4AWYB

Crystal structure of the mobile metallo-beta-lactamase aim-1 from pseudomonas aeruginosa: insights into antibiotic binding and the role of gln157
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
270
structure length
270
Chain Sequence
b'ASRGCADDAGWNDPAMPLKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEEAATS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METALLO-BETA-LACTAMASE AIM-1
molecule tags Hydrolase
source organism Pseudomonas aeruginosa
publication title Crystal Structure of the Mobile Metallo-Beta-Lactamase Aim-1 from Pseudomonas Aeruginosa: Insights Into Antibiotic Binding and the Role of Gln157
pubmed doi rcsb
total genus 97
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4awyB00
3BC2A 4J5HA 3X30A 2BGAA 4JO0A 4YSBA 4U4LA 4B87A 3FAIA 4AWZA 3ADRA 4AD9A 3DHAA 3I0VA 2BR6A 5EHTA 5ACUA 4UWRB 3IEMA 3H3EA 5LM6A 4UWOB 3RPCA 3WXCA 5ACRA 5AXRA 5HIOA 2BTNA 1BVTA 1XM8A 3F9OA 1KR3A 2UYXA 3AJ3A 1L9YA 2P97A 2P4ZA 1X8HA 2WYMA 3BV6A 2GCUA 3I13A 5FQBA 5K4NA 2VW8A 3DH8A 2GFJA 2ZO4A 5HH6A 1ZNBA 2QINA 4ZO3A 2BFLA 4GYQA 1BC2A 2GFKA 1XTOA 5LCFA 3IOGA 3S0ZA 3MD7A 3VQZA 2DKFA 2BG6A 2QDSA 4TZFA 3T9MA 4ZEJA 2P1EA 4PVTA 1A7TA 3R2UA 2YZ3A 2BFKA 4XWTA 4Z5YA 4ZNBA 5FQCA 4WD6A 2WYLA 4UA4A 1KO3A 1E5DA 5LS3A 2FHXB 2XF4A 1M2XA 2QDTA 4YSKA 1P9EA 3JXPA 4C1DA 3T3NA 5K4KA 3AF5A 4EXSA 3SFPA 4D1UA 4EFZA 5LLDA 1VGNA 4UWSB 2GKLA 2M5CA 1VMEA 4C09A 3BK2A 5EVKA 4TZEA 3I11A 1K07A 4C1HA 2Y8AA 4J5FA 3TP9A 2YNVA 4D1TA 1Y44A 3QH8A 5KILA 2Q0JA 5EW0A 2FU8A 4RAWA 5EVBA 4TYFA 2QJSA 4O98A 3RKKA 4D02A 1WUOA 2AIOA 1DD6A 5AXOA 5LCHA 2AZ4A 4AX1B 2Q42A 5EH9A 3IE2A 2Q9UA 3KL7A 4D1WA 3I15A 4UAMA 2FU7A 2HB9A 5DPXA 2YCBA 2BG7A 3P2UA 1JJEA 4NQ2A 4AWYB 2I7TA 3RKJA 2R2DA 3X2ZA 3ZR9A 5EWAA 5LCAA 4Z5ZA 4H0DA 3A4YA 3DHBA 2YNUA 3DHCA 2ZZIA 4YSLA 4Z6XA 4NQ6A 4C1GA 3IE1A 5HIPA 1WRAA 3IE0A 5AHRA 2CBNA 3KNRA 1BMCA 5EVDA 4F6HA 2YNVB 2BIBA 5LMCA 2GMNA 4C1EA 4DIKA 1YCGA 3PY6A 4HKYA 4C1CA 4BZ3A 1JT1A 4C1FA 4KEPA 5B1UA 5EV6A 4Z67A 2BFZB 4EYLA 3ZNBA 2YNTB 5A0TA 4EY2A 2Y8BA 2E7YA 3SBLA 4UBQA 5AHOA 1ZTCA 1DDKA 2FK6A 1QH3A 3FCZA 4HL1A 4PVOA 4EYBA 2I7XA 2YNWA 5ACSA 3AF6A 4TZBA 3SRXA 1SMLA 2BFZA 4RL0A 4FSBA 3L6NA 5KIKA 2OHJA 3LVZA 5A5ZA 2BC2A 4NQ4A 1YCFA 5K4MA 4RBSA 2NZEA 5AEBA 4Z7RA 2I7VA 4NQ5A 1DXKA 2BMIA 2Q0IA 5ACQA 2FU6A 4RM5A 4D1VA 4GCWA 4RAMA 2FU9A 3IDZA 4GYUA 5B3RA 2H6AA 4XUKA 2FHXA 3ESHA 5FQAA 2BG2A 2P18A 4LE6A 3IEKA 3PG4A 3KNSA 2OHHA 5B15A 5K0WA 1ZKPA 3BK1A 2YNTA 4TYTA 3SPUA 2FM6A 4V0HA 1A8TA 4FEKA 5ACXA 4EYFA 4XWWA 4ZO2A 2WYMC 3Q6VA 3IELA 5ACVA 5HIQA 3ZQ4A 3IOFA 2ZWRA 2DOOA 5ACWA 3X2XA 1KO2A 3X2YA 2NXAA 5HISA 4HL2A 3T3OA 3PY5A 3ZWFA 4RL2A 2Y87A 2ZNBA 5HH5A 3G1PA 4UWPB 4Z60A 4CHLA 4P62A 5ACTA 1WW1A 1VJNA 1X8GA 4KEQA 5ACPA 1X8IA 4BP0A 1QH5A 2NZFA 5AYAA 4AX0B 2BG8B 1YCHA 2QEDA 5A0VA 4TZ9A 2XR1A 1WUPA 3SD9A 4FR7A 5EV8A 4F6ZA 2WRSA 5IQKA 3VPEA 5A87A 5LSCA 1JJTA 4DILA 2A7MA 2BG8A 5LE1A 5HH4A 3SW3A 2M5DA 1HLKA 3I14A 2OHIA 1MQOA 2NYPA 4EXYA 2WHGA
chains in the Genus database with same CATH superfamily
3BC2A 4J5HA 3X30A 2BGAA 4JO0A 4YSBA 4U4LA 4B87A 3FAIA 4AWZA 3ADRA 4AD9A 3DHAA 3I0VA 2BR6A 5EHTA 5ACUA 4UWRB 3IEMA 4NURA 3H3EA 5LM6A 4UWOB 3RPCA 3WXCA 5ACRA 5AXRA 5HIOA 2BTNA 1BVTA 1XM8A 3F9OA 1KR3A 2UYXA 3AJ3A 1L9YA 2P97A 2P4ZA 1X8HA 2WYMA 3BV6A 2GCUA 3I13A 5FQBA 5K4NA 2VW8A 3DH8A 2GFJA 2ZO4A 4AXHA 5HH6A 1ZNBA 2QINA 4ZO3A 2BFLA 4GYQA 1BC2A 2GFKA 1XTOA 5LCFA 3IOGA 3S0ZA 3MD7A 3VQZA 2DKFA 2BG6A 2QDSA 4TZFA 3T9MA 4ZEJA 2P1EA 4PVTA 1A7TA 3R2UA 2YZ3A 4AV7A 2BFKA 4XWTA 4Z5YA 4ZNBA 5FQCA 4WD6A 2WYLA 4UA4A 1KO3A 1E5DA 5LS3A 2FHXB 2XF4A 1M2XA 2QDTA 4YSKA 1P9EA 3JXPA 4C1DA 3T3NA 5K4KA 3AF5A 4EXSA 3SFPA 4D1UA 4EFZA 5LLDA 1VGNA 4UWSB 2GKLA 2M5CA 1VMEA 4C09A 3BK2A 5EVKA 4TZEA 3I11A 1K07A 4C1HA 2Y8AA 4J5FA 3TP9A 2YNVA 4D1TA 1Y44A 3QH8A 5KILA 2Q0JA 2YHEA 5EW0A 2FU8A 4RAWA 5EVBA 4TYFA 2QJSA 4O98A 3RKKA 4D02A 1WUOA 2AIOA 1DD6A 5AXOA 5LCHA 2AZ4A 4AX1B 2Q42A 5EH9A 3IE2A 2Q9UA 3KL7A 4D1WA 3I15A 4UAMA 2FU7A 2HB9A 5DPXA 2YCBA 2BG7A 3P2UA 1JJEA 4NQ2A 4AWYB 2I7TA 3RKJA 2R2DA 3X2ZA 3ZR9A 5EWAA 5LCAA 4Z5ZA 4H0DA 3A4YA 3DHBA 2YNUA 3DHCA 2ZZIA 4YSLA 4Z6XA 4NQ6A 4C1GA 3IE1A 5HIPA 1WRAA 3IE0A 5AHRA 2CBNA 3KNRA 1BMCA 5EVDA 4F6HA 2YNVB 2BIBA 5LMCA 2GMNA 4C1EA 4DIKA 1YCGA 3PY6A 4HKYA 4C1CA 2CFUA 2CG3A 4BZ3A 1JT1A 4C1FA 4KEPA 5B1UA 5EV6A 4Z67A 2BFZB 4EYLA 3ZNBA 2YNTB 5A0TA 4EY2A 2Y8BA 2E7YA 3SBLA 4UBQA 5AHOA 1ZTCA 1DDKA 4PDXA 2FK6A 1QH3A 3FCZA 4HL1A 4PVOA 4EYBA 2I7XA 2YNWA 5ACSA 3AF6A 4TZBA 3SRXA 1SMLA 2BFZA 4RL0A 4FSBA 3L6NA 5KIKA 2OHJA 3LVZA 5A5ZA 2BC2A 4NQ4A 1YCFA 5K4MA 4RBSA 2NZEA 5AEBA 4Z7RA 2I7VA 4NQ5A 1DXKA 2BMIA 2Q0IA 5ACQA 2FU6A 4RM5A 4D1VA 4GCWA 4RAMA 2FU9A 3IDZA 4GYUA 5B3RA 2H6AA 4XUKA 2FHXA 3ESHA 5FQAA 2BG2A 2P18A 4LE6A 3IEKA 3PG4A 3KNSA 2OHHA 5B15A 5K0WA 1ZKPA 3BK1A 2YNTA 4TYTA 3SPUA 2FM6A 4V0HA 1A8TA 5A23A 4FEKA 5ACXA 4EYFA 4XWWA 4ZO2A 2WYMC 3Q6VA 3IELA 5ACVA 5HIQA 3ZQ4A 3IOFA 2ZWRA 2DOOA 5ACWA 3X2XA 1KO2A 3X2YA 2NXAA 5HISA 4HL2A 3T3OA 3PY5A 3ZWFA 4RL2A 2Y87A 2ZNBA 5HH5A 3G1PA 4UWPB 4Z60A 4CHLA 4P62A 5AJLA 5ACTA 1WW1A 1VJNA 1X8GA 4KEQA 5ACPA 1X8IA 4BP0A 1QH5A 2NZFA 5AYAA 4AX0B 2BG8B 2CFZA 1YCHA 2QEDA 5A0VA 4TZ9A 2XR1A 1WUPA 3SD9A 4FR7A 5EV8A 4F6ZA 2WRSA 5IQKA 3VPEA 5A87A 5LSCA 1JJTA 4DILA 2A7MA 2BG8A 5LE1A 5HH4A 3SW3A 2M5DA 1HLKA 3I14A 2OHIA 1MQOA 2NYPA 5AIJA 4EXYA 2CG2A 2WHGA
chains in the Genus database with same CATH topology
3BC2A 4J5HA 3X30A 2BGAA 4JO0A 4YSBA 4U4LA 4B87A 3FAIA 4AWZA 3ADRA 4AD9A 3DHAA 3I0VA 2BR6A 5EHTA 5ACUA 4UWRB 3IEMA 3H3EA 5LM6A 4UWOB 3RPCA 3WXCA 5ACRA 5AXRA 5HIOA 2BTNA 1BVTA 1XM8A 3F9OA 1KR3A 2UYXA 3AJ3A 1L9YA 2P97A 2P4ZA 1X8HA 2WYMA 3BV6A 2GCUA 3I13A 5FQBA 5K4NA 2VW8A 3DH8A 2GFJA 2ZO4A 5HH6A 1ZNBA 2QINA 4ZO3A 2BFLA 4GYQA 1BC2A 2GFKA 1XTOA 5LCFA 3IOGA 3S0ZA 3MD7A 3VQZA 2DKFA 2BG6A 2QDSA 4TZFA 3T9MA 4ZEJA 2P1EA 4PVTA 1A7TA 3R2UA 2YZ3A 2BFKA 4XWTA 4Z5YA 4ZNBA 5FQCA 4WD6A 2WYLA 4UA4A 1KO3A 1E5DA 5LS3A 2FHXB 2XF4A 1M2XA 2QDTA 4YSKA 1P9EA 3JXPA 4C1DA 3T3NA 5K4KA 3AF5A 4EXSA 3SFPA 4D1UA 4EFZA 5LLDA 1VGNA 4UWSB 2GKLA 2M5CA 1VMEA 4C09A 3BK2A 5EVKA 4TZEA 3I11A 1K07A 4C1HA 2Y8AA 4J5FA 3TP9A 2YNVA 4D1TA 1Y44A 3QH8A 5KILA 2Q0JA 5EW0A 2FU8A 4RAWA 5EVBA 4TYFA 2QJSA 4O98A 3RKKA 4D02A 1WUOA 2AIOA 1DD6A 5AXOA 5LCHA 2AZ4A 4AX1B 2Q42A 5EH9A 3IE2A 2Q9UA 3KL7A 4D1WA 3I15A 4UAMA 2FU7A 2HB9A 5DPXA 2YCBA 2BG7A 3P2UA 1JJEA 4NQ2A 4AWYB 2I7TA 3RKJA 2R2DA 3X2ZA 3ZR9A 5EWAA 5LCAA 4Z5ZA 4H0DA 3A4YA 3DHBA 2YNUA 3DHCA 2ZZIA 4YSLA 4Z6XA 4NQ6A 4C1GA 3IE1A 5HIPA 1WRAA 3IE0A 5AHRA 2CBNA 3KNRA 1BMCA 5EVDA 4F6HA 2YNVB 2BIBA 5LMCA 2GMNA 4C1EA 4DIKA 1YCGA 3PY6A 4HKYA 4C1CA 4BZ3A 1JT1A 4C1FA 4KEPA 5B1UA 5EV6A 4Z67A 2BFZB 4EYLA 3ZNBA 2YNTB 5A0TA 4EY2A 2Y8BA 2E7YA 3SBLA 4UBQA 5AHOA 1ZTCA 1DDKA 2FK6A 1QH3A 3FCZA 4HL1A 4PVOA 4EYBA 2I7XA 2YNWA 5ACSA 3AF6A 4TZBA 3SRXA 1SMLA 2BFZA 4RL0A 4FSBA 3L6NA 5KIKA 2OHJA 3LVZA 5A5ZA 2BC2A 4NQ4A 1YCFA 5K4MA 4RBSA 2NZEA 5AEBA 4Z7RA 2I7VA 4NQ5A 1DXKA 2BMIA 2Q0IA 5ACQA 2FU6A 4RM5A 4D1VA 4GCWA 4RAMA 2FU9A 3IDZA 4GYUA 5B3RA 2H6AA 4XUKA 2FHXA 3ESHA 5FQAA 2BG2A 2P18A 4LE6A 3IEKA 3PG4A 3KNSA 2OHHA 5B15A 5K0WA 1ZKPA 3BK1A 2YNTA 4TYTA 3SPUA 2FM6A 4V0HA 1A8TA 4FEKA 5ACXA 4EYFA 4XWWA 4ZO2A 2WYMC 3Q6VA 3IELA 5ACVA 5HIQA 3ZQ4A 3IOFA 2ZWRA 2DOOA 5ACWA 3X2XA 1KO2A 3X2YA 2NXAA 5HISA 4HL2A 3T3OA 3PY5A 3ZWFA 4RL2A 2Y87A 2ZNBA 5HH5A 3G1PA 4UWPB 4Z60A 4CHLA 4P62A 5ACTA 1WW1A 1VJNA 1X8GA 4KEQA 5ACPA 1X8IA 4BP0A 1QH5A 2NZFA 5AYAA 4AX0B 2BG8B 1YCHA 2QEDA 5A0VA 4TZ9A 2XR1A 1WUPA 3SD9A 4FR7A 5EV8A 4F6ZA 2WRSA 5IQKA 3VPEA 5A87A 5LSCA 1JJTA 4DILA 2A7MA 2BG8A 5LE1A 5HH4A 3SW3A 2M5DA 1HLKA 3I14A 2OHIA 1MQOA 2NYPA 4EXYA 2WHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BC2 A;  4J5H A;  3X30 A;  2BGA A;  4JO0 A;  4YSB A;  4U4L A;  4B87 A;  3FAI A;  4AWZ A;  3ADR A;  4AD9 A;  3DHA A;  3I0V A;  2BR6 A;  5EHT A;  5ACU A;  4UWR B;  3IEM A;  3H3E A;  5LM6 A;  4UWO B;  3RPC A;  3WXC A;  5ACR A;  5AXR A;  5HIO A;  2BTN A;  1BVT A;  1XM8 A;  3F9O A;  1KR3 A;  2UYX A;  3AJ3 A;  1L9Y A;  2P97 A;  2P4Z A;  1X8H A;  2WYM A;  3BV6 A;  2GCU A;  3I13 A;  5FQB A;  5K4N A;  2VW8 A;  3DH8 A;  2GFJ A;  2ZO4 A;  5HH6 A;  1ZNB A;  2QIN A;  4ZO3 A;  2BFL A;  4GYQ A;  1BC2 A;  2GFK A;  1XTO A;  5LCF A;  3IOG A;  3S0Z A;  3MD7 A;  3VQZ A;  2DKF A;  2BG6 A;  2QDS A;  4TZF A;  3T9M A;  4ZEJ A;  2P1E A;  4PVT A;  1A7T A;  3R2U A;  2YZ3 A;  2BFK A;  4XWT A;  4Z5Y A;  4ZNB A;  5FQC A;  4WD6 A;  2WYL A;  4UA4 A;  1KO3 A;  1E5D A;  5LS3 A;  2FHX B;  2XF4 A;  1M2X A;  2QDT A;  4YSK A;  1P9E A;  3JXP A;  4C1D A;  3T3N A;  5K4K A;  3AF5 A;  4EXS A;  3SFP A;  4D1U A;  4EFZ A;  5LLD A;  1VGN A;  4UWS B;  2GKL A;  2M5C A;  1VME A;  4C09 A;  3BK2 A;  5EVK A;  4TZE A;  3I11 A;  1K07 A;  4C1H A;  2Y8A A;  4J5F A;  3TP9 A;  2YNV A;  4D1T A;  1Y44 A;  3QH8 A;  5KIL A;  2Q0J A;  5EW0 A;  2FU8 A;  4RAW A;  5EVB A;  4TYF A;  2QJS A;  4O98 A;  3RKK A;  4D02 A;  1WUO A;  2AIO A;  1DD6 A;  5AXO A;  5LCH A;  2AZ4 A;  4AX1 B;  2Q42 A;  5EH9 A;  3IE2 A;  2Q9U A;  3KL7 A;  4D1W A;  3I15 A;  4UAM A;  2FU7 A;  2HB9 A;  5DPX A;  2YCB A;  2BG7 A;  3P2U A;  1JJE A;  4NQ2 A;  4AWY B;  2I7T A;  3RKJ A;  2R2D A;  3X2Z A;  3ZR9 A;  5EWA A;  5LCA A;  4Z5Z A;  4H0D A;  3A4Y A;  3DHB A;  2YNU A;  3DHC A;  2ZZI A;  4YSL A;  4Z6X A;  4NQ6 A;  4C1G A;  3IE1 A;  5HIP A;  1WRA A;  3IE0 A;  5AHR A;  2CBN A;  3KNR A;  1BMC A;  5EVD A;  4F6H A;  2YNV B;  2BIB A;  5LMC A;  2GMN A;  4C1E A;  4DIK A;  1YCG A;  3PY6 A;  4HKY A;  4C1C A;  4BZ3 A;  1JT1 A;  4C1F A;  4KEP A;  5B1U A;  5EV6 A;  4Z67 A;  2BFZ B;  4EYL A;  3ZNB A;  2YNT B;  5A0T A;  4EY2 A;  2Y8B A;  2E7Y A;  3SBL A;  4UBQ A;  5AHO A;  1ZTC A;  1DDK A;  2FK6 A;  1QH3 A;  3FCZ A;  4HL1 A;  4PVO A;  4EYB A;  2I7X A;  2YNW A;  5ACS A;  3AF6 A;  4TZB A;  3SRX A;  1SML A;  2BFZ A;  4RL0 A;  4FSB A;  3L6N A;  5KIK A;  2OHJ A;  3LVZ A;  5A5Z A;  2BC2 A;  4NQ4 A;  1YCF A;  5K4M A;  4RBS A;  2NZE A;  5AEB A;  4Z7R A;  2I7V A;  4NQ5 A;  1DXK A;  2BMI A;  2Q0I A;  5ACQ A;  2FU6 A;  4RM5 A;  4D1V A;  4GCW A;  4RAM A;  2FU9 A;  3IDZ A;  4GYU A;  5B3R A;  2H6A A;  4XUK A;  2FHX A;  3ESH A;  5FQA A;  2BG2 A;  2P18 A;  4LE6 A;  3IEK A;  3PG4 A;  3KNS A;  2OHH A;  5B15 A;  5K0W A;  1ZKP A;  3BK1 A;  2YNT A;  4TYT A;  3SPU A;  2FM6 A;  4V0H A;  1A8T A;  4FEK A;  5ACX A;  4EYF A;  4XWW A;  4ZO2 A;  2WYM C;  3Q6V A;  3IEL A;  5ACV A;  5HIQ A;  3ZQ4 A;  3IOF A;  2ZWR A;  2DOO A;  5ACW A;  3X2X A;  1KO2 A;  3X2Y A;  2NXA A;  5HIS A;  4HL2 A;  3T3O A;  3PY5 A;  3ZWF A;  4RL2 A;  2Y87 A;  2ZNB A;  5HH5 A;  3G1P A;  4UWP B;  4Z60 A;  4CHL A;  4P62 A;  5ACT A;  1WW1 A;  1VJN A;  1X8G A;  4KEQ A;  5ACP A;  1X8I A;  4BP0 A;  1QH5 A;  2NZF A;  5AYA A;  4AX0 B;  2BG8 B;  1YCH A;  2QED A;  5A0V A;  4TZ9 A;  2XR1 A;  1WUP A;  3SD9 A;  4FR7 A;  5EV8 A;  4F6Z A;  2WRS A;  5IQK A;  3VPE A;  5A87 A;  5LSC A;  1JJT A;  4DIL A;  2A7M A;  2BG8 A;  5LE1 A;  5HH4 A;  3SW3 A;  2M5D A;  1HLK A;  3I14 A;  2OHI A;  1MQO A;  2NYP A;  4EXY A;  2WHG A; 
#chains in the Genus database with same CATH topology
 3BC2 A;  4J5H A;  3X30 A;  2BGA A;  4JO0 A;  4YSB A;  4U4L A;  4B87 A;  3FAI A;  4AWZ A;  3ADR A;  4AD9 A;  3DHA A;  3I0V A;  2BR6 A;  5EHT A;  5ACU A;  4UWR B;  3IEM A;  4NUR A;  3H3E A;  5LM6 A;  4UWO B;  3RPC A;  3WXC A;  5ACR A;  5AXR A;  5HIO A;  2BTN A;  1BVT A;  1XM8 A;  3F9O A;  1KR3 A;  2UYX A;  3AJ3 A;  1L9Y A;  2P97 A;  2P4Z A;  1X8H A;  2WYM A;  3BV6 A;  2GCU A;  3I13 A;  5FQB A;  5K4N A;  2VW8 A;  3DH8 A;  2GFJ A;  2ZO4 A;  4AXH A;  5HH6 A;  1ZNB A;  2QIN A;  4ZO3 A;  2BFL A;  4GYQ A;  1BC2 A;  2GFK A;  1XTO A;  5LCF A;  3IOG A;  3S0Z A;  3MD7 A;  3VQZ A;  2DKF A;  2BG6 A;  2QDS A;  4TZF A;  3T9M A;  4ZEJ A;  2P1E A;  4PVT A;  1A7T A;  3R2U A;  2YZ3 A;  4AV7 A;  2BFK A;  4XWT A;  4Z5Y A;  4ZNB A;  5FQC A;  4WD6 A;  2WYL A;  4UA4 A;  1KO3 A;  1E5D A;  5LS3 A;  2FHX B;  2XF4 A;  1M2X A;  2QDT A;  4YSK A;  1P9E A;  3JXP A;  4C1D A;  3T3N A;  5K4K A;  3AF5 A;  4EXS A;  3SFP A;  4D1U A;  4EFZ A;  5LLD A;  1VGN A;  4UWS B;  2GKL A;  2M5C A;  1VME A;  4C09 A;  3BK2 A;  5EVK A;  4TZE A;  3I11 A;  1K07 A;  4C1H A;  2Y8A A;  4J5F A;  3TP9 A;  2YNV A;  4D1T A;  1Y44 A;  3QH8 A;  5KIL A;  2Q0J A;  2YHE A;  5EW0 A;  2FU8 A;  4RAW A;  5EVB A;  4TYF A;  2QJS A;  4O98 A;  3RKK A;  4D02 A;  1WUO A;  2AIO A;  1DD6 A;  5AXO A;  5LCH A;  2AZ4 A;  4AX1 B;  2Q42 A;  5EH9 A;  3IE2 A;  2Q9U A;  3KL7 A;  4D1W A;  3I15 A;  4UAM A;  2FU7 A;  2HB9 A;  5DPX A;  2YCB A;  2BG7 A;  3P2U A;  1JJE A;  4NQ2 A;  4AWY B;  2I7T A;  3RKJ A;  2R2D A;  3X2Z A;  3ZR9 A;  5EWA A;  5LCA A;  4Z5Z A;  4H0D A;  3A4Y A;  3DHB A;  2YNU A;  3DHC A;  2ZZI A;  4YSL A;  4Z6X A;  4NQ6 A;  4C1G A;  3IE1 A;  5HIP A;  1WRA A;  3IE0 A;  5AHR A;  2CBN A;  3KNR A;  1BMC A;  5EVD A;  4F6H A;  2YNV B;  2BIB A;  5LMC A;  2GMN A;  4C1E A;  4DIK A;  1YCG A;  3PY6 A;  4HKY A;  4C1C A;  2CFU A;  2CG3 A;  4BZ3 A;  1JT1 A;  4C1F A;  4KEP A;  5B1U A;  5EV6 A;  4Z67 A;  2BFZ B;  4EYL A;  3ZNB A;  2YNT B;  5A0T A;  4EY2 A;  2Y8B A;  2E7Y A;  3SBL A;  4UBQ A;  5AHO A;  1ZTC A;  1DDK A;  4PDX A;  2FK6 A;  1QH3 A;  3FCZ A;  4HL1 A;  4PVO A;  4EYB A;  2I7X A;  2YNW A;  5ACS A;  3AF6 A;  4TZB A;  3SRX A;  1SML A;  2BFZ A;  4RL0 A;  4FSB A;  3L6N A;  5KIK A;  2OHJ A;  3LVZ A;  5A5Z A;  2BC2 A;  4NQ4 A;  1YCF A;  5K4M A;  4RBS A;  2NZE A;  5AEB A;  4Z7R A;  2I7V A;  4NQ5 A;  1DXK A;  2BMI A;  2Q0I A;  5ACQ A;  2FU6 A;  4RM5 A;  4D1V A;  4GCW A;  4RAM A;  2FU9 A;  3IDZ A;  4GYU A;  5B3R A;  2H6A A;  4XUK A;  2FHX A;  3ESH A;  5FQA A;  2BG2 A;  2P18 A;  4LE6 A;  3IEK A;  3PG4 A;  3KNS A;  2OHH A;  5B15 A;  5K0W A;  1ZKP A;  3BK1 A;  2YNT A;  4TYT A;  3SPU A;  2FM6 A;  4V0H A;  1A8T A;  5A23 A;  4FEK A;  5ACX A;  4EYF A;  4XWW A;  4ZO2 A;  2WYM C;  3Q6V A;  3IEL A;  5ACV A;  5HIQ A;  3ZQ4 A;  3IOF A;  2ZWR A;  2DOO A;  5ACW A;  3X2X A;  1KO2 A;  3X2Y A;  2NXA A;  5HIS A;  4HL2 A;  3T3O A;  3PY5 A;  3ZWF A;  4RL2 A;  2Y87 A;  2ZNB A;  5HH5 A;  3G1P A;  4UWP B;  4Z60 A;  4CHL A;  4P62 A;  5AJL A;  5ACT A;  1WW1 A;  1VJN A;  1X8G A;  4KEQ A;  5ACP A;  1X8I A;  4BP0 A;  1QH5 A;  2NZF A;  5AYA A;  4AX0 B;  2BG8 B;  2CFZ A;  1YCH A;  2QED A;  5A0V A;  4TZ9 A;  2XR1 A;  1WUP A;  3SD9 A;  4FR7 A;  5EV8 A;  4F6Z A;  2WRS A;  5IQK A;  3VPE A;  5A87 A;  5LSC A;  1JJT A;  4DIL A;  2A7M A;  2BG8 A;  5LE1 A;  5HH4 A;  3SW3 A;  2M5D A;  1HLK A;  3I14 A;  2OHI A;  1MQO A;  2NYP A;  5AIJ A;  4EXY A;  2CG2 A;  2WHG A; 
#chains in the Genus database with same CATH homology
 3BC2 A;  4J5H A;  3X30 A;  2BGA A;  4JO0 A;  4YSB A;  4U4L A;  4B87 A;  3FAI A;  4AWZ A;  3ADR A;  4AD9 A;  3DHA A;  3I0V A;  2BR6 A;  5EHT A;  5ACU A;  4UWR B;  3IEM A;  3H3E A;  5LM6 A;  4UWO B;  3RPC A;  3WXC A;  5ACR A;  5AXR A;  5HIO A;  2BTN A;  1BVT A;  1XM8 A;  3F9O A;  1KR3 A;  2UYX A;  3AJ3 A;  1L9Y A;  2P97 A;  2P4Z A;  1X8H A;  2WYM A;  3BV6 A;  2GCU A;  3I13 A;  5FQB A;  5K4N A;  2VW8 A;  3DH8 A;  2GFJ A;  2ZO4 A;  5HH6 A;  1ZNB A;  2QIN A;  4ZO3 A;  2BFL A;  4GYQ A;  1BC2 A;  2GFK A;  1XTO A;  5LCF A;  3IOG A;  3S0Z A;  3MD7 A;  3VQZ A;  2DKF A;  2BG6 A;  2QDS A;  4TZF A;  3T9M A;  4ZEJ A;  2P1E A;  4PVT A;  1A7T A;  3R2U A;  2YZ3 A;  2BFK A;  4XWT A;  4Z5Y A;  4ZNB A;  5FQC A;  4WD6 A;  2WYL A;  4UA4 A;  1KO3 A;  1E5D A;  5LS3 A;  2FHX B;  2XF4 A;  1M2X A;  2QDT A;  4YSK A;  1P9E A;  3JXP A;  4C1D A;  3T3N A;  5K4K A;  3AF5 A;  4EXS A;  3SFP A;  4D1U A;  4EFZ A;  5LLD A;  1VGN A;  4UWS B;  2GKL A;  2M5C A;  1VME A;  4C09 A;  3BK2 A;  5EVK A;  4TZE A;  3I11 A;  1K07 A;  4C1H A;  2Y8A A;  4J5F A;  3TP9 A;  2YNV A;  4D1T A;  1Y44 A;  3QH8 A;  5KIL A;  2Q0J A;  5EW0 A;  2FU8 A;  4RAW A;  5EVB A;  4TYF A;  2QJS A;  4O98 A;  3RKK A;  4D02 A;  1WUO A;  2AIO A;  1DD6 A;  5AXO A;  5LCH A;  2AZ4 A;  4AX1 B;  2Q42 A;  5EH9 A;  3IE2 A;  2Q9U A;  3KL7 A;  4D1W A;  3I15 A;  4UAM A;  2FU7 A;  2HB9 A;  5DPX A;  2YCB A;  2BG7 A;  3P2U A;  1JJE A;  4NQ2 A;  4AWY B;  2I7T A;  3RKJ A;  2R2D A;  3X2Z A;  3ZR9 A;  5EWA A;  5LCA A;  4Z5Z A;  4H0D A;  3A4Y A;  3DHB A;  2YNU A;  3DHC A;  2ZZI A;  4YSL A;  4Z6X A;  4NQ6 A;  4C1G A;  3IE1 A;  5HIP A;  1WRA A;  3IE0 A;  5AHR A;  2CBN A;  3KNR A;  1BMC A;  5EVD A;  4F6H A;  2YNV B;  2BIB A;  5LMC A;  2GMN A;  4C1E A;  4DIK A;  1YCG A;  3PY6 A;  4HKY A;  4C1C A;  4BZ3 A;  1JT1 A;  4C1F A;  4KEP A;  5B1U A;  5EV6 A;  4Z67 A;  2BFZ B;  4EYL A;  3ZNB A;  2YNT B;  5A0T A;  4EY2 A;  2Y8B A;  2E7Y A;  3SBL A;  4UBQ A;  5AHO A;  1ZTC A;  1DDK A;  2FK6 A;  1QH3 A;  3FCZ A;  4HL1 A;  4PVO A;  4EYB A;  2I7X A;  2YNW A;  5ACS A;  3AF6 A;  4TZB A;  3SRX A;  1SML A;  2BFZ A;  4RL0 A;  4FSB A;  3L6N A;  5KIK A;  2OHJ A;  3LVZ A;  5A5Z A;  2BC2 A;  4NQ4 A;  1YCF A;  5K4M A;  4RBS A;  2NZE A;  5AEB A;  4Z7R A;  2I7V A;  4NQ5 A;  1DXK A;  2BMI A;  2Q0I A;  5ACQ A;  2FU6 A;  4RM5 A;  4D1V A;  4GCW A;  4RAM A;  2FU9 A;  3IDZ A;  4GYU A;  5B3R A;  2H6A A;  4XUK A;  2FHX A;  3ESH A;  5FQA A;  2BG2 A;  2P18 A;  4LE6 A;  3IEK A;  3PG4 A;  3KNS A;  2OHH A;  5B15 A;  5K0W A;  1ZKP A;  3BK1 A;  2YNT A;  4TYT A;  3SPU A;  2FM6 A;  4V0H A;  1A8T A;  4FEK A;  5ACX A;  4EYF A;  4XWW A;  4ZO2 A;  2WYM C;  3Q6V A;  3IEL A;  5ACV A;  5HIQ A;  3ZQ4 A;  3IOF A;  2ZWR A;  2DOO A;  5ACW A;  3X2X A;  1KO2 A;  3X2Y A;  2NXA A;  5HIS A;  4HL2 A;  3T3O A;  3PY5 A;  3ZWF A;  4RL2 A;  2Y87 A;  2ZNB A;  5HH5 A;  3G1P A;  4UWP B;  4Z60 A;  4CHL A;  4P62 A;  5ACT A;  1WW1 A;  1VJN A;  1X8G A;  4KEQ A;  5ACP A;  1X8I A;  4BP0 A;  1QH5 A;  2NZF A;  5AYA A;  4AX0 B;  2BG8 B;  1YCH A;  2QED A;  5A0V A;  4TZ9 A;  2XR1 A;  1WUP A;  3SD9 A;  4FR7 A;  5EV8 A;  4F6Z A;  2WRS A;  5IQK A;  3VPE A;  5A87 A;  5LSC A;  1JJT A;  4DIL A;  2A7M A;  2BG8 A;  5LE1 A;  5HH4 A;  3SW3 A;  2M5D A;  1HLK A;  3I14 A;  2OHI A;  1MQO A;  2NYP A;  4EXY A;  2WHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...