4AWYB

Crystal structure of the mobile metallo-beta-lactamase aim-1 from pseudomonas aeruginosa: insights into antibiotic binding and the role of gln157
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
270
structure length
270
Chain Sequence
ASRGCADDAGWNDPAMPLKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEEAATS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METALLO-BETA-LACTAMASE AIM-1
publication title Crystal Structure of the Mobile Metallo-Beta-Lactamase Aim-1 from Pseudomonas Aeruginosa: Insights Into Antibiotic Binding and the Role of Gln157
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 97
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4awyB00
4J5HA 5LCFA 3BK1A 4YSBA 3P2UA 2YNVB 3KL7A 5K0WA 4TYTA 3X30A 4ZEJA 2Q0IA 2WHGA 2FU8A 2XR1A 2Y8AA 3RKKA 4LE6A 5EV8A 5HIPA 2BR6A 2BC2A 2FK6A 1A7TA 3T3NA 2BFZA 5HISA 1BMCA 3SD9A 3DHCA 1BVTA 3I15A 4ZO2A 4FEKA 4C1GA 5EHTA 2FU7A 4DILA 4BP0A 3FAIA 5EVDA 5ACQA 5LE1A 2P18A 2M5DA 1QH5A 4JO0A 4D1WA 4PVTA 4DIKA 5AXOA 4C1HA 2R2DA 3S0ZA 3ADRA 2Y8BA 3SPUA 5ACXA 3IEMA 2I7TA 1E5DA 2FU9A 2YNUA 1YCGA 5B3RA 4F6HA 4AWYB 3AJ3A 1HLKA 2Q42A 4ZO3A 4UA4A 4KEQA 1ZNBA 3DHAA 2AIOA 4GYUA 5HH6A 3ZR9A 4ZNBA 4UWPB 5HIOA 3ZNBA 4HKYA 2FM6A 3ZWFA 3DHBA 4Z67A 4V0HA 4EYBA 2QINA 2Q0JA 3KNRA 2GFJA 5LCHA 1KO2A 5ACWA 3BC2A 4HL1A 4CHLA 5EV6A 5K4MA 2Q9UA 2I7XA 2DOOA 3IELA 3H3EA 2BG7A 2Y87A 1VJNA 1XM8A 2GCUA 1DDKA 2BG8A 3SW3A 2P97A 2GFKA 1VMEA 5A0VA 5AHOA 4H0DA 3IDZA 4PVOA 5EVKA 3RPCA 1BC2A 5ACSA 1JJEA 2YNWA 3PY5A 3ZQ4A 5IQKA 3IE0A 2WYMA 5EWAA 4AX0B 3R2UA 5K4KA 4TZ9A 2NZEA 3BV6A 2UYXA 4U4LA 4UWRB 2ZO4A 4EYFA 4GYQA 3QH8A 1Y44A 4EYLA 3I14A 2BFLA 4TYFA 5FQBA 3I11A 4RL2A 4BZ3A 5A5ZA 2YNTB 3L6NA 4C09A 5ACUA 3TP9A 2BMIA 5ACPA 4UWOB 4FSBA 4YSKA 4NQ6A 1KO3A 2BIBA 4P62A 4XWTA 4RBSA 5LS3A 4AWZA 2I7VA 3SBLA 5A87A 1KR3A 2NXAA 4B87A 2WRSA 3X2ZA 3IEKA 2FHXB 2QDTA 5KILA 1P9EA 1X8IA 4EY2A 2YNVA 4FR7A 4D02A 4EXSA 1MQOA 2QDSA 4TZBA 2VW8A 1X8HA 1WUPA 2GKLA 4UBQA 4WD6A 1WRAA 2YNTA 5AYAA 3ESHA 2BFKA 3SRXA 2DKFA 4AD9A 4D1VA 1L9YA 2P1EA 2YCBA 2M5CA 2A7MA 2BG6A 4EXYA 3JXPA 3IE1A 3DH8A 1XTOA 5EH9A 3IE2A 3I13A 1X8GA 4EFZA 5DPXA 3AF6A 4TZEA 2BTNA 3FCZA 4Z60A 2CBNA 2ZNBA 3VPEA 4Z5ZA 2BFZB 1ZKPA 4UWSB 5HH4A 5KIKA 3LVZA 4Z7RA 2OHIA 2BGAA 2AZ4A 5AHRA 2QJSA 2HB9A 5B15A 3I0VA 1ZTCA 1WW1A 2ZZIA 2OHJA 1SMLA 5ACTA 2BG2A 2YZ3A 1JJTA 4D1TA 3F9OA 2WYLA 5LLDA 2NYPA 2NZFA 4KEPA 3WXCA 4Z6XA 5LMCA 5K4NA 3X2YA 1K07A 4GCWA 5EVBA 2ZWRA 1M2XA 5AXRA 4HL2A 4C1FA 3IOFA 5ACVA 3X2XA 1JT1A 4F6ZA 5FQAA 5B1UA 2E7YA 3SFPA 4C1DA 5ACRA 2FU6A 2GMNA 4D1UA 4NQ4A 4RM5A 4O98A 4AX1B 2BG8B 3T3OA 4YSLA 5LCAA 3MD7A 5LM6A 5AEBA 5A0TA 4NQ2A 5EW0A 1VGNA 1A8TA 1QH3A 2OHHA 4XWWA 2WYMC 4RAMA 3PG4A 3VQZA 4C1CA 4J5FA 1DD6A 2FHXA 3G1PA 4UAMA 4XUKA 5HH5A 3IOGA 3T9MA 4Z5YA 1YCHA 3PY6A 4RL0A 3KNSA 1WUOA 4TZFA 2P4ZA 3RKJA 3A4YA 3AF5A 1DXKA 5LSCA 4RAWA 3Q6VA 2H6AA 4C1EA 2XF4A 3BK2A 2QEDA 1YCFA 4NQ5A 5FQCA 5HIQA
chains in the Genus database with same CATH superfamily
4J5HA 5LCFA 3BK1A 4YSBA 2CFZA 3P2UA 2YNVB 3KL7A 5K0WA 4TYTA 3X30A 4ZEJA 2Q0IA 2WHGA 2FU8A 2XR1A 2Y8AA 3RKKA 4LE6A 5EV8A 5HIPA 2BR6A 2BC2A 2FK6A 1A7TA 3T3NA 2BFZA 5HISA 1BMCA 3SD9A 3DHCA 1BVTA 3I15A 4ZO2A 4FEKA 4C1GA 5EHTA 2FU7A 4DILA 4BP0A 3FAIA 5EVDA 5ACQA 5LE1A 2P18A 2M5DA 1QH5A 4JO0A 4D1WA 4PVTA 4DIKA 5AXOA 4C1HA 2R2DA 3S0ZA 3ADRA 2Y8BA 3SPUA 5ACXA 3IEMA 2I7TA 1E5DA 2FU9A 2YNUA 1YCGA 5B3RA 4F6HA 4AWYB 3AJ3A 1HLKA 2Q42A 4ZO3A 4UA4A 4KEQA 1ZNBA 3DHAA 4NURA 2AIOA 4GYUA 5HH6A 3ZR9A 4ZNBA 4UWPB 5HIOA 3ZNBA 4HKYA 2FM6A 3ZWFA 3DHBA 4Z67A 4V0HA 4EYBA 2QINA 2Q0JA 3KNRA 2GFJA 5LCHA 1KO2A 5ACWA 3BC2A 4HL1A 4CHLA 5EV6A 5K4MA 2CG3A 2Q9UA 2I7XA 2DOOA 3IELA 2YHEA 3H3EA 2BG7A 2Y87A 1VJNA 1XM8A 2GCUA 1DDKA 2BG8A 3SW3A 2P97A 2GFKA 1VMEA 5A0VA 5AHOA 4H0DA 3IDZA 4PVOA 5EVKA 3RPCA 1BC2A 5ACSA 1JJEA 2YNWA 3PY5A 3ZQ4A 5IQKA 3IE0A 2WYMA 5EWAA 4AX0B 3R2UA 5K4KA 4TZ9A 2NZEA 3BV6A 2UYXA 4U4LA 4UWRB 2ZO4A 4EYFA 4GYQA 3QH8A 1Y44A 4EYLA 3I14A 2BFLA 4TYFA 5FQBA 3I11A 4RL2A 4BZ3A 5A5ZA 2YNTB 3L6NA 4C09A 5ACUA 3TP9A 2BMIA 5ACPA 4UWOB 4FSBA 4YSKA 4NQ6A 1KO3A 2BIBA 4P62A 4XWTA 4RBSA 5LS3A 4AWZA 2I7VA 3SBLA 5A87A 2CFUA 1KR3A 2NXAA 4B87A 2WRSA 3X2ZA 3IEKA 2FHXB 2QDTA 5KILA 1P9EA 1X8IA 4EY2A 2YNVA 4AXHA 4FR7A 4D02A 4EXSA 1MQOA 2QDSA 4TZBA 2VW8A 1X8HA 1WUPA 2GKLA 4UBQA 4WD6A 1WRAA 2YNTA 5AYAA 3ESHA 2BFKA 3SRXA 2DKFA 4AD9A 4D1VA 1L9YA 2P1EA 2YCBA 2M5CA 2A7MA 2BG6A 4EXYA 3JXPA 3IE1A 3DH8A 5A23A 1XTOA 5EH9A 3IE2A 3I13A 1X8GA 4PDXA 4EFZA 5DPXA 3AF6A 4TZEA 2BTNA 3FCZA 4Z60A 2CBNA 2ZNBA 3VPEA 4Z5ZA 2BFZB 1ZKPA 4UWSB 5HH4A 5KIKA 3LVZA 4Z7RA 2OHIA 4AV7A 2BGAA 2AZ4A 5AHRA 2QJSA 2HB9A 5B15A 3I0VA 1ZTCA 1WW1A 2ZZIA 2OHJA 1SMLA 5ACTA 2BG2A 2YZ3A 1JJTA 4D1TA 3F9OA 2WYLA 5LLDA 2NYPA 2NZFA 4KEPA 3WXCA 4Z6XA 5LMCA 5K4NA 3X2YA 1K07A 4GCWA 5EVBA 2ZWRA 1M2XA 5AXRA 4HL2A 4C1FA 3IOFA 5ACVA 3X2XA 1JT1A 4F6ZA 5AJLA 5FQAA 5B1UA 2E7YA 3SFPA 4C1DA 5ACRA 2FU6A 2GMNA 4D1UA 4NQ4A 4RM5A 4O98A 4AX1B 2BG8B 3T3OA 4YSLA 5LCAA 3MD7A 2CG2A 5LM6A 5AEBA 5A0TA 4NQ2A 5EW0A 1VGNA 1A8TA 1QH3A 2OHHA 4XWWA 2WYMC 4RAMA 3PG4A 3VQZA 4C1CA 4J5FA 1DD6A 2FHXA 3G1PA 4UAMA 4XUKA 5HH5A 3IOGA 3T9MA 4Z5YA 1YCHA 3PY6A 4RL0A 3KNSA 1WUOA 4TZFA 2P4ZA 3RKJA 3A4YA 3AF5A 1DXKA 5LSCA 4RAWA 3Q6VA 2H6AA 4C1EA 2XF4A 3BK2A 2QEDA 1YCFA 4NQ5A 5FQCA 5AIJA 5HIQA
chains in the Genus database with same CATH topology
4J5HA 5LCFA 3BK1A 4YSBA 3P2UA 2YNVB 3KL7A 5K0WA 4TYTA 3X30A 4ZEJA 2Q0IA 2WHGA 2FU8A 2XR1A 2Y8AA 3RKKA 4LE6A 5EV8A 5HIPA 2BR6A 2BC2A 2FK6A 1A7TA 3T3NA 2BFZA 5HISA 1BMCA 3SD9A 3DHCA 1BVTA 3I15A 4ZO2A 4FEKA 4C1GA 5EHTA 2FU7A 4DILA 4BP0A 3FAIA 5EVDA 5ACQA 5LE1A 2P18A 2M5DA 1QH5A 4JO0A 4D1WA 4PVTA 4DIKA 5AXOA 4C1HA 2R2DA 3S0ZA 3ADRA 2Y8BA 3SPUA 5ACXA 3IEMA 2I7TA 1E5DA 2FU9A 2YNUA 1YCGA 5B3RA 4F6HA 4AWYB 3AJ3A 1HLKA 2Q42A 4ZO3A 4UA4A 4KEQA 1ZNBA 3DHAA 2AIOA 4GYUA 5HH6A 3ZR9A 4ZNBA 4UWPB 5HIOA 3ZNBA 4HKYA 2FM6A 3ZWFA 3DHBA 4Z67A 4V0HA 4EYBA 2QINA 2Q0JA 3KNRA 2GFJA 5LCHA 1KO2A 5ACWA 3BC2A 4HL1A 4CHLA 5EV6A 5K4MA 2Q9UA 2I7XA 2DOOA 3IELA 3H3EA 2BG7A 2Y87A 1VJNA 1XM8A 2GCUA 1DDKA 2BG8A 3SW3A 2P97A 2GFKA 1VMEA 5A0VA 5AHOA 4H0DA 3IDZA 4PVOA 5EVKA 3RPCA 1BC2A 5ACSA 1JJEA 2YNWA 3PY5A 3ZQ4A 5IQKA 3IE0A 2WYMA 5EWAA 4AX0B 3R2UA 5K4KA 4TZ9A 2NZEA 3BV6A 2UYXA 4U4LA 4UWRB 2ZO4A 4EYFA 4GYQA 3QH8A 1Y44A 4EYLA 3I14A 2BFLA 4TYFA 5FQBA 3I11A 4RL2A 4BZ3A 5A5ZA 2YNTB 3L6NA 4C09A 5ACUA 3TP9A 2BMIA 5ACPA 4UWOB 4FSBA 4YSKA 4NQ6A 1KO3A 2BIBA 4P62A 4XWTA 4RBSA 5LS3A 4AWZA 2I7VA 3SBLA 5A87A 1KR3A 2NXAA 4B87A 2WRSA 3X2ZA 3IEKA 2FHXB 2QDTA 5KILA 1P9EA 1X8IA 4EY2A 2YNVA 4FR7A 4D02A 4EXSA 1MQOA 2QDSA 4TZBA 2VW8A 1X8HA 1WUPA 2GKLA 4UBQA 4WD6A 1WRAA 2YNTA 5AYAA 3ESHA 2BFKA 3SRXA 2DKFA 4AD9A 4D1VA 1L9YA 2P1EA 2YCBA 2M5CA 2A7MA 2BG6A 4EXYA 3JXPA 3IE1A 3DH8A 1XTOA 5EH9A 3IE2A 3I13A 1X8GA 4EFZA 5DPXA 3AF6A 4TZEA 2BTNA 3FCZA 4Z60A 2CBNA 2ZNBA 3VPEA 4Z5ZA 2BFZB 1ZKPA 4UWSB 5HH4A 5KIKA 3LVZA 4Z7RA 2OHIA 2BGAA 2AZ4A 5AHRA 2QJSA 2HB9A 5B15A 3I0VA 1ZTCA 1WW1A 2ZZIA 2OHJA 1SMLA 5ACTA 2BG2A 2YZ3A 1JJTA 4D1TA 3F9OA 2WYLA 5LLDA 2NYPA 2NZFA 4KEPA 3WXCA 4Z6XA 5LMCA 5K4NA 3X2YA 1K07A 4GCWA 5EVBA 2ZWRA 1M2XA 5AXRA 4HL2A 4C1FA 3IOFA 5ACVA 3X2XA 1JT1A 4F6ZA 5FQAA 5B1UA 2E7YA 3SFPA 4C1DA 5ACRA 2FU6A 2GMNA 4D1UA 4NQ4A 4RM5A 4O98A 4AX1B 2BG8B 3T3OA 4YSLA 5LCAA 3MD7A 5LM6A 5AEBA 5A0TA 4NQ2A 5EW0A 1VGNA 1A8TA 1QH3A 2OHHA 4XWWA 2WYMC 4RAMA 3PG4A 3VQZA 4C1CA 4J5FA 1DD6A 2FHXA 3G1PA 4UAMA 4XUKA 5HH5A 3IOGA 3T9MA 4Z5YA 1YCHA 3PY6A 4RL0A 3KNSA 1WUOA 4TZFA 2P4ZA 3RKJA 3A4YA 3AF5A 1DXKA 5LSCA 4RAWA 3Q6VA 2H6AA 4C1EA 2XF4A 3BK2A 2QEDA 1YCFA 4NQ5A 5FQCA 5HIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J5H A;  5LCF A;  3BK1 A;  4YSB A;  3P2U A;  2YNV B;  3KL7 A;  5K0W A;  4TYT A;  3X30 A;  4ZEJ A;  2Q0I A;  2WHG A;  2FU8 A;  2XR1 A;  2Y8A A;  3RKK A;  4LE6 A;  5EV8 A;  5HIP A;  2BR6 A;  2BC2 A;  2FK6 A;  1A7T A;  3T3N A;  2BFZ A;  5HIS A;  1BMC A;  3SD9 A;  3DHC A;  1BVT A;  3I15 A;  4ZO2 A;  4FEK A;  4C1G A;  5EHT A;  2FU7 A;  4DIL A;  4BP0 A;  3FAI A;  5EVD A;  5ACQ A;  5LE1 A;  2P18 A;  2M5D A;  1QH5 A;  4JO0 A;  4D1W A;  4PVT A;  4DIK A;  5AXO A;  4C1H A;  2R2D A;  3S0Z A;  3ADR A;  2Y8B A;  3SPU A;  5ACX A;  3IEM A;  2I7T A;  1E5D A;  2FU9 A;  2YNU A;  1YCG A;  5B3R A;  4F6H A;  4AWY B;  3AJ3 A;  1HLK A;  2Q42 A;  4ZO3 A;  4UA4 A;  4KEQ A;  1ZNB A;  3DHA A;  2AIO A;  4GYU A;  5HH6 A;  3ZR9 A;  4ZNB A;  4UWP B;  5HIO A;  3ZNB A;  4HKY A;  2FM6 A;  3ZWF A;  3DHB A;  4Z67 A;  4V0H A;  4EYB A;  2QIN A;  2Q0J A;  3KNR A;  2GFJ A;  5LCH A;  1KO2 A;  5ACW A;  3BC2 A;  4HL1 A;  4CHL A;  5EV6 A;  5K4M A;  2Q9U A;  2I7X A;  2DOO A;  3IEL A;  3H3E A;  2BG7 A;  2Y87 A;  1VJN A;  1XM8 A;  2GCU A;  1DDK A;  2BG8 A;  3SW3 A;  2P97 A;  2GFK A;  1VME A;  5A0V A;  5AHO A;  4H0D A;  3IDZ A;  4PVO A;  5EVK A;  3RPC A;  1BC2 A;  5ACS A;  1JJE A;  2YNW A;  3PY5 A;  3ZQ4 A;  5IQK A;  3IE0 A;  2WYM A;  5EWA A;  4AX0 B;  3R2U A;  5K4K A;  4TZ9 A;  2NZE A;  3BV6 A;  2UYX A;  4U4L A;  4UWR B;  2ZO4 A;  4EYF A;  4GYQ A;  3QH8 A;  1Y44 A;  4EYL A;  3I14 A;  2BFL A;  4TYF A;  5FQB A;  3I11 A;  4RL2 A;  4BZ3 A;  5A5Z A;  2YNT B;  3L6N A;  4C09 A;  5ACU A;  3TP9 A;  2BMI A;  5ACP A;  4UWO B;  4FSB A;  4YSK A;  4NQ6 A;  1KO3 A;  2BIB A;  4P62 A;  4XWT A;  4RBS A;  5LS3 A;  4AWZ A;  2I7V A;  3SBL A;  5A87 A;  1KR3 A;  2NXA A;  4B87 A;  2WRS A;  3X2Z A;  3IEK A;  2FHX B;  2QDT A;  5KIL A;  1P9E A;  1X8I A;  4EY2 A;  2YNV A;  4FR7 A;  4D02 A;  4EXS A;  1MQO A;  2QDS A;  4TZB A;  2VW8 A;  1X8H A;  1WUP A;  2GKL A;  4UBQ A;  4WD6 A;  1WRA A;  2YNT A;  5AYA A;  3ESH A;  2BFK A;  3SRX A;  2DKF A;  4AD9 A;  4D1V A;  1L9Y A;  2P1E A;  2YCB A;  2M5C A;  2A7M A;  2BG6 A;  4EXY A;  3JXP A;  3IE1 A;  3DH8 A;  1XTO A;  5EH9 A;  3IE2 A;  3I13 A;  1X8G A;  4EFZ A;  5DPX A;  3AF6 A;  4TZE A;  2BTN A;  3FCZ A;  4Z60 A;  2CBN A;  2ZNB A;  3VPE A;  4Z5Z A;  2BFZ B;  1ZKP A;  4UWS B;  5HH4 A;  5KIK A;  3LVZ A;  4Z7R A;  2OHI A;  2BGA A;  2AZ4 A;  5AHR A;  2QJS A;  2HB9 A;  5B15 A;  3I0V A;  1ZTC A;  1WW1 A;  2ZZI A;  2OHJ A;  1SML A;  5ACT A;  2BG2 A;  2YZ3 A;  1JJT A;  4D1T A;  3F9O A;  2WYL A;  5LLD A;  2NYP A;  2NZF A;  4KEP A;  3WXC A;  4Z6X A;  5LMC A;  5K4N A;  3X2Y A;  1K07 A;  4GCW A;  5EVB A;  2ZWR A;  1M2X A;  5AXR A;  4HL2 A;  4C1F A;  3IOF A;  5ACV A;  3X2X A;  1JT1 A;  4F6Z A;  5FQA A;  5B1U A;  2E7Y A;  3SFP A;  4C1D A;  5ACR A;  2FU6 A;  2GMN A;  4D1U A;  4NQ4 A;  4RM5 A;  4O98 A;  4AX1 B;  2BG8 B;  3T3O A;  4YSL A;  5LCA A;  3MD7 A;  5LM6 A;  5AEB A;  5A0T A;  4NQ2 A;  5EW0 A;  1VGN A;  1A8T A;  1QH3 A;  2OHH A;  4XWW A;  2WYM C;  4RAM A;  3PG4 A;  3VQZ A;  4C1C A;  4J5F A;  1DD6 A;  2FHX A;  3G1P A;  4UAM A;  4XUK A;  5HH5 A;  3IOG A;  3T9M A;  4Z5Y A;  1YCH A;  3PY6 A;  4RL0 A;  3KNS A;  1WUO A;  4TZF A;  2P4Z A;  3RKJ A;  3A4Y A;  3AF5 A;  1DXK A;  5LSC A;  4RAW A;  3Q6V A;  2H6A A;  4C1E A;  2XF4 A;  3BK2 A;  2QED A;  1YCF A;  4NQ5 A;  5FQC A;  5HIQ A; 
#chains in the Genus database with same CATH topology
 4J5H A;  5LCF A;  3BK1 A;  4YSB A;  2CFZ A;  3P2U A;  2YNV B;  3KL7 A;  5K0W A;  4TYT A;  3X30 A;  4ZEJ A;  2Q0I A;  2WHG A;  2FU8 A;  2XR1 A;  2Y8A A;  3RKK A;  4LE6 A;  5EV8 A;  5HIP A;  2BR6 A;  2BC2 A;  2FK6 A;  1A7T A;  3T3N A;  2BFZ A;  5HIS A;  1BMC A;  3SD9 A;  3DHC A;  1BVT A;  3I15 A;  4ZO2 A;  4FEK A;  4C1G A;  5EHT A;  2FU7 A;  4DIL A;  4BP0 A;  3FAI A;  5EVD A;  5ACQ A;  5LE1 A;  2P18 A;  2M5D A;  1QH5 A;  4JO0 A;  4D1W A;  4PVT A;  4DIK A;  5AXO A;  4C1H A;  2R2D A;  3S0Z A;  3ADR A;  2Y8B A;  3SPU A;  5ACX A;  3IEM A;  2I7T A;  1E5D A;  2FU9 A;  2YNU A;  1YCG A;  5B3R A;  4F6H A;  4AWY B;  3AJ3 A;  1HLK A;  2Q42 A;  4ZO3 A;  4UA4 A;  4KEQ A;  1ZNB A;  3DHA A;  4NUR A;  2AIO A;  4GYU A;  5HH6 A;  3ZR9 A;  4ZNB A;  4UWP B;  5HIO A;  3ZNB A;  4HKY A;  2FM6 A;  3ZWF A;  3DHB A;  4Z67 A;  4V0H A;  4EYB A;  2QIN A;  2Q0J A;  3KNR A;  2GFJ A;  5LCH A;  1KO2 A;  5ACW A;  3BC2 A;  4HL1 A;  4CHL A;  5EV6 A;  5K4M A;  2CG3 A;  2Q9U A;  2I7X A;  2DOO A;  3IEL A;  2YHE A;  3H3E A;  2BG7 A;  2Y87 A;  1VJN A;  1XM8 A;  2GCU A;  1DDK A;  2BG8 A;  3SW3 A;  2P97 A;  2GFK A;  1VME A;  5A0V A;  5AHO A;  4H0D A;  3IDZ A;  4PVO A;  5EVK A;  3RPC A;  1BC2 A;  5ACS A;  1JJE A;  2YNW A;  3PY5 A;  3ZQ4 A;  5IQK A;  3IE0 A;  2WYM A;  5EWA A;  4AX0 B;  3R2U A;  5K4K A;  4TZ9 A;  2NZE A;  3BV6 A;  2UYX A;  4U4L A;  4UWR B;  2ZO4 A;  4EYF A;  4GYQ A;  3QH8 A;  1Y44 A;  4EYL A;  3I14 A;  2BFL A;  4TYF A;  5FQB A;  3I11 A;  4RL2 A;  4BZ3 A;  5A5Z A;  2YNT B;  3L6N A;  4C09 A;  5ACU A;  3TP9 A;  2BMI A;  5ACP A;  4UWO B;  4FSB A;  4YSK A;  4NQ6 A;  1KO3 A;  2BIB A;  4P62 A;  4XWT A;  4RBS A;  5LS3 A;  4AWZ A;  2I7V A;  3SBL A;  5A87 A;  2CFU A;  1KR3 A;  2NXA A;  4B87 A;  2WRS A;  3X2Z A;  3IEK A;  2FHX B;  2QDT A;  5KIL A;  1P9E A;  1X8I A;  4EY2 A;  2YNV A;  4AXH A;  4FR7 A;  4D02 A;  4EXS A;  1MQO A;  2QDS A;  4TZB A;  2VW8 A;  1X8H A;  1WUP A;  2GKL A;  4UBQ A;  4WD6 A;  1WRA A;  2YNT A;  5AYA A;  3ESH A;  2BFK A;  3SRX A;  2DKF A;  4AD9 A;  4D1V A;  1L9Y A;  2P1E A;  2YCB A;  2M5C A;  2A7M A;  2BG6 A;  4EXY A;  3JXP A;  3IE1 A;  3DH8 A;  5A23 A;  1XTO A;  5EH9 A;  3IE2 A;  3I13 A;  1X8G A;  4PDX A;  4EFZ A;  5DPX A;  3AF6 A;  4TZE A;  2BTN A;  3FCZ A;  4Z60 A;  2CBN A;  2ZNB A;  3VPE A;  4Z5Z A;  2BFZ B;  1ZKP A;  4UWS B;  5HH4 A;  5KIK A;  3LVZ A;  4Z7R A;  2OHI A;  4AV7 A;  2BGA A;  2AZ4 A;  5AHR A;  2QJS A;  2HB9 A;  5B15 A;  3I0V A;  1ZTC A;  1WW1 A;  2ZZI A;  2OHJ A;  1SML A;  5ACT A;  2BG2 A;  2YZ3 A;  1JJT A;  4D1T A;  3F9O A;  2WYL A;  5LLD A;  2NYP A;  2NZF A;  4KEP A;  3WXC A;  4Z6X A;  5LMC A;  5K4N A;  3X2Y A;  1K07 A;  4GCW A;  5EVB A;  2ZWR A;  1M2X A;  5AXR A;  4HL2 A;  4C1F A;  3IOF A;  5ACV A;  3X2X A;  1JT1 A;  4F6Z A;  5AJL A;  5FQA A;  5B1U A;  2E7Y A;  3SFP A;  4C1D A;  5ACR A;  2FU6 A;  2GMN A;  4D1U A;  4NQ4 A;  4RM5 A;  4O98 A;  4AX1 B;  2BG8 B;  3T3O A;  4YSL A;  5LCA A;  3MD7 A;  2CG2 A;  5LM6 A;  5AEB A;  5A0T A;  4NQ2 A;  5EW0 A;  1VGN A;  1A8T A;  1QH3 A;  2OHH A;  4XWW A;  2WYM C;  4RAM A;  3PG4 A;  3VQZ A;  4C1C A;  4J5F A;  1DD6 A;  2FHX A;  3G1P A;  4UAM A;  4XUK A;  5HH5 A;  3IOG A;  3T9M A;  4Z5Y A;  1YCH A;  3PY6 A;  4RL0 A;  3KNS A;  1WUO A;  4TZF A;  2P4Z A;  3RKJ A;  3A4Y A;  3AF5 A;  1DXK A;  5LSC A;  4RAW A;  3Q6V A;  2H6A A;  4C1E A;  2XF4 A;  3BK2 A;  2QED A;  1YCF A;  4NQ5 A;  5FQC A;  5AIJ A;  5HIQ A; 
#chains in the Genus database with same CATH homology
 4J5H A;  5LCF A;  3BK1 A;  4YSB A;  3P2U A;  2YNV B;  3KL7 A;  5K0W A;  4TYT A;  3X30 A;  4ZEJ A;  2Q0I A;  2WHG A;  2FU8 A;  2XR1 A;  2Y8A A;  3RKK A;  4LE6 A;  5EV8 A;  5HIP A;  2BR6 A;  2BC2 A;  2FK6 A;  1A7T A;  3T3N A;  2BFZ A;  5HIS A;  1BMC A;  3SD9 A;  3DHC A;  1BVT A;  3I15 A;  4ZO2 A;  4FEK A;  4C1G A;  5EHT A;  2FU7 A;  4DIL A;  4BP0 A;  3FAI A;  5EVD A;  5ACQ A;  5LE1 A;  2P18 A;  2M5D A;  1QH5 A;  4JO0 A;  4D1W A;  4PVT A;  4DIK A;  5AXO A;  4C1H A;  2R2D A;  3S0Z A;  3ADR A;  2Y8B A;  3SPU A;  5ACX A;  3IEM A;  2I7T A;  1E5D A;  2FU9 A;  2YNU A;  1YCG A;  5B3R A;  4F6H A;  4AWY B;  3AJ3 A;  1HLK A;  2Q42 A;  4ZO3 A;  4UA4 A;  4KEQ A;  1ZNB A;  3DHA A;  2AIO A;  4GYU A;  5HH6 A;  3ZR9 A;  4ZNB A;  4UWP B;  5HIO A;  3ZNB A;  4HKY A;  2FM6 A;  3ZWF A;  3DHB A;  4Z67 A;  4V0H A;  4EYB A;  2QIN A;  2Q0J A;  3KNR A;  2GFJ A;  5LCH A;  1KO2 A;  5ACW A;  3BC2 A;  4HL1 A;  4CHL A;  5EV6 A;  5K4M A;  2Q9U A;  2I7X A;  2DOO A;  3IEL A;  3H3E A;  2BG7 A;  2Y87 A;  1VJN A;  1XM8 A;  2GCU A;  1DDK A;  2BG8 A;  3SW3 A;  2P97 A;  2GFK A;  1VME A;  5A0V A;  5AHO A;  4H0D A;  3IDZ A;  4PVO A;  5EVK A;  3RPC A;  1BC2 A;  5ACS A;  1JJE A;  2YNW A;  3PY5 A;  3ZQ4 A;  5IQK A;  3IE0 A;  2WYM A;  5EWA A;  4AX0 B;  3R2U A;  5K4K A;  4TZ9 A;  2NZE A;  3BV6 A;  2UYX A;  4U4L A;  4UWR B;  2ZO4 A;  4EYF A;  4GYQ A;  3QH8 A;  1Y44 A;  4EYL A;  3I14 A;  2BFL A;  4TYF A;  5FQB A;  3I11 A;  4RL2 A;  4BZ3 A;  5A5Z A;  2YNT B;  3L6N A;  4C09 A;  5ACU A;  3TP9 A;  2BMI A;  5ACP A;  4UWO B;  4FSB A;  4YSK A;  4NQ6 A;  1KO3 A;  2BIB A;  4P62 A;  4XWT A;  4RBS A;  5LS3 A;  4AWZ A;  2I7V A;  3SBL A;  5A87 A;  1KR3 A;  2NXA A;  4B87 A;  2WRS A;  3X2Z A;  3IEK A;  2FHX B;  2QDT A;  5KIL A;  1P9E A;  1X8I A;  4EY2 A;  2YNV A;  4FR7 A;  4D02 A;  4EXS A;  1MQO A;  2QDS A;  4TZB A;  2VW8 A;  1X8H A;  1WUP A;  2GKL A;  4UBQ A;  4WD6 A;  1WRA A;  2YNT A;  5AYA A;  3ESH A;  2BFK A;  3SRX A;  2DKF A;  4AD9 A;  4D1V A;  1L9Y A;  2P1E A;  2YCB A;  2M5C A;  2A7M A;  2BG6 A;  4EXY A;  3JXP A;  3IE1 A;  3DH8 A;  1XTO A;  5EH9 A;  3IE2 A;  3I13 A;  1X8G A;  4EFZ A;  5DPX A;  3AF6 A;  4TZE A;  2BTN A;  3FCZ A;  4Z60 A;  2CBN A;  2ZNB A;  3VPE A;  4Z5Z A;  2BFZ B;  1ZKP A;  4UWS B;  5HH4 A;  5KIK A;  3LVZ A;  4Z7R A;  2OHI A;  2BGA A;  2AZ4 A;  5AHR A;  2QJS A;  2HB9 A;  5B15 A;  3I0V A;  1ZTC A;  1WW1 A;  2ZZI A;  2OHJ A;  1SML A;  5ACT A;  2BG2 A;  2YZ3 A;  1JJT A;  4D1T A;  3F9O A;  2WYL A;  5LLD A;  2NYP A;  2NZF A;  4KEP A;  3WXC A;  4Z6X A;  5LMC A;  5K4N A;  3X2Y A;  1K07 A;  4GCW A;  5EVB A;  2ZWR A;  1M2X A;  5AXR A;  4HL2 A;  4C1F A;  3IOF A;  5ACV A;  3X2X A;  1JT1 A;  4F6Z A;  5FQA A;  5B1U A;  2E7Y A;  3SFP A;  4C1D A;  5ACR A;  2FU6 A;  2GMN A;  4D1U A;  4NQ4 A;  4RM5 A;  4O98 A;  4AX1 B;  2BG8 B;  3T3O A;  4YSL A;  5LCA A;  3MD7 A;  5LM6 A;  5AEB A;  5A0T A;  4NQ2 A;  5EW0 A;  1VGN A;  1A8T A;  1QH3 A;  2OHH A;  4XWW A;  2WYM C;  4RAM A;  3PG4 A;  3VQZ A;  4C1C A;  4J5F A;  1DD6 A;  2FHX A;  3G1P A;  4UAM A;  4XUK A;  5HH5 A;  3IOG A;  3T9M A;  4Z5Y A;  1YCH A;  3PY6 A;  4RL0 A;  3KNS A;  1WUO A;  4TZF A;  2P4Z A;  3RKJ A;  3A4Y A;  3AF5 A;  1DXK A;  5LSC A;  4RAW A;  3Q6V A;  2H6A A;  4C1E A;  2XF4 A;  3BK2 A;  2QED A;  1YCF A;  4NQ5 A;  5FQC A;  5HIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...