4AX3A

Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
456
structure length
456
Chain Sequence
AKLPGDFGPPRGEPIHAVLTSPPLVPPPVNRTYPAKVIVELEVVEKEMQISEGVSYTFWTFGGTVPGSFIRVRQGDTVEFHLKNHPSSKMPHNIDLHGVTGPGGGAASSFTAPGHESQFTFKALNEGIYVYHCATAPVGMHIANGMYGLILVEPPEGLPKVDHEYYVMQGDFYTAGKYREKGLQPFDMEKAIDERPSYVLFNGAEGALTGDKALHAKVGETVRIFVGNGGPNLVSSFHVIGAIFDQVRYEGGTNVQKNVQTTLIPAGGAAVVKFTARVPGSYVLVDHSIFRAFNKGAMAILKIDGAENKLVYSGKELDSVYLGDRAAPNMSAVTKATQASVSGTLTVQDQVQAGRALFAGTCSVCHQGNGAGLPGVFPPLAKSDFLAADPKRAMNIVLHGLNGKIKVNGQEYDSVMPPMTQLNDDEVANILTYVLNSWDNPGGRVSAEDVKKVRAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Structures of protein-protein complexes involved in electron transfer.
pubmed doi rcsb
source organism Ralstonia pickettii
molecule tags Oxidoreductase
total genus 146
structure length 456
sequence length 456
chains with identical sequence B, C, D
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2012-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
A PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 4ax3A03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ax3A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4ax3A02
4E9RA 3ZOWA 1A8ZA 1KYAA 1NIFA 1RZ6A 1ZIBA 3H56A 5KKZB 4A67A 1VLXA 1AZUA 5CIDB 2BP8B 1CRGA 1IC0A 2JQRA 3NBTA 4EIFA 3X1GA 1URIA 1JDLA 5AKRA 5IY5B 4P5SA 4YSRA 4K9JA 4GYBA 5B1BB 5E9NA 3BCCD 3IN0A 2OCCB 1CHIA 4YSDA 4F2EA 1J9SA 3D12B 1FWXA 3NSFA 4A68A 4F7KA 2MHMA 1I54A 3ZOYA 1JERA 4WQ7A 3NSYA 3X2QB 2FT6A 6PAZA 2B10B 1HRCA 1NIAA 1CC3A 2FT7A 2VMJA 1KYOD 5B1KA 2D0SA 1OV8A 3NJJA 3RMZA 1H9XA 5TK2A 4A2HA 4Y5RA 5PCYA 2XV3A 1YEBA 2YAMA 3ASNB 1KYOW 2XXFA 3X1EA 2Q5BA 5KAFV 3T6VA 1YLBB 3SLEA 3FQ2A 2GC4C 1WA1X 4X4KA 1SFHA 3FSAA 1N15A 3CU4A 4AKQA 5I6LA 4YVNA 5H2FV 5A7EA 3ABGA 1BXUA 1PY0A 3FPXA 3ORVA 1CRCA 1ILUA 5AURA 4GP8B 4Q5PA 2IBZD 1EB7A 5KAIV 1N50A 4NB7A 1DW2A 2BCNB 4E9YA 3L74D 2AFNA 5B7MA 2CALA 2WO2B 4KO7A 2PCFA 4AALA 1A8CA 1DVHA 1NPNA 2VN3A 2XWZA 3EH4B 1OCCB 4YSSA 1NICA 2JFCA 5ANHA 2BP0B 4JHUA 5B5EV 2EXVA 4A2FA 4JCGA 2J5WA 4WQ9A 5I6KA 4QLWA 3PPSA 1CORA 1HH7A 2DVHA 4E9QA 4FA7B 1H32A 2IWFA 1C52A 4AKPA 1ZDSA 2EIKB 5C0ZA 3NJKA 3PLYA 2FWLA 1L9OA 3ZIYA 1GSKA 1YTCA 3PXWA 1DW1A 4G7QB 4BK5C 2A3TA 4UB8V 351CA 4PAZA 4BWTA 2HX7A 2XU9A 2MTAC 4A2EA 4GYDA 1KX7A 3BQVA 1ZV2A 1W2LA 1NIBA 1DT1A 3L4MA 1GYCA 4O1WA 5FC9A 3UAEA 4HZ1A 5TK4A 1B7VA 3L45A 1E67A 3DP5A 3HQ6A 1NIEA 5D4HA 2FQGA 1HJ3A 4H0KA 4P5RA 3CVCA 4GP5B 1PAZA 2YQBA 2DY2A 2PP9A 2IH8A 1KBWA 2B12B 1AZNA 155CA 2Q9OA 1ETJA 2PACA 3VYMA 1LC1A 5DJQC 5DJQB 1CRJA 3WFEC 1F56A 2AXTV 2GI0A 2IDFA 2PPDA 4FA1A 5AZUA 3NJNA 1AZRA 6PCYA 1C7MA 1WS7A 1PNCA 1JOIA 3IEAA 4HAKA 1SDDB 1C2RA 4FB1A 1BXAA 5I5IA 4DP5X 1CIHA 2PPEA 1NTKD 2QT6A 1MZ4A 4UF7C 2X88A 1JVLA 1N68A 1ZZHA 1OCOB 1RZQA 1QL3A 1I8OA 2GC7D 1EZVD 1LC2A 2GBAA 3PXTA 1GKSA 1OF0A 4WTQA 1E29A 4P4QB 5IY51 1M56B 1WA2X 1BYOA 5AFAA 1H9YA 1E2RA 1J5CA 2HRGA 1ADWA 1JZFA 2DGEA 1AS8A 1ZIAA 1NIRA 2VW7A 1A2SA 4WQ8A 1OAEA 1PLCA 3FYIB 3H1HD 1JZEA 3WU2V 1HROA 1AAJA 3QJVB 3DTUB 1HZUA 4BWWA 2I8FA 1CC5A 3PAZA 4PD4D 3OCDA 2YAFA 2CA4B 2PCCB 2ZXYA 1M60A 4EIDA 1CSXA 3NWVA 4V2KA 2P80A 2N9JA 3ABMB 4L3GA 1ET7A 4MU8A 2FNWA 3WI9A 5B1AB 3C75A 1I6EA 4FA4A 2VM3A 3CDZB 1C6OA 1HAWA 5F7AA 2XVBA 1SHXA 4HCFA 1FI9A 1OE1A 4NERA 3TBCA 3HEIB 3JBTB 3CYTI 2B0ZB 4G71B 4DPBX 1DIQC 1XB6A 4A2GA 1BL9A 4N4YB 4A66A 1N90A 1BQKA 2GSMB 1CRYA 4QKTA 3FU8A 5I6OA 4BDVB 1J5DA 2BW5A 2PLTA 4AAMA 4GY4A 1HJ5A 1IRVA 1GR7A 2HXAA 3DR0A 3IE9A 3PCYA 2N0MA 3QJRB 3QJUB 2YAHA 2QJPB 3O5CA 1KB0A 1AACA 2B11B 3SVWA 1PMYA 2CXBA 2CA3B 1KCBA 3ZDWA 1NZRA 4HCIA 4HALA 1AIZA 1QLEB 2XV0A 1CO6A 1CSWA 1GIWA 2BLFB 1JXGA 1MG3C 3FQYA 4D6TD 3PAVA 3FU7B 4AKOA 1AOFA 4WQDA 1DZ0A 2PPCA 2E86A 2ZXWB 3PAUA 3H1LD 4WKXA 3WC8A 4FA9A 4EF3A 1H31B 2UXTA 4DP2X 2BHFA 2GIWA 4JHVA 1PPJD 2BW4A 1LS9A 1QYZA 1H33A 4W1TA 5KLVD 3SBRA 1CTYA 4UB6V 1CYXA 5B1JC 3OQRA 2HV4A 1BQRA 3WG7B 1L9JC 1GY1A 5B7FA 1RAQA 3FPYA 4H0JA 1QL4A 3ERXA 2FQDA 2R7EA 1GS8A 2X87A 2EINB 1EHKB 1M57B 4WQEA 2XV2A 5I6MA 4N8UA 4U3FD 1J3SA 2HX8A 3GXUB 1K3GA 5PAZA 3ZX1A 1KCWA 4DP0X 3TYIA 2EIMB 4YSEA 1J9RA 1H1OA 1L9QA 1XB8A 1IBYA 1NPJA 2YCCA 3WIAA 3QJTB 1L0ND 2EILB 3HB3B 1QHQA 3UGEA 7PCYA 1BGYD 1DW0A 2AI5A 2FRCA 1RZ5A 1CXCA 2FT8A 4DP1X 1MDAA 1FJ0A 1W8EA 3UABA 2FTAA 3AG3B 2QJKB 1WS8A 1NTZD 3FQ1A 1SQBD 3FT0A 2P80D 2CAKA 2JTIB 3A9FA 2LLNA 3OMNB 2N18C 2C1UA 2N18B 3V9CA 2QDVA 2GC7C 2IDQA 1AG6A 1JZHA 3DMIA 3OA8A 1L9RA 1MZYA 5CIEB 2BCCD 1ASOA 3OD3A 1FOCA 2YXVA 2MTAA 3AZUA 2PPAA 4KOBA 1S6VB 2ZONA 1KX2A 1KDJA 3H1JD 2YXWA 3SQRA 1NWPA 1IRWA 3QQXA 1R0QA 1PZBA 1YNRA 2QPEB 2RACA 1HFUA 1AS7A 1CIEA 3AW5A 3JT2A 3WFCC 4CSPA 1AZBA 5CIFB 1IUZA 2V07A 3NBSA 2UXGA 3CG8A 3N2JA 2YAEA 2XX1A 3L73D 1FCDC 2C2CA 4AANA 1KIBA 1XMEB 2BZ7A 1DIIC 3QJQB 3CXHW 3H1KD 1J9QA 1PNDA 1BCCD 3S3CB 1ZPUA 4MFHA 2I85A 2UXVA 1CCHA 1FI3A 1CYWA 4E9SA 1BQ5A 1SJMA 1W6WA 3ZCFA 4BWUA 1CHHA 1F1FA 1HCMA 3CX5W 1NINA 2VHDA 1WEJF 1OCRB 1SF5A 1V10A 1CTJA 3GDCA 1CYCA 3CWBD 2AANA 4DP6X 4YL4A 2EIJB 5DF5A 2CJ3A 3A0HV 4IL6V 3PXLA 4GP4B 1H32B 1WA0X 2HRHA 5E79V 4WQBA 5D4IA 3T71A 4KOCA 4E9XA 4NAJA 3IBOA 1U75B 4RSZA 2FWLB 2CE0A 1FHBA 2YK3A 4ZK8A 3ASOB 4JKNA 2BPBB 2GB2A 2UX6A 4DP8X 4PW9B 1SQQD 3EH3B 4EIEA 2C1DA 1ASPA 1X9RA 4Q89A 3H4HA 3O1YA 2OZ1A 4RH4A 3G5WA 2QJYB 4AAOA 2J56A 3KW7A 1EZLA 451CA 1I53A 5C9MA 1CUOA 2OV0A 2VW4A 1E65A 3AY2A 2LIRA 2YAQA 4DPAX 3SXTA 3M97X 2I7SA 3AG2B 3HQ9A 4G7RB 5B3SB 1M6ZA 2HX9A 5KLIB 1IQCA 1YCCA 1BXVA 2A06D 2C1VA 3ZOXA 1F1CA 3RN0A 1E8EA 2I7OA 2XYBA 1NWOA 2B3IA 2FQEA 2TSBA 1OCZB 4E9WA 5EHFA 1BE3D 1N9CA 1AOQA 1I8PA 3NSCA 2YIUB 1HZVA 1NU1D 4YSAA 1C6RA 2BH4X 1IO3A 3WKQA 4BXVA 3O0RC 4CSZA 2VW6A 1IZL0 2PP8A 4EICA 2JXMA 3EH5B 2DYSB 4ENZA 3OMIB 5B7EA 5I5MA 2FJSA 3H1ID 1CXAA 3CVBA 1RKRA 3QPKA 1V55B 2BP8A 2ORLA 1NTDA 4FA5A 1CYJA 3UACA 2UXFA 4YSTA 1NMIA 3WUIA 4GXFA 1RAPA 3NJGA 1A4CA 1W5CT 3ZBMA 3OCDB 5CIBB 1ZDQA 1LFMA 1C2NA 2DYRB 1WAEA 2IWKA 2JKWA 1KB9D 2QPDB 4L0PB 1KBVA 3AG1B 2PCBB 2TSAA 1AZCA 5DFSA 5CIHB 1SQXD 1CSVA 1HAUA 3NP4A 1SQVD 2YAOA 1AKKA 5I26A 2BZCA 2BWIA 1SQPD 1IBZA 2BH5X 1TKWA 5CIGB 1ETPA 1SHWA 3NJMA 1SNRA 3SBQA 3FS9A 3VNWA 3T6WA 1M70A 1A4AA 1TU2A 1PZCA 1P84D 2AVFA 1K3HA 2WSDA 3CP5A 3NJFA 4AX3A 1YEAA 4PJ0V 4F2FA 5B66V 4DP7X 2DWSA 2IAAC 4GEDB 4L3HA 3DKHA 4DP9X 1NMLA 1LMSA 3ABKB 2ZOOA 4N0KA 3KW8A 2ZBOA 2B08A 3T6ZA 1MG2D 1L0LD 5EXQA 1KDIA 3FSVA 2VSMB 2ZZS1 1CRIA 5GTIV 3CZUB 1KGYE 3NSDA 3V9EA 3PH2B 1CCRA 2BP0A 4G72B 1PCSA 4J20A 1L9SA 1NTMD 3A0BV 3TBBA 2PPFA 3KZIV 9PCYA 5TISV 1GQ1A 3WFDC 5I6NA 4PWAA 1SF3A 3FSZA 3RLMA 1W6LA 3EHBB 1X9UA 4HIPA 2LITA 4M4RB 1H33B 4DY9A 2VSKB 1NIDA 3QJSB 2AZUA 2XLLA 2Y69B 2J57A 3SBPA 1CTZA 3AG4B 1L9PA 1BYPA 1RCYA 2D0WA 1S5LV 3WNIA 5GTHV 4KNTA 2R7EB 3RYMA 3WNJA 3FYEB 4W9ZA 1GY2A 1SFDA 4KNUA 1GDVA 1JVOA 2VM4A 3HQ8A 4G7SB 4E9VA 1N70A 1OCDA 4KO9A 1KV9A 1A3ZA 1ASQA 1OOWA 1PLBA 3CXHD 4YVUA 3TA4D 3TASA 3UADA 4YE1A 2AIUA 3PXSA 2PP7A 4G70B 2OJ1A 4UANA 1NDTA 3X1NA 1CURA 4DP4X 2CUAA 3MBWB 1MG3D 1JZGA 2FYUD 3CX5D 2C9XB 1ILSA 1HJ4A 1GJQA 1CSUA 3JTBA 2N3YA 1DVVA 1PP9D 2QDWA 1ID2A 3N55A 3NP3A 2IWEA 3H4FA 2B4ZA 2XX0A 3RN1A 1OE3A 1VYDA 1XB3A 2IDSA 1SDDA 2BO0A 4L1QA 1ET5A 1MZZA 1QKSA 2DV6A 2W8CA 2GB8B 4FANA 3L75D 1CIGA 1DW3A 1I5TA 1PF3A 3S8GB 3OA8B 4PCYA 3T9WA 4KNSA 1ET8A 1UATA 3HQ7A 4AZUA 1M9WA 2C8SA 1WVEC 2FQFA 3BVDB 3S3DB 1CEDA 2GC4D 2H5UA 2W88A 2CE1A 2J55A 1COTA 1IKOP 1OE2A 5D4JA 4UAHA 2BGVX 3WKPA 4QAOA 2ZONG 2NRDA 3MX0B 1L9TA 4YSOA 1T5KA 1TEGA 1PLAA 1R1CA 1CYIA 2MRYA 1FI7A 4YSCA 2Y1AA 4YSPA 5B6QA 1I55A 3X1FA 1KV7A 4KO6A 1CIFA 1RZPA 2WO3B 3TU6A 1QNIA 4M3HA 2BWDA 3NJHA 2XXGA 7PAZA 1CRHA 3S3BB 1GS6X 1AS6A 2HZHA 1C6SA 1AG0A 2L4DA 1A4BA 1BAWA 3L72D 3SJLA 3FSWA 4TXVB 1ZRTD 3DIVA 3SWSA 4HHWA 2CCWA 4KO5A 4A2DA 1DYZA 1FFTB 1E5YA 3CDZA 3T6XA 3U25A 8PAZA 1AYGA 3UAAA 1E30A 4XXLA 3NJIA 3FU9A 3NJLA 1AQ8A 2HLEB 1B3IA 3OM3B 4WQCA 1GS7A 4BDVA 5I28A 3NT0A 1I6DA 2V08A 1GU2A 1QN2A 3L70D 5CYTR 2C1DB 3MK7B 3MK7C 3O20A 4FAVA 5CICB 1BEXA 2GIMA 1YFCA 2IDUA 2OZ1B 3L4OA 4KMGA 1JZJA 1MG2C 3C2CA 2CBPA 1GW0A 1NNOA 2UX7A 3X1BA 4YSUA 4LJIA 3X39A 3ZOOA 1TEFA 4HCGA 1A56A 1C75A 1L9BC 1U74B 1E5ZA 1PZAA 3NYKA 4DPCX 3GYRA 1YICA 2YARA 1CHJA 1JXDA 1CNOA 3VRDA 2DWTA 3L71D 4WQAA 2PCYA 3ABLB 4XYDB 2XUWA 3EF4A 2IH9A 3FU7A 4HHGA 5I5JA 1JXFA 1YIQA 4K3IA 2GHZA 4FAAB 2N9IA 2H3XC 3OMAB 2N3BA 4YSQA 1AOZA 1H31A 1AANA 2FYNB 1FA4A 3TGUD 4Q8BA 2AZAA 1A65A 2H47C 5F7BA 4NFGB 4AI7A 4BXSV 5LDUA 1AR1B 3S8FB 2XTSB 5B1JA 4E9TA 5I6PA 2ZWNA 2IDTA 4O1QA 3WFBC 1V54B 3CVDA 3IN2A 1J9TA 2YAPA 1JZIA
chains in the Genus database with same CATH superfamily
1TVHA 2P8LB 3RKDD 4QJ5B 4KDWA 2A9CA 3WFDL 2V8MA 3VFVA 2YD6A 2NPLX 4OVVA 4QNPF 5CIDB 4BQ8A 1TJIH 2YOCA 4I3RL 5EIVA 4XRCB 2YKKA 1WAAE 2H1LM 3NRQA 4MCYB 3ULUE 2JQAA 2NX5E 1J12A 5FDYA 4JEGB 4Y9GA 2E9GA 2VNCA 5K39B 6PAZA 1SEBB 4XNMA 3UJTL 2B10B 4MJIA 1EJOL 1NFDA 2HFFA 3C6LB 1FNHA 4ZQKA 1AY1L 1YEEH 4P4RA 4F1SA 2ZXCA 4W9JC 1FH5L 1ROWA 3EAKA 3O3EA 3QQ9C 4L37A 2DMGA 3WUZA 3L5HA 1QA9B 1RPUA 1TU2B 3MGAA 4PRIE 3ORVA 1FBIH 2DAVA 4FQJH 5E7FA 3HLKA 5AWNH 4G80A 4DPRA 5L8LB 3BRGC 2BSCA 3DJ9A 4S1RH 1CB4A 2HG5B 4NM4H 3ZK0A 4JY4A 1XH3B 2HJKB 5D72L 2DF3A 4UAOC 4W9CC 3ZY7A 4AUYA 3IDNB 4YK4C 4FTVE 4PWJA 3AT0A 4LSSH 5FDWB 3V4PH 3VYNA 5I1LB 4Q9RH 3MU3A 2MWCA 1X5ZA 3PWPA 2K70A 2ESVA 4FFWD 4WGWB 4A7SA 5F7UA 4Y1AB 2ZT9C 1QSFB 3BEWB 5FYJH 1U4EA 2MQCA 1ETZA 2IWFA 2JJTC 4MDRA 2VQ1B 1MNNA 3Q43A 4LQFH 3B7RL 4PAZA 4XNYH 3DVIA 3QJHA 4FEMA 5TQ0L 2FGWH 3IDYC 2GUOB 1JL8A 3E9TA 1EGJH 2XA8H 3GZKA 1KFAH 4AT6B 1B7VA 3ILQC 4PJEF 4HXAH 3UAJA 1BFVL 4HJ1A 4XAWH 1I7RA 5GRVK 4GAGL 1PAZA 2GJRA 4B5ZA 3MTRA 1JCKA 1MPAH 2P5PA 4JG0H 4KROC 5KVDL 3KPPA 2OULB 1FIGH 4KH9A 4XPGL 5KAQF 5EA0H 2WKOF 2C34A 3OV6A 5JPMC 5FV2A 3P9MB 3C6SA 3OKOA 4AV4A 1UYWL 4GBXA 2D3LA 2GY7B 5CXPA 1IZJA 1BOGA 1I8AA 1MJ7L 3JTTA 3VD4A 2I9LB 4ELMA 5CHNA 4P9HL 1LO3L 4OLEA 3HUJB 3IFLH 3QWQB 2V17L 1LC2A 2VIRB 4HFWA 4YHNB 4WTQA 4WO4C 3LV3B 1OAQH 1YVLA 2FIKB 2XNAA 5EH1A 5ESQB 5F2FA 3GMNB 3S5ZA 2YJQA 5KYUA 1OTSC 3HVDA 3DI2B 4U1IB 4LSTH 4UIMA 5H2BA 2P3YA 1TTCA 1V7ML 3WELA 2G5UA 3I3DA 3L08A 4YHOL 4JZNA 1DJWA 2VCOA 3ULVC 1HN1A 4OLWH 3ATFA 5DWUH 4I3SH 4LQ1A 4TTDD 2K8QA 3TJPA 4Z7WB 4I5BA 4PTUB 3HEIB 1E4XI 2BVTA 4H4NA 2V5MA 4OLZL 1DIQC 4GW4A 5T1DH 4ABQA 2F19H 3BWAA 3A24A 4IDLA 3TGXA 3DVNB 4QEGA 4IOSA 3DR0A 3RVTD 2NXYD 3RU8H 3R0MA 4ZXBA 1V05A 3N85L 2MIZA 5IIEB 4R3SA 4NIYE 3KGRA 1BFOA 2CXBA 4DVBB 4EN3C 2Y5QA 5L8JB 3PP4L 3R06B 2XV0A 1CO6A 5DF0A 3ZDYF 2NOYA 4L8SB 3U2SA 5H35B 3L7FA 2NY1C 4XPHH 3T1FA 3ARBB 4WQDA 5SWQA 3DJRA 3FU0A 1AD0B 5A2AA 3WE1A 1O0VA 2H4EA 2ROXA 2J21A 1PKQA 2BJMH 4MAYB 4HHAB 4O02A 5KANI 5C08A 1U8NB 2CZNA 4UB6V 3ECVA 3V6OC 5ITFB 1AGCB 3MV01 5F93C 5FHAL 1O5DT 4CILA 2R69H 4G82A 1NCWL 1UXWB 2VXQH 4IOFC 4Q2ZB 5F9WC 4DTGH 2WUBH 3KPRA 3B5HA 3GWJA 4YL9A 1H5BA 1MCEA 5EU7E 3ML9A 1E43A 4I3GA 4OJCA 3I50L 4IIZA 5DVMA 2VXSL 1LO0L 1ZLVH 1AE6H 1VFBB 3IETB 4XT1C 1XMWA 2V0AA 3DVGB 1XB8A 3KPSB 1IQWH 1CICA 1YY8B 2BS9A 3SO3C 5AOKA 4FYTA 1L0ND 1D9KC 3AS3A 2E4TA 5BO1H 4NQTA 4WY7H 1WHPA 3LMJH 1RZ5A 2WJ5A 2KLSA 3L3HA 2AXFB 1E4JA 1WS8A 4DOHB 4JFYA 1VGEH 3NFPB 5SV4A 1NCIA 2Z4TA 1OGTA 3TCLA 3E2HB 4KOBA 2O6CA 4F8QA 1DO5A 1KDJA 4G1MA 4D9QD 1BD2E 5FUCC 1NC4D 2DH2A 3DRQA 4UZSA 4XNXL 4OZ4B 1JMZA 1G7IB 3JT2A 4JFEE 4JK0D 3UO1H 1SYSA 5GRWA 1PX8A 1XGYL 2UXGA 4AM0A 3VXNB 1HXYB 5TF1H 5I1IL 1BCCD 2V7NB 4N8VG 2GSIA 3TCXA 3TT1L 1IAIL 1ZVSB 3C8KA 2LR4A 5C0BA 1WGVA 1XF3B 2AERT 2QSTA 3GDCA 2VLME 3LPPA 4EXPX 1BLIA 1HT6A 2VDMB 4LLVB 2PMZA 5ILTL 3TN0D 1E40A 4N3UA 3T71A 4KOCA 1X5MA 4RSZA 1Y18B 4YLCA 1M6OB 4JGNA 4M6NH 5KN5A 4N0YH 3SYPA 5EF1A 1QD0A 3NUKA 2A74B 2J56A 3KW7A 2YKLH 4MX7B 5HHMB 4PJ8C 3PGDB 4JM4L 1I4FB 2C3HA 4KVCL 3SXTA 3O2DA 2RBLA 3HQ9A 5J3HC 3MVSA 5IROC 1X3DA 3KL3A 2AK4D 3JVGA 4IRSC 4Z3IA 3L95B 2QVTA 2TSBA 2O5YH 1BE3D 1AOQA 3VRIB 1M2OA 4HUXB 1WC7A 1JF1A 3TYGH 2XTJD 2CK0L 1FRGH 1XZ0A 3D06A 2LGNA 3QUYD 4OSUL 2IFFH 1LP9B 2TAAA 5GSVA 1A6UL 1CGSL 5CZXD 4MDJB 5EU6D 3B1UA 3PDOA 4FX5A 4K0OA 3EYOB 3DHPA 4WGVB 3TYFA 5FYLL 4KXCA 5GHWL 1A4CA 3PP3H 4AEHH 1OAXH 4JY6B 3CX5K 2AF2A 3MI6A 4G6KH 3EJPA 2JKWA 5DS8B 4HAGA 1OGAE 1FVDA 3CTTA 5DFSA 2CDGA 3T4AC 4H13C 4O2FB 3GRBA 2F9BT 2GY5A 2KI6A 3H6JA 4I18C 1CLYH 2BZCA 2M26A 3RZWA 5IEKA 5DUML 5CR1A 4GB9A 2DLIA 1TLMA 5IW3A 2KZ1B 2B16A 2UY6B 3WY2A 1HI6A 4DZBA 3Q8BA 4DKDC 4O51B 1BHGA 3B3BA 3C09B 5IV2A 2FBJL 4OM1L 1A7PH 1ODUA 4NLHA 1YNKL 4OIIH 2O5XH 5JDSA 3GIVB 4JQIL 3E3QC 4NHUA 5T3XE 2J8UA 1CF8H 4WWKB 2DQDL 2R1WA 2PTTA 3V4LA 1RFDL 3CZUB 4Z95H 8FABA 4NQXB 4JFPB 2DDQL 2OMWA 1IEBB 1WZAA 3CDYA 2W60A 2H1PL 1TETH 1JGUL 1H33B 1IGCH 2QFPA 4XOEA 2WNWA 1T0NA 3PHOA 3QYNA 1SPDA 1I1CA 5GGSB 4IS6A 1N5YL 1FNGA 2J6EA 3WNJA 5HPMA 5D6DA 4AQ8A 3FYEB 3VCLA 5F8QC 3QHFH 3O6FC 4WDIB 4FZEL 2NLJA 5CCGE 3QZWB 3ILDA 1OPOA 3FFCB 2DQFA 4AI7A 3OZKA 1O5PA 3FQXA 3BQUC 4UQCA 3UJJH 2X89D 3GI9H 2PYFB 3MJ8B 4FQXB 2GBUA 3TIDB 3ZDYB 4PW4A 4K9EL 2FZ3A 2FIRT 1YQVL 3QXAA 2FX7H 1KB9K 4V11A 4LEXH 5TD4A 1TXKA 4NFDA 1F6AB 4DGUA 4L1QA 2NW3B 3IDJA 3W9EB 1JFQH 1UFGA 1CXKA 1MIML 5EO0B 4IRJA 5HI4C 1JTTA 2BRQA 1YPZF 2WTOA 3QORA 2ZX6A 4W6YB 3BVDB 2H5UA 4WUUA 4FMFA 2WQVA 4UAHA 5E2WL 3F5WB 1MY5A 3N1FC 4QAOA 1RJZA 1N3NA 2DJ4A 3MOQA 3CBRA 3EO1A 2MRYA 3CN4A 2WO3B 3VFMB 5DD3L 3SPGA 3TCTA 1G9EA 3TF7C 1AS6A 1RJLA 2HZHA 1RK1A 1L4IA 4M93C 4F3FB 5ICYB 2NYYD 2PYED 3IXTA 1MAKA 4ADIA 1HHJA 5FOBA 3VXMB 3KG5A 4B3VA 1XAKA 1QBAA 1DN2A 3IMBA 3B4NA 4NWTL 4FTVD 4H44C 4X80H 5IW6A 3C5SB 5DWPA 5EMYA 3WY4A 4WEBH 5JW4R 5C3LD 1HE8A 5T1LD 3U79A 2ITEA 5C0AB 4DEUA 2FSDA 2IDUA 5TDOB 3H55A 3PDDA 5HYQA 4JO3H 4M6MH 4FQ2L 5TPWL 3X39A 5KSUA 4NM8H 1ECYA 2YD4A 4IJ3C 3VWJC 3QULA 1NDMB 2YARA 2CO3A 4FERA 3S6CA 3CSGA 1ZD6A 4XVTL 1P53A 3FU7A 5HHVH 3VFOA 5D6CB 3OKLB 5I19H 4KDTA 4PJHA 4IBLT 3OMAB 4YSQA 3HE6D 3DXAE 3WGVB 3S48A 1JV2B 4NFGB 3JWDC 1GW6A 3LKPA 3QZLA 4CVZB 3C5JA 4IEFA 5E9DB 1J10A 4MGXA 5I6PA 1HL4A 1Z7JA 1YA5A 3K46A 1CLZL 4MD0B 5DVPA 2ITCB 3S98A 2NY2C 2CKBB 5TE6L 2OBGA 5E2VH 2N7AA 3GMLA 5HVFB 1UWGH 4MMYB 3U9PH 1CD1A 4UTAA 4YHIA 4X5RA 1M05B 1U8MA 5DI8A 4LASL 5CBAB 4OM0L 2VSCA 3BGAA 4PGEB 4MZ2A 3X2QB 2ADFH 1IIKA 5ID0B 5E9AA 5FUZH 4A7QA 2C7UA 2VMJA 5DO2C 1PJWA 2OR7A 3C6LC 4HMEA 3U7YL 4AXWA 4B9ZA 3DROB 2APXA 5TK2A 2ZNXA 1E28A 4JRWA 5DEJA 5JYLA 1HL9A 4Z76A 3OKMB 1NMAL 1YLBB 4BZYA 2NY7H 4F80A 1JDCA 3ESOA 4NQEA 2HLFC 4ZUSB 4GXUN 1V7NL 1B88A 1CL7H 1VEMA 4C55A 4OKDA 3FPXA 4FABH 3D39B 4O5LL 5AW6B 5E95B 1WHOA 3FT2A 5AURA 3MA7B 2FR4B 5EOTB 2VLKE 1P7KA 1CI5A 2IBZD 4J1UA 3CHRA 1WFTA 1DDHA 4F2ME 2WO2B 4OIBA 3U7AA 2EDKA 1OCCB 1NICA 3QEUB 2JFCA 3T0EE 4B9GA 4GKOA 4K73A 2ITDB 1QNZH 4N8CH 1IM9D 4PRHD 4X6CE 5T1MB 1G0DA 25C8L 4EBQL 4ZG1A 2LU4A 4P5KA 3K2UH 5J6GB 1X44A 1C5DA 5CGYD 2WJ7A 2IGFL 1KPUA 3H3PL 4ELMF 3BDYH 3EOBB 4CC4C 3D6GA 3VFGL 1DVQA 1AD9B 1GSKA 4UB8V 2KZKA 4K5PA 1U92A 4XCCH 5I1AB 2W0FB 4N20A 2CNZA 2GFBB 4UQ3A 1TQUA 3AQXA 4GYDA 4A2EA 5BV7H 1R0AH 3MJ7B 4PLKD 2R0WL 5IBLD 1S7UB 2BRRL 1DBBH 2BDNH 3DP5A 3RWJA 4UQAA 2O5NA 3ZGIA 2GCYB 3QUMB 1LEGA 5DUBB 4OFYD 4GUPB 2J1ZA 12E8L 2CU9A 3NJNA 1COBA 4HQQL 2O93L 1RMFH 2NMSA 2QVKA 3WEBA 3ATBA 3DVFA 4YHPA 3UJIL 2VE6B 1IBGL 2UZXA 3DDGA 5BRZE 5I0DA 2VXVH 2E46A 1CS6A 2CE6A 3F7RA 4I9XA 3VI3A 5KEZA 4BEIA 4Y5YB 1QL3A 1CU4L 2OMZA 5K9OA 2O6PA 2KYIA 2IBZY 5A3ID 5AB2A 1WITA 4KKLC 3O8XA 5D1XC 3FH7A 1AS8A 4BIKA 1JNNH 4MSWB 4L4VE 3KPTA 1QWUA 5LAXB 1ESOA 4I0PB 4NZRH 4RAVB 4TYUA 4BH7B 1BMWA 1G7JA 2QV2A 1C8PA 2HUHA 3L6FB 3DTUB 4TUKL 1UWYA 3DSFH 4U1SA 4ZMPA 4MHHI 2KLTA 1CFSA 2XV6B 4NZUL 1PEZA 3EJUA 2AEPH 1FSKB 1KNOB 4NZDA 1Y6MR 3KWWB 4TQIA 4ZO7A 1RIUL 2NZ9D 3E6HB 1E4XH 1NSNL 3FQTA 2FGZA 3C60B 1C6OA 3N0PB 4KHXL 3K0YA 1OAZH 1T03L 3UTTE 4NX0A 3ZYZA 2JI2A 2O5ZH 4G8FB 4IU2B 5KWYC 4I48A 3MCLL 3W9DA 2VZ1A 4XCYA 4AAMA 4NO0D 4U6HB 1HJ5A 1IRVA 1UM5H 2HXAA 1YPZB 2YWZA 4P23A 4LSPL 3IMRA 1ZT4A 2ZKYA 4Z8FL 1XSJA 4KJYB 2EYTA 3ZDWA 1NL0H 1QHPA 5M7QA 4JCWA 2XICA 4PCKA 2BHZA 1CSWA 2DQUH 5J5EA 4L8SC 2R0LH 2VXUH 3ARBC 1X4XA 2BVPB 4RFOH 5LVEA 2E86A 1Q9WA 4MXWL 5DK2B 1E0OB 3H1LD 3CZKA 1U95B 5EFIA 5LBVA 1AKJD 1BQSA 1FNFA 1LNUB 3FTGB 2BHFA 3CGTA 5DEGA 3VMNA 4MAYC 3D85A 2YEZA 3BWUF 3TT3H 4NAMA 2APVA 5DRZA 3S3PA 5B1JC 3DV6B 3DO3A 4PVBA 2HV4A 1DZBA 1BM3L 1S7SB 4FNSA 1TVHB 1DVFD 3FO2A 3ZSTA 1T7WA 4K8RH 4PS7A 4YE4L 3HG5A 4KU1A 1EHKB 1TTBA 1SLUA 3VDCA 1J3SA 4Q52A 2P28B 1NQBA 5E5UB 1FF5A 4L05A 4S1DD 2OAAA 1HWHB 3IWVA 4B96A 5FCUL 3IDMA 4ENEC 1E8YA 4PTTA 7PCYA 2C9XA 5IREA 1RZ7L 2F5AH 4IKKA 4APXA 4XNMB 5KS9A 4MJIB 5H94A 5E6UB 2EICA 1NFDB 2HFFB 4ZQKB 2BY1A 4OLVL 4P4RB 1SQBD 3FUHA 2CAKA 1G7PA 3BVUA 1OT2A 2RALA 3O3EB 4L37B 2WVUA 5EUOE 1EDQA 1MFNA 3E2HC 2BM3A 2OSXA 2R2HA 1KACB 2Y06H 3NIFF 1RVFH 1FCGA 1K6QL 1I7UA 2FECI 5EOCL 3BN9C 3K5SA 3D52A 4FHBD 4G80B 5EIQA 2MCMA 1GCYA 1P7HL 1RXLA 4KTDH 1J18A 3BYYA 2R27A 1MFDL 4TNEA 3QO0A 3LZNA 2C2CA 2BZ7A 3QJQB 4JY4B 1BG1A 1F58H 1GGCL 4LEEA 2I85A 4S2SA 4WHYG 2IOOA 2PCPA 2WWMC 5ITBL 4XO9A 1MW2A 4MA8L 4PJXA 4UOJA 2X53A 3PWPB 3X11A 2ESVB 4DP6X 4Z3EA 4RA3A 1AOHA 3QWRD 5DQ9A 1ZGLP 2MNWA 1NUGA 4J2QA 1EZUA 2B20A 4TPRH 3GT6A 1ETZB 1ZLWK 4TQHA 1UGNA 3DHJA 3ULVL 4L1LA 2X7LA 1FG2A 2BS71 2YZ1A 4HCRH 3QJHB 3PWLA 2OYKA 1MHHA 2XPZA 5KVFE 4H8PA 2BSTA 1NDGA 4BKLA 2A74C 1FYTE 2BXYA 4X7EC 3I9GL 1CUOA 2Q76A 2R29H 1I7RB 2VDRB 4I85A 1U3HA 5C0JA 4KZDL 4IRZH 4G7RB 5I0YA 2H6OA 3KPPB 2HX9A 5JW3L 1HKLH 3HMXL 1OT1A 4AG4L 5DJ2A 3C6SB 3ZOXA 1E8EA 3RN0A 3OKOB 4HJIA 3QCVH 4GBXB 1A1NA 1UADC 3HC0A 2FSEA 4KNQA 3LHAA 1CDCA 3RG1C 4R2GB 3UBXG 1BOGB 1UZGA 1K4DA 3JTTB 3NSCA 2EO1A 2DQIL 2YIUB 4AQZA 3HNVL 4GKZA 5JHDE 4P2RA 5CHNB 3W82A 4ELMB 3TONA 1NCOA 1FGNL 1WO2A 4HFWB 4TLTA 3EH5B 3VGHA 5GZOD 2XNAB 4KI5D 5KYUB 4L48A 4DT2A 3FQRA 1G87A 5H2BB 2J8UF 3T2NL 3GSRA 3WUIA 2CWRA 4QHNA 5CJOH 4YSTA 1MWAH 1XF1A 2YPVL 3VUAA 4EZKA 1ZDQA 4JZNB 2DYRB 4M1DL 3TVMD 3RDJA 4BFNA 2QPDB 4LPVA 4KKAC 4DK5A 1OAUH 3O4LE 2Q8BH 1WCQA 4JY5H 4I5BB 3IDGA 1ETPA 1HCVA 1K5NA 4GW4B 4KMLB 1FO0A 4K3JH 3ZZ1A 4X4ME 2IAMA 3BWAB 1X9LA 1VACA 1C1EL 1UACH 1DQDL 3EOTL 1ITCA 3C09C 3D0LA 1JFHA 1ND0A 4ZXBB 3RNQA 4R3SB 1NMLA 1MCBA 1BFOB 2YC1A 4TVUA 4XCNA 3GRWA 5EZOL 1PZ2A 4WWKC 3L2LA 3U2SB 4PRNA 3L7FB 1NFKA 1FAIL 5HHOE 3T1FB 3GUFA 3LRSA 2DMHA 3A6BL 2IG2L 3CSBA 5T5FH 3IJYA 3KPNA 1G7LA 3MUUA 3PH2B 5SWQB 2JJUA 3A0BV 3FTSA 3GM8A 2Y7SA 5TISV 3B37A 3UPRA 1PKQB 4GPVA 1JK9A 4TUUA 1DL7H 1YN7A 4O02B 5F72S 1QFWM 5C08B 1U8LA 1TIUA 4JKWA 5AKVA 4XP4L 2B39A 4PUBH 1XSIA 1Q1PA 1RCYA 1CGWA 3I6GA 4FLSA 3BZFA 4ONFH 5MEOA 3KPRB 1FNEA 5HYJE 1B0RA 1H5BB 4LCWE 2WBKA 1OKEA 3OAZK 4U1JA 4ZQTA 4LARH 5KVEE 1DLFL 2FJHA 5KYNA 1OCDA 1NCDL 2BIPA 2YD3A 3TASA 3PXSA 4GMSH 1CICB 2OJ1A 5DGQA 1JGEA 3TF4A 4FQXC 3CX5D 4YBQD 1YNTA 4W68A 2N3YA 1PP9D 3CFKA 3L3HB 3KYNA 1KTBA 2J25A 3MTXA 2X4TA 4DFIA 4JFYB 1OE3A 2HSIA 4U6VL 2X6VA 1DJXA 3BMWA 2DTML 1QKSA 5C0RL 5MEQA 4UWQB 1PF3A 4OCXL 4XGZA 5HJBA 4CDGC 1F1DA 4PCYA 1M6UA 3BX7C 1OGTB 1A25A 4KKBD 3TCLB 1DUZA 3T9WA 4CL7A 2K78A 2Z1KA 3LIZA 3FOMA 2OSLA 1YJDL 3RA7H 4G1MB 3DRQB 4JFFD 1OE2A 4NQCA 3VTMA 1SYSB 5AVQB 2YPLD 2DBLL 2ZPKL 4AL8C 4X4YA 2GPZA 3MXVL 4FZ8H 3X1FA 2LOEA 2GSIB 2EKJA 3LB6D 4AC4A 2CA4A 4R8WL 4MCMA 3C8KB 3AM8C 3OHXA 1OSPH 2H3NA 1A4BA 5C0BB 4F57L 3GJEA 5I24A 2BOLA 1ZRTD 1TQWA 4ZJ9A 1JMXA 1IBFA 5IJCC 4GAYA 2E9BA 5C0EA 8PAZA 3FAWA 2V6HA 4JN1H 2DM2A 2DEWX 4LMQI 3NJIA 4OFKA 3ZVVA 2FUTA 1J5OL 1B3IA 4PI0A 2YGPA 5KN5B 1AXIB 5I16A 4IBTA 5FGCE 1NUNB 1TQBB 2YUWA 4L1DA 5GS2D 2B1OA 1QWNA 3VH8G 2IMMA 5CEZL 3M46A 5HGHA 4POZC 1Q4NX 5AYQA 2X89A 5KBPA 1QR4A 5D1ZD 4F8TA 4WQAA 3SDYL 2IH9A 2GBTA 2D03L 2B9AA 2EDYA 3E80A 1REIA 2GHZA 1WAAA 2VWEC 4WHDA 4WRLA 4KRPC 4BYHA 3IRPX 4O58H 2NX5A 1EO7A 1WC7B 1JF1B 1N8ZA 1XZ0B 4GAJL 4AVHA 1V54B 4ZUTA 1Z2KA 1IGYA 1JG9A 4H2CA 4PG2C 4A67A 3OBAA 1R4XA 5GSVB 4U1HA 1BECA 1JD9A 5TE4L 3PDOB 3WFDH 1KYFA 4JN2A 4JREB 3TYFB 4I3RH 1MCLA 3BVWA 4F9LA 2VERN 1SEQL 1U0QA 2X09A 3TL5A 4URKA 2QMJA 1QFOA 4PRIA 3ZR6A 4WFHE 3N06B 4X8XA 3US0A 3QXTA 3DRTA 5C09D 1FVDB 1CC3A 5B1KA 2CDGB 5F9JA 2CGRL 3UJTH 2DICA 2IV9A 2WUCL 1EJOH 5D5MF 1XHHA 4CMMA 1AY1H 1ZRUA 3CIAA 5IEKB 4Y1SA 2BNQD 4CUCA 1PDKA 2Q5BA 1FH5H 2XPGA 5FYJU 1HI6B 3MJGX 4J3BA 4FTVA 3VXSE 4DZBB 2Y7NA 4L8DA 5DEFA 5LGKA 1I3RA 4YVNA 1U42A 3OSKA 4HULB 4X8CA 4H0GA 3CMGA 5K1NA 5A6IA 1JTPA 4QRQA 5D1QE 2Z7ZA 3P02A 4G7YL 4QRRD 4N8VA 4D3CH 2XZAL 4HBCL 3VYPA 5JDSB 3OHMB 3MC0A 3R4DA 1KWGA 4NHUB 4FA6A 2J8UB 3QIBD 5C0CD 3W38A 2PCFA 2R1WB 2PTTB 5EU4A 4NGHL 5DHVH 3GHPA 8FABB 2WCGA 5DHYA 5IGXL 4A2FA 1EEYA 2OMWB 2ID5A 2W60B 4QLWA 3VI3F 3KVDD 3V0IA 4DGIL 1T0NB 3PHOB 2CXKA 2EIKB 1WZKA 3HHSA 4GEIA 4KTYA 1L9OA 3O6KL 1YTCA 4AYMC 4IS6B 1FNGB 5D7JD 5HPMB 2CRYA 3MFGB 2O6DA 4M62L 5CF3A 5FECA 4BSVA 4ZX4A 2NLJB 4FG6D 2J44A 2DQFB 3TJHC 3H3KA 5I1EL 1NIEA 2ZYIA 3FQXB 4O00A 3V4VA 5BMFH 3B9DA 1BFVH 4GAGH 2EDXA 2KPNA 2FZ3B 3QXAB 1C7MA 3NA4A 2AW2A 3GPEA 1UYWH 5HYJB 2K9UA 3VGBA 3MV9D 4DP5X 4UF7C 1SN0A 3IDJB 3FW6A 3IMUA 4N2GA 4OR1A 1IC5H 1MJ7H 1JVLA 1B0WA 4Y5YC 1CO1A 2IWGA 2J1XA 5ADOH 1QSEE 3QORB 4BFKA 3OKEA 2V17H 4WUUB 4XCEA 1G7QA 2VRQA 3PQYD 4FQIL 3X13A 3HN8A 4XP5L 1EJ8A 4YHLL 3T0DA 1RJZB 4G8GD 1N3NB 3S37L 4Z77A 4OZIA 4HS3A 2R9HD 2NNAA 1R17A 2PCCB 4PP1C 4YHOH 4AY0A 3BHBA 4GQZA 4Q9BA 3FU6A 2NY6B 1RJLB 1FSKC 3NWVA 3PDGA 1RK1B 5IJBC 5KYWA 2ARJA 5JQ6L 5KZCD 2VM3A 3QFJE 3IXTB 2B59A 1HHJB 3CC5A 1FI9A 5FOBB 3JBTB 1J1XL 2SEBA 3II2A 1OP4A 3P30L 1N19A 5IW6B 3Q6FA 4OLZH 3UEQA 4KHTL 3ZDXF 4J3OC 3W0WD 4ZNEE 3WEOA 1KB0A 4Z7VF 3VVVA 5HVHC 5HYQB 1BZQK 2CIKA 5KSUB 1TZHA 3N85H 1S6NA 1BPVA 2OTUA 1AFVL 3ARDD 3QULB 5L8KB 1N5AA 5DS1A 1CPUA 1OK0A 5KS9F 4RDQF 3PU7A 3KWXA 3FU7B 3VFOB 3ZTJG 1S5HA 4OFYA 4HIJA 4PJHB 5EF0A 2CK2A 1MXDA 3WC8A 4XBMA 2YRZA 4NQUA 4XMUA 4Z3FA 2DMKA 5DVOA 3U1PA 3LKPB 3N9GH 3C5JB 3KGTA 4IEFB 5IP4A 2QV4A 1GY1A 4LP5A 1MY7A 3FPYA 3VE0A 3LRKA 3IMVA 3FCUB 1U58A 5FHAH 2NYKA 1IVLA 2X87A 1NCWH 1BV8A 2EINB 2ICWJ 4G9FE 4TVPL 1NLBL 3INUH 3FT9A 2AXJA 3GMLB 5GZND 1CD1B 4YHIB 1F18A 2VXSH 1U8MB 1LO0H 1VPOL 3U1QA 4DP0X 1UKSA 3N1MC 2OM5A 4N2LA 5DI8B 1JF5A 3UGEA 1DW0A 4JFEA 4PMEA 1Y1UA 5C0FA 5CD5D 3S2CA 4JFSA 4FQPA 2C7UB 1UB5A 5GGTL 4AXWB 4YDKH 1CGYA 2EDBA 1E28B 4LGPB 4YHMH 3LNGA 3HAEH 4B6ZA 4Z76B 1JZHA 3RVVC 3K6NA 4NQEB 3L4YA 4NQDD 1HCYA 2HT3C 4XH2A 4JDVA 5F89A 2D31A 4N1EA 3QQXA 1YNRA 3FT2B 3PE9A 4CSPA 5I0WA 5GGVL 1P7KB 3KZ8A 4XNXH 3IGUA 2V07A 4HOZA 4J1UB 4LCCA 4P3WA 3BGFB 5I8OL 4MJ4A 1DDHB 1XGYH 2R56L 2IJ0C 1ZPUA 5EC1A 4KXBA 5I1IH 3GMRA 4HWZA 2WVSA 3TT1H 1IAIH 4XO3A 3ECBA 1AKJA 2RJMA 3LXAA 1LEIA 2X6UA 3ISRA 3UDWA 4EVNB 4UNVA 5LJYH 4AMKL 2F1EA 4P5KB 3ZE0B 2ICWI 4YL4A 1C5DB 1KPUB 5FF6A 4LLAA 1EO8L 5L7XH 2GITA 4PV8A 3HG3A 1OSZA 2A9NL 2Z65C 2OJEA 5MERA 1MW0A 4M1CD 1MCHA 1U92B 4EUPA 3QH3A 4UQ3B 4JDTL 2UX6A 2HPOA 4DP8X 4P3CL 4KH2A 1CD8A 3D1MC 4AAOA 4P2QE 3RWJB 3PV7A 1SN5A 4LSDA 3ARQA 4MXVE 3UAJC 4B27A 5I1DA 4D94A 1LEGB 1NUFA 4JM4H 4P2YA 3GBNL 5DC2A 3GQFA 5ETUA 1U8CA 3PPEA 4PBDA 4KVCH 2NY4D 2J1YA 2ENSA 2E7LA 5HHNA 1AR2A 4GBXC 4FQHA 1YY9C 2WQAA 3ZLQC 1L0XA 3CN2A 2ZP8A 4YHPB 1I8PA 2UZXB 3VI3B 2DJSA 1OGAA 1IZL0 1MFAL 4R5VA 2CK0H 2OMZB 1FZJA 5K9OB 5GISL 4JO1L 2EO9A 1HHHA 4NOFA 3QDMD 2XWBA 4X99A 5I5MA 3O8XB 2FJSA 1S78C 1SLWA 4OSUH 4PJ9D 2XWRA 3N1GC 1F8TL 1A6UH 1EEQA 1PLGL 3GDBA 5IFAL 1CGSH 2BIIA 2UXFA 1G7JB 4U1SB 5CP3A 5FYJD 3ZMNA 3LCYA 1CFSB 4HIXL 4MBRA 5GHWH 5A2IH 1VB9A 2HWZH 1QBML 3FQTB 5IR1A 5H4ZA 2BWIA 4V33A 4JCMA 4KJWD 5DUMH 2CPCA 3BE1L 2RCSL 4I48B 3W9DB 1UXMA 4XCYB 4P23B 9CGTA 4ZXBC 1ZT4B 2QVMA 1HZLA 3FKUS 3AXIA 2EYTB 4JL1A 2DQJH 2FBJH 2Y2YA 3QZMA 1YNKH 2DM3A 1HNGA 3KHQA 2CHWA 2ZBOA 2CR6A 2EVIA 1UGKA 4OCLC 2JLLA 3V0VA 4ZMOA 2DQDH 3EDEA 1Q9WB 4OBSA 4J20A 5C2UB 1GQ1A 1Q9KA 4D7PA 1PD0A 3D85B 2YEZB 1X9UA 5DRZB 1RP8A 2IQ9L 2H1PH 6FABL 5T1KB 1JGUH 5JA9A 3QNZB 2XSKA 1LMIA 2D0WA 1S5LV 5GZOA 3FO2B 3DJZA 1INDL 1KJ2A 4Z7AA 1H5BC 2ADGA 4FLQA 4GXVL 4U6YA 4P5MB 1G43A 2XC8A 1PY4A 1J0YA 2VDML 3MUGA 1OOWA 2HVJA 4FZEH 4ZTPH 1T2JA 3D87B 5C6TH 1CICC 3CN3A 2ZYSA 3MRDA 3IDMB 4PTTB 3VG9B 2C9XB 3VSQA 3KLHC 1MI5E 1RHFA 1N2RA 5KS9B 2NY0B 1TZOA 4YJZL 4MCNA 5FUCE 5H94B 1ZJBA 3D2TA 3UC0L 2B4ZA 3F6IA 4K9EH 3WUWG 3IJHA 1SDDA 5DGRA 1G7PB 1YQVH 2W8CA 4ESKA 1PU0A 3GB7A 3OZ9L 1B0IA 3RY6A 1QO3A 5IUSA 5E4IA 3V7AE 5SX5K 4NO5A 5A40E 2EE2A 3MROA 2R2HB 4QRSA 2C8SA 3WJMA 4PEEA 5HJ3A 1T66D 1I7UB 5CSGA 1XVSA 4JUSA 5JIHA 5KVGL 1IEHA 3QI9C 2IANE 4OGXL 1QUNA 1U41A 1R1CA 3QO0B 3U0TA 4L9LA 1HH6A 1L5GA 4MNHA 4S2SB 3SE9H 3FZUD 4XWGL 3PNWA 1ZVYA 2PCPB 5FO9A 1WAAF 5ERWA 3A6CH 5DD3H 4PJXB 4XXDA 3X11B 3NRFA 3TA3D 4HHWA 2WP3T 3CDZA 5DQ9B 1AYGA 1DVSA 4LRIA 2P24A 2KDGA 1S3KL 3NJLA 1E9OA 2X7LB 1FG2B 3DXAA 1T6VN 4NWTH 3UZEC 3PWLB 3MV8D 5E2TL 1MHHB 3ZTEA 4KX9A 1BEXA 5CICB 1PD6A 3BH9A 4L23A 2BSTB 1NDGB 4BKLB 2ICES 1EJ6A 2ZSWA 5ALCH 3RWIA 1LWRA 3CFUA 5H37H 3SYAA 4P3DB 3TH4T 2Q76B 4FQ2H 5TPWH 1U3HB 2YGOA 5CKGA 4C4BA 2VMCA 4HHGA 2LHAA 3GTTA 3TBVA 2RB8A 3JVGC 5DJ2B 4XVTH 1I1AD 4KUCF 1BF5A 1JNJA 2C5DC 3IFOA 1A1NB 3HC0B 2FSEB 2ZAGA 3RHWK 1ZE3H 4LK4A 1K4DB 4XB7A 2O61A 4EEEA 4GKZB 1U8HA 4P2RB 3L48A 2WZPD 4ICWA 3CVDA 4F33A 4E9RA 1RZ6A 3LEXA 3H56A 5KKZB 3ZKND 1MKFA 2JCWA 1CLZH 2VAAA 4JFFA 3ALPA 4GRWH 2J5LB 2NW2A 3B9KA 4JREC 1DJGA 43CAA 4AM0Q 3GSRB 4QHNB 1R75A 1M71A 4C54A 2VR5A 2Q3AA 4LASH 4OM0H 2VLKA 3IB4A 4IIQA 4MXQC 3BIBX 4F2MA 2YA1A 1H9XA 3U7YH 2YO3A 1LO5A 3IDGB 1MW3A 3E3QE 4ELDA 3UIYA 1ZOXA 5KAFV 1DJSA 1K5NB 3T0EA 3WAJA 4HMDA 1FO0B 2IAMB 4X4KA 1CE1L 2BXZA 1RUQL 1NMAH 4M6OL 4X6CA 1XF2A 1VACB 1WTGT 4Y9FA 4J6RL 3D0LB 1BLNA 3CIQA 4FQQA 1ND0B 1JF6A 1EANA 4QWWC 3ATAA 1HQ4A 3RNQB 1AO7D 4O5LH 4PP2A 3AXLA 3AGWA 2YC1B 4XCNB 5AVZB 3GSWA 3MRCB 5F7LB 4K23L 1RQ5A 2DW5A 2EEFA 4PRNB 4JFDD 4EI5B 2XWZA 3LRSB 5IJKC 3IJYB 4D9RE 3KPNB 1G7LB 1HNYA 3EADA 3GXMA 2E7DA 2NR6D 4U33A 2Y1VA 4IBWA 3HKZA 4U1KA 4AL8L 2OSWA 2QLYA 3UPRB 3RTQD 1JK9B 1BREA 1YN7B 25C8H 4OIAA 4ORGA 3ZHDA 3R1GL 1U8LB 5AOJA 4GKLA 4XB3A 2X4UA 3H3PH 2IGFH 3EDDA 4L3ED 5I1CH 1RUKL 2VR8A 3ARFA 3I6GB 3PXWA 1UKQA 3BZFB 3F6JA 1MFCH 3VFGH 5MEOB 3RX9A 1FNEB 1WBYA 3DX4A 5D6DC 5ELIA 1B0RB 4AQ8C 1OP9A 2R8SL 4U1JB 1PBYA 1ZV5A 2FJHB 3N42F 5BRZA 1K85A 4TF4A 4YDLB 5K33A 2R0WH 4KPHL 2CRIA 2JTDA 2QQNL 3LYRA 3DSNA 1JGEB 2UV3A 2Q8AL 5A7BA 5D7SL 1BEYL 4FXLA 4LLDA 1MWOA 1O7DC 1UB6A 1YNTB 2Z6FA 3AU1A 3GO1L 2J73A 3UBXA 3V7AG 3CFKB 2H1XA 1LC1A 2IDFA 3KYNB 3QP3A 5EZIL 4GSRA 4JG1L 1CFBA 2X4TB 2GTWA 4C8XA 2GJ6E 12E8H 4FB1A 4HQQH 5I5IA 3ZIMA 5MEQB 5DYOA 2WXOA 2JNZA 4OZFH 4XGZB 4HXBH 1A6VL 3D18A 4IRJC 3UJIH 1IBGH 1SVBA 1ETB1 1DUZB 4GG8A 3FOMB 2OSLB 1IGIL 3PXTA 2VZVA 2Y2TA 3QORC 4TSBH 3NCYP 5IY51 1DHKA 5DMGC 1J8HD 2GG1A 1CU4H 1BYOA 1M9SA 4BA8A 2AMGA 4NQCB 5AB9A 4QRRA 3L5WA 2AAVA 2IV8A 1A2SA 4WQ8A 2Y5EA 2BOBA 2ZNWA 4X4YB 1E4HA 1IAKA 3QIBA 1NFAA 3IJ8A 3LN4A 2IPTL 1ZCRA 4L29A 2WAQA 4OGYL 5AZEH 4BWWA 3T0BA 4TUKH 2CA4B 2EZ0D 2ZXYA 4FNQA 3OHXB 4NZUH 2NY6C 2CG9X 4H88L 1UUNA 2H3NB 2P80A 2W0KA 3GJEB 3PJSA 5EBGA 4XNZC 4GAYB 5LUMA 1RIUH 4RX4D 4CBZA 5C0EB 1NSNH 2JKJA 5IUCA 4NERA 2YD7A 3VXUE 2B0ZB 4KKZA 5DR5L 1T03H 4U2ZA 1J8KA 2AI0L 1CRYA 5TGBA 2OMUA 3V5KA 1WFUA 5D7JA 4YHZL 5I16B 1MN4A 2EDDA 3MCLH 3QJUB 5KSVA 1SXNA 1T2QL 4OF6A 3BKJL 4KK8D 5HI5D 2FEDD 2OQJA 2G0KA 3I6SA 4Z8FH 5HGHB 3UTPE 2E7HA 4BZ1L 3F64A 3X17A 2OMVA 2QKIA 4B5EA 4KJQD 3G7TA 3CLEL 5G55A 1DZ0A 4N22A 3S9DB 4UT9H 3V10A 4RMTA 4IDJL 5BS0D 4MXWH 4OCWL 5LKNA 5JW4N 5ANME 2NX5B 4PJ5D 4DH2A 3MV9A 5B21A 5C0GA 1E8XA 2EDMA 2Q7YA 1N8ZB 3CFJA 1ORQA 3E8VA 2CJUL 4ZUTB 5LGYA 2V3EA 5EEUA 2BIQA 1IGYB 2OYMA 3QUKA 4XNAA 3ARED 2WNGA 2GABA 2GKIA 1AIFA 4U1HB 5FX3A 5SWSE 1G9MC 1M57B 1JDAA 4W93A 4X8GA 1LMKA 4G8GA 4JN2B 4UMSA 1YEFL 5EUOA 4G59C 5C07D 5KANG 3WIAA 2ZP0T 4PRIB 3C87A 4PB9L 1E5AA 4FG0A 1BGYD 1Q9LA 3DRTB 2YEQA 2X0UA 3FH5A 5JIDA 1MDAA 3B2VL 1RZ7H 5F9JB 1H8SA 4HGKC 4JUTA 2X4QA 1A0QL 2HYMA 3WN6A 3FT0A 3GLDA 3G5VA 2JTIB 1FZKA 4EN2A 4CMMB 4OLVH 4HSAC 1FFQA 3QUML 1A7RL 1PDKB 1ZTXL 2XPGB 1KIQA 3MV11 3VD5A 4Q9QH 4LPCA 5C97A 4FTVB 4MMZA 1ASOA 2PXYD 2VR9A 4L8DB 2YXVA 5DEFB 1I3RB 1T4WA 1RIHL 2JJVA 3VVWA 5BVPL 2YXWA 2QKSA 4WUKL 1SDAB 4QRQB 1ZHNA 3W0WA 1AS7A 2WXGA 4AUUA 4XPFL 1K6QH 4N8VB 1PGRB 1DVYA 2F54D 4GT0A 4JPSA 4S11A 4XBPA 5DDHB 5EOCH 3BGFC 3ZO0A 5CMAA 4N2KA 1USQA 1J9QA 2PCFB 2AKRB 4TQ8A 4P5TA 3EJZC 1CCHA 1OSEA 2FO4A 3D0VA 2HFGL 3MLRL 1JGIA 5F0LB 1V10A 1YC7A 1PPIA 2YUZA 5DHYB 1EEYB 2WWOA 3PL6D 1JI2A 1FYTA 4MA8H 1CMOA 1XIWA 4E9LA 1LDSA 2VDNB 4FL4B 3PXLA 3U1SH 2VABA 3QAQA 2XZZA 4M8UA 3HHSB 4KUCD 1A6ZA 2JKIS 1UG9A 3MACL 2OMYA 3QNXA 3RKDC 4WSGA 3VH8A 4OJFL 5A2CA 4UNTA 5I73B 3GIZL 4RGNE 3U0WL 1SQQD 1NGPL 5FECB 5IB2A 2WKGA 2MQGA 4LT7A 4Q89A 2F74A 3LVEA 5JHDA 4CVXA 1J0HA 2DQGL 3V4VB 3RHWF 2VW4A 2YAQA 3WIIL 4Y4KD 1FVCA 2BSEA 4IBSA 1MRFL 3HCVA 3T08A 5DVLA 4AG4H 5D1XE 2OZ4L 4IGBD 1ED3A 2VLJD 4E9WA 4UT7L 3HC4L 3G9AB 2BH4X 3II1A 1R24A 3D48R 2DQIH 3SE6A 4A7VA 4R96A 3HNVH 2Z31D 1FGNH 4JFTA 3TWYA 2WXHA 3JYCA 3OKEB 2GW5A 4XCEB 1RY7B 1G7QB 3X13B 3O8XC 5FW8A 4EI6A 3CVBA 1PYWA 1WF5A 2VO8A 1I3GH 1A1OA 2CM5A 3QO1A 5SX4H 4X0KA 2RHEA 4Z77B 4X4MA 4I7ZC 3T2NH 4RSVA 1VZGA 3MV7D 5HVGB 4HS3B 3VW3L 2NNAB 2WXJA 2YPVH 2XOTA 2BNUA 4HX1A 5C8JA 1VENA 3BHBB 2EIBA 4M1DH 5KYWB 4P05A 3CMOL 2ARJB 3LRLA 2ZWKA 4QUOA 1W8NA 4XNUL 1CGUA 1H3PL 1W91A 1DQTA 1BMZA 4JO4L 2B59B 2Y7QA 3CFNA 3ESVF 3CC5B 1B3JA 3OPZL 5HHOA 2SEBB 3Q6FB 4GIPD 3P0GB 1PZCA 2L7QA 3FN3A 3GXDA 4MDIA 5E5LA 1U91A 3EH2A 5CEYA 4WTZG 4XAKD 4P23C 3L3IA 3NDZE 2D3VA 1C1EH 2JIXA 1DQDH 3EOTH 4GEDB 1SQMA 1J5HA 1X5KA 3SODB 4PCTA 2ZOOA 2CIKB 1KY6A 1TZHB 1QFWI 2PO6D 3DO4A 5EN2A 2OTUB 2WBJA 4N2CA 1N5AB 5EZOH 2WLLA 5HYJA 4LCWA 1R19A 4GI6A 3P4LA 4LAJH 3V9EA 3D0AA 1FAIH 1S5HB 2A73A 2WQSA 3A6BH 2IG2H 3LZOA 4HIJB 1NTMD 4WFGE 2EE3A 5ISZD 2AITA 3V0EA 1JHKH 3RLMA 2LABA 1KG0B 3OKNA 4KQ4H 2Y69B 3LKNA 2JCCA 4H20L 4ZO8A 3LDBB 3VE0B 1U58B 2P9RA 3OR7A 4FMKA 5EF2A 4W9ZA 2MPVA 3WY3A 4HEPG 2OYPA 1YEHL 1OB1A 1G4RA 1DLFH 1NCDH 3U46A 2CUAA 1MG3D 1U8PA 5JHLH 3VG9C 2GSGA 1ZEAL 4JFEB 2WP3O 5C0FB 2NY0C 4QOKE 3K2MC 4WTXA 5EC2A 3BT2L 1UB5B 4TQPA 4YBHA 2XX0A 3SKJL 7CGTA 2C1OA 2F58L 1QFUL 1RUAL 3IF1A 2IPUG 5E99L 4U6VH 3RTLA 4PWHA 2VDRL 1T80A 5DMIL 2FEEL 4I2XA 5TH2A 3UAFA 3TPUA 5C0RH 2E8YA 2YMOA 4OCXH 4EDXA 5F89B 4LCUB 4JDVB 4KBPA 1EAPA 4XH2B 2D31B 5IB5A 3V5HA 3RVTC 3O9WA 1YJDH 4FFVC 3OC5A 3BKML 2GQHA 5CIPA 4LCCB 2PWHA 2YGQA 3GK8L 3MRRA 2ZPKH 2DBLH 2BNRE 3NTCL 2IO5A 4UCFA 5EC1B 1RZPA 2CDEA 3GMRB 4HWZB 5AOMA 5BO0D 3MGTA 3GSQA 3L4CA 3QIUD 4JZJB 3ECBB 1AKJB 4R8WH 1LEIB 3G08A 4Y4HA 1M1XA 4FCAA 5C7ZA 5L9DH 3U25A 5FF6B 1L0PA 4KQ0A 2GITB 3UAAA 4PV8B 1E8ZA 1OSZB 4G8IA 2ZUVA 2DPKA 2OJEB 4TV3A 2AQSA 5MERB 1ZMYA 4TSAH 2KDYA 2JWYA 4BDVA 4JDEA 4EUPB 3QH3B 1J5OH 3FT3A 2V5SA 4LF3A 1OP3K 3CBJB 5F96H 4M7KL 3MK7B 3WTXA 1JZJA 4OKVA 1HXKA 5DZ9A 5F3BA 2UX7A 3WFBL 5I1DB 3RUGE 2ZXEB 1U3HC 5CEZH 4X7TA 3VWKA 2DWTA 5ETUB 1U8CB 1N10A 2AJSL 3DX9A 4MRBA 4BM7A 2D4FA 5HHNB 1T7ZA 4FQHB 2D03H 5FAAA 4HFUH 4G6ML 4DAGL 3ZKQD 2IMNA 3SGEH 1FGVH 4X6CF 3D5OF 5HBBA 1OGAB 3KPLB 3QXVA 3Q01A 3ZOWA 1FZJB 2MOVA 2ZG1A 3NPZB 1DCLA 4GAJH 4H1LH 1HHHB 4BHUA 2XWBB 4X99B 2XN1A 1SN2A 1KPRA 4ZOCA 5T8IA 3N50A 2J5LC 4O02L 4NKMA 2ZWZA 2CBTA 3CSYA 2P46B 1LO2L 5CN1A 5TE4H 3VXSA 1F4WH 5JXAL 5FA3A 3HC3H 1W72A 4FC3E 4B60A 1FNAA 1SEQH 1MCIA 1U8OA 3K5RA 4JRYE 4F7KA 2R69A 3BW9A 4WQ7A 2VXQA 3F7YA 5C0NC 3MDJA 3WIFA 3FB5B 2H2PD 3TA3A 3CWGA 5IR1B 1KIPA 4Y5RA 1AXSA 2CGRH 4XHJC 5F7WC 5CGBA 2X6CA 2WM0A 2W65A 3CHPA 1S9WA 3SLEA 1U8IA 4NQQA 2IAMC 2D9CA 3MZGB 2BY2A 3QEGH 3VRLE 2ENYA 1HYSC 4JR9H 3SOBH 4UINH 4G7YH 4QXTB 5I18L 4HBCH 4DIXA 1ID5I 2CALA 1RP9A 3DMMD 2FX9H 5BXFA 4ZFGH 1B2YA 4YSSA 3V0VB 3IT8D 4GEJA 1Y1DA 4LSUL 2F53D 1Q9KB 1BBDH 2JLPA 2EC9U 4NGHH 1I9IL 5HHXL 1GPOH 1OM3L 5IGXH 3FF8A 4OFVA 4ZMNA 2DVHA 4W9HC 2JKLA 2XTJC 4FA7B 3MBED 2WZPA 4WNJA 1A7OL 4JNXA 2CCVA 1B9KA 4S1QL 2XU9A 2FAUA 2UWEE 1KX7A 1SMAA 4PW9A 5BOJA 3EH1A 3P4MA 4U6YB 1NIBA 1JZ8A 2XWCA 3MUGB 3FRPG 3KBPA 2HVJB 3K6SA 4XC1H 1R5VA 2XCMC 4Y2DD 5ALBL 1TENA 1QSEA 1YO4A 3D25A 3MRDB 4HWNA 5AW0B 5I1EH 1JVKA 2IH8A 5CUSL 1HNFA 4QF1B 2YXMA 1N2RB 2AAAA 3NG5A 3VYMA 3WFEC 2GI0A 4HLJA 3FO9A 5AZUA 1LK3H 1JOIA 3IJHB 4HAKA 1SDDB 2X1OA 3IAPA 3GB7B 1QO3B 3F7VA 4PLOB 2ZKWA 4PJAE 3QQDA 4NO5B 3MPCA 3VU2A 3A47A 3MROB 3PUUA 4ZI8A 4QRSB 3WJMB 4NJAL 5HJ3B 1WA2X 5AFAA 3QFJA 3H2WA 4XO5A 3HS8A 3BP7A 3MUY1 1AO7A 4LPXA 2E6JA 1QUNB 4XP5H 4PJDE 4OY9A 1MNUH 4YHLH 4OCNC 3U0TB 4L9LB 1HH6B 1L5GB 2X2UA 4MNHB 3S37H 3VQLA 4QRPD 3TFKD 2YMTA 5CLTA 2ZOTA 3PNWB 1EHXA 4F7CA 3MXWH 5C6PB 5FO9B 3BVTA 4MJ5A 5ERWB 4ZNEA 3OHXC 3B7SA 4NRXA 4PYHA 5L2KE 2N9JA 3ABMB 1P5UC 4XXDB 1JGVL 1ZS2A 4J4PD 3O41A 4FA4A 3CDZB 5JQ6H 1QLEH 1S7XA 4CGTA 1AH1A 4PM1A 2JKTM 1CTMA 2P24B 2F7PA 1J1XH 2CIIA 4UBDC 1E9OB 4YXLL 2Q10A 3P30H 1FIEA 3DXAB 4MHHG 1T7YA 4KHTH 1GR7A 3K8LA 5KUMA 1VHPA 2YAHA 3BH9B 1NJ9A 4YWGL 1MHCA 2ZSWB 3RWIB 4Y88A 3SKUD 4ATTA 3U30B 1KJMA 1UEMA 4AYID 1JXGA 1A3RL 2CHDA 3M7FB 3P0VL 5IZ7A 2K1MA 1AFVH 4G9FA 4Z78A 1F13A 4N24A 1QKZL 3TBVB 1BJ1J 3IFOB 3OAUL 2JQZA 1BAFH 3LZPA 2UXTA 4XMVA 3ULUC 1T04A 3ISYA 2N01B 2Q3ZA 5I1GL 2O61B 3TO4A 1U8HB 2A9AA 4BUQA 4GKSA 1OM9A 5IOKA 1UD8A 4F33B 3MRLA 2HTKC 3LEXB 3STZB 1IM3D 2VAAB 4JFFB 5DURB 1DSFL 1H15A 2NQ3A 4BFFA 1CFTA 2XV2A 4TVPH 2NW2B 3B9KB 3LXBA 4OVUA 1OPGH 1NLBH 43CAB 4BRJA 4K5MA 4YSEA 2Y5TA 4F9LC 5HDBE 1M71B 4L2YA 3MBXL 5T5NG 1WBXA 3QJTB 1VPOH 5DA4A 1X5XA 2J6EL 3WS6A 4LVHB 3WUWA 3WFCL 2VLKB 3ESNA 2E47A 4IIQB 1FJ0A 5IHWA 4KZEL 3UABA 5DFVD 5KBNC 1JV5B 2X12A 3FQ1A 4F2MB 5GGTH 2WANA 1LO5B 3CFMA 4PBWD 4NLAA 1GYVA 3T0EB 4F27A 3HBPA 1RI8A 4NCC2 4X6CB 5T3ZE 4ZW3A 1XF2B 2AJYL 3SJVE 1BLNB 2JKNA 4FQQB 2RACA 1HQ4B 5A6LA 1ZLSL 3CG8A 2PW1A 4PP2B 3AXLB 1JCVA 3GSWB 5GGVH 1OP5K 3LEYL 3K2KA 3S3CB 3W2DL 3D3VD 4PRPD 5C1MB 2FEJA 2LVCA 1RJCA 3CAFA 2K6WA 4KK9C 3T2QA 4B9YA 3HAEG 4FD0A 4OD1L 4P2QA 4U1KB 35C8L 4FL4C 3SKNA 3K74B 4IMKA 1Z0MA 1JI1A 2FB4L 2QADD 2Y36L 5CWSA 2X4UB 1W15A 4V1DD 1Q8MA 3MYJA 3Q3GA 1EO8H 4MD4A 1U75B 3RIKA 1KPVA 1TFHA 3ARFB 2ZG2A 1KCUH 2C9VA 3BUYA 3HG0A 1RZIA 4I89A 1J8SA 1WBYB 2A9NH 4IQHA 4EKXA 2BHYA 5I73C 2X3BA 2X2IA 2ZX5A 4W6XB 3HRPA 2X1WL 4B41A 5BRZB 1RK7A 3O1YA 2OZ1A 2Z9TA 1E6OL 3EYQD 4QHKJ 3WNOA 3MGOA 4P3CH 4DVRL 1TSRA 4FNRA 1RV6X 5C9MA 1I1FA 1DQVA 3DSNB 3W39A 4R0LA 3CSFA 4OB5L 4QGTA 3HN3A 4LLDB 4Z5RA 5B3SB 1UB6B 2FLMA 1H19A 3AU1B 3AS2A 5IVXE 3UBXB 1IQCA 3F3HA 2UVFA 5I82A 3GBNH 3G6AA 2GTWB 3IMSA 3QDGE 4UDTA 2NY3B 4QTHA 3MRBA 4Z7UE 1HZHL 5FW7A 4YSAA 5DYOB 3F58L 4Y8AA 4CKVX 5CJQL 4RWYL 3QNYA 2B0SH 3D18B 4OF7A 5K93A 4XWOD 3IPFA 4LMQE 4GG8B 4XN5A 2EIEA 5HGGS 4KXDA 4TLSA 3A22A 4ENZA 1CDBA 1MFAH 2BSRA 1DE4A 1QI4A 5GISH 3U2JA 1NAMA 3U9UA 4QRRB 3L5WB 5AYUL 2F54A 2EACA 3UTTB 2ORLA 2BOBB 5GS0C 3POCA 1F8TH 1IAKB 2JKXA 3QIBB 3LN4B 4L29B 5IFAH 3SBWA 2JF1A 1X5LA 3T1WA 4HF5L 1QVOA 1WAEA 3VFTA 4R83A 4LSRH 3Q9PA 1Z6JT 3ATEA 3KYKH 3MUHL 4HIXH 1DCEA 1EBAA 2ZUSA 4KKCD 3PJSB 3S35L 4F7TA 3UPAA 2JI1A 1SQVD 5CGYC 4NC2B 4UTAL 4P4KD 4ES8A 4JM2F 1QBMH 2BH5X 4UI2A 1KELL 4QHKI 2EADA 4XMPL 2ZIDA 3LH2L 1BVLA 4HK0A 5B1CA 3NIDE 5TGBB 1Z5LA 3V5KB 1P84D 5D7JB 3N6YA 1CTOA 4Y16A 1QSVA 3BE1H 2RCSH 3BH8A 4XE0A 5C92A 2IADA 4PLKC 5IBLC 5KSVB 2DIBA 2ZE0A 4DP9X 1WDAA 2WGNB 2OQJB 4JRXE 4N0KA 2Z7WA 3HA0A 4TM9A 4GRMA 4XOCA 3BVVA 4ACPA 2EC8A 3DX1A 3JWOC 4UUJA 2OMVB 5F6IC 2QKIB 5EU7C 1LK2A 2PWEA 4Y19D 1BQHG 5DC0A 1GH7A 3RX5A 5SWZD 1YMMD 3JUZA 4IGBA 3K3QA 3O6LL 1TYJA 1X7SA 1K5WA 1IX2A 3MV9B 2LITA 3ZE2E 5C0GB 1XCWA 4YDMA 3GHEH 2IC2A 2Q7YB 3HBGA 1MI5A 3CFJB 4N0RA 1ORQB 1W2KT 2IQ9H 3TIEA 6FABH 1CLVA 3QUKB 3T04D 5BRPA 4KNTA 2F8IA 1AIFB 3NPSC 3REWA 1NFDE 1INDH 5ADPL 1GDVA 2VM4A 4G8GB 5EUOB 3Q6GH 3D8MA 4GXVH 4KO9A 5JXED 3RDTD 5AOZA 4YS4A 2VDMH 4PPTA 1XH2A 1E4WH 3LKRA 5DRWA 4P46D 1Q9LB 2IANA 4WW2F 2NZ9C 3V7MA 4RIRA 2ARJQ 2X4QB 4HGWA 4OU3A 3S3JA 5I75B 2IDSA 5KZCB 1FZKB 3UC0H 5K9JH 4GSUA 2GB8B 4XR8C 4N0CD 4X7DC 1I5TA 1ADQA 1KIQB 3OZ9H 2X1PA 1DVUA 4MMZB 1T0PB 2ZAHA 4HKBA 3ETTA 1KOAA 4MS8C 1M3JA 2FQFA 3PG2A 1KGIA 2IQAA 1COTA 2DQHL 4J8QA 2HFEA 5D71L 3VXQB 3W0WB 1KXVC 2XRAL 4ZUVA 4XBPB 4LBEA 2MQ3A 4LCCC 4UT6A 1YEGL 2HMID 5KVGH 1CYIA 5CMAB 3EF7A 1G6RA 4OGXH 3KJ6L 5B6QA 2R1YA 4A6YB 4OI7A 4ODWA 1X7QA 4P5TB 2H6UA 3BWSA 2FBOJ 2FO4B 5E8NA 3D0VB 4QRFA 1CFMA 4XWGH 1C6SA 3UDWC 4P48A 1FYTB 1XIWB 1I8KA 2XBDA 3AT8A 3T6XA 1XH1A 3AADB 3WIHA 2VL5A 2Q20A 3CC1A 2K9FB 2VABB 4R97B 2JTYA 2GIXA 4LLQA 5TDNA 3SDAA 5HGBA 1A6ZB 3QNXB 2OMYB 4R84A 5FGSA 1JXFA 3OM3B 4XVOA 1S3KH 5A1AA 3VH8B 3NFNA 5IB2B 3ZN6A 3MK7C 3KR3L 4LPYA 2NQCA 1FORL 2F74B 5J57B 5E2TH 5JHDB 1MG2C 3HNTH 4R4FL 4POYA 4Y5XB 4ORZC 4CVXB 2JELL 4S1DC 1SUHA 5FUOH 3H8NA 2B14A 3BIKA 3UCRA 2ZUYA 3T8XA 1NC2A 3CXHK 3VU1A 2L4OA 3WDHA 1FVCB 2WXRA 2DLTA 1OW0A 2ZP9A 2E7LC 3HCVB 3I02A 5D7IE 3BXNA 4ODHL 1VADA 1ED3B 3UCQA 1AR1B 3JZYA 5ES4B 3MNDA 2C4XA 4DO4A 4J27A 3SEPA 1R24B 1MIEL 3GD1C 4IM8A 4R96B 1DQLL 2ITFA 1CTNA 4EI6B 3O4LB 3KM1A 3KS0J 2SODB 1FDLL 1NKOA 4C4UA 1A1OB 1NGXA 3QO1B 4HC1L 5IY5B 4HJSA 4Y7OC 4X0KB 4EDWL 2HT4D 4XMXA 2I69A 4F2EA 4RMUA 1K72A 5CP7A 1EEZA 2BNUB 4HX1B 5C8JB 3QHZL 3L1OL 2JSFA 3IFNH 4FADA 2RR3A 2CHNA 3OGOE 2GIYA 4DGWC 3GS0A 2WTRA 2DQTL 2Y7QB 5HHOB 4NS0A 4A1RA 1PG7L 3HZMA 5LBGA 5L2JA 4I0CC 1AJ7L 3FC8A 1WA1X 3GMMA 2VN5A 1N15A 4BE5A 4MDIB 4GO6B 1U91B 2R39A 1DJYA 5CEYB 1CE1H 1EZVX 3L3IB 1RUQH 4M6OH 4BCYA 2WXLA 4LEOA 2DYPD 2JIXB 3KGUA 4NWUH 1T20A 4U1NA 1N50A 1DW2A 2VYRE 2R1XA 1YC8A 5EN2B 5B38A 2B1AL 3K80A 2WBJB 2PN5A 5I8EA 4DN3L 2VDOB 2WLLB 3O2WH 1I3UA 3OKYA 2X9YA 3EYSL 4K23H 4LCWB 4QJ4B 2NQDA 5E4EC 3LKQA 3UO8B 5F1OB 3IPBA 1D6EA 2A73B 2ZJSL 3ETBF 1XCTA 2X4NA 3PHSA 3H9SD 4H2AA 2XQYG 1GYUA 4BE6A 1R3LA 1QQDA 2EEAA 3AXHA 3L13A 3OKNB 4KV5E 4XCFL 4X5QA 4P2CG 3LKNB 3R1GH 2JCCB 3R8QA 5D1ZI 1UUSA 5GZOC 4CN1A 3DECA 4KRLB 3OR7B 1RUKH 5D7LE 4KI5C 2EYSA 5DVKA 1EEUA 2RD0A 4Z3JA 1PZUB 3VXRD 4PJCE 3SDXA 2R8SH 1HHKA 4NIKB 2A7BA 3GXPA 1OB1B 1E67A 4B95C 3GBLA 1JXJA 2BSSA 5D4HA 4KPHH 3U46B 3WU1A 2W91A 2YQBA 1U8PB 4UM9A 5JYMA 2GSGB 2P5WE 3VSVA 2HFTA 3TBWA 155CA 3DGDA 2Q8AH 2DQCL 1BEYH 3QNFA 3KAAA 3P3YA 5EC2B 4XP6L 3SZKC 3P1VA 1RUMH 4Y9BA 2C1OB 4Y2LA 3ESPA 4S0TD 4JG1H 2X4RA 3IF1B 1T89A 4QI3A 4DKFL 2QT6A 3RY6C 3KDPB 5TH2B 4I2XB 2XN9E 3TPUB 2EH8L 2F0CA 1E9QA 4CU7A 1I8OA 4EDXB 1EAPB 3SPIA 2QSCH 5CCJA 3O2VH 5IB5B 3V5HB 3O9WB 4JM2D 1IGIH 3MCKA 5IBTH 3NMEA 5C0BE 3K0WA 2Z35A 2CLZA 3EJSA 3VXUA 5CIPB 1KBGL 4Z7NB 5CSBA 2EVGA 1Q0YL 3MRRB 4L9LC 5G4OA 1VERA 3K4ZA 2WVTA 1CC5A 3G6JE 5KVMC 2CDEB 3ZL4L 1WE5A 2IPTH 4OGYH 3D9AH 5FGCB 3MGTB 3GSQB 2E75C 4L3FA 3G08B 2Q2LA 3NCYS 4Y4HB 1M1XB 3HE7D 3MAWA 4H88H 4LRIC 3PY9A 4C57C 4WTZA 3CYTI 4K7PH 5IKCA 3L3GA 1MWAA 4OD3H 3IJ9A 4G8IB 1MSPA 2QQLL 4BH8A 5JIQA 4FLRA 5DR5H 4JDEB 4BDVB 2BW5A 5HYFA 3FT3B 2AI0H 4LF3B 5ANMA 5JOEA 1UD5A 4YHZH 1F11A 1GC1C 4DO6A 2RQEA 3MLZL 3PFUA 4OKVB 4Y4FA 2AQ2A 1T2QH 3U30C 3BKJH 5DZLA 1FO0L 5HI3D 4MMXA 5LGHL 3LNHA 4X7TB 3VWKB 5DJAA 2XQBH 1NCCL 5SWSA 2OYLA 4BZ1H 1SZNA 5ECJE 2EC9T 3DX9B 2NYZA 3NBNA 3QS3A 2WGXA 3CFCL 2PF6A 3S5YA 3HFML 4JHVA 4YNYA 3UTSD 3DURA 1NEUA 4LNRA 2WZ0A 2X0WA 4I1NB 4IDJH 4U7SA 1QZNA 5IJDC 1XEDA 5KLVD 3CQFA 1T1YA 2R59A 2Y25A 4HEPA 2XN0A 4JQVC 1QZ1A 5T5FA 2CJUH 2VQTA 3N04A 1ETA1 1JPSL 3UZQA 1KPRB 4WQEA 1H3XA 5I6MA 3B9KC 2VMEA 4NKMB 1TJHL 3CSYB 4HV8A 3RI5K 3VXSB 3VXTA 4GSXA 5DZJA 2KPWA 5FO8A 1YEFH 4D8PA 5FA3B 4QRPA 3O11A 3FO1A 4F15B 1W72B 3FB7A 7FABL 1U8OB 1U2CA 2JB5H 2LU3A 3EO9H 4LVHC 3BW9B 1CD0A 4PB9H 1CXCA 3F7YB 4IIQC 5E6ZA 1W8EA 1Z3GL 2FTAA 3WIFB 3SYQA 1VAHA 4G6AD 5GJSL 3TA3B 3B2VH 4J4PA 1KIPB 1AXSB 4WNQA 2VTFA 1JUFA 1N0XL 1A0QH 1AI1L 3FB8A 2W65B 3T0EC 1S9WB 1U8IB 4WKZA 4L2LA 3QUMH 1A7RH 1ZTXH 4HIHA 1KGUA 2PPAA 2WXKA 5L88L 4XXCA 3WFEL 1NWPA 4EQ3A 3PRZA 1RIHH 1PZBA 5BVPH 4NO2B 5CZKA 4JW3A 3K8KA 1WIPA 3Q1SH 3N2JA 1EHAA 1H3UA 3QZPA 1ERNA 4XPFH 4K3DL 3ULVF 3AROA 2DH3A 4KXAA 1AYRA 3CXHW 2DJMA 3LIZL 4FS0A 5BXFB 1QHOA 5I0ZA 4FI6A 4ZFFA 3S5LG 4XB8A 3RBSA 3IM1A 3MLRH 3DIDA 3EBHA 3GJFK 2WLZA 2KL6A 5DUJA 3UTOA 1JZ5A 4JPQA 1CI3M 4L0YA 1KFGA 4R90L 3ARFC 2DWDA 4Z0BH 2ISDA 5C2BH 4LL4A 5CAYB 5D1XA 4ZAKA 1C12A 3MACH 3LS4L 4PW9B 4QKXB 5JLZA 2OXHA 3MOBL 5LNEA 3P4MB 1BVKA 4M6AA 4MVBD 3U0WH 5D7EA 1NGPH 4HSQA 3UXFA 4DO5A 4URTB 4KTEL 4J3WA 3K6SB 1R5VB 2VUKA 1QSEB 3D25B 1NOFA 1G4MA 2DQGH 3AG2B 3LX9A 1TITA 4EO5A 2XG5A 4WFEE 3WIIH 2Z8WC 3ZMEA 3FO9B 1MFBL 2DEYX 2NY3C 4MZIA 5HJGA 4X6DF 1JIBA 2OZ4H 1S5IL 5GS1A 3F7VB 4LDOB 4UT7H 3P4OA 3QQDB 4IKJA 1CQKA 1ZT7A 3QFJB 1CGTA 4KQ3L 3ULUL 2HKHH 3BP7B 5EBWA 1AO7B 1I1YA 3N41B 2P26A 2K7QA 3ELQA 3QIBC 4MQXC 4Q0XL 1CYGA 4G8AC 4PRPA 1GOGA 4F7CB 1OOAA 3OR6A 1QFPA 3IXAA 2ENJA 4TRPL 4K7PX 4AIOA 3VW3H 4NRXB 1PZSA 3AG1B 1UH4A 4BGDA 4NFBA 1CSVA 4LHUD 2AQTA 3O41B 1AKKA 3CMOH 4OCSH 1S7XB 4LU5L 4PJFF 2YD0A 3EBAA 3RVUC 1H3PH 1J1PL 4JO4H 2AV1A 3DDFA 2PW2A 5D8JL 1T6WA 1A4AA 2WC7A 3G04B 2CIIB 3OPZH 4MNQE 1VKXA 1LO4H 1YMHA 3CZJA 4HS6A 5D7JC 3TZVD 3FU5A 1IRAY 1HC1A 5E8DH 1WZMA 5HD8C 5EEYA 3CZSA 3U36A 4IBYA 1RZJC 1NJ9B 4HUWA 1MHCB 3QEQE 3ABKB 3DC0A 2KUTA 3QRBA 1KJMB 4ODVL 1L0LD 5EXQA 3FSVA 2IGLA 2QKIC 4G9FB 4U31A 4Z78B 4G72B 4JKPL 4APQD 5I5RA 1XZWA 2PPFA 2V33A 1UA6L 1T04B 4M9PA 4NZ8A 1CDUA 3IAQA 4LAQH 2MNJB 4TTGA 3TO4B 2IPUK 4FQLL 3ZQXA 1DBKL 2H9GA 3PV6A 4X83A 4GKSB 3RJOA 4LE8A 5FYKE 1HZKA 4QOKA 3EYVA 4CU6A 4ODTL 3MRLB 4BK5A 3QPQD 3FRPA 3QPXH 4GRLD 4H20H 4OLUH 4P8QA 5KYXA 3K81A 1H15B 1Q90A 5I8KL 3WXVL 1CFTB 5D9SA 2VDNL 3K7UA 5KJRL 1IAMA 3B3IA 2WLJA 4BELD 4YVUA 5D7KD 2Y5TB 4YE1A 1EXUA 1YEHH 1U4FA 1NDTA 1LJMA 1WBXB 3EYFA 5M94B 4OBRA 3K4AA 3WUWB 1T5XA 4KDVA 1X7TA 2X4OA 4K15A 1ZEAH 2OMXA 5I75C 1OCWL 2GAZA 1IE5A 3BT2H 2BNRA 1MZZA