4AWYB

Crystal structure of the mobile metallo-beta-lactamase aim-1 from pseudomonas aeruginosa: insights into antibiotic binding and the role of gln157
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
270
structure length
270
Chain Sequence
ASRGCADDAGWNDPAMPLKVYGNTWYVGTCGISALLVTSDAGHILVDAATPQAGPQILANIRALGFRPEDVRAIVFSHEHFDHAGSLAELQKATGAPVYARAPAIDTLKRGLPDRTDPQFEVAEPVAPVANIVTLADDGVVSVGPLALTAVASPGHTPGGTSWTWRSCEGDDCRQMVYADSLTAISDDVFRYSDDAAHPGYLAAFRNTLARVAALDCDILVTPHPSASGLWNRIGPRAAAPLMDTTACRRYAQGARQRLEKRLAEEAATS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METALLO-BETA-LACTAMASE AIM-1
publication title Crystal Structure of the Mobile Metallo-Beta-Lactamase Aim-1 from Pseudomonas Aeruginosa: Insights Into Antibiotic Binding and the Role of Gln157
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 97
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4awyB00
4EFZA 1ZKPA 3I15A 2ZNBA 4NQ2A 1WUOA 2Q0JA 3RKKA 3ZR9A 2QDSA 2YNVB 3IE0A 4PVOA 2FK6A 5K4KA 4EYFA 2YNWA 5DPXA 5EHTA 4B87A 1WUPA 2FHXA 3WXCA 5LSCA 5A5ZA 4JO0A 1A8TA 2FU6A 1Y44A 4NQ5A 5ACTA 4J5FA 4V0HA 2XR1A 4O98A 5ACRA 1SMLA 3I14A 4XWTA 1E5DA 3F9OA 5AYAA 4Z5ZA 3I13A 3SBLA 5A0VA 5HH4A 4AWZA 3VPEA 4TZ9A 3X30A 4UBQA 1ZTCA 4NQ4A 4BZ3A 1X8HA 2NZEA 4ZO3A 5HIQA 3RPCA 4FR7A 5K4NA 4HL2A 2M5DA 4KEPA 4Z60A 4YSBA 4EXYA 3T3NA 4DIKA 3IOFA 5EVKA 1A7TA 3T9MA 3IDZA 5B3RA 1XTOA 4F6HA 3IE1A 1JT1A 2BG7A 1QH3A 1M2XA 2WYMA 2YNVA 3ZWFA 2Q0IA 2FU9A 5B1UA 5HH5A 2QDTA 4Z5YA 3X2ZA 3AF6A 4C09A 5LCAA 3S0ZA 4CHLA 4C1HA 5B15A 5HISA 4PVTA 1BVTA 4UWPB 3RKJA 4J5HA 1QH5A 4GCWA 2XF4A 5ACVA 3PY5A 3KL7A 4TZBA 2BG8A 5LS3A 5HH6A 2BFZB 5ACPA 4RAMA 5LLDA 4YSLA 3H3EA 3X2XA 3ESHA 2WRSA 3ZQ4A 2OHHA 4GYUA 3IE2A 1VMEA 2M5CA 2R2DA 5ACWA 2P97A 5ACXA 3TP9A 5KILA 2Q9UA 5ACSA 4GYQA 5KIKA 5K4MA 4TZEA 4C1FA 2AIOA 3A4YA 3L6NA 1BMCA 4TZFA 5AEBA 2H6AA 4AX1B 3I11A 4D1UA 5LM6A 4Z6XA 3JXPA 2BC2A 2ZO4A 2Q42A 1YCFA 3DH8A 3IOGA 3BK2A 3X2YA 2QJSA 4UWRB 3SRXA 1X8IA 3I0VA 2FU7A 1JJEA 2OHIA 5AXRA 2YNTA 2YZ3A 4EY2A 4HL1A 1WRAA 3AJ3A 5FQAA 2Y8AA 3MD7A 4C1DA 4XWWA 3P2UA 2NZFA 4D1WA 4D1TA 2NXAA 2P18A 4RBSA 3FCZA 3IELA 4WD6A 2HB9A 4P62A 5AHOA 5FQCA 4KEQA 4AD9A 3SD9A 2WHGA 5FQBA 4RL0A 1ZNBA 2BR6A 2Y8BA 2FHXB 3BK1A 1HLKA 2BFLA 3PY6A 5LE1A 2VW8A 5HIPA 4TYTA 4HKYA 5EV8A 4D02A 2I7XA 3BC2A 2QEDA 4ZEJA 5EVBA 2BMIA 1VGNA 5ACUA 4RL2A 1K07A 3ADRA 4F6ZA 5ACQA 4C1EA 1KO2A 5A0TA 2DKFA 4ZO2A 4UWOB 1KR3A 4C1CA 2BTNA 2WYLA 3AF5A 4U4LA 3ZNBA 1VJNA 1BC2A 5AXOA 4UAMA 1P9EA 2YNUA 2BG6A 3R2UA 1YCGA 3G1PA 4YSKA 2GFKA 4EYBA 2FM6A 5LCFA 2BGAA 2E7YA 2A7MA 3LVZA 3IEMA 4FEKA 2FU8A 1DXKA 5IQKA 5K0WA 2ZZIA 1DD6A 3QH8A 3DHCA 2BG8B 4FSBA 4UA4A 2BG2A 4Z7RA 5EV6A 3DHBA 1MQOA 2WYMC 5EW0A 2OHJA 3PG4A 3KNSA 4ZNBA 4H0DA 2ZWRA 4D1VA 3IEKA 2BFZA 5EH9A 5HIOA 1YCHA 4RM5A 3VQZA 1WW1A 1XM8A 3SW3A 4UWSB 3SFPA 5AHRA 2I7VA 3Q6VA 4BP0A 4LE6A 3KNRA 2I7TA 4EXSA 5LCHA 2Y87A 1KO3A 3FAIA 4Z67A 1JJTA 5EVDA 5A87A 1X8GA 2AZ4A 4TYFA 1DDKA 2CBNA 1L9YA 2BIBA 2DOOA 4XUKA 2GMNA 2GFJA 3T3OA 2BFKA 4AWYB 2GCUA 2GKLA 2YNTB 3SPUA 3DHAA 4NQ6A 2NYPA 4AX0B 4C1GA 2P4ZA 2UYXA 2P1EA 5EWAA 3BV6A 2QINA 4DILA 5LMCA 4RAWA 2YCBA 4EYLA
chains in the Genus database with same CATH superfamily
4EFZA 1ZKPA 3I15A 2ZNBA 4NQ2A 1WUOA 2Q0JA 3RKKA 3ZR9A 2QDSA 2YNVB 3IE0A 4PVOA 2FK6A 5K4KA 4EYFA 2YNWA 5DPXA 5EHTA 4B87A 1WUPA 2FHXA 3WXCA 5LSCA 5A5ZA 4JO0A 1A8TA 2FU6A 1Y44A 4NQ5A 5ACTA 4J5FA 4V0HA 2XR1A 4O98A 5ACRA 1SMLA 3I14A 4XWTA 1E5DA 3F9OA 5AYAA 4Z5ZA 3I13A 3SBLA 2CFZA 5A0VA 5HH4A 4AWZA 3VPEA 4TZ9A 3X30A 4UBQA 1ZTCA 4NQ4A 4BZ3A 1X8HA 2NZEA 4ZO3A 5HIQA 3RPCA 4FR7A 5K4NA 4HL2A 2M5DA 4KEPA 4Z60A 4YSBA 4EXYA 3T3NA 4DIKA 3IOFA 5EVKA 1A7TA 3T9MA 3IDZA 5B3RA 1XTOA 4F6HA 3IE1A 1JT1A 2BG7A 1QH3A 1M2XA 2WYMA 2YNVA 3ZWFA 2Q0IA 2FU9A 5B1UA 5HH5A 2QDTA 4Z5YA 3X2ZA 3AF6A 4C09A 5LCAA 3S0ZA 4CHLA 4C1HA 4AXHA 5B15A 5HISA 4PVTA 1BVTA 4UWPB 3RKJA 4J5HA 1QH5A 4GCWA 2XF4A 5A23A 5ACVA 3PY5A 3KL7A 4TZBA 5AIJA 2BG8A 5LS3A 5HH6A 2BFZB 5ACPA 4RAMA 5LLDA 4YSLA 3H3EA 3X2XA 3ESHA 2WRSA 3ZQ4A 2OHHA 4GYUA 3IE2A 1VMEA 2M5CA 2R2DA 5ACWA 2P97A 5ACXA 3TP9A 5KILA 2Q9UA 5ACSA 4GYQA 5KIKA 5K4MA 4TZEA 4C1FA 2AIOA 3A4YA 3L6NA 1BMCA 4TZFA 5AEBA 2H6AA 4AX1B 3I11A 4D1UA 5LM6A 4Z6XA 3JXPA 2BC2A 2ZO4A 2Q42A 1YCFA 2CG3A 3DH8A 3IOGA 3BK2A 3X2YA 2QJSA 4UWRB 3SRXA 1X8IA 3I0VA 2FU7A 1JJEA 2OHIA 5AXRA 2YNTA 2YZ3A 4EY2A 4HL1A 1WRAA 3AJ3A 5FQAA 2Y8AA 3MD7A 4C1DA 4XWWA 3P2UA 2NZFA 4D1WA 4D1TA 2NXAA 2P18A 4RBSA 3FCZA 3IELA 4WD6A 2HB9A 4P62A 5AHOA 5FQCA 4KEQA 4AD9A 3SD9A 2WHGA 5FQBA 4RL0A 2CG2A 1ZNBA 2BR6A 2Y8BA 2FHXB 3BK1A 4PDXA 1HLKA 2BFLA 3PY6A 5LE1A 2VW8A 5HIPA 4TYTA 4HKYA 5EV8A 4D02A 2I7XA 3BC2A 2QEDA 4ZEJA 5EVBA 2BMIA 1VGNA 5ACUA 4RL2A 1K07A 3ADRA 4F6ZA 5AJLA 5ACQA 4C1EA 1KO2A 2YHEA 5A0TA 2DKFA 4ZO2A 4UWOB 1KR3A 4C1CA 2BTNA 2WYLA 3AF5A 4U4LA 3ZNBA 1VJNA 1BC2A 5AXOA 4UAMA 1P9EA 2YNUA 2BG6A 3R2UA 1YCGA 3G1PA 4YSKA 2GFKA 4EYBA 2FM6A 5LCFA 2BGAA 2E7YA 2A7MA 3LVZA 3IEMA 4FEKA 2FU8A 1DXKA 5IQKA 5K0WA 2ZZIA 1DD6A 3QH8A 2CFUA 3DHCA 2BG8B 4FSBA 4UA4A 2BG2A 4Z7RA 5EV6A 3DHBA 1MQOA 2WYMC 5EW0A 2OHJA 3PG4A 3KNSA 4ZNBA 4H0DA 2ZWRA 4D1VA 3IEKA 2BFZA 5EH9A 5HIOA 1YCHA 4RM5A 3VQZA 1WW1A 1XM8A 4NURA 3SW3A 4UWSB 3SFPA 4AV7A 5AHRA 2I7VA 3Q6VA 4BP0A 4LE6A 3KNRA 2I7TA 4EXSA 5LCHA 2Y87A 1KO3A 3FAIA 4Z67A 1JJTA 5EVDA 5A87A 1X8GA 2AZ4A 4TYFA 1DDKA 2CBNA 1L9YA 2BIBA 2DOOA 4XUKA 2GMNA 2GFJA 3T3OA 2BFKA 4AWYB 2GCUA 2GKLA 2YNTB 3SPUA 3DHAA 4NQ6A 2NYPA 4AX0B 4C1GA 2P4ZA 2UYXA 2P1EA 5EWAA 3BV6A 2QINA 4DILA 5LMCA 4RAWA 2YCBA 4EYLA
chains in the Genus database with same CATH topology
4EFZA 1ZKPA 3I15A 2ZNBA 4NQ2A 1WUOA 2Q0JA 3RKKA 3ZR9A 2QDSA 2YNVB 3IE0A 4PVOA 2FK6A 5K4KA 4EYFA 2YNWA 5DPXA 5EHTA 4B87A 1WUPA 2FHXA 3WXCA 5LSCA 5A5ZA 4JO0A 1A8TA 2FU6A 1Y44A 4NQ5A 5ACTA 4J5FA 4V0HA 2XR1A 4O98A 5ACRA 1SMLA 3I14A 4XWTA 1E5DA 3F9OA 5AYAA 4Z5ZA 3I13A 3SBLA 5A0VA 5HH4A 4AWZA 3VPEA 4TZ9A 3X30A 4UBQA 1ZTCA 4NQ4A 4BZ3A 1X8HA 2NZEA 4ZO3A 5HIQA 3RPCA 4FR7A 5K4NA 4HL2A 2M5DA 4KEPA 4Z60A 4YSBA 4EXYA 3T3NA 4DIKA 3IOFA 5EVKA 1A7TA 3T9MA 3IDZA 5B3RA 1XTOA 4F6HA 3IE1A 1JT1A 2BG7A 1QH3A 1M2XA 2WYMA 2YNVA 3ZWFA 2Q0IA 2FU9A 5B1UA 5HH5A 2QDTA 4Z5YA 3X2ZA 3AF6A 4C09A 5LCAA 3S0ZA 4CHLA 4C1HA 5B15A 5HISA 4PVTA 1BVTA 4UWPB 3RKJA 4J5HA 1QH5A 4GCWA 2XF4A 5ACVA 3PY5A 3KL7A 4TZBA 2BG8A 5LS3A 5HH6A 2BFZB 5ACPA 4RAMA 5LLDA 4YSLA 3H3EA 3X2XA 3ESHA 2WRSA 3ZQ4A 2OHHA 4GYUA 3IE2A 1VMEA 2M5CA 2R2DA 5ACWA 2P97A 5ACXA 3TP9A 5KILA 2Q9UA 5ACSA 4GYQA 5KIKA 5K4MA 4TZEA 4C1FA 2AIOA 3A4YA 3L6NA 1BMCA 4TZFA 5AEBA 2H6AA 4AX1B 3I11A 4D1UA 5LM6A 4Z6XA 3JXPA 2BC2A 2ZO4A 2Q42A 1YCFA 3DH8A 3IOGA 3BK2A 3X2YA 2QJSA 4UWRB 3SRXA 1X8IA 3I0VA 2FU7A 1JJEA 2OHIA 5AXRA 2YNTA 2YZ3A 4EY2A 4HL1A 1WRAA 3AJ3A 5FQAA 2Y8AA 3MD7A 4C1DA 4XWWA 3P2UA 2NZFA 4D1WA 4D1TA 2NXAA 2P18A 4RBSA 3FCZA 3IELA 4WD6A 2HB9A 4P62A 5AHOA 5FQCA 4KEQA 4AD9A 3SD9A 2WHGA 5FQBA 4RL0A 1ZNBA 2BR6A 2Y8BA 2FHXB 3BK1A 1HLKA 2BFLA 3PY6A 5LE1A 2VW8A 5HIPA 4TYTA 4HKYA 5EV8A 4D02A 2I7XA 3BC2A 2QEDA 4ZEJA 5EVBA 2BMIA 1VGNA 5ACUA 4RL2A 1K07A 3ADRA 4F6ZA 5ACQA 4C1EA 1KO2A 5A0TA 2DKFA 4ZO2A 4UWOB 1KR3A 4C1CA 2BTNA 2WYLA 3AF5A 4U4LA 3ZNBA 1VJNA 1BC2A 5AXOA 4UAMA 1P9EA 2YNUA 2BG6A 3R2UA 1YCGA 3G1PA 4YSKA 2GFKA 4EYBA 2FM6A 5LCFA 2BGAA 2E7YA 2A7MA 3LVZA 3IEMA 4FEKA 2FU8A 1DXKA 5IQKA 5K0WA 2ZZIA 1DD6A 3QH8A 3DHCA 2BG8B 4FSBA 4UA4A 2BG2A 4Z7RA 5EV6A 3DHBA 1MQOA 2WYMC 5EW0A 2OHJA 3PG4A 3KNSA 4ZNBA 4H0DA 2ZWRA 4D1VA 3IEKA 2BFZA 5EH9A 5HIOA 1YCHA 4RM5A 3VQZA 1WW1A 1XM8A 3SW3A 4UWSB 3SFPA 5AHRA 2I7VA 3Q6VA 4BP0A 4LE6A 3KNRA 2I7TA 4EXSA 5LCHA 2Y87A 1KO3A 3FAIA 4Z67A 1JJTA 5EVDA 5A87A 1X8GA 2AZ4A 4TYFA 1DDKA 2CBNA 1L9YA 2BIBA 2DOOA 4XUKA 2GMNA 2GFJA 3T3OA 2BFKA 4AWYB 2GCUA 2GKLA 2YNTB 3SPUA 3DHAA 4NQ6A 2NYPA 4AX0B 4C1GA 2P4ZA 2UYXA 2P1EA 5EWAA 3BV6A 2QINA 4DILA 5LMCA 4RAWA 2YCBA 4EYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EFZ A;  1ZKP A;  3I15 A;  2ZNB A;  4NQ2 A;  1WUO A;  2Q0J A;  3RKK A;  3ZR9 A;  2QDS A;  2YNV B;  3IE0 A;  4PVO A;  2FK6 A;  5K4K A;  4EYF A;  2YNW A;  5DPX A;  5EHT A;  4B87 A;  1WUP A;  2FHX A;  3WXC A;  5LSC A;  5A5Z A;  4JO0 A;  1A8T A;  2FU6 A;  1Y44 A;  4NQ5 A;  5ACT A;  4J5F A;  4V0H A;  2XR1 A;  4O98 A;  5ACR A;  1SML A;  3I14 A;  4XWT A;  1E5D A;  3F9O A;  5AYA A;  4Z5Z A;  3I13 A;  3SBL A;  5A0V A;  5HH4 A;  4AWZ A;  3VPE A;  4TZ9 A;  3X30 A;  4UBQ A;  1ZTC A;  4NQ4 A;  4BZ3 A;  1X8H A;  2NZE A;  4ZO3 A;  5HIQ A;  3RPC A;  4FR7 A;  5K4N A;  4HL2 A;  2M5D A;  4KEP A;  4Z60 A;  4YSB A;  4EXY A;  3T3N A;  4DIK A;  3IOF A;  5EVK A;  1A7T A;  3T9M A;  3IDZ A;  5B3R A;  1XTO A;  4F6H A;  3IE1 A;  1JT1 A;  2BG7 A;  1QH3 A;  1M2X A;  2WYM A;  2YNV A;  3ZWF A;  2Q0I A;  2FU9 A;  5B1U A;  5HH5 A;  2QDT A;  4Z5Y A;  3X2Z A;  3AF6 A;  4C09 A;  5LCA A;  3S0Z A;  4CHL A;  4C1H A;  5B15 A;  5HIS A;  4PVT A;  1BVT A;  4UWP B;  3RKJ A;  4J5H A;  1QH5 A;  4GCW A;  2XF4 A;  5ACV A;  3PY5 A;  3KL7 A;  4TZB A;  2BG8 A;  5LS3 A;  5HH6 A;  2BFZ B;  5ACP A;  4RAM A;  5LLD A;  4YSL A;  3H3E A;  3X2X A;  3ESH A;  2WRS A;  3ZQ4 A;  2OHH A;  4GYU A;  3IE2 A;  1VME A;  2M5C A;  2R2D A;  5ACW A;  2P97 A;  5ACX A;  3TP9 A;  5KIL A;  2Q9U A;  5ACS A;  4GYQ A;  5KIK A;  5K4M A;  4TZE A;  4C1F A;  2AIO A;  3A4Y A;  3L6N A;  1BMC A;  4TZF A;  5AEB A;  2H6A A;  4AX1 B;  3I11 A;  4D1U A;  5LM6 A;  4Z6X A;  3JXP A;  2BC2 A;  2ZO4 A;  2Q42 A;  1YCF A;  3DH8 A;  3IOG A;  3BK2 A;  3X2Y A;  2QJS A;  4UWR B;  3SRX A;  1X8I A;  3I0V A;  2FU7 A;  1JJE A;  2OHI A;  5AXR A;  2YNT A;  2YZ3 A;  4EY2 A;  4HL1 A;  1WRA A;  3AJ3 A;  5FQA A;  2Y8A A;  3MD7 A;  4C1D A;  4XWW A;  3P2U A;  2NZF A;  4D1W A;  4D1T A;  2NXA A;  2P18 A;  4RBS A;  3FCZ A;  3IEL A;  4WD6 A;  2HB9 A;  4P62 A;  5AHO A;  5FQC A;  4KEQ A;  4AD9 A;  3SD9 A;  2WHG A;  5FQB A;  4RL0 A;  1ZNB A;  2BR6 A;  2Y8B A;  2FHX B;  3BK1 A;  1HLK A;  2BFL A;  3PY6 A;  5LE1 A;  2VW8 A;  5HIP A;  4TYT A;  4HKY A;  5EV8 A;  4D02 A;  2I7X A;  3BC2 A;  2QED A;  4ZEJ A;  5EVB A;  2BMI A;  1VGN A;  5ACU A;  4RL2 A;  1K07 A;  3ADR A;  4F6Z A;  5ACQ A;  4C1E A;  1KO2 A;  5A0T A;  2DKF A;  4ZO2 A;  4UWO B;  1KR3 A;  4C1C A;  2BTN A;  2WYL A;  3AF5 A;  4U4L A;  3ZNB A;  1VJN A;  1BC2 A;  5AXO A;  4UAM A;  1P9E A;  2YNU A;  2BG6 A;  3R2U A;  1YCG A;  3G1P A;  4YSK A;  2GFK A;  4EYB A;  2FM6 A;  5LCF A;  2BGA A;  2E7Y A;  2A7M A;  3LVZ A;  3IEM A;  4FEK A;  2FU8 A;  1DXK A;  5IQK A;  5K0W A;  2ZZI A;  1DD6 A;  3QH8 A;  3DHC A;  2BG8 B;  4FSB A;  4UA4 A;  2BG2 A;  4Z7R A;  5EV6 A;  3DHB A;  1MQO A;  2WYM C;  5EW0 A;  2OHJ A;  3PG4 A;  3KNS A;  4ZNB A;  4H0D A;  2ZWR A;  4D1V A;  3IEK A;  2BFZ A;  5EH9 A;  5HIO A;  1YCH A;  4RM5 A;  3VQZ A;  1WW1 A;  1XM8 A;  3SW3 A;  4UWS B;  3SFP A;  5AHR A;  2I7V A;  3Q6V A;  4BP0 A;  4LE6 A;  3KNR A;  2I7T A;  4EXS A;  5LCH A;  2Y87 A;  1KO3 A;  3FAI A;  4Z67 A;  1JJT A;  5EVD A;  5A87 A;  1X8G A;  2AZ4 A;  4TYF A;  1DDK A;  2CBN A;  1L9Y A;  2BIB A;  2DOO A;  4XUK A;  2GMN A;  2GFJ A;  3T3O A;  2BFK A;  4AWY B;  2GCU A;  2GKL A;  2YNT B;  3SPU A;  3DHA A;  4NQ6 A;  2NYP A;  4AX0 B;  4C1G A;  2P4Z A;  2UYX A;  2P1E A;  5EWA A;  3BV6 A;  2QIN A;  4DIL A;  5LMC A;  4RAW A;  2YCB A;  4EYL A; 
#chains in the Genus database with same CATH topology
 4EFZ A;  1ZKP A;  3I15 A;  2ZNB A;  4NQ2 A;  1WUO A;  2Q0J A;  3RKK A;  3ZR9 A;  2QDS A;  2YNV B;  3IE0 A;  4PVO A;  2FK6 A;  5K4K A;  4EYF A;  2YNW A;  5DPX A;  5EHT A;  4B87 A;  1WUP A;  2FHX A;  3WXC A;  5LSC A;  5A5Z A;  4JO0 A;  1A8T A;  2FU6 A;  1Y44 A;  4NQ5 A;  5ACT A;  4J5F A;  4V0H A;  2XR1 A;  4O98 A;  5ACR A;  1SML A;  3I14 A;  4XWT A;  1E5D A;  3F9O A;  5AYA A;  4Z5Z A;  3I13 A;  3SBL A;  2CFZ A;  5A0V A;  5HH4 A;  4AWZ A;  3VPE A;  4TZ9 A;  3X30 A;  4UBQ A;  1ZTC A;  4NQ4 A;  4BZ3 A;  1X8H A;  2NZE A;  4ZO3 A;  5HIQ A;  3RPC A;  4FR7 A;  5K4N A;  4HL2 A;  2M5D A;  4KEP A;  4Z60 A;  4YSB A;  4EXY A;  3T3N A;  4DIK A;  3IOF A;  5EVK A;  1A7T A;  3T9M A;  3IDZ A;  5B3R A;  1XTO A;  4F6H A;  3IE1 A;  1JT1 A;  2BG7 A;  1QH3 A;  1M2X A;  2WYM A;  2YNV A;  3ZWF A;  2Q0I A;  2FU9 A;  5B1U A;  5HH5 A;  2QDT A;  4Z5Y A;  3X2Z A;  3AF6 A;  4C09 A;  5LCA A;  3S0Z A;  4CHL A;  4C1H A;  4AXH A;  5B15 A;  5HIS A;  4PVT A;  1BVT A;  4UWP B;  3RKJ A;  4J5H A;  1QH5 A;  4GCW A;  2XF4 A;  5A23 A;  5ACV A;  3PY5 A;  3KL7 A;  4TZB A;  5AIJ A;  2BG8 A;  5LS3 A;  5HH6 A;  2BFZ B;  5ACP A;  4RAM A;  5LLD A;  4YSL A;  3H3E A;  3X2X A;  3ESH A;  2WRS A;  3ZQ4 A;  2OHH A;  4GYU A;  3IE2 A;  1VME A;  2M5C A;  2R2D A;  5ACW A;  2P97 A;  5ACX A;  3TP9 A;  5KIL A;  2Q9U A;  5ACS A;  4GYQ A;  5KIK A;  5K4M A;  4TZE A;  4C1F A;  2AIO A;  3A4Y A;  3L6N A;  1BMC A;  4TZF A;  5AEB A;  2H6A A;  4AX1 B;  3I11 A;  4D1U A;  5LM6 A;  4Z6X A;  3JXP A;  2BC2 A;  2ZO4 A;  2Q42 A;  1YCF A;  2CG3 A;  3DH8 A;  3IOG A;  3BK2 A;  3X2Y A;  2QJS A;  4UWR B;  3SRX A;  1X8I A;  3I0V A;  2FU7 A;  1JJE A;  2OHI A;  5AXR A;  2YNT A;  2YZ3 A;  4EY2 A;  4HL1 A;  1WRA A;  3AJ3 A;  5FQA A;  2Y8A A;  3MD7 A;  4C1D A;  4XWW A;  3P2U A;  2NZF A;  4D1W A;  4D1T A;  2NXA A;  2P18 A;  4RBS A;  3FCZ A;  3IEL A;  4WD6 A;  2HB9 A;  4P62 A;  5AHO A;  5FQC A;  4KEQ A;  4AD9 A;  3SD9 A;  2WHG A;  5FQB A;  4RL0 A;  2CG2 A;  1ZNB A;  2BR6 A;  2Y8B A;  2FHX B;  3BK1 A;  4PDX A;  1HLK A;  2BFL A;  3PY6 A;  5LE1 A;  2VW8 A;  5HIP A;  4TYT A;  4HKY A;  5EV8 A;  4D02 A;  2I7X A;  3BC2 A;  2QED A;  4ZEJ A;  5EVB A;  2BMI A;  1VGN A;  5ACU A;  4RL2 A;  1K07 A;  3ADR A;  4F6Z A;  5AJL A;  5ACQ A;  4C1E A;  1KO2 A;  2YHE A;  5A0T A;  2DKF A;  4ZO2 A;  4UWO B;  1KR3 A;  4C1C A;  2BTN A;  2WYL A;  3AF5 A;  4U4L A;  3ZNB A;  1VJN A;  1BC2 A;  5AXO A;  4UAM A;  1P9E A;  2YNU A;  2BG6 A;  3R2U A;  1YCG A;  3G1P A;  4YSK A;  2GFK A;  4EYB A;  2FM6 A;  5LCF A;  2BGA A;  2E7Y A;  2A7M A;  3LVZ A;  3IEM A;  4FEK A;  2FU8 A;  1DXK A;  5IQK A;  5K0W A;  2ZZI A;  1DD6 A;  3QH8 A;  2CFU A;  3DHC A;  2BG8 B;  4FSB A;  4UA4 A;  2BG2 A;  4Z7R A;  5EV6 A;  3DHB A;  1MQO A;  2WYM C;  5EW0 A;  2OHJ A;  3PG4 A;  3KNS A;  4ZNB A;  4H0D A;  2ZWR A;  4D1V A;  3IEK A;  2BFZ A;  5EH9 A;  5HIO A;  1YCH A;  4RM5 A;  3VQZ A;  1WW1 A;  1XM8 A;  4NUR A;  3SW3 A;  4UWS B;  3SFP A;  4AV7 A;  5AHR A;  2I7V A;  3Q6V A;  4BP0 A;  4LE6 A;  3KNR A;  2I7T A;  4EXS A;  5LCH A;  2Y87 A;  1KO3 A;  3FAI A;  4Z67 A;  1JJT A;  5EVD A;  5A87 A;  1X8G A;  2AZ4 A;  4TYF A;  1DDK A;  2CBN A;  1L9Y A;  2BIB A;  2DOO A;  4XUK A;  2GMN A;  2GFJ A;  3T3O A;  2BFK A;  4AWY B;  2GCU A;  2GKL A;  2YNT B;  3SPU A;  3DHA A;  4NQ6 A;  2NYP A;  4AX0 B;  4C1G A;  2P4Z A;  2UYX A;  2P1E A;  5EWA A;  3BV6 A;  2QIN A;  4DIL A;  5LMC A;  4RAW A;  2YCB A;  4EYL A; 
#chains in the Genus database with same CATH homology
 4EFZ A;  1ZKP A;  3I15 A;  2ZNB A;  4NQ2 A;  1WUO A;  2Q0J A;  3RKK A;  3ZR9 A;  2QDS A;  2YNV B;  3IE0 A;  4PVO A;  2FK6 A;  5K4K A;  4EYF A;  2YNW A;  5DPX A;  5EHT A;  4B87 A;  1WUP A;  2FHX A;  3WXC A;  5LSC A;  5A5Z A;  4JO0 A;  1A8T A;  2FU6 A;  1Y44 A;  4NQ5 A;  5ACT A;  4J5F A;  4V0H A;  2XR1 A;  4O98 A;  5ACR A;  1SML A;  3I14 A;  4XWT A;  1E5D A;  3F9O A;  5AYA A;  4Z5Z A;  3I13 A;  3SBL A;  5A0V A;  5HH4 A;  4AWZ A;  3VPE A;  4TZ9 A;  3X30 A;  4UBQ A;  1ZTC A;  4NQ4 A;  4BZ3 A;  1X8H A;  2NZE A;  4ZO3 A;  5HIQ A;  3RPC A;  4FR7 A;  5K4N A;  4HL2 A;  2M5D A;  4KEP A;  4Z60 A;  4YSB A;  4EXY A;  3T3N A;  4DIK A;  3IOF A;  5EVK A;  1A7T A;  3T9M A;  3IDZ A;  5B3R A;  1XTO A;  4F6H A;  3IE1 A;  1JT1 A;  2BG7 A;  1QH3 A;  1M2X A;  2WYM A;  2YNV A;  3ZWF A;  2Q0I A;  2FU9 A;  5B1U A;  5HH5 A;  2QDT A;  4Z5Y A;  3X2Z A;  3AF6 A;  4C09 A;  5LCA A;  3S0Z A;  4CHL A;  4C1H A;  5B15 A;  5HIS A;  4PVT A;  1BVT A;  4UWP B;  3RKJ A;  4J5H A;  1QH5 A;  4GCW A;  2XF4 A;  5ACV A;  3PY5 A;  3KL7 A;  4TZB A;  2BG8 A;  5LS3 A;  5HH6 A;  2BFZ B;  5ACP A;  4RAM A;  5LLD A;  4YSL A;  3H3E A;  3X2X A;  3ESH A;  2WRS A;  3ZQ4 A;  2OHH A;  4GYU A;  3IE2 A;  1VME A;  2M5C A;  2R2D A;  5ACW A;  2P97 A;  5ACX A;  3TP9 A;  5KIL A;  2Q9U A;  5ACS A;  4GYQ A;  5KIK A;  5K4M A;  4TZE A;  4C1F A;  2AIO A;  3A4Y A;  3L6N A;  1BMC A;  4TZF A;  5AEB A;  2H6A A;  4AX1 B;  3I11 A;  4D1U A;  5LM6 A;  4Z6X A;  3JXP A;  2BC2 A;  2ZO4 A;  2Q42 A;  1YCF A;  3DH8 A;  3IOG A;  3BK2 A;  3X2Y A;  2QJS A;  4UWR B;  3SRX A;  1X8I A;  3I0V A;  2FU7 A;  1JJE A;  2OHI A;  5AXR A;  2YNT A;  2YZ3 A;  4EY2 A;  4HL1 A;  1WRA A;  3AJ3 A;  5FQA A;  2Y8A A;  3MD7 A;  4C1D A;  4XWW A;  3P2U A;  2NZF A;  4D1W A;  4D1T A;  2NXA A;  2P18 A;  4RBS A;  3FCZ A;  3IEL A;  4WD6 A;  2HB9 A;  4P62 A;  5AHO A;  5FQC A;  4KEQ A;  4AD9 A;  3SD9 A;  2WHG A;  5FQB A;  4RL0 A;  1ZNB A;  2BR6 A;  2Y8B A;  2FHX B;  3BK1 A;  1HLK A;  2BFL A;  3PY6 A;  5LE1 A;  2VW8 A;  5HIP A;  4TYT A;  4HKY A;  5EV8 A;  4D02 A;  2I7X A;  3BC2 A;  2QED A;  4ZEJ A;  5EVB A;  2BMI A;  1VGN A;  5ACU A;  4RL2 A;  1K07 A;  3ADR A;  4F6Z A;  5ACQ A;  4C1E A;  1KO2 A;  5A0T A;  2DKF A;  4ZO2 A;  4UWO B;  1KR3 A;  4C1C A;  2BTN A;  2WYL A;  3AF5 A;  4U4L A;  3ZNB A;  1VJN A;  1BC2 A;  5AXO A;  4UAM A;  1P9E A;  2YNU A;  2BG6 A;  3R2U A;  1YCG A;  3G1P A;  4YSK A;  2GFK A;  4EYB A;  2FM6 A;  5LCF A;  2BGA A;  2E7Y A;  2A7M A;  3LVZ A;  3IEM A;  4FEK A;  2FU8 A;  1DXK A;  5IQK A;  5K0W A;  2ZZI A;  1DD6 A;  3QH8 A;  3DHC A;  2BG8 B;  4FSB A;  4UA4 A;  2BG2 A;  4Z7R A;  5EV6 A;  3DHB A;  1MQO A;  2WYM C;  5EW0 A;  2OHJ A;  3PG4 A;  3KNS A;  4ZNB A;  4H0D A;  2ZWR A;  4D1V A;  3IEK A;  2BFZ A;  5EH9 A;  5HIO A;  1YCH A;  4RM5 A;  3VQZ A;  1WW1 A;  1XM8 A;  3SW3 A;  4UWS B;  3SFP A;  5AHR A;  2I7V A;  3Q6V A;  4BP0 A;  4LE6 A;  3KNR A;  2I7T A;  4EXS A;  5LCH A;  2Y87 A;  1KO3 A;  3FAI A;  4Z67 A;  1JJT A;  5EVD A;  5A87 A;  1X8G A;  2AZ4 A;  4TYF A;  1DDK A;  2CBN A;  1L9Y A;  2BIB A;  2DOO A;  4XUK A;  2GMN A;  2GFJ A;  3T3O A;  2BFK A;  4AWY B;  2GCU A;  2GKL A;  2YNT B;  3SPU A;  3DHA A;  4NQ6 A;  2NYP A;  4AX0 B;  4C1G A;  2P4Z A;  2UYX A;  2P1E A;  5EWA A;  3BV6 A;  2QIN A;  4DIL A;  5LMC A;  4RAW A;  2YCB A;  4EYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...