZA 4RIOA 3DLZA 1Q24A 2HXLA 5K0XA 4ACCA 3OT8A 2R3GA 3AC3A 1TQMA 4XRLA 3VS1A 4GFOA 4FZ6A 4IZ5A 3V5JA 1JWHA 4DE4A 5FRIA 2HOGA 3ENHA 4EYMA 1YW2A 5I9WA 1CSNA 1OPLA 3AC5A 5CEKA 2ZB1A 2IVVA 5EYMA 1BYGA 4FL3A 4QTCA 4PDYA 2P3GX 3R9RA 4DFBA 4PX6A 2XEYA 5AA8A 3DKGA 4EKKA 4A07A 1PRYA 5FUTA 4ZTLA 1OECA 2Y4IC 5CNNA 5AAEA 5GIOE 2ONLA 5AADA 1LEZA 1JQHA 4AW0A 2W1DA 1LUFA 3WE8A 4AA0A 3VJNA 5JQ5A 4NM5A 1OKWA 2XS0A 3VF8A 3JY0A 2VWIA 3M42A 4KUJA 5JFXA 1XH8A 1BI7A 1SMHA 5JKGA 2Z8CA 1YXXA 2FSMX 2ITOA 2VTHA 3GVUA 2VTAA 2PUUA 4OAVB 3MJ1A 3PYYA 4FEXA 2Z7QA 1KWPA 4PL5A 4HOKA 4XOZA 4R3CA 2CGXA 5GINE 3ACKA 2F7XE 3SXRA 4B7TA 4F9CA 4H36A 4EWHA 2Z02A 3ETAA 3LE6A 2W5BA 5L2WA 1S9JA 5EM8A 4C3RA 4CFXA 2BRMA 5CU3A 2O0UA 1ZY4A 3ZUTA 4HVIA 1PY5A 2BDJA 4DEHA 1YKRA 1YI3A 4RFYA 5IUIA 3D94A 4IAYA 4NCTA 5IA2A 4YC3A 4L6QA 4L67A 4Y8DA 2PZPA 4FL1A 2VV9A 3QD2B 3VO3A 1PKDA 5AP4A 2ITWA 1OKVA 4IFCA 5KHWA 5IPJA 4RC2A 3VUGA 4H1MA 4E6QA 3TNHA 3G51A 5CI6A 3QZIA 4ZSEA 2C0IA 4M0YA 5IQBA 3O8PA 3PLSA 5HCYA 4FZFB 2O8YA 2W5HA 2WMWA 3OXTA 2CLQA 3F3WA 2B53A 1TKIA 4BDEA 4IDTA 2VNWA 4QPMA 2R64A 3QD3A 5AM7A 3AOXA 4YMJA 2WAJA 3NS9A 1NVSA 4L46A 4X2NA 3SOAA 4C33A 4BDIA 2WEIA 3QX2A 3D15A 3PJCA 5E8YA 4FG9A 4GYIA 2W1IA 3OP5A 1H24A 4PNIA 4D2TA 4JIAA 4DAWA 5J95A 4FGBA 3R7EA 1J91A 3BBWA 4K6ZA 1YDRE 2QVSE 5J7BA 3EL8A 3Q6WA 3U54A 1U46A 4EOQA 4O86A 4LOQA 5BVOA 4G17A 4KIKA 3SC1A 4XEYA 5K0KA 2O65A 4D2SA 5J8IA 3AGLA 2ZB0A 3E5AA 2J0JA 3P4KA 3S3IA 2R5TA 3L8PA 4RA5A 2I0EA 2NO3A 4U41A 3EN7A 4XG3A 3NVMB 2Y9QA 4EQUA 2ZJWA 3MI9A 4C3PA 4CLIA 1OL6A 2BZHB 4PMSA 4P5QA 3I81A 4ONAA 1QPEA 3ZBFA 4XHKB 5EI2A 2AYPA 3PSBA 3QLGA 4L7FA 3OF0A 3FMHA 4C62A 1JNKA 4FV2A 2W9ZB 3VUDA 5E92A 4YZ9A 3MFRA 4CEGA 5LWNA 4OTFA 2QU6A 2W05A 3N4VA 2C3KA 4M3QA 3QU0A 4IM2A 3BWJA 2QOQA 3HUBA 1YQJA 3CGFA 1BLXA 2O3PA 2OJFE 2PE0A 4FKOA 4XV9A 2YWPA 3QKLA 5T6KA 3RNYA 3R1SA 5FXRA 5I9ZA 4BCGA 2CPKE 3FSKA 3HLLA 1SNXA 4QNAA 4TT7A 3RHKA 4GW8A 5AR8A 3W8LA 3GCQA 5E7RA 4GT3A 4MTAA 2WTIA 3KRLA 3PPKA 5DT4A 3W2RA 3PDTA 3V5WA 1ZYSA 2XKFA 4OTHA 4D1ZA 3PY0A 3AD5A 4O6LA 3F5GA 2HZ0A 3WIGA 4BCOA 4E26A 2PUIA 2CMWA 4RJ5A 4CFMA 4ZIMA 3R21A 5KUPA 2VTJA 4LMNA 1SVEA 2R0IA 4YHTA 4CFVA 2YM6A 2Z7LA 3W1FA 1YVJA 3LLAA 1KE8A 5GHVA 3F82A 3Q9XA 3COHA 5FP5A 2OIDA 4I5PA 4FSWA 4RIYB 2XKEA 5EHLA 5CLPA 5EHOA 2YISA 5M55A 2JAMA 4U5JA 5BYZA 4EBWA 4WHZA 4EK8A 4G6LA 2C0TA 3SVVA 4L7SA 5CF6A 4YJVA 1OL7A 4A9RA 1XBCA 5H9BA 2YHVA 1UKIA 3ORMA 5HLNA 2YM4A 4R8QA 4IE9A 3RM6A 2ONLC 3WF5A 2WQMA 2WMTA 4FT7A 4Y72A 2JLDA 3NUUA 1W82A 4JXFA 3DJ7A 2HZ4A 2X2MA 4KKGA 3MW1A 4Y5HA 4GFMA 3SW4A 3DKCA 3QTRA 4QNYA 4D2WA 2QOKA 2QU5A 1SVGA 1XH7A 2VX1A 4O0TA 4EHVA 2XVDA 3U6JA 4M15A 3Q5IA 3OBJA 3RVGA 4KAOA 3C4EA 1QPDA 4DFZE 3ANRA 3TDVA 3L9NA 1ZARA 3MY5A 3NYVA 2C5VA 2KTYA 3UODA 4ZY4A 5BVWA 4LFIA 4CMOA 4BCNA 5J5SA 2WELA 4I3ZA 3OEZA 5JFSA 4GSBA 3DA6A 5AP5A 2H96A 1APME 3D2IA 1M17A 1OB3A 1UWJA 4DT9A 4UZHA 2G2HA 3VBQA 1L3RE 4ENYA 3U51A 3OD6X 4A9YA 3KK8A 3B2WA 3FXWA 5LVMA 2BVAA 2Z60A 5T68A 5M4IA 4MD8E 4EHZA 3PLAE 2C5XA 5HE3A 4CQGA 2X6EA 3UIBA 1GZKA 3EFWA 3IDBA 4NCTC 4ERWA 2SRCA 1UU3A 3GFEA 3PVGA 2UZOA 2XNGA 3MPAA 3A2CA 4RRVA 3EZVA 3LIJA 4U40A 4ZSJA 2XIZA 2HW6A 1YHWA 3QA8A 4TY1A 5HQ0A 4K9YA 4MXXA 3OW3A 4MF1A 3UPZA 3VHKA 2YIWA 1QCFA 2JD5A 3I0QA 3EKNA 2VAGA 4RLLA 2LAVA 3ROCA 4S2ZA 1KV2A 2QI8A 4I5CA 3R8ZA 4MWHA 4OBQA 5CEPA 3DKFA 2ETKA 4EOMA 2QG5A 4FKQA 3SLSA 3EQIA 3FL4A 5DHJA 4ZTSA 4O84A 4O0UA 4DH1A 1I44A 1DM2A 4OBOA 5AEPA 3O50A 5LMKA 4QP3A 2CCIA 4BCIA 2EU9A 4BWXA 5KBQA 3P0MA 1WFCA 2VUWA 5HD4A 4BZDA 3LLTA 5GZ9A 3O7LB 3UQFA 4CKJA 2JGZA 3AG9A 4WSQA 1NXKA 3AD6A 4UXLA 4MNEB 4RJ4A 2EXCX 1R0EA 4U80A 3OCBA 4WG3A 5C27A 1W0XC 3L9MA 3VBYA 1P14A 4O1PA 5B0XA 4L8MA 3V01A 5IH6A 5IQDA 1OUKA 2AC3A 3RALA 2FO0A 2HELA 3GT8A 4BBEA 4FV9A 3HAVA 2W0JA 3CS9A 4ZZNA 3D14A 3QXOA 4ZTHA 4EORA 2PVFA 4FSMA 4MXYA 1XH6A 4EOPA 1FPUA 2JDTA 1SNUA 2ITTA 5DPVA 1PXJA 3BZ3A 5DN3A 1YRPA 4YP8A 1Q3WA 4JBVA 5M51A 4BCKA 4UALA 3QHWA 4QOXA 2B55A 3L8XA 4MBLA 4Y73A 4HGTA 5EW3A 3KGAA 4A7CA 4F99A 3IG7A 4JG7A 4H05A 1WCCA 2UZBA 3C1XA 4CT2A 4YHFA 2FUMA 5ANEA 3ZSGA 3LFAA 3Q9WA 4ACGA 3KVWA 4ALUA 4QTAA 2W4OA 3QL8A 5ETIA 5AUVA 4XH6A 4BDJA 4EC8A 3G90X 1JKKA 4J1RA 4F08A 5D9HA 2VWZA 4RZWA 2ZV8A 1W98A 3HMPA 3LXKA 3ORTA 3ZU7A 5IDPA 1F3MC 2C6MA 1G8SA 3R0TA 4D55A 5TF9A 3SHEA 3UP7A 3F3UA 2WQOA 3NW6A 4K1BA 3H30A 5AR3A 2BAKA 3A7HA 4O0WA 4FK3A 3MB6A 5CSPA 4EWQA 2YDJA 4NWMA 1H4LA 2C3LA 5CEQA 4AWIA 3TKHA 3FKLA 4UZDA 4TNDA 3R9NA 4RA4A 1WVWA 3OWPA 2E9VA 4IAZA 1IAHA 3CJFA 5LVPA 2XJ0A 3BGZA 4E4LA 2WB8A 3JR1A 3UTOA 5J79A 2OICA 5A4EA 4LGDA 4YZMA 3PE1A 3MH1A 3T3UA 4JDJA 3DTCA 4KIKB 4YO4A 5L2SA 4U43A 1PXPA 3KULB 4DFYA 3E7VA 5HICA 4DLIA 4QTDA 4X7QA 4M97A 3R8UA 3UO5A 4GJ3A 4ID7A 3Q2JA 3BU3A 4M14A 5CS6A 4GUBA 1J7UA 3I6WA 5FXQA 2VO6A 2UW5A 4JG8A 3ZRKA 4RVLA 4AXAA 1K9AA 4IX5A 4W8EA 1LR4A 2XEZA 3QTSA 4J8NA 3ZTXA 3FMNA 2J4ZA 1S9IA 4W4XA 5CU6A 4EYJA 3WARA 3FI4A 2CSNA 3HP5A 3MH0A 5T3QA 1I09A 4FKTA 4XV1A 3CXWA 4QRCA 5EYCA 5H8GA 3FE3A 3RWQA 3S95A 3DFAA 3P7BA 4FG7A 4G1WA 3EQRA 4QP9A 3E63A 3O23A 4DG3E 2E2BA 4DLJA 4JQ8A 2G15A 3RTPA 5AV1A 2PMOX 4IJPA 4DFLA 5HVYA 2EB2A 3GCUA 3RK5A 3S4QA 3LQ3A 4EH8A 4FVQA 2ITVA 3FV8A 3CBLA 2IVTA 4BDBA 3UQGA 3O71A 3R83A 3AT3A 4Y5QA 4QD6A 4O7NA 4DA5A 1CKJA 1O6LA 4PTEA 1YXSA 1UVRA 2HAKA 1U59A 3OTVA 1OUYA 3BKBA 3ZDUA 3C7QA 1Q8WA 2A2AA 4IZAA 5AP2A 5BVDA 4EI4A 5EM7A 1GJOA 4DGMA 1IASA 4ITHA 2VTRA 5HG7A 4F70A 3R9HA 4DFUA 4DTBA 5LCJA 3PWDA 3LAUA 2Y6OA 2ESMA 3KRXA 3LFQA 3EIDA 1KE9A 3K2LA 3NEWA 5AUWA 4V04A 4DEBA 2ITXA 2RFSA 2WO6A 4S31A 4DEDA 3THBA 3BHHA 3QFVA 5K5XA 5CNOA 4FTCA 1BMKA 2FSOX 5EOBA 1R0PA 1FMOE 3LCTA 5ANGA 5LMKC 3D5WA 2HY0A 3ZZEA 5AP3A 2V5QA 3A4PA 3W2PA 4ANBA 4FKWA 3BGQA 4IADA 4IZ7A 4V0GA 4FEUA 3PIZA 3LJ0A 3SXSA 2P4IA 4OTQA 4YC8A 1VZOA 3LFNA 4WBBB 5AJQA 4FA2A 2QG7A 4R5SA 2R3FA 1OIUA 4O96A 3GI3A 4RSSA 3TZ8A 4QYEA 2RFDA 3BWFA 4EKLA 4Y95A 4EH9A 2B54A 4C57A 5EQEA 4MHAA 5LVOA 2B9IA 4FSNA 1CKIA 3QQHA 3F3VA 4QMXA 4C58A 2B0QA 3U55A 4OT6A 5HCXA 1ZY5A 5M07A 5IKWA 5DEYA 5E90A 2YIYA 2WQBA 4A4LA 1PXIA 2R9SA 3ZYAA 2PZYA 3VUKA 3LFBA 3O7LD 3GOPA 3SQQA 4E6AA 3S1HA 2VO7A 2BFXA 3JY9A 5KKRC 5A3XA 3FQHA 1ZAOA 4K33A 2V62A 2IZRA 3AD4A 4X3FB 3KEXA 3Q32A 5JN2A 1V0OA 2J51A 3V8SA 4E4XA 3ZO4A 3TN8A 3ZEPA 4IZYA 5A6OA 3C4CA 4LL5A 4M69A 3QQGA 3C0GA 2PULA 3QQKA 4KD1A 4R77A 2VZ6A 2X4FA 5AP6A 5BQ0A 4LRJA 2OI4X 2CGVA 3QGYA 2I0HA 1HCLA 3BPRA 2WMUA 5J87A 3P5KA 5E8SA 5DRBA 5CAOA 1PXMA 3UVQA 3VS7A 3HRFA 3NUPA 4S33A 5KMNA 5CWZA 3WYXA 2G9XA 2IW9A 4OTPA 3V3VA 4RIWA 1CTPE 4OTWA 3W2CA 2CCHA 3EN6A 3ZOSA 2C68A 5L4QA 2W17A 4UWCA 4ENXA 1VR2A 1O6KA 2XNPA 2YN8A 3DJ6A 5BVFA 3NR9A 2RKUA 4O38A 3PXZA 3TI1A 3FDNA 1PYEA 5ACBC 4JRNA 2C3IB 4Q5HA 3CPCA 3R9DA 3RCDA 5BVNA 4RG0A 5CALA 2FA2A 2W99B 2V0DA 3NDMA 2YLFA 3FZSA 3UMXA 4FKIA 3C9WA 1J7LA 3DXPA 4FV6A 3R00A 4I23A 1A9UA 5GJFA 3BU5A 4GVAA 2Q0NA 4QQ5A 2CKOA 4X3JA 5CANA 1UA2A 5KKRB 2UW6A 2CJMA 1FOTA 4TN6A 4YTIA 3MA6A 4FEQA 4I4FA 1H1SA 4JI9A 2IZUA 3MIAA 3VUIA 3UOJA 4GKIA 4IAKA 4L9IA 4L00A 4ZTNA 4BDDA 5GZAA 5JGDA 1W7HA 3BYUA 1RE8A 4QYGA 5IQFA 4KABA 4BRXA 2VGOA 3RAKA 4ANSA 3JVSA 4X2JA 3LMHA 4N4SA 2R0UA 4MQ1A 4CNHA 3UZPA 4RC4A 2R3JA 2UZWE 3GENA 3QC4A 4UEUA 4DCEA 3DKOA 4QQCA 3OG7A 4I41A 1XWSA 1H01A 3OFMA 3G0EA 1PXOA 4E6CA 4F0GA 2P2HA 2R2PA 4WSYA 2JBPA 2X2LA 2YA9A 4EJNA 3KY2A 1GIJA 3PXRA 5EOLA 2A4LA 4X2GA 1URWA 3QRIA 1XBBA 4MK0A 3PSCA 4JBPA 4RWLA 4X2FA 2WTWA 3HV6A 4JDIA 4KA3A 5AUXA 1Q8YA 4EBVA 2QO9A 2PMIA 1STCE 4PUZA 2VD5A 2GHMA 3F6XA 4FOBA 3IW7A 5AFVA 3ODYX 4NFMA 3LJ2A 4L3JA 2PUNA 1GNGA 4DTAA 3L9LA 5EQYA 2B52A 5LMAA 2OO8X 3FI3A 4EK3A 1GIHA 1YXVA 2QCSA 2XNOA 3NW5A 5HIDA 3RPVA 3IPHA 1H27A 4FT9A 2PE2A 2QC6A 3MDYA 3GEQA 3JXWA 5KO1A 1ZYCA 2UW9A 4W8DA 4JR7A 3W55A 3KXNA 3MSSA 1GOLA 2F4JA 3QRJA 2E9UA 5IU2A 3D7ZA 2BIYA 2JFLA 3G6HA 3MY1A 3E62A 4FV3A 4FOCA 3ITZA 5M53A 3VUHA 4QMUA 3WBLA 5ANJA 2GNJA 3DZQA 5KX8A 4WKQA 2CLXA 4AAAA 3UNZA 4CT1A 1O9UA 3JPVA 4HNFA 4PMPA 3D7TA 3T9TA 4L44A 2OF4A 4BC6A 4CZTA 2RFNA 1FQ1B 3QQJA 4KS7A 2YAAA 2R3HA 4NTTA 5EYDA 5GNKA 3UPXA 4E73A 4EUUA 4RFZA 1U5QA 2XRWA 3R1NA 2X0GA 3CTHA 4EOLA 4GV1A 5M09A 5ETCA 5LOHA 5E8WA 1XJDA 3VBVA 2R7IA 2OH4A 2UVZA 3OXZA 4C02A 5HBEA 4CGAA 4DYMA 5M4UA 3RJCA 3SG8A 5AV2A 3RHXA 2DS1A 4L3LA 5CVHA 1H28A 2C5OA 2P2IA 4ZSLA 3QXPA 3RPYA 3QLFA 1J1BA 4NW6A 4S34A 3BYOA 4IWQA 4RQVA 4DT8A 5AV3A 5EDQA 1DAWA 3CQUA 4ZSGA 5J5TA 3DAJA 4EK5A 3UGCA 4FL2A 2I6LA 3OROA 2XZSA 4XJ0A 3KMMA 4H3BA 4EQMA 5IUGA 4EC9A 4BDCA 2ETMA 5DI1A 1IG1A 4GH2A 4K11A 2OWBA 5AWMA 4XOYA 2Y4PA 2C6TA 4HYHA 3Q9YA 3EQHA 3FMEA 5DNRA 4WNKA 5C4LA 4M67A 4J99A 4PL4A 4J98A 1R39A 4FSYA 2QO2A 5CVFA 5F1ZA 4U42A 3BQRA 1IAJA 3KXGA 4MCVA 4HZSA 4XG9A 4FKLA 1ZWSA 2OZAA 1Y8GA 3WIKA 3U4WA 3VVHA 4G16A 4GFGA 2WTKC 5EH0A 5CY3A 4F65A 3ELJA 2XM9A 4DGNA 2Z7SA 2CKQA 5ANKA 5FD2A 5JRQA 1HOWA 4N70A 3BV3A 2LGCA 3OC1A 1Q5KA 2QLUA 4GIIA 5DOSA 5AUUA 1OBGA 3FZ1A 3EFKA 4FI1A 4Y85A 1Q97A 4GK2A 4YLLA 2GQSA 5HD7A 2QD9A 5HIBA 4XBUA 3NIEA 3FPQA 2QODA 1R3CA 4HGEA 3CLYA 1OITA 2QNJA 4IAIA 3EJ1A 5H8BA 3MBLA 5K3YA 3ZHPC 5LMBA 4K77A 1J3HA 2PE1A 3GUBA 4EOOA 3EFJA 4ZOGA 3JYAA 4UB7A 2GS2A 2VWWA 2QLQA 3RINA 2XIKA 4DH7A 4E4MA 3Q96A 2UVXA 3QYZA 1AGWA 1KSWA 3E8EA 3FBVA 1KE6A 3BYVA 4F7JA 5JSMA 2HCKA 4C4EA 3OT3A 5M06A 4YJNA 3ODZX 3EZRA 3Q4ZA 3QKMA 2OGVA 3DT1A 4BBFA 2B7AA 5DMZA 2YABA 3E93A 3POOA 1Y8YA 4I22A 4FTUA 3SRVB 4IVAA 4P7EA 5AA9A 2XK8A 4MD9E 3ORLA 3QD0A 1AQ1A 4BDKA 4OTIA 5HEZA 2OH0E 4Z16A 4PL3A 1XH9A 2PUPA 2VTSA 2JDSA 4HCVA 4WUNA 3MJ2A 3F2NA 3P7AA 4D1XA 5DWRA 1XBAA 2BHHA 5IMXA 3ZONA 3O2MA 4YTCA 4WA9A 3FXZA 1OL5A 5ANOA 4FBXA 3N4TA 2WTKB 5CU4A 3FMLA 4FKJA 3PZHA 4M69B 3R7IA 3UBDA 3PXYA 4Q5EA 4AG8A 3E92A 3SA0A 3LJ1A 1PMUA 4BCPA 4AW1A 3F9NA 4EOSA 3O8UA 5M4FA 4DEAA 3H9FA 3DTWA 4YGAA 4XMOA 3DDQA 3PXKA 4FICA 4USFA 2WTDA 4YLJA 3K5UA 2Y6MA 4AT4A 3QTXA 3A8XA 1REJA 3AGMA 3ALNA 3CR0A 3FHIA 2Y4IB 3EQPA 1Q3DA 3GCSA 4G31A 4PWNA 4KKHA 3LMIA 1JVPP 1F0QA 3F66A 3R8VA 2PVYA 2P33A 2OBJA 3F3ZA 3ULZA 3UP2A 4EJ7A 2XBAA 5CU2A 3GU7A 3EQCA 2EXMA 3Q4UA 3EWHA 3G9LX 3IQ7A 2BZKB 3R2YA 3Q5ZA 4YJOA 4UN0C 3H4JA 3ET7A 2JDRA 4JDHA 4TWOA 3C0HA 2EUFB 2QO7A 4XS2A 5IG1A 3NRMA 2CNUA 1IA8A 1JSUA 2OIBA 3AT2A 1OPJA 5G6VA 3SGCA 4QO9A 4O91A 4DTKA 5KMLA 4KSPA 3A61A 1KE7A 4FTMA 4IANA 4C4FA 5E1EA 4LUDA 4RFMA 2JIVA 2XRUA 2XB7A 3ENMA 1FVVA 4KIOA 5HTCA 4ASZA 1YHVA 4QP7A 3VRYA 2XCHA 5CSVA 5DT0A 4LRKA 1BI8A 3RK9A 5IA0A 4UBAA 5FDXA 3TDWA 4C4IA 3DB8A 4BI1A 4AX8A 2C5YA 4R1YA 3TNPC 4AOTA 5CEIA 4JL9A 2JBOA 4I0SA 3DAEA 2EXEA 4FTOA 5L3AA 4OTRA 2X8EA 5HNBA 4C38A 4CSVA 4DITA 4XG6A 3UOHA 3S0OA 1Y6BA 4MEDA 3WZJA 1XKKA 2BR1A 4TYEA 2G2FA 3EN5A 1Q8ZA 3ORIA 4PPBA 2QHNA 1NT2A 4KBAA 4ZTMA 4GK3A 4JS8A 4RIXB 1YXTA 3R01A 2GNGA 4AT3A 1UNLA 1WZYA 4DH3A 1M52A 3R02A 3EB0A 3L8SA 4DEGA 4OAUC 5DYJA 2W5AA 2PSQA 1LPUA 1P2AA 2BROA 1VEBA 4MD7E 4PRJA 4QT1A 4USEA 4YSMA 4L53A 3FI8A 4FTNA 3TIYA 3QAME 4JLCA 5CU0A 1UNGA 1W84A 4FIJA 4LMUA 3FEGA 3G9NA 3OW4A 4FSQA 1T45A 3U87A 4A9SA 4EK4A 2ERKA 3P23A 2ZMCA 4MBJA 5KNJA 5AV4A 4P5ZA 5GJDA 1H07A 2IVSA 4UY9A 5F94A 2WKMA 2DUVA 4QYYA 4W4VA 5C1QB 5AV0A 3NNVA 5JZJA 4IVBA 2XBJA 4ZS4A 2BKZA 1M2PA 2YDIA 1Q41A 3DQWA 2G01A 3E7OA 2UW7A 3GB2A 3PPJA 4IWPA 5IUHA 3OWKA 4MYGA 3TG1A 3V8TA 3WF6A 4G5JA 3VWAA 4OT5A 3AMBA 4J95A 2OXYA 1V0PA 3PJ2A 3DU8A 1SZMA 5TKDA 2X2KA 5EI6A 4ZJJA 1Q4LA 1A06A 3DB6A 3FKOA 3VS3A 5KMOA 1Z5MA 2ZOQA 3HYHA 4NM3A 4PP7A 4ACDA 2ACXA 5H8EA 3QTIA 3EFLA 4UMPA 4EOJA 3Q52A 3KC3A 2I40A 4HYSA 4FK6A 4Z9LA 3TNQB 3F2AA 5CI7A 3VJOA 3U6IA 1KUTA 4QMMA 2NRYA 3D4QA 1FGIA 3KL8A 4ZJIA 5IDNA 3AQVA 5H2UA 1UU7A 4OW8A 5AUYA 4L3PA 4NKSA 4KRDA 2F2UA 2PYWA 4BTFA 5L6WL 3TEIA 3TTJA 1JSVA 5JFVA 4AQCA 3ZBXA 2WQEA 5J1VA 2QURA 4JJRA 4YPDA 4ACMA 4ARKA 5AUTA 3U6HA 4IVDA 1KOAA 3A4OX 4NIFA 2BAQA 4ITIA 4AACA 3CTJA 3KREA 3R63A 2GMXA 3E3PA 4NEUA 3FLQA 3MB7A 4PDSA 3RAIA 4BDGA 3PP0A 4GEOA 3ZZWA 4OTGA 3FZOA 1TVOA 5J9LA 5AIKA 1YWVA 5DVRA 4CKRA 3TV7A 3R8MA 3BE9A 3E88A 5D12A 3E8NA 3UC4A 4CV8A 3BLQA 2W9FB 4F9AA 4JX3A 3LCDA 4ANQA 3RAHA 2W96B 3DPKA 4QP1A 2IN6A 2EB3A 1DI9A 3K5VA 4EHEA 3PWYA 4KIPA 4U3YA 4IEBA 3VUTA 4AFJA 2XUUA 4IB5A 4F09A 1MP8A 1Y57A 5LARA 4IX4A 2CKEA 4FIGA 2GPHA 2X7GA 1M7NA 2QOFA 4N0SA 3CKWA 1MUOA 4FEWA 2GFCA 1PJKA 3TL8A 4CQEA 2Y7JA 4LGHA 4CCUA 4CZUA 3DXQA 4PY1A 4FNXA 4EQCA 5JT2A 2YEXA 3HL7A 3CC6A 3KA0A 3HDNA 2RG5A 3DGKA 1RQQA 3W2QA 3W2OA 3KCFA 5JFWA 4ANLA 5HE1A 3UMWA 4I6QA 3WI6A 4EH6A 3VUMA 3DOGA 3AXWA 2JAVA 2VWVA 3OZ6A 1FVTA 2VNYA 2ZM1A 2C47A 3SXFA 3I79A 4BR3A 2ZDUA 5IMEA 2WMSA 4W9WA 3HV5A 3LQ8A 4EH5A 3CE3A 4YZCA 4GMYA 5BPYA 4ZAUA 2BDFA 3HP2A 4FODA 2NRUA 2E9OA 2WEVA 3V5QA 3DK7A 5IISA 3LM0A 3OBGA 5I3RA 1PXLA 4U44A 2JDOA 4V01A 3MA3A 5A6NA 2YJSA 2CHLA 4GYGA 1H08A 3PZEA 4M66A 4ZK5A 3FY0A 3QZGA 2GCDA 1ZZ2A 2PU8A 1BL7A 5IA3A 3VS2A 4ORKA 3VIDA 4BKYA 3PXFA 3Q60A 4O0SA 3MWUA 2YFXA 4TWCA 4CMUA 2W1FA 5F95A 3QCQA 5DFPA 5AR4A 3AC8A 3E8CA 3R2BA 3IKAA 3LOKA 4ZLYA 3LFCA 3HZTA 4NJ3A 3NGAA 5KHXA 3RBWA 4FTRA 4JVGA 4BKZA 5EK7A 4CXAA 4YPSA 2X4ZA 5KMMA 4DH5A 5JZNA 2VTTA 3OOMA 3R6XA 2FB8A 3IW5A 2BUJA 1V0BA 3PRFA 4FC0A 5DT3A 3QTQA 5F9EA 1W8CA 4I24A 1BKXA 4ZTQA 2GFSA 2PPQA 2OJ9A 1BUHA 1MQ4A 2FGIA 5TOZA 3V51A 4RJ8A 3FAAA 3DBQA 2V55A 3C50A 1FGKA 2OXXA 4ZS0A 4EZ7A 5J9YA 4GG7A 3NNXA 4BICA 3RMFA 3GU4A 1K3AA 4XUFA 3OCSA 5AX3A 3LKMA 2ITNA 1PKGA 2ITPA 5HZNA 5TR6A 3Q53A 4UMQA 3ZRLA 4BBMA 3TIZA 2QOBA 5E8UA 2J0IA 3R7UA 2XF0A 2C6EA 1DAYA 2XNNA 3BRBA 5AP7A 5C01A 4AN3A 4D9UA 4YO6A 2WXVA 5M4CA 5JK3A 4RZVA 3GC8A 3FZPA 2WNTA 5FTQA 1B6CB 5DR2A 3WZUA 4D4YA 1KV1A 5FBOA 5HTIA 2UW4A 2VWXA 4BWKA 5F4NA 3SOCA 1P4OA 2W1HA 4AZFA 5EM6A 3O96A 3H3CA 2AUHA 4HVDA 2X8DA 4JR3A 4D58A 4MXOA 4W4WA 3GU5A 3UG1A 3TUBA 4UWYA 3ZDIA 4AUAA 3OEFX 2VO0A 3EYGA 1H1QA 4ASDA 3L8VA 3VS0A 3MPTA 3FXXA 4KSQA 4IB1A 3NCZA 2ZYBA 1SM2A 2V7AA 3V5LA 4F63A 2YZLA 4Y46A 3DNDA 4BGHA 5CVGA 4FT0A 3TTIA 2OU7A 2B9FA 4IIRA 2XIRA 3PA4A 4O7YA 3ZLXA 3NPCA 4CYJA 3FMDA 4QQJA 2YCSA 3I0OA 3FQEA 1Z57A 1L8TA 4R3RA 3D5UA 4HJOA 4G5PA 3JUHA 1XH5A 3PVUA 5HKMA 3EHAA 4DH8A 4DG0E 3EN9A 4JAJA 2HIWA 5CX9A 1NA7A 2UZNA 4OUCA 2XM8A 4FKSA 3MFUA 4FTTA 4NT4A 4Z55A 4F1MA 4IMYA 5D1JA 2OG8A 4I5MA 2XMYA 5E8VA 2ZV9A 4DBNA 3A62A 3E8DA 3G5DA 4YJQA 4BWPA 3H10A 3LCKA 3NIZA 1CKPA 5L8KA 3L1SA 4A9TA 3DQXA 3BELA 2R3MA 3ZC6A 1H1WA 1CMKE 3WYYA 4U6RA 2J6MA 1NW1A 3T9IA 4XG8A 5IH5A 1BL6A 2PVLA 2YAKA 1G5SA 4K2RA 5LVLA 4FSZA 3FYJX 3BYMA 3EQDA 3Q6UA 5AP1A 3RI1A 5CF8A 4NU1A 4RX8A 4H58A 4QP6A 5CSWA 1P4FA 2X8IA 2YIXA 4RWKA 3OOGA 3PVWA 1ZRZA 4IQ6A 3T8OA 4WO5A 4L42A 4RJ6A 4EZ5A 5HGIA 2F2CB 4ZY5A 4FV5A 1SVHA 3TKUA 3FLNC 4WNPA 4BIDA 4FYOA 3VAPA 1WMKA 1Y6AA 3MPMA 4BZOA 3JVRA 3KXHA 4IC8A 2XNMA 4QMVA 4FIEA 3ORNA 3ZLYA 5KZIA 2WIPA 4HCTA 2BMCA 2WTVA 2DYLA 3N9XA 4KS8A 3GC0A 3Q04A 1UWHA 3NAXA 5IA4A 4DEEA 2PMLX 4YJTA 3NLBA 4UMUA 4YHJA 5LWMA 2VTLA 2UZEA 5L6OA 3FYKX 2ZV7A 4C2VA 3TCPA 3HVCA 3PUPA 2QOOA 4C59A 3VRZA 4C34A 1EH4A 3ZUVA 4FVPA 3LM5A 4YBKA 2GTNA 4ANNA 2J9MA 3GU6A 3NW7A 4BYJA 3A7IA 4FNWA 4EL9A 2ITYA 5IEXA 5A9UA 3Q4CA 5FLFA 3ZRMA 3DBFA 4KRCA 3M2WA 4WIHA 4BIEA 4TNBA 1OMWA 4U81A 4AP7A 5ETAA 2I1MA 3CY3A 3KMWA 4NH1A 3VBTA 3KXMA 4TW9A 3FLSA 4A06A 4XCUA 2J0MB 3QUDA 4U8ZA 3TJDA 4FSUA 4FSTA 3IW8A 4LYNA 3GU8A 1PMVA 1H00A 2WZJA 4FUYA 4BL1A 4L68A 2WMRA 1WBPA 3LCOA 5CF5A 3CGOA 3PY1A 4CRLA 2YM3A 2BHEA 2BILB 4QMQA 4LRMA 4UMTA 4D4RA 4GU9A 4ZLOA 4O7RA 2ITQA 4TYJA 4BTKA 5A46A 4X0MA 5EHYA 2BZJA 5JGAA 1VYZA 2GTMA 2WIHA 2BTRA 4GKHA 2BDWA 2BALA 2FVDA 2X9EA 5KBRA 2ZVAA 5HVKA 2QKWB 4DBXA 2UZLA 2IPXA 4GS6A 3HUCA 1MRYA 3EOCA 4PMTA 5FQDC 5HBJA 4J53A 4OGRA 1HCKA 3ROYA 4E5AX 4N57A 4YTFA 3TWJA 2OIQA 5HLWA 3WZEA 5DA3A 2C3JA 3QD4A 1PXKA 4R7HA 4FT5A 3HRBA 3ZO3A 4EH7A 1ZYJA 3GCPA 5HG8A 1WVYA 1GAGA 4L43A 5HO6A 5HG5A 1YI6A 3TUDA 2C6KA 2OSCA 2R3QA 5EFQA 3GXLA 4EOIA 4YUQA 3ATSA 4C37A 2YCRA 4AZSA 3QTUA 4WG4A 5HTBA 5JMSA 3CP9A 5B2LA 4YJUA 4J7BA 5E8XA 4IM0A 4WT6A 5I3OA 4M68A 4I0TA 1GY3A 4MVFA 5ETFA 4LGGA 3DS6A 3UIUA 3HMOA 3RP9A 3NWWA 4HW7A 1G3NA 5AP0A 4DG2E 4FYNA 1NVRA 4EH2A 2IWIA 5AR5A 4BZNA 3R73A 4EHGA 1M7QA 4FGRA 2G1TA 4D0XA 3IONA 3NYNA 4F6UA 4B0GA 5JEBA 4YJRA 4Q2AA 4Q9SA 2ETRA 4I20A 3BIZA 3RGFA 2QQ7A 4B8LA 3I6UA 5FEEA 4R6VA 4JIKA 4G6OA 4ZY6A 3IGGA 4L01A 3E87A 2OFVA 3Q4TA 4FV4A 3QRUA 4D2VA 4I94A 4Z7HA 4BIBA 4JAIA 4YJSA 3GC9A 2UZUE 3MTFA 4YLKA 4CFNA 1JAMA 4UMRA 4ZSAA 4HYUA 4D4SA 3CQEA 3EL7A 3VW6A 1M2RA 4D4VA 5B7VA 5L2IA 3SD0A 3TZ7A 3EQBA 3F2RA 4RVTA 4AE9A 4FIHA 3PJ3A 4RX5A 1PYXA 3ZFMA 4YZDA 3DLSA 4O0RA 1SYKA 4FKUA 4WNOA 5I4NA 2PZIA 4G9CA 2FSTX 3PRIA 3UO4A 4F0FA 2HENA 3RK7A 4ZMEA 3OS3A 3ZXTA 4E5WA 3ZM4A 2YZAA 3A7JA 3R7GA 4S30A 3KRWA 3PG1A 4ZJVA 4MH7A 3S00A 4QMPA 3ZM9A 4O1OA 4J8MA 4MX9A 2RSVA 2WMQA 5FM2A 5CZIA 2RG6A 4O7LA 3Q3BA 2HY81 2X7FA 2AC5A 4FTQA 2VTNA 4XYFA 1PF8A 4YZBA 5G1XA 4UYAA 4G3CA 2O2UA 3AMAA 3FUPA 3W2SA 1CM8A 4ZMFA 3LXPA 4ZXTA 4QP8A 3QCXA 3QBNA 4BVUA 3DFCB 4F4PA 2C5NA 4GUEA 1OM1A 3UQCA 2J90A 4F6WA 1JKTA 1ZOHA 2E9NA 4FR4A 3MFTA 2XIXA 2H34A 4TZRA 4IJ9A 3UVRA 3F69A 3QRKA 5L8JA 3WF9A 4E5BA 3R1YA 4EUTA 3VHEA 3HMNA 4JG6A 3ZO1A 5HOAA 4C3FA 3O8TA 3R8LA 1ZYDA 4BN1A 1PMNA 1E1XA 3O51A 3AMYA 1UU9A 3H9RA 2BRBA 3DCVA 4A4XA 3U4UA 3GQIA 4F7LA 3UZRA 4WNMA 5BNJA 2WFYA 1M2QA 4NZWB 5KZ0A 2OKRA 5HBHA 3FLZA 4ASEA 2UVYA 3GNIB 4RIYA 2YLEA 5CTPA 5E9EA 3MH3A 5EI8A 4O22A 5A54A 2WMBA 3OCTA 4R7BA 4K8AA 2GHLA 4G3FA 4E3CA 2W4KA 2P0CA 3LMGA 4DC2A 1GIIA 2VGPA 2UW3A 4LQMA 1GZNA 2VTQA 2R3OA 3COMA 4TTHB 4D2RA 4AT5A 2YM5A 5B2MA 5HNIX 5AUZA 1VYWA 3V5PA 3FY2A 3W18A 2C4GA 4AW5A 3N4UA 2QOHA 2C69A 3NAYA 2GS7A 2OW3A 2RIOA 1RJBA 3PXQA 4MF0A 4OBPA 4E20A 4AN2A 3RPSA 4D1SA 1IR3A 5M57A 2UW8A 3C4FA 4GJ2A 3QWKA 2C6LA 4MQ2A 4G3GA 1B38A 2VU3A 4MNFA 4U97A 2ZM3A 3RAWA 5M56A 1OBDA 3D2KA 5KMIA 2XCKA 3DJ5A 4QMOA 1Y91A 4C35A 3KF7A 2QR7A 4F9YA 2HK5A 3C4XA 1ZMWA 4V0GB 4AN9A 3DXNA 3MVLA 2QOIA 4FZDB 2WTJA 4YJPA 3IGOA 3DAKA 2J5FA 3CTQA 4NM0A 4X6RA 2Q0BA 4GIHA 3KF4A 4O82A 5FTOA 5CF4A 5E4HA 4F7NA 3TJCA 3DBDA 3COKA 3R71A 1LP4A 3QUEA 4XX9A 3NUAA 2VTIA 2JIUA 3F88A 3ZFYA 1GZOA 1G8AA 5CAVA 2HXQA 3LFFA 5I5ZA 3UG2A 1H8FA 4L52A 5ANIA 3R7VA 4AA4A 4CV9A 4FG8A 5IA5A 4BGGA 2OF2A 4RX7A 3ID6C 4MXZA 3D5VA 4QPAA 3R8PA 5KE0A 4BTMA 3NMUF 2XKCA 4O7SA 3SW7A 3V6RA 4IBMA 3SKCA 4D5HA 3POZA 3KRRA 3G2FA 5A4CA 3PA3A 4XP0A 3KKVA 4C2WA 5CAQA 3HV3A 3K3JA 2R3PA 2JFMA 5BMMA 4O81A 2HZIA 4PPCA 5EKOA 5HX8A 3ORKA 5HLPA 3IO7A 1UV5A 1DI8A 3B8RA 4GU6A 4BHNA 1IEPA 2ITZA 5GJGA 2ZMDA 3IS5A 4RIWB 3DZOA 4B9DA 4MNEA 1O6YA 3CIKA 3GQLA 1ZMUA 4WBOA 5EKNA 5IQHA 1U54A 4CKIA 3MTLA 3NUXA 3LPBA 3PJ8A 3H0YA 1AD5A 4PV0A 3FC2A 4U45A 3HGKA 4AGUA 4I6FA 1XR1A 5HNGA 4O2ZA 4FNYA 5HI2A 5I9YA 2I0YA 5TO8A 3H9OA 2YM8A 3BHUA 1H0WA 3H0ZA 3OTUA 3ZXZA 4D2PA 3GFWA 4BHZA 2B1PA 5ICPA 4F9WA 3KN5A 3PE2A 4FIFA 4ZEGA 1FBNA 2WU7A 3F7ZA 3JS2A 2WGJA 5IEYA 3E3BX 2QOLA 4AZTA 3NVKI 1Q61A 4MWIA 4AA5A 3CCNA 3M11A 3MESA 4JRVA 3RPOA 2IJMA 4FTAA 2XK9A 1XH4A 4IM3A 1UNHA 1WBSA 3G33A 4JBOA 4O0YA 1URCA 3TV4A 5IQIA 3GCVA 3OXIA 3SAYA 4RJ7A 4LV8A 4EH3A 5HG9A 3IW6A 4MBIA 3VS6A 4II5A 3V6SA 3MYGA 2YJRA 4XP2A 2CKPA 2H9VA 5CSXA 4LM5A 3HEGA 3PG3A 2XKDA 4QMLA 1PHKA 2X6DA 3RCJA 3ERKA 3UIXA 3LVPA 3LHJA 3HKOA 2X1NA 2W1EA 4IX6A 1ZLTA 1OKZA 5BUIA 2IO6A 4WG5A 3SX9A 5HU9A 2GNHA 3BQCA 3KULA 5IQAA 2XYNA 3V5TA 4USDA 4DINA 4M12A 3CEKA 2QR8A 3FL5A 2JKOA 1KOBA 3NCGA 3DY7A 4KIQA 2B9JA 2YIRA 3GBZA 4JDKA 4F1TA 4NUSA 5L2QA 4YZNA 4PTGA 3TT0A 4NK9A 3HA6A 4PDPA 5A14A 5ANDA 4RQKA 5CT7A 3C4ZA 2GHGA 1H26A 3I4BA 4FNZA 4W9XA 4F1OA 5LVNA 2GDOA 2Y8OA 4XLIA 4S32A 3BEGA 4FV7A 5C9CA 2QHMA 2UUEA 1ZMVA 2YDKA 4WRSA 3OHTA 3KB7A 3VNTA 5F20A 4FX3A 4C4HA 3UOLA 4E93A 4KWPA 4H3QA 3SDJA 2UW0A 2NP8A 4GG5A 4J52A 4EZ3A 4YURA 2GU8A 3D7TB 4AZWA 3QQFA 5CASA 4IAFA 5DLSA 1QL6A 4E7WA 4FE2A 4PDOA 4PNKA 1OIQA 4FTKA 3ANQA 4DF3A 4QP2A 4CFWA 4CVAA 2A1AB 4M0ZA 5IQGA 3VF9A 4K18A 3MIYA 4M8TA 2R3IA 2YM7A 4ACHA 4GVJA 4XV2A 4QPSA 5J9ZA 1OIRA 1Q62A 2PZRA 1JKLA 2OJJA 3KCKA 5E1SA 3ZEWA 4I93A 4ERKA 2F7EE 3IDPA 1JKSA 2YACA 2XH5A 3CQWA 4YNEA 2R3NA 3VW8A 4B4LA 5HIEA 1J7IA 2F49A 5LCKA 4IC7A 2HZNA 4I1ZA 4X21A 1QPJA 3I5ZA 3UDBA 3KXZA 3WF8A 2JKQA 1YWRA 2I0VA 3UZTA 4MXCA 3WILA 1H1RA 1JPAA 4APCA 4G34A 2CGWA 3KK9A 2RFEA 3A8WA 1F5QA 5IQCA 3AC1A 3DV3A 5CYIA 5HX6A 2IW6A 3MFSA 4GL9A 4LOOA 3UNKA 4CG9A 2PVHA 3QUPA 3FLWA 1PMEA 2X39A 4NYEA 2O63A 3NYXA 2BKKA 4DN5A 2RGPA 5LJJA 2OZAB 3ORXA 5EDPA 4E4NA 4FZ7A 4O83A 3ORZA 2HYYA 2VWBA 3IECA 4HYIA 1OKYA 4XG2A 5ACKA 3PTGA 5E8TA 5HE2A 5DR9A 4CTCA 2XNEA 4UXQA 1ATPE 4TYGA 5HVJA 3TXOA 4FTIA 1PXNA 4NKAA 2ZM4A 3UJGA 5AAGA 3BE2A 3W33A 3FQSA 3C4WA 3WZDA 1OI9A 4RMZA 3P7CA 5D10A 4YR8A 4AGCA 2GQGA 1UU8A 2VX0A 3BLHA 3WF7A 3KFAA 3MVHA 2F7ZE 5HORA 2CDZA 5KCVA 4HGLA 5IA1A 2GS6A 3EQFA 4JQEA 2HWPA 4FF8A 1WBOA 5CT0A 3ULIA 2W1GA 5J1WA 5BUJA 2UZTA 2OK1A 4LUEA 3OUNB 3P9JA 3UYSA 4P2KA 4BTJA 2R7BA 2YWVA 4JNWA 2R3RA 4X3FA 1TQPA 4I21A 5D41A 4AGWA 4HGSA 3VBXA 4BDHA 5LQFA 3WE4A 4EEVA 5ITAA 2PVNA 1RW8A 2NNWB 5FBNC 3TNWA 3R28A 3KVXA 4J71A 2CNVA 5AR7A 4BCHA 5HO7A 2VRXA 4APPA 3QA0A 5HE0A 3TZMA 1WAKA 1VJYA 2ZAZA 4RBLA 3EKKA 2XK6A 4UYNA 4MKCA 4B99A 3FZTA 4F7SA 2IG7A 3ATTA 4QYFA 3RZFA 5K4JA 1K2PA 2PZ5A 2W7XA 2XP2A 2A27A 3BV2A 4L45A 3FSFA 3REPA 4F0IA 3P86A 4TYHA 4XNEA 2ZDTA 3AC2A 4ALVA 2W06A 1E1VA 3I60A 4ZZMA 4FZAB 5CEOA 2XK4A 2GSFA 4TKSA 2JDVA 5DIAA 3HX4A 1A48A 2WMXA 2XYUA 4UWBA 2YCFA 1R1WA 4C4GA 4KB8A 3CY2A 2JKMA 4FTJA 4M84A 3ZC5A 1E9HA 4O7ZA 4FKRA 5BVKA 2GNLA 3HMIA 5HESA 5BX0A 4CYIA 4I0RA 4TWNA 4W4YA 4AFEA 4XV3A 4IACA 5AAFA 4FEVA 2XNBA 4RC3A 3VULA 4ANMA 4A4OA 4C0TA 3HAMA 1OGUA 3AC4A 2X81A 3R30A 4BYIA 3OWLA 3RZBA 4UV0A 4BCMA 3P78A 4NL0A 4Z7GA 2J0KA 3G6GA 5FEQA 2CN5A 5CXHA 5EM5A 3KN6A 1U54B 3FMMA 4FMQA 4NM7A 4X6QC 2XJ2A 5CEMA 4R1VA 2Q83A 5BYLA 2QOCA 2UV2A 4YC6A 3CD8A 4QMWA 3PIXA 5D7VA 2UZVA 3BBTB 3EQGA 5BMSA 4BCQA 4F9BA 3QKKA 4U9AA 2Y0AA 3MVJA 4IH8A 3W32A 2X9FA 4R5YA 4OR5A 5CQWA 4FV0A 3BX5A 3LW0A 3KU2A 4LV5A 4KINA 3FZRA 3BHTA 4C4JA 1MQBA 1OIYA 3UC3A 2F9GA 4F64A 3PY3A 2V7OA 5DGZA 1MRVA 2C6OA 2OZOA 4QMNA 5I9XA 3D0EA 2PY3A 3QC9A 3QYWA 4DFXE 4OTDA 5I0BA 1P5EA 2WOTA 3O17A 4R7IA 1YDTE 4DGOA 5EW9A 1M14A 1WVXA 3R1QA 4P90A 4V05A 4ZP5A 4ZZOA 2ZV2A 3IW4A 3TZ9A 4IXPA 4PPAA 3VQHA 1UKHA 5CAUA 2YITA 4FIIA 3GC7A 1ND4A 4AOIA 4XG4A 5BUEA 2C6DA 2VTMA 3HV7A 4JBQA 2WQNA 1YHSA 3PSDA 4YNOA 4OLIA 4YTHA 3VN9A 1RDQE 4QTEA 3R04A 4XBRA 5GZ8A 5IEVA 4GRBA 1DS5A 5DR6A 3CSVA 3I7BA 1X8BA 4G2FA 3W8QA 3ZO2A 5C4KA 2PL0A 2J7TA 2VN9A 2VX3A 3BHYA 4IB3A 3LQ5A 2DWBA 2VTPA 5CZHA 5CENA 3C0IA 3QX4A 5BVEA 4R3PA 4FKGA 4A9UA 4YU2A 5DG5A 3ZLSA 2QKRA 2E9PA 4GK4A 4I6HA 3NNUA 3EN4A 4IDVA 2OJIA 5DRDA 3NX8A 3PPZA 1REKA 1ZZLA 4FSRA 1Q8UA 3HRCA 4ZTRA 4RWIA 4HCUA 4P4CA 4J96A 5L8LA 3G15A 3F61A 4BI2A 4Y83A 3D9VA 5DEWA 2FSLX 2JC6A 3F5UA 4YBJA 4GCJA 4H39A 4TPTA 4G3DA 4O21A 3BI6A 4F6SA 2OFUA 3NUSA 4PQNA 1MRUA 2WOUA 2XIYA 2YCQA 4WUAA 2RF9A 2PTKA 1WBNA 1ZOEA 2YIQA 3A7FA 3ZS5A 2O5KA 1YXUA 5A4TA 2PK9A 2B4SB 4JOAA 5HCZA 4EONA 5CAPA 2VWYA 3OCGA 3R7OA 4Q9ZA 5C8NA 3BYSA 1B39A 1V1KA 1YOLA 2DQ7X 3PIYA 3QTWA 3QTZA 3QCSA 5D11A 4RVKA 2BIKB 4CMTA 4FT3A 1R78A 1OPKA 4UX9A 3HDMA 3BEAA 1ZOGA 4TXCA 2HW7A 1H0VA 1OL2A 3V8WA 3A99A 2R4BA 3QHRA 1PW2A 3II5A 4LI5A 3W10A 4NSTA 2OXDA 4X3FC 4QTBA 3P08A 5H3QA 5IQEA 3KRJA 4TRLA 3TNIA 4ZLZA 4R78A 3MS9A 5EW8A 3MH2A 4D9TA 1IRKA 3ZH8A 1QPCA 4RT7A 4DEIA 1FMKA 2BAJA 1YI4A 3WOWA 5FG8A 2JEDA 4O27B 2A19B 2IZSA 4FUXA 3R22A 1IA9A 4QQTA 3DK3A 4CD0A 2XJ1A 4I92A 3PA5A 4PP9A 5E8ZA 4NIFB 3KMUA 4TYIA 4JT3A 4PMMA 4AW2A 3GP0A 1Q8TA 2JITA 5CQUA 5JRSA 3VC4A 4RLKA 4XLVA 3CJGA 1JLUE 5CSHA 4BY9E 3LZBA 4O0XA 4AZVA 2XA4A 4XP3A 4CLJA 5IH4A 4DFNA 3ZSHA 4X2KA 2WU6A 3FWQA 4D28A 1NY3A 5IZFA 4MAOA 3T3VA 4TL0A 2RL5A 2W1CA 2C1BA 4XRJA 1WBWA 1YOMA 3PJ1A 3V04A 4BI0A 3N51A 5D7AA 3RWPA 2IW8A 3HV4A 4IX3A 1Z9XA 2FH9A 4FKPA 4BDAA 3TV6A 4RX9A 2WMVA 4FV8A 4KKEA 5DE2A 4BB4A 1YDSE 4BCJA 2VO3A 3NSZA 3SRVA 2V22A 3VBWA 3QZFA 4U0IA 2Z7RA 3OMVA 2W4JA 4I4EA 5B2KA 3F5PA 2PVRA 3S2PA 3WZKA 3ZLWA 5IF1A 3GOKA 4H3PA 4TWPA 3QQLA 4FV1A 4ASXA 4EK6A 5M08A 3CPBA 3VQUA 3FLYA 2W1ZA 5KMJA 5FDPA 2R3LA 3AT4A 2O64A 2OLCA 3GGFA 4DHFA 3BLRA 3K3IA 3Q9ZA 1WBTA 3B8QA 1ZYLA 3MV5A 2ERZE 5FTGA 2WTCA 5GIPE 3F7WA 3PP1A 5C03A 4K0YA 1H1PA 4JX7A 4O6EA 2GQRA 2EWAA 2I7QA 4E8AA 4AU8A 3R9OA 4QMTA 3SV0A 3DK6A 2CNQA 2PVMA 4B8MA 4WRGA 3IDCA 3U9NA 1ZXEA 3B2TA 3D5XA 4TYHB 4BKJA 3ZMMA 2NPQA 2R3KA 2UZDA 5C8KA 3W16A 5L2TA 4CCBA 2WPAA 4BDFA 4HVGA 5DBXA 3OUKA 2F57A 3IK3A 2H6DA 4Z3VA 3QWJA 5K9IA 5TE0A 5LXMA 4IB0A 4KBKA 2BPMA 3DBEA 3M1SA 4WD5A 1U5RA 3ORPA 5TT7A 2VTOA 1JBPE 3NNWA 3K54A 4HPTE 2J50A 3FC1X 5KMKA 2BFYA 4NW5A 4H1JA 4E6DA 3QRTA 4B6LA 4DCAA 3TUCA 5DH3A 2H8HA 3FMKA 3D83A 5JGBA 5EYKA 3C5UA 3FKNA 3FJQE 3FPMA 5HO8A 4CFFA 3C13A 3U8WA 3EH9A 3EMGA 1QMZA 3LXNA 4AOJA 3PFQA 4N6YA 2C1AA 1LEWA 4GT5A 2CN8A 3RM7A 3RNIA 1JSTA 3L9PA 3LFEA 4QYHA 4LL0A 3VS4A 2BRGA 4AS0A 4IW0A 3EYHA 2WMAA 4FTLA 1OVEA 2Z2WA 5AM6A 4AZEA 3R7YA 3DBCA 4U7ZA 1H25A 4CG8A 2PVKA 3PVBA 4U3ZA 4O0VA 4G9RA 2J2IB 4IWOA 2J0LA 3TACA 5JH6A 3F3TA 3P79A 5J7HA 4D5KA 5CXZA 5HU3A 3E64A 4FVRA 5FWKK 1NVQA 2FYSA 2PMNX 5AIRA 5C8MA 4YSJA 1WBVA 4IFGA 2REIA 3NUNA 5EG3A 2C0OA 2WHBA 3ALOA 3BU6A 2C6IA 3QZHA 4RGJA 1XQZA 3BHVA 3OY1A
chains in the Genus database with same CATH superfamily
2A0CX 2P55A 4RPVA 2JIIA 4QMSA 5K4IA 4U79A 3I5NA 2XK3A 3LFDA 3UNJA 5AX9A 3ACJA 1KE5A 2BTSA 4JQ7A 3QGWA 3CD3A 5FEDA 5I9VA 4G6NA 3MVMA 5EDRA 4BCFA 2QONA 1CDKA 3MGYA 2BCJA 3MN3A 4M13A 3UVPA 4CRSA 4D0WA 4EOKA 5BYYA 2IZTA 3IOKA 2JKKA 3A7GA 5FP6A 5I9UA 3QALE 2BRHA 4HVSA 3I1AA 3LFSA 3C51A 4CZYB 1XHAA 3ZCLA 1W83A 3HA8A 3NYOA 4PF4A 1U4DA 3ZSIA 4MXAA 2B9HA 2PWLA 3QQUA 4RIXA 3HNGA 2YERA 3OWJA 4NJDA 4CFUA 4FKVA 1OL1A 1OZ1A 4M7IA 4O2PA 4IHPA 3FHRA 3BCEA 3RKBA 3ZFXA 4O7WA 5M44A 5FXSA 3LCSA 2X7OA 5HHWA 5K5NA 5FM3A 2BRNA 3QF9A 5EQPA 1YWNA 3UOKA 4IWDA 2OJGA 4AF3A 3OY3A 3CKXA 1T46A 4LG4A 5AR2A 5JQ8A 4HVHA 4QMZA 1FVRA 3O0GA 1XO2B 2XALA 4RWJA 4AGDA 4GT4A 3MY0A 2PHKA 5AMNA 3HMMA 4AE6A 4E1ZA 3C5IA 2G2IA 3COIA 3TM0A 3RPRA 4WOVA 4BGQA 1Q99A 4J97A 4I6BA 2HWOA 2C30A 2GNIA 3FMJA 2EVAA 4DGLC 5L6PA 3BGPA 4LOPA 4PTCA 4BJJB 2XK7A 5C26A 1GZ8A 1JOWB 4CTBA 5A4LA 3A60A 1TQIA 3HECA 3NZ0A 3DDPA 4KNBA 3ZUUA 1FINA 2GNFA 2CGUA 2BZIB 3LXLA 4ITJA 3KXXA 4IAAA 4QMYA 4ALWA 2VWUA 2PVJA 4HZRA 3F5XA 3QCYA 4RVMA 4IVCA 3U9CA 2IVUA 4C36A 4HNIA 4KBCA 4BF2A 1BX6A 4XG7A 3UE4A 4C7TA 3TKIA 2J5EA 2WD1A 3SG9A 4DGGA 4HPUE 4NTSA 3UYTA 4QP4A 3VS5A 4O7TA 3DNEA 3UO6A 4BFMA 4EH4A 3G0FA 1ERKA 2ITUA 3NUYA 5A4QA 3KQ7A 3UIMA 4C8BA 2KULA 3OVVA 1J1CA 4G3EA 3FI2A 4NFNA 5FGKA 3I7CA 4O7VA 5E91A 1YOJA 4I5HA 4RJ3A 4ANOA 3IOPA 3P1AA 4C61A 3W0RA 3Q2MA 4N6ZA 4RIOA 3UDTA 3DLZA 1Q24A 2HXLA 5K0XA 4ACCA 3OT8A 2R3GA 3AC3A 1TQMA 4XRLA 3VS1A 3P5JC 4GFOA 4FZ6A 4IZ5A 3V5JA 1JWHA 4DE4A 1TZDA 5FRIA 2HOGA 3ENHA 4EYMA 1YW2A 5I9WA 1CSNA 1OPLA 3AC5A 5CEKA 2ZB1A 2IVVA 1XMLA 5EYMA 1BYGA 4FL3A 4QTCA 4PDYA 2P3GX 3R9RA 4DFBA 4PX6A 2XEYA 5AA8A 3DKGA 4EKKA 4A07A 1PRYA 5FUTA 4ZTLA 1OECA 2Y4IC 5CNNA 5AAEA 5GIOE 2ONLA 5AADA 1LEZA 1JQHA 4AW0A 2W1DA 1LUFA 3WE8A 4AA0A 3VJNA 5JQ5A 4NM5A 1OKWA 2XS0A 3VF8A 3JY0A 2VWIA 3M42A 4KUJA 5JFXA 1XH8A 1BI7A 1SMHA 5JKGA 2Z8CA 1YXXA 2FSMX 2ITOA 4QDEA 2VTHA 3GVUA 2VTAA 2PUUA 4OAVB 3MJ1A 3PYYA 4FEXA 2Z7QA 1KWPA 4PL5A 4HOKA 4XOZA 4R3CA 2CGXA 5GINE 3ACKA 2F7XE 3SXRA 4B7TA 4F9CA 4H36A 4EWHA 2Z02A 4O4BB 3ETAA 3LE6A 2W5BA 5L2WA 1S9JA 5EM8A 4C3RA 4CFXA 2BRMA 5CU3A 2O0UA 1ZY4A 3ZUTA 4HVIA 1PY5A 2BDJA 4DEHA 1YKRA 1YI3A 4RFYA 5IUIA 3D94A 4IAYA 4NCTA 5IA2A 4YC3A 4L6QA 4L67A 4Y8DA 2PZPA 4FL1A 2VV9A 3QD2B 3VO3A 1PKDA 5AP4A 2ITWA 1OKVA 4IFCA 5KHWA 5IPJA 4RC2A 3VUGA 4H1MA 4E6QA 3TNHA 3G51A 5CI6A 3QZIA 4ZSEA 2C0IA 4M0YA 5IQBA 3O8PA 3PLSA 5HCYA 4FZFB 2O8YA 2W5HA 2WMWA 3OXTA 2CLQA 3F3WA 2B53A 1TKIA 4BDEA 4IDTA 2VNWA 4QPMA 2R64A 3QD3A 5AM7A 3AOXA 4YMJA 2WAJA 3NS9A 1NVSA 4L46A 4X2NA 3SOAA 4C33A 4BDIA 2WEIA 3QX2A 3D15A 3PJCA 5E8YA 4FG9A 4GYIA 2W1IA 3OP5A 1H24A 4PNIA 4D2TA 4JIAA 1ST0A 4DAWA 5J95A 4FGBA 3R7EA 1J91A 3BBWA 2A98A 1YDRE 4K6ZA 3BL7A 2QVSE 5J7BA 3EL8A 3Q6WA 3U54A 1U46A 4EOQA 4O86A 4LOQA 5BVOA 4G17A 4KIKA 3SC1A 4XEYA 5K0KA 2O65A 4D2SA 5J8IA 3AGLA 2ZB0A 3E5AA 2J0JA 3P4KA 3S3IA 2XANA 2R5TA 3L8PA 4RA5A 2I0EA 2NO3A 4U41A 3EN7A 4XG3A 3NVMB 2Y9QA 4EQUA 2ZJWA 3MI9A 4C3PA 4CLIA 1OL6A 2BZHB 4PMSA 4P5QA 3I81A 4ONAA 1QPEA 3ZBFA 4XHKB 5EI2A 2AYPA 3PSBA 3BL9A 3QLGA 4L7FA 3OF0A 3FMHA 3AKLA 4C62A 1JNKA 4FV2A 2W9ZB 3VUDA 5E92A 4YZ9A 3MFRA 4CEGA 5LWNA 4OTFA 2QU6A 2W05A 3N4VA 2C3KA 4M3QA 3QU0A 4IM2A 3BWJA 2QOQA 3HUBA 1YQJA 3CGFA 1BLXA 2O3PA 2OJFE 2PE0A 4FKOA 4XV9A 2YWPA 3QKLA 5T6KA 3RNYA 3R1SA 5FXRA 5I9ZA 4BCGA 2CPKE 3FSKA 3HLLA 1SNXA 4QNAA 4TT7A 3RHKA 4GW8A 5AR8A 3W8LA 3GCQA 5E7RA 4GT3A 4MTAA 2WTIA 3KRLA 3PPKA 5DT4A 3W2RA 3PDTA 3V5WA 1ZYSA 2XKFA 4OTHA 4D1ZA 3PY0A 3AD5A 4O6LA 3NFFB 3F5GA 2HZ0A 3WIGA 4BCOA 4E26A 2PUIA 2CMWA 4RJ5A 4CFMA 4ZIMA 3R21A 5KUPA 2VTJA 4LMNA 1SVEA 2R0IA 4YHTA 4CFVA 2YM6A 2Z7LA 3W1FA 1YVJA 3LLAA 1KE8A 5GHVA 3F82A 3Q9XA 3COHA 5FP5A 2OIDA 4I5PA 4FSWA 4RIYB 2XKEA 5EHLA 5CLPA 5EHOA 2YISA 5M55A 2JAMA 4U5JA 5BYZA 4EBWA 4WHZA 4EK8A 4G6LA 2C0TA 3SVVA 4L7SA 5CF6A 4YJVA 1OL7A 4A9RA 1XBCA 5H9BA 2YHVA 1UKIA 3ORMA 5HLNA 2YM4A 4R8QA 4IE9A 3RM6A 4DDIA 2ONLC 3WF5A 2WQMA 2WMTA 4FT7A 4Y72A 2JLDA 3NFGB 3NUUA 1W82A 4JXFA 3DJ7A 2HZ4A 2X2MA 4KKGA 3MW1A 4Y5HA 4GFMA 3SW4A 3DKCA 3QTRA 4QNYA 4D2WA 2QOKA 2QU5A 1SVGA 1XH7A 2VX1A 4O0TA 4EHVA 2XVDA 3U6JA 4M15A 3Q5IA 3OBJA 3RVGA 4KAOA 3C4EA 1QPDA 4DFZE 3ANRA 3TDVA 3L9NA 1ZARA 3MY5A 3NYVA 2C5VA 2KTYA 3UODA 4ZY4A 5BVWA 4LFIA 4CMOA 4BCNA 5J5SA 2WELA 4I3ZA 3OEZA 5JFSA 4GSBA 3DA6A 5AP5A 2H96A 1APME 3D2IA 1M17A 1OB3A 1UWJA 4DT9A 4UZHA 2G2HA 3VBQA 1L3RE 4ENYA 3U51A 3OD6X 4A9YA 3KK8A 3B2WA 3FXWA 5LVMA 2BVAA 2Z60A 5T68A 5M4IA 4MD8E 4EHZA 3PLAE 2C5XA 5HE3A 4CQGA 2X6EA 3UIBA 1GZKA 3EFWA 3IDBA 4NCTC 4ERWA 2SRCA 1UU3A 3GFEA 3PVGA 2UZOA 2XNGA 3MPAA 3A2CA 4RRVA 3EZVA 3LIJA 4U40A 4ZSJA 2XIZA 2HW6A 1YHWA 3QA8A 4TY1A 5HQ0A 4K9YA 4MXXA 3OW3A 4MF1A 3UPZA 3VHKA 2YIWA 1QCFA 2JD5A 3I0QA 3EKNA 2VAGA 4RLLA 2LAVA 3ROCA 4S2ZA 1KV2A 2QI8A 4I5CA 3R8ZA 4MWHA 4OBQA 5CEPA 3DKFA 2ETKA 4EOMA 2QG5A 4FKQA 3SLSA 3EQIA 3FL4A 5DHJA 4ZTSA 3W0MA 4O84A 4O0UA 4DH1A 1I44A 1DM2A 4OBOA 5AEPA 3O50A 5LMKA 4QP3A 2CCIA 4BCIA 2EU9A 4BWXA 5KBQA 3P0MA 1WFCA 2VUWA 5HD4A 4BZDA 3LLTA 5GZ9A 3O7LB 3UQFA 4CKJA 2JGZA 3AG9A 4WSQA 1NXKA 3AD6A 4UXLA 4MNEB 4RJ4A 2EXCX 1R0EA 4U80A 3OCBA 4WG3A 5C27A 1W0XC 3L9MA 3VBYA 1P14A 4O1PA 5B0XA 4L8MA 3V01A 5IH6A 5IQDA 1OUKA 2AC3A 3RALA 2FO0A 2HELA 3GT8A 4BBEA 4FV9A 3HAVA 2W0JA 3CS9A 4ZZNA 3D14A 3QXOA 4ZTHA 4EORA 2PVFA 4FSMA 4MXYA 1XH6A 4EOPA 1FPUA 2JDTA 1SNUA 2ITTA 5DPVA 1PXJA 3BZ3A 5DN3A 1YRPA 4YP8A 1Q3WA 4JBVA 5M51A 4BCKA 4UALA 3QHWA 4QOXA 2B55A 3L8XA 4MBLA 4Y73A 4HGTA 5EW3A 3KGAA 4A7CA 4F99A 3IG7A 4JG7A 4H05A 1WCCA 2UZBA 3C1XA 4CT2A 4YHFA 2FUMA 5ANEA 3ZSGA 3LFAA 3Q9WA 4ACGA 3KVWA 4ALUA 4QTAA 2W4OA 3QL8A 5ETIA 5AUVA 4XH6A 4BDJA 4EC8A 3G90X 1JKKA 4J1RA 4F08A 5D9HA 2VWZA 4RZWA 2ZV8A 1W98A 3HMPA 3LXKA 3ORTA 3ZU7A 5IDPA 1F3MC 2C6MA 1G8SA 3R0TA 4D55A 5TF9A 3SHEA 3UP7A 3F3UA 2WQOA 3NW6A 4K1BA 3H30A 5AR3A 2BAKA 3A7HA 4O0WA 4FK3A 3MB6A 5CSPA 4EWQA 2YDJA 4NWMA 1H4LA 2C3LA 5CEQA 4AWIA 3TKHA 3FKLA 4UZDA 4TNDA 3R9NA 4RA4A 1WVWA 3OWPA 2E9VA 4IAZA 1IAHA 3CJFA 5LVPA 2XJ0A 3BGZA 4E4LA 2WB8A 3JR1A 3UTOA 5J79A 2OICA 5A4EA 4LGDA 4YZMA 3PE1A 3MH1A 3T3UA 4JDJA 3DTCA 4KIKB 4YO4A 5L2SA 3W0OA 4U43A 1PXPA 3KULB 4DFYA 3E7VA 5HICA 4DLIA 4QTDA 4X7QA 4M97A 3R8UA 3UO5A 4GJ3A 4ID7A 3Q2JA 3BU3A 4M14A 5CS6A 4GUBA 1J7UA 3I6WA 5FXQA 2VO6A 2UW5A 4JG8A 3ZRKA 4RVLA 4AXAA 1K9AA 4IX5A 4W8EA 1LR4A 2XEZA 3QTSA 4J8NA 3ZTXA 1VLRA 3FMNA 2J4ZA 1S9IA 4W4XA 5CU6A 4EYJA 3WARA 3FI4A 2CSNA 3HP5A 3MH0A 5T3QA 1I09A 4FKTA 4XV1A 3CXWA 4QRCA 5EYCA 5H8GA 3FE3A 3RWQA 3S95A 3DFAA 3P7BA 4FG7A 4G1WA 3EQRA 4QP9A 3E63A 3O23A 4DG3E 2E2BA 4DLJA 4JQ8A 2G15A 3RTPA 5AV1A 2PMOX 4IJPA 4DFLA 5HVYA 2EB2A 3GCUA 3RK5A 3S4QA 3LQ3A 4EH8A 4FVQA 2ITVA 3FV8A 3CBLA 2IVTA 4BDBA 3UQGA 3O71A 3R83A 3AT3A 4Y5QA 4QD6A 4O7NA 4DA5A 1CKJA 1O6LA 4PTEA 1YXSA 1UVRA 2HAKA 1U59A 3OTVA 1OUYA 3BKBA 3ZDUA 3C7QA 1Q8WA 2A2AA 4IZAA 5AP2A 5BVDA 4EI4A 5EM7A 1GJOA 4DGMA 1IASA 4ITHA 2VTRA 5HG7A 4F70A 3R9HA 4DFUA 4DTBA 5LCJA 3PWDA 3LAUA 2Y6OA 2ESMA 3KRXA 3LFQA 3EIDA 1KE9A 3K2LA 3NEWA 5AUWA 4V04A 3W0NA 4DEBA 2ITXA 2RFSA 2WO6A 4S31A 4DEDA 3THBA 3BHHA 3QFVA 5K5XA 5CNOA 4FTCA 1BMKA 2FSOX 5EOBA 1R0PA 4LV7A 1FMOE 3LCTA 5ANGA 5LMKC 3D5WA 2HY0A 3ZZEA 5AP3A 2V5QA 3A4PA 3W2PA 4ANBA 4FKWA 3BGQA 4IADA 4IZ7A 4V0GA 4FEUA 3PIZA 3LJ0A 3SXSA 2P4IA 4OTQA 4YC8A 1VZOA 3LFNA 4WBBB 5AJQA 4FA2A 2QG7A 4R5SA 2R3FA 1OIUA 4O96A 3GI3A 4RSSA 3TZ8A 4QYEA 2RFDA 3BWFA 4EKLA 4AXFA 4Y95A 4EH9A 2B54A 4C57A 5EQEA 4MHAA 5LVOA 2B9IA 4FSNA 1CKIA 3QQHA 3F3VA 4QMXA 4C58A 2B0QA 3U55A 4OT6A 5HCXA 1ZY5A 5M07A 5IKWA 5DEYA 5E90A 2YIYA 2WQBA 4A4LA 3AKJA 1PXIA 2R9SA 3ZYAA 2PZYA 3VUKA 3LFBA 3O7LD 3GOPA 3SQQA 4E6AA 3S1HA 2VO7A 2BFXA 3JY9A 5KKRC 5A3XA 3FQHA 1ZAOA 4K33A 2V62A 2IZRA 3AD4A 4X3FB 3KEXA 3Q32A 5JN2A 1V0OA 2J51A 3V8SA 4E4XA 3ZO4A 3TN8A 3ZEPA 4IZYA 5A6OA 3C4CA 4LL5A 4M69A 3QQGA 3C0GA 2PULA 3QQKA 4KD1A 4R77A 2VZ6A 2X4FA 5AP6A 5BQ0A 4LRJA 2OI4X 2CGVA 3QGYA 2I0HA 1HCLA 3BPRA 2WMUA 5J87A 3P5KA 5E8SA 5DRBA 5CAOA 1PXMA 3UVQA 3VS7A 3HRFA 3NUPA 4S33A 5KMNA 5CWZA 3WYXA 2G9XA 2IW9A 4OTPA 3V3VA 4RIWA 1CTPE 1W2CA 4OTWA 3W2CA 2CCHA 3EN6A 3ZOSA 2C68A 5L4QA 2W17A 4UWCA 4ENXA 1VR2A 1O6KA 2XNPA 2YN8A 3DJ6A 5BVFA 3NR9A 2RKUA 4O38A 3PXZA 3TI1A 3FDNA 1PYEA 5ACBC 4JRNA 2C3IB 4Q5HA 3CPCA 3R9DA 3RCDA 5BVNA 4RG0A 5CALA 2FA2A 2W99B 2V0DA 3NDMA 2YLFA 3FZSA 3UMXA 4FKIA 3C9WA 1J7LA 3DXPA 4FV6A 3R00A 4I23A 1A9UA 5GJFA 3BU5A 4GVAA 2Q0NA 4QQ5A 2CKOA 4X3JA 5CANA 1UA2A 5KKRB 2UW6A 2CJMA 1FOTA 4TN6A 4YTIA 3MA6A 4FEQA 4I4FA 1H1SA 4JI9A 2IZUA 3MIAA 3VUIA 3UOJA 4GKIA 4IAKA 4L9IA 4L00A 4ZTNA 4BDDA 5GZAA 5JGDA 3BLAA 1W7HA 3BYUA 1RE8A 4QYGA 5IQFA 4KABA 4BRXA 2VGOA 3RAKA 4ANSA 3JVSA 4X2JA 3LMHA 4N4SA 2R0UA 4MQ1A 4CNHA 3UZPA 4RC4A 2R3JA 2UZWE 3GENA 3QC4A 4UEUA 4DCEA 3DKOA 4QQCA 3OG7A 4I41A 1XWSA 1H01A 3OFMA 2NYAA 3G0EA 1PXOA 4E6CA 4F0GA 2P2HA 2R2PA 4WSYA 2JBPA 2X2LA 2YA9A 4EJNA 3TMOA 3KY2A 1GIJA 3PXRA 5EOLA 2A4LA 4X2GA 1URWA 3QRIA 1XBBA 4MK0A 4JMQA 3PSCA 4JBPA 4RWLA 4X2FA 2WTWA 3HV6A 4JDIA 4KA3A 5AUXA 1Q8YA 4EBVA 2QO9A 2PMIA 1STCE 4PUZA 2VD5A 2GHMA 3F6XA 4FOBA 3IW7A 5AFVA 3ODYX 4NFMA 3LJ2A 4L3JA 2PUNA 1GNGA 4DTAA 3L9LA 5EQYA 3W0PA 2B52A 5LMAA 2OO8X 3FI3A 4EK3A 1GIHA 1YXVA 2QCSA 2XNOA 3NW5A 5HIDA 3RPVA 3IPHA 1H27A 4FT9A 2PE2A 2QC6A 3MDYA 3GEQA 3JXWA 5KO1A 1ZYCA 2UW9A 4W8DA 4JR7A 3W55A 3KXNA 3MSSA 1GOLA 2F4JA 3QRJA 2E9UA 5IU2A 3D7ZA 2BIYA 2JFLA 3G6HA 3MY1A 3E62A 4FV3A 4FOCA 3ITZA 5M53A 3VUHA 4QMUA 3WBLA 5ANJA 2GNJA 3DZQA 5KX8A 4WKQA 2CLXA 4AAAA 3UNZA 4CT1A 1O9UA 3JPVA 4HNFA 4PMPA 3D7TA 3T9TA 4L44A 2OF4A 4BC6A 4CZTA 4AAYA 2RFNA 1FQ1B 3QQJA 4KS7A 2YAAA 2R3HA 4NTTA 5EYDA 5GNKA 3UPXA 4E73A 4EUUA 4RFZA 1U5QA 2XRWA 3R1NA 2X0GA 3CTHA 4EOLA 4GV1A 5M09A 5ETCA 5LOHA 5E8WA 1XJDA 3VBVA 2R7IA 2OH4A 2UVZA 3OXZA 4C02A 5HBEA 4CGAA 4DYMA 5M4UA 3RJCA 3SG8A 5AV2A 3RHXA 2DS1A 4L3LA 5CVHA 1H28A 2C5OA 2P2IA 4ZSLA 3QXPA 3RPYA 3QLFA 1J1BA 4NW6A 4S34A 3BYOA 4IWQA 4RQVA 4DT8A 5AV3A 5EDQA 1DAWA 3CQUA 4ZSGA 5J5TA 4QEBA 3DAJA 4EK5A 3UGCA 4FL2A 2I6LA 3OROA 2XZSA 4XJ0A 3KMMA 4H3BA 4EQMA 5IUGA 4EC9A 4BDCA 2ETMA 5DI1A 1IG1A 4GH2A 4K11A 2OWBA 5AWMA 4XOYA 2Y4PA 2C6TA 4HYHA 3Q9YA 3EQHA 3FMEA 5DNRA 4WNKA 5C4LA 4M67A 4J99A 4PL4A 4J98A 1R39A 4FSYA 2QO2A 5CVFA 5F1ZA 4AQKA 4U42A 3BQRA 1IAJA 3KXGA 4MCVA 4HZSA 4XG9A 4FKLA 1ZWSA 2OZAA 1Y8GA 3WIKA 3U4WA 3VVHA 4G16A 4GFGA 2WTKC 5EH0A 5CY3A 4F65A 3ELJA 2XM9A 4DGNA 2Z7SA 2CKQA 5ANKA 5FD2A 5JRQA 1HOWA 4F78A 4N70A 3BV3A 2LGCA 3OC1A 1Q5KA 2QLUA 4GIIA 5DOSA 5AUUA 1OBGA 3FZ1A 3EFKA 4FI1A 4Y85A 1Q97A 4GK2A 4YLLA 2GQSA 5HD7A 2QD9A 5HIBA 4XBUA 3NIEA 3FPQA 2QODA 1R3CA 4HGEA 3CLYA 1OITA 2QNJA 4IAIA 3EJ1A 5H8BA 3MBLA 5K3YA 3ZHPC 5LMBA 4K77A 1J3HA 2PE1A 3GUBA 4EOOA 3EFJA 4ZOGA 3JYAA 4UB7A 2GS2A 2VWWA 2QLQA 3RINA 2XIKA 4DH7A 4E4MA 3Q96A 2UVXA 3QYZA 1AGWA 1KSWA 3E8EA 3FBVA 1KE6A 3BYVA 4F7JA 5JSMA 2HCKA 4C4EA 3OT3A 5M06A 4YJNA 3ODZX 3EZRA 3Q4ZA 3QKMA 2OGVA 3DT1A 4BBFA 2B7AA 5DMZA 3UDZA 2YABA 3E93A 3POOA 1Y8YA 4I22A 4FTUA 3SRVB 4IVAA 4P7EA 5AA9A 2XK8A 4MD9E 3ORLA 3QD0A 1AQ1A 4BDKA 4OTIA 5HEZA 2OH0E 4Z16A 4PL3A 1XH9A 2PUPA 2VTSA 2JDSA 2ZFYA 4HCVA 4WUNA 3MJ2A 3F2NA 3P7AA 4D1XA 5DWRA 1XBAA 2BHHA 5IMXA 3ZONA 3O2MA 4YTCA 4WA9A 3FXZA 1OL5A 5ANOA 4FBXA 3N4TA 2WTKB 5CU4A 3FMLA 4FKJA 3PZHA 4M69B 3R7IA 3UBDA 3PXYA 4Q5EA 4AG8A 3E92A 3SA0A 3LJ1A 1PMUA 4BCPA 4AW1A 3F9NA 4EOSA 3O8UA 5M4FA 4DEAA 3H9FA 3DTWA 4YGAA 4XMOA 3DDQA 3PXKA 4FICA 4USFA 2WTDA 4YLJA 3K5UA 2Y6MA 4AT4A 3QTXA 3A8XA 1REJA 3AGMA 3ALNA 3CR0A 3FHIA 2Y4IB 3EQPA 1Q3DA 3GCSA 4G31A 4PWNA 4KKHA 3LMIA 1JVPP 1F0QA 3F66A 3R8VA 2PVYA 2P33A 2OBJA 3F3ZA 3ULZA 3UP2A 4EJ7A 2XBAA 5CU2A 3GU7A 3EQCA 2EXMA 3Q4UA 3EWHA 3G9LX 3IQ7A 2BZKB 3R2YA 3Q5ZA 4YJOA 4UN0C 3H4JA 3ET7A 2JDRA 4JDHA 4TWOA 3C0HA 2EUFB 2QO7A 4XS2A 5IG1A 3NRMA 2CNUA 1IA8A 1JSUA 2OIBA 3AT2A 1OPJA 5G6VA 3SGCA 4QO9A 2XAOA 4QDVA 4O91A 4DTKA 5KMLA 4KSPA 3A61A 1KE7A 4FTMA 4IANA 4C4FA 5E1EA 4LUDA 4RFMA 2JIVA 2XRUA 2XB7A 3ENMA 1FVVA 4KIOA 5HTCA 4ASZA 1YHVA 4QP7A 3VRYA 2XCHA 5CSVA 5DT0A 4LRKA 1BI8A 3RK9A 5IA0A 4UBAA 5FDXA 3TDWA 4C4IA 3DB8A 4BI1A 4AX8A 2C5YA 4R1YA 3TNPC 4AOTA 5CEIA 4JL9A 2JBOA 4I0SA 3DAEA 2EXEA 4FTOA 5L3AA 4OTRA 2X8EA 5HNBA 4C38A 4CSVA 4DITA 4XG6A 3UOHA 3S0OA 1Y6BA 4MEDA 3WZJA 1XKKA 2BR1A 4TYEA 2G2FA 3EN5A 1Q8ZA 3ORIA 4PPBA 2QHNA 1NT2A 4KBAA 4ZTMA 4GK3A 4JS8A 4RIXB 1YXTA 3R01A 2GNGA 4AT3A 1UNLA 1WZYA 4DH3A 1M52A 3R02A 3EB0A 3L8SA 4DEGA 4OAUC 5DYJA 2W5AA 2PSQA 1LPUA 1P2AA 2BROA 1VEBA 4MD7E 4PRJA 4QT1A 4USEA 4YSMA 4L53A 3FI8A 4FTNA 3TIYA 3QAME 4JLCA 5CU0A 1UNGA 1W84A 4FIJA 4LMUA 3FEGA 3G9NA 3VONA 3OW4A 4FSQA 1T45A 3U87A 4A9SA 4EK4A 2ERKA 3P23A 2ZMCA 4MBJA 5KNJA 5AV4A 4P5ZA 4O4CA 5GJDA 1H07A 2IVSA 4UY9A 5F94A 2WKMA 2DUVA 4QYYA 4W4VA 5C1QB 5AV0A 3NNVA 5JZJA 4IVBA 2XBJA 4ZS4A 2BKZA 1M2PA 2YDIA 1Q41A 3DQWA 2G01A 3E7OA 2UW7A 3GB2A 3PPJA 4IWPA 5IUHA 3OWKA 4MYGA 3TG1A 3V8TA 3WF6A 4G5JA 3VWAA 4OT5A 3AMBA 4J95A 2OXYA 1V0PA 3PJ2A 3DU8A 1SZMA 5TKDA 2X2KA 5EI6A 4ZJJA 1Q4LA 1A06A 3DB6A 3FKOA 3VS3A 5KMOA 1Z5MA 2ZOQA 3HYHA 4NM3A 4PP7A 4ACDA 2ACXA 5H8EA 3QTIA 3EFLA 4UMPA 4EOJA 3Q52A 3KC3A 2I40A 4HYSA 4FK6A 4Z9LA 3TNQB 3F2AA 5CI7A 3VJOA 3U6IA 1KUTA 4QMMA 2NRYA 3D4QA 1FGIA 3KL8A 4ZJIA 5IDNA 3AQVA 5H2UA 1UU7A 4OW8A 5AUYA 4L3PA 4NKSA 4KRDA 2F2UA 2PYWA 4BTFA 5L6WL 3TEIA 3TTJA 1JSVA 5JFVA 4AQCA 3ZBXA 2WQEA 5J1VA 2QURA 4JJRA 4YPDA 4ACMA 4ARKA 5AUTA 3U6HA 1OGYA 4IVDA 1KOAA 3A4OX 4NIFA 2BAQA 4ITIA 4AACA 3CTJA 3KREA 3R63A 2GMXA 3E3PA 4NEUA 3FLQA 3MB7A 4PDSA 3RAIA 4BDGA 3PP0A 4GEOA 3ZZWA 4OTGA 3FZOA 1TVOA 5J9LA 5AIKA 1YWVA 5DVRA 4CKRA 3TV7A 3R8MA 3BE9A 3E88A 5D12A 3E8NA 3UC4A 4CV8A 3BLQA 2W9FB 4F9AA 4JX3A 3LCDA 4ANQA 3RAHA 2W96B 3DPKA 4QP1A 2IN6A 2EB3A 1DI9A 3K5VA 4EHEA 3PWYA 4KIPA 4U3YA 4IEBA 3VUTA 4AFJA 2XUUA