4AXIA

Structure of the clostridium difficile euts protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
TEESKQRVIQEYVPGKQVTLAHIIANPNEDIYKKLGLVLDKKDAIGILTITPSEASIIAADVATKASNVSLGFIDRFSGSVVISGDVSSVESALNDVLEVLGNMLNFSSTKITRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ETHANOLAMINE CARBOXYSOME STRUCTURAL PROTEIN
publication title Structural Insight Into the Clostridium Difficile Ethanolamine Utilisation Microcompartment.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Structural protein
total genus 27
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4axiA00
4QIFA 4OX8A 4OX6A 4QIGA 3SSSA 4P7VA 3MPYA 3N79A 2EWHA 3BN4A 4OLPA 3IA0A 2A10A 2A18A 4QIVA 3CIMA 3PACA 2A1BA 4OLOA 5L38A 4QIEA 4P7TA 4AXJA 4DDFA 3DN9A 3MPWA 3DNCA 3I96A 4OX7A 3H8YA 4PPDA 4RBUA 3SSQA 3VCDA 3SSRA 3CGIA 5DJBA 4P2SA 4RBVA 2G13A 3NWGA 4LIWA 4RBTA 4AXIA 3I6PA 3NGKA
chains in the Genus database with same CATH superfamily
1W2IA 2VQFJ 3R5DA 3IXQA 4WWSA 4ITSA 1J27A 1IVZA 3QGHA 2E1CA 2L9NA 2JSXA 4WYLA 2RRNA 3JSBA 2OKQA 3D9BA 2IRUA 3UDCA 1EHWA 2DNZA 2WONA 5IWAF 4PPZA 1I5OB 3BPSP 1FE4A 1SJ4P 1ICEB 2ZKUA 5A8RB 4OZLA 3K58A 3DRPB 2CNKB 4J9PA 3G2XA 2XYGB 4LF7J 1LNQA 3MGJA 4X62F 2FHJA 1KQSR 2HHPA 4JI6J 4TNOA 4TQSA 4X4VA 4ANEA 3LANA 3G86A 2HSEB 4WFZA 3LW5C 3PFOA 3M2RA 1WHYA 1ZA1B 1Q79A 3D3CJ 3ITHB 3D68A 1X9MA 1MROB 3GCWP 1RDRA 2BW7A 2WB4A 3SEOA 4FS2A 4OI1A 2B9YA 5KT7A 1MSWD 3U7JA 4LF4J 1ZH5A 3BQ2A 5LMNJ 2ZC3A 1BUXA 4CLYA 2CJAA 5A6PA 3UDEA 1DRZA 4DQPA 1FDNA 5D0EA 2OELA 3ENQA 3BBBA 3TA0A 2QO3A 3CW2C 1WG1A 1S6PB 3OVBA 1KQFB 4NL5A 1P1TA 4F8RA 4LJMA 4C7QA 1S0OA 3UPFA 3CC7S 1TL3B 4KJIA 5I42A 1U02A 4DS4A 2RU9A 1ZM9A 3KNAA 2Z2LA 4J9SA 1JLBA 2KU7A 1V5IB 1QE1B 1W7WA 1RBAA 2GVZB 5C24A 3ZZZA 1YGYA 2AJ4A 1NLKL 1B99A 2VFUA 1KP6A 2FLLA 3M6WA 2I38A 2WRMA 3NGUA 3IFEA 2EFOA 2J7UA 3F73A 3H90A 5KFOA 4CI0B 3FBCA 4Q2MA 3S1TA 2R2TA 2YNHB 3IBFB 3ZC4A 3N9UC 2K1RB 2R8HA 5ETTA 1U6FA 2H5IB 3MAAB 3GONA 5A8WA 1NMEB 2FJBB 1FKPB 1T3OA 1V3SA 2A2DA 4IQMA 3RAMA 2B0GA 1RUSA 5MAOA 3CJSA 1KFSA 2BJ8A 5IV4A 2D3ZA 4F3QA 5KFSA 4IOCQ 1SUQB 4ZVSB 4L3NA 4P2XA 3CCJS 5KG6A 1SJ1A 1M5KC 2CPFA 5E3RA 3ISNC 5IM0B 4CWBA 4ZK7M 4U95A 2QJ3A 7FDRA 2HWTA 1WI6A 4JV1A 2V4RA 1U2RA 2P2CB 2CJKA 4TLQA 2R2UA 3EGZA 2ZM6J 2VASA 4PXDA 3GV5B 3M8YA 3QQCD 5DG8A 2UUBF 2AJ2A 1TVRA 5D6GA 3IAM9 4PWUA 2B6AB 2F5GA 1S9GA 3SCIE 3V81A 1GTHA 2X3GA 2SXLA 1RBLA 4ZVHA 1FXDA 2ZHBA 1PSDA 1FXRA 2Y8YA 3US5A 2NXEA 4NYOA 2XHCA 3C8YA 1KLMB 2AJQA 5E3QA 3VAMA 1Q8IA 4ES2A 1MN7A 1M1HA 2JVRA 3WBZA 4PWDB 4FYVB 3J7YI 3K89A 1ZPVA 1VQ9S 3P5TL 5L39A 2VKZG 1DURA 1S1VB 2PMHA 3LO3A 1AZSB 2HFNA 3HHKA 1FJ7A 2OFGX 2YQ1A 1S9EB 4B3RF 3MR3A 3QWPA 1WDTA 7FD1A 2HGNA 4NYZA 1VQ5S 3OSNA 4EO6A 3ZO7A 3MPVA 1DAXA 3N6MA 1JLQA 2ZH5A 1BQXA 2RIJA 2OPSA 1HBUB 3OTOJ 1FNMA 1ZPWX 2GNKA 2V94A 1I6JA 4IO1A 3FRZA 1U1KA 1HPZA 2OMLA 2EXUA 3J7YU 1OJ4A 3VAKA 1MMLA 1UMJA 3AXMA 1N6QA 4ZPDA 3D1HA 2GAGC 4ZN1A 3DOKB 4WP9A 4RL1A 2AGOA 3VAGA 4EU0A 4LFCF 3HFZB 2IC3A 1PYOB 2CAJA 3MURP 2V8PA 1NDLA 3PJ9A 1O51A 3QT8A 3B4MA 5A8KA 2YX7A 4ZPAA 2HBYB 2BE9B 3PKMA 3QT7A 2DEJA 1RLCL 3MM7B 1NPRA 1Q8KA 2OH2A 1OO0B 3QATA 1SKUB 2J5AA 4MYUA 2ACYA 2X1GA 1RYSA 4RW4B 3J80Y 1S1TA 4J5OA 3DU5A 2R8KA 2ZBPA 3NS7B 3DHWC 5KFIA 1GXUA 1FEHA 4TQRA 1JXVA 4R25A 2XQCA 3PX0A 1N5TA 1RT5A 5C2GA 3D4JA 1NH8A 3KLVA 5A6WA 4ZLNA 3TA1A 3BQ1A 2E5LJ 4JI0F 1LEOA 1RK8A 1VQ6S 1ZETA 4NMLA 3DRRA 2HHTA 1GEHA 3DKDA 3IBCB 3MD1A 4GVBB 4ECTA 2FJXA 2V4JA 3GR0A 4OL8A 1LWEB 1RZMA 4KGXB 3BGUA 2W2OP 3EPGA 1YBUA 1G7CB 2BOPA 2VA2A 3PV8A 2MQQA 3KLEB 1HNZJ 1UVNA 4CO1A 2MZQA 4NLWA 4ZLPA 4KV8A 1OPIA 1VI7A 4UOCA 1UWBA 2LEPA 3W2VA 1H3DA 3AY0A 1TL1A 3ZZOA 2H65B 3OTEA 4I2QA 4WBFA 3I82A 5FJ4A 3KHRA 2IMWP 5C5JA 1TL5A 2K3IA 3IM8A 2K8GA 3C14B 5J1EB 2ALYB 2QGFB 3V5RA 2DPIA 4PXEA 1MWZA 4Y65A 1L5UA 4U9RA 4DSKA 3HK2A 3HZGA 3SQGB 4WKRA 3QO9B 2YBVA 1LK7A 3JXOA 3TWZA 2Q6BA 3IR7B 3MEGA 4OX9F 1ZA2B 2CQHA 2Y1IA 2RRBA 2B9EA 3SV4A 3M8QB 1JKHA 4NXMF 3SXLA 2R8IA 3NOCA 5EN1A 1CJVA 2PO4A 4ZOSA 4J9UE 4NASA 1T3NA 1E6YB 1XR6A 3HP6A 3SCKE 4LIWA 3VGUA 3HLUA 1K47A 3H2LA 2CNNB 1CULA 5KFCA 2J7WA 3LPYA 4NCAA 1N33F 5B0BA 1FJCA 3TEHB 4Y0FA 3W8GA 3PXGa 4HHJA 4IKAA 4LF9J 3GG1A 2IDLA 4CLPA 2IA6A 3VALA 3IG1A 4UQGA 1FE0A 3NRBA 3HJVA 2B9XA 3GIRA 3TX0A 2I5JA 5HK4A 3MM9B 1QJHA 2D3UA 4LRBA 3KLGB 3IR6B 5DZ6A 2VONA 2NSCA 3NBPA 4GMKA 1KQKA 3M2VB 2R8JA 2IM2A 1OQ6A 2XWXA 2BJ9A 4A8KA 2RS8A 1O6XA 1FHTA 4ED4A 3CJ4A 4C97A 4O3OA 4ED3A 3H7HB 1HR0F 1RHJB 1W26A 2FZCB 2M9KA 8ATCB 4JI5J 2ROGA 1WUUA 3TQEA 5KOXA 3LAKA 2NR0A 3ZZPA 1LWFA 2RAQA 2C2NA 4USKA 3NAHA 1VFJA 2ZDPA 2CZ9A 4C6AA 4DV4F 3VGVA 1U8WA 5CCLA 5KFPA 1QSSA 1P9YA 4K59A 1IM4A 1XC9A 3NS6A 4U96A 3BSCA 4OHWA 4MK9A 5I3QA 3J81U 1IBLJ 4J9QA 5DRKA 2QC3A 1AUDA 2QA4S 1EKSA 3FCHA 3JQMA 2RU3A 3ZFVA 3R1LA 3TUPA 1RU2A 3OUYA 2XMMA 3R6LB 3N79A 4BBYA 1RWVB 4A8YA 1G4CA 4HI2A 4C3LA 4RBVA 5ETSA 4IH5A 2XB2D 4QWBA 2GVDB 2XGPA 1P1LA 4F36A 4RWWA 3HSZA 1CS4B 4DV3J 3O5TB 1PO6A 4X64J 3NWGA 5KOWA 1CJTB 3PW2A 3KJVA 2FD2A 3L3CA 4BC7A 2COLA 1FX2A 3TI0A 3P45B 2KHCA 4CNZA 1FD8A 4DOZA 3AOCA 1R6VA 1AFJA 1X9WA 2MQNA 1PC5A 3CDWA 2O5DA 1WEYA 4Z37A 1VRUA 2VKRA 1Q16B 3MPDA 4RBUA 5J2NB 3CCTA 2W2MP 1YRXA 3Q83A 4L74A 1UCNA 4QWAA 2HK3A 3NS5A 2DGWA 4DR3J 4CQ1A 3BF4A 2M2BA 3TJAA 2EWHA 4RX6A 1KBRA 4V19X 3UFCX 3UDLA 3DDKA 2ZKTA 4ZJLA 2DXFA 4L6V3 3HVTA 2HNYB 1GK8A 5I3PA 2C3MA 2AYBA 4P2SA 3AJ2A 4Q0BB 2AV5A 3KTQA 1S79A 1BQNB 3JTOA 3W1YC 4LF6J 4DX7A 1WG4A 1S10A 3CJRA 1NNDA 4R5PA 1C0TB 2BVZA 2NSBA 4ENOA 1MWQA 2G9OA 4M63A 4PG6A 2C3OA 1S4EA 2DCUB 3UE2A 4OHVA 1AYEA 1SH2A 2KM8B 4C8ZA 4A8SA 5GADI 3W8PA 2AWZA 2ZBIA 3HI9A 2WSCC 1AW0A 1T05A 1NSAA 3EX7B 2B4OA 2HRTA 1C0UB 2CIMA 4LR9A 3MPWA 1RP5A 1HI1A 1FK9A 2AW0A 1IBMF 2Q79A 4O44B 2B9WA 4LFAJ 1U2FA 2FGOA 2LQBA 2U1AA 5EWGA 4M5NA 4J9MA 3WX8A 2CG4A 2B5JA 2OFHX 4O3NA 5EDWA 1R7IA 2HZCA 4IG3B 3T1YF 4FF3A 3TAMA 1HNVB 4CT8A 1UJ4A 1RT4A 2I1RA 5G4DA 3V6DA 4CLTA 4DV1J 2V8DA 2IRXA 2P6TA 1YJ9S 5KFYA 4MT1A 2IVMA 1IWGA 3EZOA 1KD1T 3PO4A 1HL6A 2UUAF 3QSIA 5GAEI 1NB2A 4C0BA 2C2RA 2VBZA 3LUYA 2WCXA 1SPBP 3DGVA 2KHDA 2EEYA 4OHYA 2M88A 1KHVA 1NHKL 4F0HA 4RNOA 5IQQA 1URRA 1IKYB 3T5JA 2GQQA 1J5OA 1Y5IB 3KJQB 3D3BJ 2L08A 2M8DB 1RTJA 2FZKB 4OI6A 2MKJA 3NNAA 2N4CA 5KT4A 1TKZA 1HWUA 3UNYA 4IG0B 1Y5LB 3M30B 5GAEU 1LW2A 3LP1A 3DGPB 3K0JA 4DS5A 2VBWA 5LJ5Y 5L46A 5CYQB 2YTCA 3PW7A 4I4BA 2JLGA 4Y2AA 2KVIA 2AQ4A 1T03B 4YR0A 2F4VJ 5ETNA 5B0CA 2HVHA 4AL7A 5AJ3J 4USIA 3AHPA 2VODA 1L3TA 3ZZ0A 4LF7F 1HNIA 3MUMP 2ABYA 5D4NA 1I1GA 1HARA 4JOUA 5B09A 4YQWA 1F5CA 3MECA 1BE4A 3NCQA 1L3KA 4KTQA 4LVNP 1WC0A 2DR9A 1Q86T 2WONB 4BS2A 2IA0A 2CADA 3I5CA 3P3DA 3HSGA 3KJFB 1VQMS 4FYYB 4YN3B 3LP2A 4GKJF 1WF1A 3V6KA 2JH3A 4B17A 3T41A 3EM1A 3P8BB 5IC6B 2BE2A 3POTB 2HQGA 2DNNA 4L3KA 3IC1A 3W5YA 3THVA 1HQUB 2VFVA 5K8OA 1XWLA 1M5VC 2X51A 2MKSA 2CQCA 1HNWJ 4PUOA 3M2RB 2ZBQA 3M8RA 1F2HA 3LWLA 1YSJA 2Y1LB 3CUNA 3QRRA 1GQEA 2VC1A 2RE1A 4XDDA 3JSRA 3GR1A 2DH8A 1F1BB 3PR4A 3TZYA 3W62A 3TANA 3NNHA 3VF0B 3TZZA 3NCRA 4HL9A 4FVCA 3QFWA 2XS2A 3H5UA 1U1MA 2I9SA 3GB0A 5CCMA 3SSQA 2J9EA 3T9NA 3O1LA 2D9PA 3R7SB 3SFUA 1S1UB 4NZ0A 2OPPA 1LW0A 3D1OA 3LAMA 2ZHAA 4ILLA 4NZ6A 5LXRA 4K4WA 3PX6A 1RQ0A 4EBDA 4IFYB 1U0HA 1H72C 1JLGA 2R42A 3BM7A 2H54B 2DITA 1FNOA 2XHWA 4WZQA 5I42B 1RA7A 1IWAA 1JLBB 1WTFA 2DGSA 4CH0S 5GAHU 1VQNS 3DRYA 2LXUA 2JFKA 5C24B 4MIWA 3TZWA 4NLVA 1F0XA 3MWBA 3D1QA 4MKAA 1MN9A 3OL9A 3BGRA 1QAXA 2PMWA 2W2NP 3ENWA 2D74B 4JP8A 3I0SA 2UV8G 5IT4A 3CJTA 3TVYA 3RAXA 1NDCA 4DV5J 3AOBA 4K0KF 3HZEA 2FVRA 2KTQA 2LFVA 3UD5A 4PG7A 1VQOS 1FRIA 3CNQP 1H2TZ 1B7FA 6FD1A 2Y0BB 1JB0C 5DG7A 1BQMB 4N76A 2DJWA 4WK1A 1RYRA 3NLCA 1WSVA 2VG5A 2GJIA 1N88A 2R7XA 4OHZA 1NEEA 1WORA 4KPCA 1NJYA 3THPA 3LOUA 1IKXA 3V4IA 5SUHA 2ZVIA 2OO4A 3C15A 5KG0A 4DV7F 4QJVA 5F8NA 3H20A 2XBPA 3DLLQ 3DM2A 7AT1B 4PYAA 2CUYA 3ISND 2DGVA 3OPKA 2F63A 3EE3A 3EGVA 1YRTA 5FLXU 3HMJG 4MMOA 3T1HF 1Q81T 1FDDA 4Z2XA 2HNDA 1FRXA 2BYCA 2KG1A 2YKOA 3MCMA 3M1VA 2WSFC 2GMLA 2R7UA 2FLOA 4TY9A 3AJ1A 2ZDOA 4DR1J 1CQNA 4DU7A 4ED2A 4A8QA 2CPDA 3HKWA 5IXUA 3V81B 1S9FA 5KG3A 3T9ZA 3H2UB 2V6AA 4Y00A 3EGWB 1KTVA 3SMZA 2HHUA 4NLGA 3MM5A 3C16A 1N32F 1Y00A 2LQ8A 3FKBA 3VAFA 1YJWS 3PW4A 3BGOP 3OTOF 3CC4S 3W60A 4QCLA 4OV1A 5L1KA 2XMKA 4TY8B 2C3YA 1OYDA 2D3O1 1FRJA 1X8DA 1LWCB 3Q2SC 2H51B 3MCOA 1HBNB 1UPMB 4FXDA 4ZMMA 2OPSB 3ELHA 2CA9A 3BR9A 4ECYA 2LU1A 3T5LA 4E98A 1HPZB 2IJRA 4H4MB 3HHNB 2LU2A 1VQYA 2XC9A 1HQEA 5F0WA 4W90B 1OWXA 3BN4A 3PFEA 1U25A 1N6QB 2VL1A 5K8NA 4USMA 4DLGA 1LQ9A 4FZVA 3R5AA 4ZPBA 3RG6A 5KFVA 2XNQA 2YX4A 2HFSA 3MXHP 2W25A 2EBGA 4YB1P 5AE3A 1FRMA 3ENVA 2IC3B 4OZ0A 1IN0A 1YJNS 2KM8C 1N0UA 4RU2A 3OFEA 2OPRA 3TJ9A 1YRUA 2DHGA 4RUHA 2J8AA 2MKHA 1RAHB 3QRQA 4K7QA 4WFBQ 3ZZUA 3CDUA 3Q8UA 4Y6IA 1UFLA 4X4RA 2CVIA 1N52B 3O3LA 5FDLB 4TN2A 1K9MT 1WTBA 4WTYA 2AMCB 2HRYA 3JTPA 4KE5A 1RSCA 2EKYA 2EG2A 3BQ0A 1G3OA 5IT9Y 2PEHA 2A10A 1RT3A 3EZ5A 2HIQA 3ZZRA 2CQGA 2ILYA 4JI2J 4W98A 2R7OA 1T8EA 2RH3A 3QLHB 1S76D 2HVZA 4AQYJ 1ZBTA 3DDIA 4HDHA 1DTTA 3NCPA 3M9MB 1S1XA 4OLOA 3D2WA 2J9CA 3DRRB 3VGSA 3W5ZA 2N4DA 2RDDA 2V4JB 3KHLA 1JXLA 1JIHA 3J81Y 4DFMA 2DPJA 4LF8F 5C25A 3FEXB 5DZ7A 3IO1A 1ZAWA 3FUYA 2V8VA 2V63A 3QGGA 4F3MA 1L3UA 3GU0A 2ZHOA 3C66A 2IM1A 3WX4A 1M5OC 4JUZA 2NXNA 2QIFA 1UWBB 4USUA 1TL1B 3IS9B 3MOJB 3QFHA 2VG7A 4I2QB 4V1Ak 5T41A 2MB0B 3CSKA 4UOHA 4DL2A 3CULA 3TR5A 4NX9A 4IR1A 3AFGA 4ILMA 2U2FA 3FSYA 1UJ6A 4DV6F 4ZKAA 3DI6A 1KHWA 4Y2MA 2DH9A 4ZPTR 3DMJA 2VZ9A 5D78A 4JI8J 2R9LA 1C4AA 5DGAA 3G71S 1SC1B 4YFUA 3TW0A 3HCXA 1N5YA 4ALZA 3PVXA 3WC2A 4PEOA 2Q66A 2JFDA 2NUHA 5IZHA 3MEGB 5LM7E 1A9NB 1WWHA 1JLEA 1XMOJ 2R7TA 1CPZA 3VAJA 2C3PA 3A8KA 3RW7A 2UXDJ 2R7SA 2XO6A 4D3GA 2ZE2A 2NUUG 1CJVB 1FD2A 2CPHA 1RHMB 3EZUA 3WIUA 3CD5A 1IKWA 2DR8A 3FK4A 4TYBA 3R1HA 3EUNA 3R5CA 3CCWA 1CULB 1NK0A 4ZVPB 2MHEA 4ZCKA 5CYMA 3MM6A 2DHSA 3BN7A 2QMXA 1WC3A 1NKCA 3OHBA 4CIOA 4OYXA 1D0EA 3IG1B 1JJHA 1FVSA 5B0EA 2I5JB 2DNKA 4O3SA 1HW9A 3W63A 3CDAA 3BS9A 5CYJA 3DLHA 2LMIA 3IN5A 4JI5F 3NBPB 1NXIA 2CQ1A 2V2QA 1SQFA 5EWFA 4NRTA 1RAEB 1IQTA 1KONA 2UXCF 1N5VA 4DPTA 5IV3A 4YOEA 2VFSA 2UU9F 3IA0A 4UY85 1SV5A 2BJEA 2PI4A 4J37A 2I6WA 2LQ5A 3M32B 4TU8A 1HQ2A 3UN2A 4LBPA 2VPWB 3GYXB 1GMWA 2LKZA 1Q5VA 3ILJA 2DD8S 2W9CA 3IMQJ 4JI4F 1RI7A 3E01A 4K8RA 3OQ2A 2EI5A 1KTQA 1IJEB 1LWFB 1M0SA 1NU4A 2ZVSA 2K06A 3CCZA 5HBMA 2OHDA 4IR9A 2B56A 2DGQA 3WZ0A 3H5YA 1FTRA 4KKOA 5L8RC 2Z0GA 4C98A 1QAYA 2UUCF 1MMDA 4HT7A 5GAGI 1MU2A 3GIMA 2B7BB 2R3VA 3A13A 5L9XA 3JSYA 4QR2A 2CJBA 3KHHA 1QAJA 2WVFA 4B9TA 4EWTA 2XLKA 2QLBB 1F5AA 3NXZA 3OT9A 4WF9Q 4OJ1A 5DGBA 2EC0A 4DV3F 1C1BA 5T14A 1VQPS 1RTHA 4RJVA 2JHEA 1T0TV 2FJWA 2QL7B 4ZPVR 4ED6A 1RTIB 4RUAA 3KK2A 3MTJA 2RKIB 4HACA 1SI9A 5GAGU 2WSEC 1J5EF 2YWHA 3F41A 2XCPA 4DR4J 2AEMA 3OR1A 5HLFA 2B8QA 2KXNB 3H5XA 4M95A 2LDYA 1PKUA 3HD1A 3W65A 5BR8F 3RAQA 3S6EA 4B3TJ 4HI1A 3PDNA 5KFMA 2B51A 2Z30B 3NGTA 2ZD1A 2LEAA 3VVTA 3H8YA 4GVLA 3M9OB 3L7OA 2JLFA 2D69A 4I2PB 5F41A 3FQLA 1VRUB 2OD4A 1EARA 3OSPA 3F0NA 1YK9A 4U7UD 3H42A 4HKQA 1SQGA 5B0AA 4ZIVA 2WOMB 2NCKL 2J0QD 2DGTA 1H2UX 2LXIA 3WDOA 4RBTA 4ZPCA 2AZ3A 4LSNA 1P9QC 1RAOA 3MD3A 5A0YA 1CQMA 2HURA 5CD4A 2C1EB 3HJFA 1LOUA 1FWLA 4B9SA 1AFIA 3HFVA 1NRKA 4NA2A 1PC4A 4CLSA 2H1YA 3N4WA 3VWSA 5J2QA 5ETQA 3SQOP 4F0MA 2CZVC 4MAKA 3W9IA 3MZIA 1Q5YA 4ETZA 3D6MB 3M2UA 1SL1A 1YTYA 4XO0A 1UVJA 2WW4A 2CYYA 4DN9A 1RT2A 4JI7F 4Y2IA 3OLAA 1FNXH 2O1PA 2EPIA 1M5PC 4MH8A 3R3TA 4LFAF 1D8YA 3A3PB 3Q24A 4HEA9 4ED1A 2YKMB 4L76A 2B3TB 4N8OA 3J7Z5 2RSQA 2YWGA 2IDEA 1S1WA 1CJKA 2Y1JA 5ETPA 5BXIA 3IBWA 5DQHA 4QYZK 2KRRA 2ASYA 1X5PA 3FRYA 1VC0A 2GZOA 1TR0A 1H7WA 3JB9k 1ZZNA 4DCOB 2YKNA 1K1QA 3PM9A 3PX4A 3W2WA 4WPAA 4M5GA 3T6BA 4QU6A 3BSNA 2B5JB 1NK8A 2QZ8A 4ATNA 1L3SA 2IAJB 3TAMB 1BWVA 3OTDA 3RZAA 2MQPA 1RT4B 2DYAA 1FEEA 5DG9A 1Q1KA 5KFZA 3OW2R 4G65A 2FUG9 4I1TA 3MEKA 1NK7A 4ES3A 1YZ7A 1U49A 4ZN3A 4IH7A 4FF2A 2J76E 4DV2J 1SKWA 4TYAA 4CH7A 2HNZA 2VHGA 3J80U 4KC5A 2O67A 2E5JA 2A0FB 4YB5A 1OY6A 1RWOB 4U7CA 4NI2A 2W4CA 4HLBA 3J81j 4KGZB 1VBKA 1URNA 3AODA 2DNPA 4DG1B 3PACA 3VGTA 1TKZB 2DNRA 2IYGA 4A46A 3I6PA 1JJCB 3LP1B 4KBIA 3OLBA 3Q23A 2CG8A 3G9CA 2DY9A 2A6OA 3B8HA 3D66A 4RKUC 1FA0A 2DO0A 3DRSB 4M5DA 2MLYA 2MZSA 3FEYB 3FGVA 4RUBA 1N36J 4F4KA 1Y5NB 3TVZA 2PMZD 2VICA 4LQ9A 5FLXY 4P73A 4K5SA 2DNGA 1HNIB 4F4AA 4CM0A 1U6ZA 2NYIA 3OL8A 5IQ6A 3VR1A 1WJ9A 1NBEB 3MECB 4M8LA 4ZP7A 1ZYQA 3QZ8A 5AXNA 2OTLS 3GIIA 3ZTQA 1ELOA 5LJ3Y 4E8UA 4NLYA 4CH1A 1VOMA 4PZVA 4DFKA 4Q5VA 3KNGA 3OBIA 2ASDA 3OTBA 3HF5A 1HNWF 3LP2B 1EP4A 2DGOA 4YY3J 5KFTA 1YG0A 2BANA 5BJRA 3CMQA 2QRRA 4K4YA 4F25A 4UQTA 2B8PA 3K5OA 2XLJA 4KAIA 2VH7A 1KC8T 2IPOB 2RF2A 1A6LA 3P96A 2KT5A 3DDNA 3SSSA 5BYSA 3UCZP 3QBCA 2PA3A 3QPIA 4ZVOB 1WF2A 3BGFA 5L38A 2MQOA 2OLWA 2K7JA 3C2PA 3KWMA 3X3UA 1FKOA 4Y28C 1E6VA 2BV3A 1BXNA 3L09A 3HVAA 3MI7X 1S6QB 1REGX 4FKXA 4FNIA 3GFYA 3AQPA 1M1KT 3MF5A 2NREA 4ECZA 2HLUA 1RWUA 4RW7B 3OR2A 1KEKA 5KFAA 3EDRB 2IRYA 2P8IA 1RB0A 2I8EA 1VBYA 4TKTA 3QT5A 1LW0B 3ENAA 3TO8A 4DN0A 2JJ4D 3UN5A 1XK8A 2FJAB 4JI3F 1U0HB 2YKQA 4DX8H 1VLYA 3C6TB 2VIHA 1HNXF 4KIAA 2AGPA 2V50A 5F8IA 2D1CA 4KQZA 2GA7A 3A8IA 3I0RA 2FVSA 2KH9A 3TNVA 5HQMA 4DR6F 3I9V9 4DJBA 3AA8A 2MLXA 3FJ2A 3IRXA 3KKFA 2JEJA 1SIZA 1NK6A 2W9BA 3MUVP 3DLGA 4RLEA 5DETA 2C3UA 1TP7A 4FNHA 4WK3A 4C8YA 2V34A 2KDOA 4DX5A 1VIXA 3MPYA 3EGNA 1T9TA 3MCSA 4LF5F 4H4OA 5A2QY 4IOBA 4GO7X 1RKJA 3DN9A 4DUYF 5DDQC 1OMSA 1Q78A 4DF4A 5LXYA 2J6TA 3K7RA 1HBOA 2XSJA 5K14A 4WYWA 4TU7A 4NLDA 2VG5B 4CCHA 3ZXWA 4F26A 4X66J 1DBDA 2HHVA 4WFAQ 1KVIA 3A4TA 4QIGA 1IKXB 2QA1A 3DM2B 2ADCA 2P9EA 1UEUA 2ZH2A 3VQSA 2RJZA 3DRPA 2ZWOA 2YVSA 2G0JA 2P6SA 3BREA 2DRAA 4ZPWR 3TX8A 2GHWA 1X4CA 3FZ2A 5F8JA 3RBXA 1CEZA 5H9FJ 5ETVA 1YHQS 3ILOA 2AX1A 3RJMB 5LOQA 2V9WA 4EBEA 5IWAJ 3M1VB 2AJFE 2C2OB 3B4DA 5L1LA 4YHHF 4K4VA 4KYZA 2HG4A 1NKBA 3LP0A 5KTQA 2ZBCA 1A7GE 4ECRA 2Z57B 4WP3A 5I3UA 2E66A 1T94A 2BOAA 4M5MA 4DR7F 1QUVA 4P74A 4WFXA 3R27A 5KG4A 2GMHA 3DLKB 4ID8A 4QYZJ 2A3JA 3I87A 4G3IA 5KFHA 1WKJA 2FGCA 3HT0A 2CFXA 2AF6A 4ID5B 4B9VA 3MM5B 3C16B 4Q43A 4ECUA 2Z2MA 2HHHF 4PYDA 4DL3A 4FF4A 1U1RA 4UOFA 2OPQA 2KL8A 5CZXA 2X1AA 1FXLA 4DPUA 2RRAA 3GV8B 1LK5A 2RS2A 3FBEA 1W25A 3BSAA 1HHSA 4DL7A 4MFBA 4F4XA 2VPXB 5C42A 4ZP9A 5HANA 5KFDA 1QE1A 3EPIA 5HO4A 1HWLA 2DR5A 3TZXA 3CJKB 3HO1A 2IMOA 3D0GE 2F9JA 1HQEB 3FVYA 4PXCA 3PW0A 5H1SV 5J2PB 3GQCA 1C2PA 1B4SA 2AGQA 3PJXA 2YQ3A 1JXEA 3JSMB 2IJNA 3EVOA 3MAAA 4G1QA 2GQ2A 2BRKA 1YJTA 1KDNA 1FKPA 1OSCA 4USJC 3HHLB 1M5HA 4DU8A 5DLFA 3PIPQ 1BWEA 3QAUA 4IQXA 1PBUA 3ET6B 2RMLA 2XMWA 2CQ0A 4PQUA 1S57A 1NSPA 3M05A 2MLZA 4AQYF 4RR5A 1JQGA 4ZCIA 2MSTA 4P9SA 3HDSA 2POKA 1RABB 1X0PA 4USWA 5D0HA 2LEBA 4O3QA 4DR5F 5G0RB 3V6JA 1ZM3A 2CPJA 1X4EA 1X5SA 4F7VA 3DFEA 5KG7A 3G4SS 2LECA 2UXBF 3GFZA 1MWYA 1DTTB 2QTWA 3O6QA 3ILIA 1S1XB 3IWXA 3I9ZA 1RT6B 2W7AA 4AL5A 2Y0SD 4QZVB 5GMEA 1VCTA 2JOQA 1ACMB 3CCSS 2ZOGA 3OL7A 3AQOA 3SV3A 2IM3A 2B6AA 5C25B 1QD1A 2F7VA 2R2SA 5LMUF 4FKYA 1SJFA 4DQQA 1KR4A 1FRLA 2V2ZA 4H4KC 2DHXA 4RPFA 1N4LA 2DR7A 1T9VA 2NXCA 4EYIB 4CLLA 4LFBF 4HTIA 4RNFA 3OXGA 1LFPA 2UUBJ 3DCAA 2QLXA 2NZ4A 2V8GA 1XNRF 3TYTA 3LALA 1WC4A 1YWXA 2XMJA 4DUZF 4XIUA 3HVRA 3IRWP 1TKXA 1S1VA 2VG7B 1Z2ZA 1TMMA 5DDPC 4OI0A 1RHKB 2QX0A 4O23A 4YR2A 3MM8B 4Q45A 2EFQA 2W4DA 3ZTRA 2IBKA 1BHNA 5EUHA 1VBZA 1XMOF 5GMKa 3MR7A 4DL4A 3DI6B 4OYOA 5EX0A 3LWMA 2MJUA 2RHQB 1WNEA 1DQAA 1I94F 2MQMA 1XNQF 3MAQA 3JAMY 2J0SD 2VBYA 2XMTA 3LTOA 3VCDA 5A76A 2ZJPQ 4F4WA 3VVUA 3K17A 4B3RJ 3MCNA 2BBEA 1EQMA 1XEZA 1SKRA 1QSYA 3BBCA 1R3NA 1SL2A 2XGQA 3CIMA 3DOKA 2AU0A 2J7KA 4V19J 2XY5A 1ZS6A 4ZDNA 1NK9A 2FZGB 3OXLA 4RZRA 3A3OB 3L7UA 3SDEA 5KFXA 2MXYA 1VRTA 1R8CA 2VG6B 3MR6A 4D3HA 5CYMB 3CO9A 3CJ8A 2E7WA 2KYZA 1T9YA 3H98A 1RLDA 4XTTA 4F4ZA 4ED5A 1XERA 3QYYA 4LFCJ 3M6UA 3PIOQ 4JI1F 2BKOA 3MM7A 3ZTSA 2PFDA 4DZDA 2WVBA 4RW9A 3WHIA 2BMBA 5D3GB 1XMQF 4RW4A 1LKZA 4O4RA 1N48A 4KY3A 1H6KX 2PN6A 5C2CA 2ZH6A 1K73T 3H25A 4USTA 2GCFA 3I5BA 4AUKA 2YKAA 4P52A 5CQGA 3M6VA 3K59A 2YXLA 2HFZA 5K20B 1VQLS 1R0BG 3W66A 3IR5B 4DSEA 3BO4A 2GC8A 4ZJOA 1SV5B 1GMUA 3ONQA 1HYSB 2JEIA 4ECXA 1P8GA 2VQEF 3FFIB 5DS7A 4CO0A 1ZZFA 2C22A 4BWMA 1WEXA 2QSFA 2MZTA 1S6UA 3V6HA 3D28A 1RWNB 1YBAA 2YPZA 4L75A 1WOSA 1FKAF 3RUBL 3KLEA 1UAWA 2QA2A 4KKOB 1TL7A 4OZ1A 5SZTA 1CVJA 5KFQA 5CZVA 2X1FA 1MU2B 1KKHA 3EXYA 5CABA 2MZRA 2YNGB 4I7FA 2APOA 5HATA 2UUTA 2ZJRQ 1QTMA 4LR8A 1K0VA 4ZVTB 3N6LA 4M5IA 2KRBA 4URSA 3C14A 1TK0A 3PEHA 2QMUB 4ICLB 1KOHA 3LQVA 4OQJA 4EUVA 3DHXA 4WFNQ 3KK2B 1GNKA 3Q0AA 4ANDA 1Q95G 3QRPA 2Z56B 2DY1A 4X65F 4B3TF 1DQ8A 3CD0A 1Y11A 3CCLS 1TUWA 5E33A 2UVWA 3TUIC 3OR1B 3TVKA 4CTAA 1U47A 3FBFA 1K44A 3UI3A 3O8WA 2NS1B 2E1MC 2ZC4A 2F4FA 3AD9C 4C8MA 3RYLA 4KHPJ 3HVWA 2AYGA 3Q8YA 2HAIA 3R97A 4OX9J 1N56A 2BJ3A 2DGXA 3GJRB 2VC0A 4DCJB 1RWXB 2K2PA 2E7XA 2RDIA 3M4XA 1FFGB 1O8BA 4NXMJ 4RNMA 3D6FB 2JL9A 1EETB 1WI8A 5KFWA 4K4ZA 4ED0A 2DBBA 4BC9A 2DNHA 1U1QA 2WW8A 3G6VA 1S0VA 4EZ9A 2BE7D 3KLHB 1RWPB 1R0AB 5K9FA 3MMJA 4CLWA 4OZ2A 3KLFB 1N34F 5LL6d 1X5TA 4Y2CA 1N33J 2C42A 1YVFA 4QIVA 3MR5A 1IBKF 3J7A1 3MHYA 3ZNJ1 3CD7A 3BR8A 5HMWA 5DQGA 3LGHA 1OS5A 4XAKA 2W7OA 3MDFA 3M2UB 3UCUP 3QSYB 4P2MA 2RQKA 1RT2B 2E29A 2RD5C 2IFXA 4FDFA 3G82B 2BZ2A 1AA1B 2W4PA 3PHTA 3MAHA 5IS2A 1UFWA 4WIIA 3GSDA 2HS0A 1D8ZA 4JYAF 4B3MJ 1DTQA 2MQLA 2YX1A 2A1BA 3MEDB 3QJJA 1V3RA 1JLFB 4HTJA 4Q44A 4QOTA 4EI2A 4WU3A 3NGKA 1R8PA 2CJYB 2AT1B 4NLUA 4OJHA 1HR0J 2RUSA 4Q8FA 2KFNA 3F56A 1VK3A 2CKWA 4KO0A 2YKNB 2WHOA 3VAIA 3E3XA 4YP3A 1JLAA 3PEJA 4EGLA 3DLJA 3R5BA 4FXWA 1UVLA 4IFVB 1EJ7L 3CB4A 4DV4J 3VTIA 2FY1A 4RW8B 1S0NA 3G87A 5M2UA 2IVFB 1XN9A 4DV2F 1UETA 2AKWB 3KJNB 3JTNA 1FF2A 4OYMA 3JS9A 3T3FA 5D77A 3S01A 2QLFB 4U67Q 2BJ7A 1IQZA 2EG1A 3HHLC 1TKTA 4MKVA 1HWJA 1VHIA 1WKKA 4QIWD 2HS3A 1JLCB 2OP5A 3D6TB 3KUGA 5IT9U 4ILRA 3KG0A 2MPUA 3PTWA 3KUHA 4HHHA 4N56A 4O0IA 1NO8A 4NI2B 1CSJA 1F5BA 3TQ1A 1B0VA 5KG2A 3KDNA 2DTJA 5JMNA 1CBKA 3R7BB 1WHXA 3PG9A 2CQPA 4FYXB 5KFNA 2VJVA 1RAGB 1S49A 4GRSA 2MGZA 4AXIA 5J2NA 2D41A 2ZJQQ 5HVHA 3QNWB 1X7VA 3OHAA 2CVEA 1WHVA 4M5DB 4W92B 5RUBA 1NCLA 4RNHA 1TMJA 3Q8QB 3GZ7A 1Q8BA 5HN0A 2EFGA 1B0PA 5DLGA 1VHFA 1BC6A 2ROEA 3GJQB 4DX6A 2XTJP 1FTCA 4TLRA 4YDDB 4OX8A 3G6ES 4LVOP 2E5HA 4JV5F 1TAUA 4ZCMA 1YZ6A 1F3FA 1BLUA 3NOGA 1RKIA 1H98A 4K5RA 2ZH7A 1EP4B 2UVVA 1AUSL 2BANB 3G6YA 4UOGA 2E5GA 4WP8A 2RQCA 4R0EA 5ETRA 2YNFA 2VFRA 1GXLA 2JDJA 3TRGA 3I56S 2V4QA 3G96A 1C0UA 2HMIA 4ED8A 3HX9A 1RU1A 5KT2A 4A47A 2B4UA 3MMCB 2UP1A 2M3DA 4X4OA 1KQGB 1RAFB 2AZ1A 1G6BA 2V2VA 4B3SJ 2HFOA 1SC3B 1E6VB 4WE1A 4ZP6A 1SJ3P 1B70B 4IG3A 5HQ8A 2VUGA 1O5JA 4LF1A 2BDPA 2CDQA 2G0CA 2FY8A 4DSFA 4LRDA 1IBMJ 1NSKL 2LQ9A 1X4BA 1FT8A 1R8AA 2CQDA 1X9SA 1SXLA 3UN3A 4Q7AA 2GS8A 2J0WA 1Q0NA 4NLTA 2N3OA 3FSXA 4JBCA 2QE5A 2JVOA 1U1PA 3HHEA 1S97A 3I96A 3T1YJ 2BA9A 2YQ0A 1RWMB 1APSA 4OYPA 2E9RX 2BXJA 1T7PA 2HQFA 3D54A 2RHSB 3IWLA 3EYZA 4C8LA 3I0RB 1YJ7A 3NY0A 2AYMA 3AH6A 1MNEA 3EVWA 2H3EB 1IKYA 2V68A 4EEYA 4DR2F 3KG4A 2ZH4A 3P49B 2UUAJ 4DSJA 3C6UA 1BGXT 2FPHX 2W9BB 3DLGB 4MYTA 4OI4A 1NJXA 4IRCA 3TUJC 2D7SA 3B54A 2W2QP 4PPDA 2PEBA 4MKBA 2FVCA 4A48A 2LXFA 2F8EX 3CCQS 3Q86A 2H4WB 4LMZA 1N8RT 1F9HA 3SFGA 1DJ0A 4IRKA 1Y10A 1KLNA 4DDFA 1GX6A 1J2VA 1T03A 1AB8A 3A12A 1HBOB 5K14B 3QGPA 3K5LA 2KZZA 3EICA 1N0VC 4GKKF 1OPZA 3BKFA 4NWBA 3RRGA 1UVMA 1RJJA 3C3LA 4QU7A 4ELVA 4GC6A 3KK1A 1S77D 3GFXA 5HMXA 4ETXA 1KWMA 3KXDA 2LA4A 4FPIA 5I4MA 1JNRB 1F9FA 3QJPA 3HULA 3JYTA 3H0PA 1ITPA 1IKVB 4OMFG 1VQ4S 5HSPA 3POTA 4FYWB 1MMNA 2N3LA 3AA9A 1B7YB 4UTGA 4NCGB 1HQUA 1REVA 1T11A 4GKJJ 1IR0A 1YX2A 4ZVFA 2LQJA 4HVZA 2VQFF 1RISA 2FVQA 3LP0B 4HH1A 5HJYA 1ZM2A 3UR0A 2PD1A 5I3UB 2W9AA 2KN4A 1SKSA 4OJ3A 1FRKA 1DLOA 1VRQC 5L1JA 4ECSA 4OX6A 1TTHB 2XZDB 5LSOA 2Y8WA 4ECQA 5LSRA 3BGLA 5L9NA 4M94A 2XNRA 3M6XA 5J2MA 4K4TA 4OZNA 2PFFB 2UUWA 2XULA 3CT9A 2EFNA 2MQ8A 5F8MA 1S1UA 4JI6F 5E5NA 5AXKA 3R9LA 1Q7LB 4LF2A 5HVGA 3MFIA 4IFYA 3VZHA 2OPQB 4UUXA 2UVRA 2A2CA 4HR2A 2I0XA 2JEFA 4PXBA 4X4QA 2EK1A 2HZVA 2E44A 3CJ5A 1KN6A 3BH7B 3MFHA 1PBAA 3UVJA 1EKRA 4MFBB 5CA5A 2F40A 3T19A 2DISA 2HQCA 3D0IE 1PG5B 5C42B 2AP6A 1JWWA 2OSRA 4J9KA 1NPPA 1RAAB 4IDKA 1OSDA 2HWHA 4UT4A 2CQ4A 4AYBD 3BSOA 3CWJA 5KFKA 5CD4H 3CCUS 4LF4F 3AAWB 2KVQE 2OAUA 5LMNF 1HFEL 1YIJS 2XS7A 4QW8A 3PY8A 3F44A 2E9TA 3PRDA 4YMEA 3FSIA 3BH6B 1NKEA 4IOAQ 2XI2A 2HKEA 4KFBA 5HROA 2DNQA 2L3MA 2RNEA 2C2MB 2CPIA 3OV7A 3SZ2A 2L41A 4G1QB 1BQMA 5E7OB 4J9VA 4C9DA 1SJRA 2CWXA 3GE9A 3S8SA 2KZMA 4C2MA 1U48A 1T9XA 1JK9B 3ILLA 4K0KJ 5GAHI 3DOLA 4KH1B 4PQUB 2X7IA 3A8JA 2NYHA 5DM6Q 2XI3A 5H9EK 4DHVA 2FHKA 2XYPB 2OEJA 1RAJA 4WCEQ 5KG1A 4NCBA 5D4OA 5DQIA 2DCLA 2OUGA 3PR5B 4DPOA 3V2UC 1KVKA 4EBCA 1IUJA 4LRFA 1DFDA 1BMQB 1S72S 1WHWA 4DV7J 4B9UA 3D7SB 5KFGA 3KOAA 2A18A 3AXKA 4CNYA 1X4AA 2XMAA 2B4VA 3OJSA 1AROP 4QW9A 3Q2TC 2C2ZB 2VDIA 1VJWA 4DZ6A 3T1HJ 1VQ8S 1UWAA 2H48B 2R7WA 1JJ4A 2JLEA 3U27A 1U24A 3PZPA 4F67A 1QSLA 4RO0A 3HPOA 3HSDA 1WC5A 2PIIA 5A8WB 4CT9A 5ETLA 4C8NA 4PCQA 4OX7A 4TU9A 2C2DA 1W2BR 2ZITA 4CO5A 1S6OA 2KYXA 4C3MA 4QQBA 3OL6A 1TK5A 1PCAA 3W64A 3BKUA 2VPYB 3QZ7A 1TKXB 5M2RA 1NK4A 1TUVA 4TY8A 1Y0HA 2YWKA 1OIAA 4GC7A 2ZM6F 3LPEA 2B7CB 4ES1A 4IUFA 4P7VA 1LWCA 3UD4P 5E3CA 3CCES 1N32J 1H73A 3IP0A 1HBNA 2GHPA 4DL6A 1M1GA 3TAPA 2F9DA 4B9LA 1F9EB 1UJ5A 1RT1A 3VHQA 3RGIA 2HVIA 2R7VA 1AT1B 2VD3A 4H4MA 3TEGA 3LH2S 2XLIA 2E5IA 4N8NA 1D09B 2VOPA 3PJWA 2P9CA 8RUCA 2BX6A 4NPOA 3S7RA 1NUEA 1YI2S 4ECVA 3R2DJ 5KT5A 2YNIA 1TVRB 4PQAA 2YH1A 3OTCA 4M5HA 2N7YA 1S59A 1S9GB 3L7PA 1P6TA 3NGDA 3CTRA 5KFLA 2ZH9A 2O66A 5HMZA 2FVPA 2HQDA 3CMAS 3JQKA 1K8AT 3K5MA 3GLJA 3SDEB 4R8UA 1VRTB 3M8WA 2M4MA 1RACB 2QYGA 2XMUA 2XY6A 4J90A 4USHA 2E1PA 4DXLA 4YS2A 2QV6A 2ZFHA 3K8WA 2IJFA 5FDLA 2NPIA 4B3OA 3N0VA 3OVSA 2KKHA 4RW9B 2GIRA 4J91A 4N77A 2RT3A 1PAUB 1NZAA 3OJUA 4F2RA 1UA1A 3ZZYA 4NRUA 3KYLA 4E0DA 2J9DE 3B78A 3BBFA 1PILA 2W2PP 1GX5A 2M5YA 2MKKA 1JLQB 1R8HA 4QR1A 4N41A 4X4PA 2WAQD 4WTOB 3OXFA 2YWFA 4ERDA 3QLHA 1PJ5A 3GILA 1D1UA 4QYRA 1UA0A 4URQU 4G1PA 2HLTA 1SH3A 2FHMA 2N7CA 4NE9C 4NA1A 3TOQA 3MTKA 1IJFB 3UCGA 1TZ0A 4CO4A 4LREA 1FFWB 3CC2S 2VFTA 2CDRB 4DUTA 4NOHA 1TL7B 5CHCB 2DH7A 2AYEA 3BO2A 2OSQA 5D4PA 5A8KB 3KLIA 4LF8J 4I7FB 5A2QU 4N5SA 3IS9A 4PG8A 1Z1ZA 2HHQA 4ZS6A 1HBMA 2HHXA 2W01A 4DQIA 3CJQA 2PT0A 2FIUA 1T02A 4NXNJ 2BABA 2DVIA 1DHMA 1H38A 2PSZA 2E5LF 2HRUA 1S1TB 3RBZA 2E1RA 1S99A 1C1CA 1HIYA 3ULHA 1VC5A 2HS4A 5KFFA 3W9HA 3MOZA 3EXCX 4ZVQB 3M7VA 1HKAA 4ANCA 4ZVUB 1RT5B 2CXEA 2ZZTA 4KHPF 2HEKA 1NHVA 2NXJA 1L3VA 2PGCA 4OLPA 3BYRA 2YY3A 4X4NA 4AXJA 3W9JA 4DV6J 4MK8A 4CTAB 5KFEA 1HNZF 5AE2A 1FERA 2D9OA 2YPYA 1R89A 3MMBA 4U6PA 4OYZA 3CJ0A 3AJDA 5IFMA 2AEFA 3DOMA 2J6SA 2P9GA 3RB6A 3SBMA 2CJXB 3LGMA 2ILZA 5D4LA 2FHOB 2HWIA 1U1OA 5E3PA 4UZBA 1P27B 4KV8B 5JJBA 2GIQA 2Q3PA 4DL0C 2FJEB 3G6XA 2KXFA 4YDXA 3OD2A 4NEYA 4B9NA 5D0GA 4ZP8A 2FJDB 5HP1A 3W2VB 2XZTB 4OI3A 3WIVA 4DLEA 4DFPA 4DPYA 2BKNA 2CQ2A 3B82A 4EMDA 1WOPA 3GTYX 3N01A 1FJEB 3BB5A 4FS1A 1G1XA 2XM3A 2QT7A 1YJRA 3DXSX 1IM6A 3G8SA 5BYRA 9RUBA 3UR3C 5H9EJ 1CC8A 4LT6A 1B3TA 4PAAA 4B3MF 3U1NA 2UZAA 1FX4A 3RB4A 4OYIA 3NGSA 2VV5A 5EGYA 3D67A 3TA2A 1WELA 3M32A 1VMBA 2Y1RI 1JKHB 2V69A 4CO3A 4Y3CA 2MEWA 4HHUA 3N5BA 2DXDA 1DTQB 2UXCJ 1U6BA 3UO0A 5HAOA 3DLBA 4YUDA 2UU9J 1TU0B 2MKIA 4LF9F 4F50A 1R31A 3HD2A 3HSJA 2UV8A 3MUTP 2DEIA 4ZLJA 3P4UB 1NHUA 3TP2A 4JI4J 4KO0B 3RU0A 5F0UA 1KS2A 5KT6A 3H2VE 3HXMA 1JLAB 2Q6CA 5JVHQ 3AT1B 1HW8A 3CIZA 1RBOB 1V9OA 4N47A 5KFBA 3FMBA 4A8WA 2XSFA 3QMQA 1XR7A 1XR5A 1EZZB 2UUCJ 2Z58B 1VYAA 3I31A 1RTIA 1T9WA 2RKIA 1HI0P 3GMGA 1TV6A 4KGVB 3RR7A 3HHLD 4P75A 2KJVA 2OJ3A 1TKTB 3DYAA 1RE1B 3AD8C 1LXJA 3MEEA 2CJ9A 3L4BC 3KK3A 2IVYA 2GQCA 1JJ2R 3I4PA 1TUGB 2R4FA 1HHQA 4PR6A 2MSSA 2XO7A 3EWGA 2VBXA 2AX0A 2JNJA 1EX8A 3QT6A 1X5OA 1U26A 2OEKA 4NLOA 1J5EJ 1IBLF 4CYUA 1DZ5A 1XBWA 2MMYA 4BDPA 2OEMA 3I55S 2FJVA 2IY5B 4I2PA 1M5SA 1FJGJ 3ZTPA 2MGZB 1WF0A 3CMES 2WVDA 5BR8J 1H74A 2KB2A 1Q4RA 3RRHA 1X4DA 2WOMA 4LRAA 5EWEA 4PG5A 4OIXA 3NL0A 3OUYB 1MW7A 4O0NA 4X64F 2IYIA 4E2FB 3RBDA 1WD6A 4OYBA 2G1HA 5K8MA 5B0DA 1F6TA 3NP5A 4I6WA 2YH0A 5AXLA 2DNMA 4O3PA 5F9NA 2CWKA 5J1PA 3U1LA 1D9DA 4LRCA 3RB3A 2X3DA 3KJVB 1WACA 1VK8A 4J9LA 4B3SF 2YNFB 2YKMA 2HZAA 2JC1A 3M8PA 4AFFA 1JX4A 2ZH3A 4J9RA 3NKYA 4DR3F 3JAMU 2VOOA 2EVZA 2KFYA 4HT5A 2HMIB 4DWIA 4JI7J 1YITS 4OJGA 2FB0A 1RTZA 2CRLA 5GVQA 4X4TA 3PCOB 2XMVA 1SQEA 4K50A 3W7BA 4WKYA 1ZAXA 1ROFA 2GJ2A 2CZ4A 3PW5A 4DV0J 4WE1B 2KFZA 4OHXA 2H9ZA 5ETOA 5GADU 3CPWR 3D5MA 1FFSB 2DNOA 2IAJA 2V0NA 3AB2B 2QL9B 1PJ7A 4LF6F 3IWNC 3IM9A 3LF0A 2GHVC 2W8LA 3A1YG 3IGVA 3HVTB 1VDHA 4R0JA 5H9FK 5D15A 1Q82T 2BM1A 2W7PA 3Q8PB 3FCVA 2ATLA 1NH7A 3NWRA 4R5PB 2FQQB 2AEJA 4ZCLA 4H4KA 2P5VA 3CXCR 1NSQA 1UVKA 2Z4PA 4ELUA 3UQSA 5CH7B 3QJLA 1UZDA 1RCOB 4Y34A 3P6YC 3PHEA 4DG1A 3C6UB 1T05B 1RTDA 2EK6A 4LSLA 4QIFA 1SB6A 2V9KA 1Z4UA 3GSIA 1QM9A 4WXOA 1FK9B 3CE8A 1QVFR 2HFVA 5EHHA 3ETOA 4DV1F 2IIHA 1F3VA 1NDKA 1XIQA 4FPRA 1VIOA 1C4CA 3DRSA 1HA1A 1GMWD 2MYFA 4X4UA 1RWWB 3J7AN 2E7VA 1KFDA 2AIRB 4RUCA 3VAHA 4C48A 5ITHA 2CPXA 3KFWX 3ZNUA 3V6DB 1SVDA 3QWUA 2QL5B 2GMJA 1XMBA 1Y7PA 1IXKA 4A4JA 1HWIA 3KK1B 3H59A 4J9NA 5CAAA 4I68A 5IT0A 1PYTA 4NLSA 2O01C 3JYTB 3CCMS 3O2IA 1T95A 4KHRA 1VBXA 2NZCA 2GIFA 5T7LA 4ZHRA 1TFYA 2JC0A 3GYGA 1EB0A 1J5OB 1Q7YT 4DSIA 4OZ3A 3HT3A 1RTJB 1REVB 2F4VF 2YKPA 5MLCV 2GAHC 2I2YA 3A8EA 1GH8A 4U7UK 4EYHB 2VU5A 1LW2B 5AJ3F 2ERRA 3OFFA 1VR6A 3AD7C 3DXBA 2V67A 5HI7A 1T9UA 1DLOB 1YJVA 3NGRA 1S6QA 2MHNA 4LQ3A 4P10A 3RTVA 1UFKA 5ETMA 2V2KA 4MK7A 4RW6A 4N7TA 5J2MB 2CQ3A 1R43A 5FIIA 2EC2A 4C4WA 2DHHA 2HK2A 4RW7A 3DLEA 4P6QA 4YEAA 1X4HA 9ATCB 4TVAB 4KGKA 4KB7A 3NG8A 2HQ3A 2Y3YA 3C6TA 1RHQB 1X60A 4EZ6A 3TJ8A 3CGIA 2R7QA 1F60B 2WK4A 4FYDA 3EDQB 3UVJB 2WVCA 1OQ3A 2BE2B 2EKNA 4FBTA 2BJDA 1WDDA 4UY8T 2MZ1A 4IDKB 3R6GB 4QPXA 2FDNA 2RQ4A 4JI3J 4MKYA 2ZWPA 4FXVA 3R2CJ 1HNXJ 4A8MP 2IHR1 4M5JA 4ZVGA 1UZHA 2B43A 4PUOB 5JXSA 4KRWA 3NMAA 1PAEX 1CJUA 2XWYA 3HFKA 4DR6J 1HMVA 4QWCA 5GMDA 2MDAA 1RT7A 5B0GA 4KFBB 5HROB 1OY8A 3QIPA 5K8PA 2DRDA 2MJNA 1PYSB 3FMWA 3THTA 2XS5A 1WC1A 1BD6A 1QY7A 1PIEA 4LF5J 2L9DA 2GGPA 5FD1A 3DOLB 3NEKA 2MKYA 1WKLA 2DB1A 4NLXA 4DUYJ 3D6HB 5ADZA 2OPPB 4C0OC 3WC0A 1N54B 3CJ3A 2QG9B 4C11A 2EFVA 2BR0A 2WVEA 1JLGB 2GX8A 3KDOA 1LXNA 3MMAA 1VC6A 4J9OA 3BDEA 1QTNB 3QGIA 4DI6A 4DV5F 1NJIT 2DIUA 4Z7YA 1U8SA 2QN6B 2LP4A 3R7NB 2BKPA 2XYHB 4O4GA 4AL6A 1UPPA 2JWNA 5CXTA 1GAOA 4CRJA 2KT3A 3BGRB 3KMSA 3I0SB 2BQ3A 1JNZB 1SBRA 2XY7A 3RBEA 4DPWA 2CNLB 2J0XA 1WSRA 4DEZA 4MJKA 1EAYC 2GJFA 2BM0A 3DLKA 3GG0A 2HQIA 3LGNA 3HHDA 4RNNA 2BJ1A 2ALZA 2LLZA 2ZUAA 3GCXP 1RAIB 2WBRA 5DM7Q 4YHHJ 4ID5A 2FLNA 1DARA 2QYCA 3BDPA 3W61A 3W3SA 2XEXA 4DR7J 2PE8A 3V4IB 5AT1B 1U0SA 3C15B 2M0GB 5F9LA 3DU6A 2F65A 5E3AA 5AXMA 1WG5A 4KH0B 5A8RA 2ADBA 3QIDA 2MY8A 1HLWA 4WFYA 3UW1A 2Z2YB 3PNIA 2HHHJ 3AB4B 4DR1F 5KFRA 1O0PA 4P2FA 1GFWB 4NMXA 1RT1B 1LWXA 2HNDB 3CJKA 3E2EA 1TK8A 1MG7A 3OVAA 4MTPA 1FO1A 1X31C 2CJQA 4PKDB 5J2PA 1JMTA 1UTAA 3PYGA 4QPTA 4X62J 3ITHA 5ETKA 2HHWA 3J7ZT 5JVGQ 1MROA 1XJWB 3ZZTA 2YNIB 3JSMA 1YKWA 3HM9A 3BZQA 2OI2A 3PYEA 4KHMA 4OV6A 1H7XA 1Q53A 3M8ZA 5IOLA 1XTZA 1KNZA 2AD9A 4YR3A 3HHLA 3K8VA 4R8UB 4Q8EA 4OYAA 3P5BP 4L73A 2Z8QA 2R7RA 3ET6A 3UWTA 1QAIA 1SIWB 2ZZMA 1S6PA 5U47A 4B3OB 5DDOC 4CP5A 3H5SA 4MIBA 4DMZA 4F2SA 2BUNA 2G1DA 1TL3A 1UW9A 1V6HA 2CPEA 5G0RA 2CQIA 4OYWA 2BACA 3QAEA 2UVUA 2MTLA 4FN5A 2G0IA 4A8OA 4FP9A 2HBQB 2GVZA 3CDBA 5F3TA 4UUWA 5KG5A 3BYPA 3FCWA 5KFUA 4OFZA 4EK2A 4EFAC 3RB0A 1D9FA 1RT6A 1WEZA 4BCAA 4UZCA 1FI4A 4DR5J 1F2GA 4Y2KA 3H4BA 2FLPA 2YNHA 1SH0A 3MR2A 4DF8A 1FWKA 2K1RA 4URGA 2UXBJ 4JB8B 1NDPA 2FC9A 2VA3A 4KT0C 5LT5A 4NXNF 2OPRB 3K2YA 3W5XA 2QA4G 1QVGR 3VV2B 2EW9A 3KLIB 1SUQA 5LMUJ 4KR0B 4JI2F 1R0CB 2W24A 1HBMB 1NJZA 3MM8A 2G2OA 4LFBJ 5IM0A 2M52A 1VGYA 3CO0P 1C1CB 1Z2LA 3UD3P 1XNRJ 4NA3A 2D3OR 1RT3B 2DKOB 4ZJQA 4WJBA 4DUZJ 1RA6A 4F02A 3PYFA 4X84A 3N28A 2GFFA 3GP9A 4F3OA 3SSRA 1RCXB 4DQRA 4Z7CA 3ADAC 3ISZA 1EQ0A 4HH0A 3ICLA 3BV8A 3VQTA 1K0TA 2R8GA 5KT3A 1I94J 3BKTA 4CLFA 3MMBB 1X0FA 2J9DA 1XNQJ 3NNCA 6FDRA 3KG1A 1I3OB 3H40A 2F8MA 3DOMB 2H5EA 1FVQA 1FWPA 2GO8A 1TFWA 3E51A 1KLMA 1R6YA 2ASLA 3PO5A 1SJQA 3G8TA 1HI8A 2RILA 2VG6A 3Q22A 3JQJA 4PWDA 1S48A 2HIYA 1S5ZA 4ED7A 4JI8F 2KXHA 4OZ5A 5HP1B 2AHOB 5HJXA 2ZEJA 1AZSA 4X4SA 2OMOA 5J1NA 4QBUA 4DSLA 4CLUA 2V5HG 3PYDA 5D3GA 3UNGC 4XPEA 1V5VA 4CLKA 1VQSA 2BEFA 1S9EA 2NLWA 1SCJB 1HHTP 8AT1B 1XQIA 1YJUA 2UXDF 4DCPB 4B08A 3DMJB 1HBUA 3SCLE 4JI1J 2F3JA 3KHGA 1N5YB 4MIAA 2ZUGA 2WBMA 1BY9A 1U09A 2ZNZA 1XMQJ 1HYSA 1JLEB 4G6VB 1MLAA 4DPXA 1FESA 1SC4B 3FFIA 4H54A 4LSZB 1Y9OA 1I51B 1VQ7S 2AJ0A 4I0WA 4KPYA 2ZE2B 4F4YA 2RB7A 4IRDA 4P7TA 1FCAA 1D3WA 4WIQA 1CC7A 4RWXA 4QWEA 4S0MA 2VF3A 1M90T 1ZTWA 2FHJD 2E1AA 4DL5A 3TUZC 3I5AA 1G2EA 2FYXA 1IKWB 1A0OB 1LFWA 3R5JB 2VQEJ 3SI8A 3R5GA 4P71A 4FBUA 2DNLA 4LUBA 2JEGA 1YDLA 2FTRA 2QFJA 2YNGA 3MM6B 1VISA 3GJTB 2RQMA 3MPUB 4ZLLA 4PG4A 2WB1D 1Y3KA 2B4PA 2JX2A 4OZJA 2ZH1A 3Q89A 1SC6A 3RR8A 2YWEA 5DJBA 1WC6A 2KI2A 5DDRC 4QWDA 1TQLA 4ICLA 2LVWA 4M5KA 3O44A 2HBRB 4W4MA 3DRXA 4ER8A 1GMVA 1TV6B 3C46A 1UKUA 5B0FA 4C8KA 4USVA 3DYAB 2LDIA 3MEEB 3KK3B 3BJYA 4EO8A 5E0OA 2BQRA 1GT8A 3AOAA 4FVMA 1NPKA 5KAKA 4GVBA 2V8HA 3RW6A 1FJGF 4IO9Q 1R8BA 1LV5A 5F3ZA 2W9CB 3E01B 1LWEA 1S0MA 4X65J 4CO2A 1KVJA 4CYUB 3CVKA 1NB7A 4XPCA 5HBMB 1RADB 3OFGA 4JI0J 1Y3JA 3PKYA 3GJSB 2FC8A 1HD1A 4F0KA 1CG2A 4O3RA 1EETA 1YLXA 2DGUA 3G8QA 3U1MA 3K5PA 3Q8SB 2PI5A 1UP1A 2PA8D 4CDIA 1ZM4A 3T5KA 4NLQA 3KLHA 1FRHA 4DR4F 1R0AA 2OIHA 3UDVA 3KLFA 1SL0A 5J1EA 1C1BB 2ASJA 1RTHB 4KGMA 2J8SA 4LBHA 5THWA 4OI2A 4U8VA 4NLPA 2JZ5A 5K5MA 4HACB 4TXSA 3CJ2A 2LA6A 3SQGA 4KSEB 3QO9A 4ECWA 2BRLA 1TL4A 3GIJA 2G13A 5D0RA 1N34J 2DO4A 1WOOA 4U8YA 3M8QA 5HLFB 3G82A 1IBKJ 3D0HE 4LBIA 3IAS9 2BQUA 1QLNA 3M8PB 2RVJA 4DV0F 3MEDA 2K7KA 1E6YA 1JLFA 2ZD1B 4RU9A 4C8OA 2OTJS 3I32A 4I67A 4NYPA 1S12A 4JYAJ 4X2BA 2ZNYA 3EMTA 2QLJB 4I56A 4IH6A 2RUGA 1DQ9A 4IFVA 2O3DA 1RGVA 4I6YA 4UW2A 3Q8VA 4RW8A 4LSNB 1KOOA 2L48A 4K4XA 4J7CA 1HD0A 5A0YB 2LCWA 2C28A 2M7SA 3MM9A 3KLGA 4WZMA 2KG0A 1GTEA 3M2VA 2ACMA 1QDUB 3X1LB 2CNOB 5J2QB 1S7HA 1B64A 1UL3A 1DY3A 3PRVA 3T1AA 5LSLA 4NZ7A 3CF5Q 2DK2A 3B6BA 1ZAVA 5F8LA 2X1BA 5B08A 3NMRA 3VZIA 1JLCA 4JV0A 2W8KA 2J6UA 3N6NA 4GO5X 2RDJA 2DXEA 3BEGB 1V3ZA 2YWWA 5BYQA 1UVIA 1NZ8A 2OD6A 2HW3A 4A8XA 2WZ1A 5HVFA 1QUPA 1VQKS 1TKDA 3FZBA 3FEZA 1S1WB 1RTDB 1CJKB 1NM2A 3FC9A 4LSLB 2K3KA 4K2XA 4ZA1A 4YB6A 3CEDA 2GW8A 2GO9A 1RXOB 2Q1LA 4A8FA 4AD6A 1CLFA 5E41A 2ROPA 3CCVS 2ZOFA 2CPYA 4P72A 1U7LA 3IGNA 4XDCA 3SYZA 3W2WB 3CCRS 3GPAA 4WU2A 1FDAA 3H4DA 2G2ZA 2DRBA 2Q43A 3PRBA 4NEZA 3I4HX 2HVDA 2QEXS 4BHQA 4M1KA 5B7WA 4I6AA 2HGMA 4Q2LA 3FDSA 3RRKA 4UF4A 2VB6A 2ZH8A 2NQPA 3C19A 5F8GA 2G4BA 2MY7A 1KSPA 4BWJA 2GVDA 2KT2A 3BPDA 2JRSA 2E9ZA 2KJWA 1X4FA 2DNYA 2DIVA 1CS4A 1TAQA 2HNZB 5E2QA 2OGUA 1CJTA 2PDAA 3L95X 2AJ1A 3SIPB 1K1SA 3GWCA 4YB7A 4I69A 4B02A 3EJMA 1UEVA 2PC6A 5T7LB 4ZHRB 3SCJE 2M70A 2W1BA 2H5JB 1NJWA 4JV5J 2L9WA 2VPZB 2M8HA 5HL7Q 2CQBA 1NK5A 1GXTA 1N36F 3MMCA 2EBEA 1R27B 4LR7A 3GIKA 3GFHA 5HQLA 2IM0A 4XK8C 3WQPA 1X4GA 2ZOMA 1AXQA 1RHUB 1S4FA 2QMWA 2XG8A 1FDBA 5DO2A 3N5FA 4NLRA 4I64A 4ZITA 2C2EA 5EX3A 1EIYB 3DNCA 4IYQA 2N82B 1OYEA 1UEKA 3KMQA 4ZIWA 2VJUA 4RW6B 2F8HA 1S7IA 2VDHA 1PGZA 3DLEB 4DQSA 1IR2A 4YY3F 4ELTA 2F1FA 3L9ZA 2HBZB 2HGLA 4QIEA 4HDGA 1N5QA 4QR0A 3FNNA 4C3KA 2HNYA 5D8HB 3K5NA 5F8HA 4JV2A 3KUEA 4Q0BA 5JUMA 1BQNA 4C0HA 2DR6A 5HMYA 4M5LA 3R8YA 1C0TA 4B9MA 1ZOTA 1RWKB 5L1IA 2EFPA 4LIRA 3TARA 2Y9HA 1RHRB 1KRPA 4PABA 4PWWA 2ZZNA 4BLGA 4CM2A 2RF2B 1YQHA 1N5SA 4PRFA 4CLZA 3GYNA 2KO1A 2IBOA 1CJUB 1HWKA 3ZTOA 4AE5A 3K57A 4O44A 1HMVB 1D9AA 5KFJA 3FQKA 1PJ6A 2MZJA 3E8OA 1RT7B 1FKOB 4DR2J 2XZWA 3Q8RB 1OY9A 3OFHA 2GV1A 3QIPB 2QFIA 1ZTTA 3V4MA 2HPUA 2XCAA 4ZVEA 2WTFA 1VJQA 4HYKA 1HNVA 4WXWA 3HKZD 4DBQA 4F04B 2HVEA 2MKCA 3OR2B 4K2JA 2GGPB 3CDEA 4CZCA 2DT9A 2G2YA 4G1IA 1VS3A 1NAQA 1Y4ZB 1U4BA 1B0TA 2HYIB 1U1LA 4K4SA 1VLOA 3M8SA 2Z2ZA 4C11B 1U2CA 5C7PA 2HFUA 2QLWA 1Q8LA 2NXUA 2H4YB 3TAQA 3EVMA 2NPFA 2BW2A 3MMAB 1IKVA 4GKKJ 1ULRA 4FF1A 1YBTA 2ZBRA 3T5HA 3FBBA 2DHAA 5IC4B 3ETMA 4ZVRB 4DFJA 1IBCB 1IR1A 3IRXB 2QSWA 2HAFA 4O4GB 3LA0A 4NCGA 3A3NB 3M9NB 3T6JA 2CPZA 4L72B 3GV7B 5AE1A 1UW4A 6AT1B 4AT1B 4IG0A 3NAIA 3M30A 4K4UA 2R2RA 1U1NA 3DGPA 4X66F 3BO3A 2C2KB 2LYVA 4H4OB 5CYQA 2A6MA 3CD6S 3U02A 2HHSA 2ATCB 1H2VZ 5M2PA 1TELA 1H0HB 1U45A 3DC2A 2XSJB
chains in the Genus database with same CATH topology
2YX4A 3TVKA 3MXHP 1W2IA 2W25A 4CTAA 3R5DA 1U47A 3IXQA 2EBGA 4YB1P 5AE3A 4R0JA 1FRMA 4ITSA 1Q82T 3ENVA 2BM1A 3UI3A 2W7PA 3Q8PB 3O8WA 2NS1B 2IC3B 2E1MC 2ZC4A 3QGHA 4OZ0A 1IN0A 1YJNS 2E1CA 2KM8C 1N0UA 4RU2A 3OFEA 2OPRA 2L9NA 4C8MA 2ATLA 1YRUA 1NH7A 2JSXA 4WYLA 4R5PB 3RYLA 2RRNA 2DHGA 3JSBA 4RUHA 4ZCLA 2OKQA 2J8AA 2MKHA 3HVWA 4H4KA 2P5VA 2IRUA 3CXCR 2AYGA 3UDCA 2DNZA 2HAIA 4WFBQ 1N56A 1UVKA 2WONA 3ZZUA 2Z4PA 3CDUA 5IWAF 4PPZA 4ELUA 2DGXA 2VC0A 1FE4A 2K2PA 4Y6IA 3UQSA 2E7XA 1SJ4P 2RDIA 2ZKUA 5A8RB 1UFLA 4OZLA 4X4RA 3K58A 3DRPB 2CVIA 1N52B 5CH7B 3QJLA 4J9PA 3O3LA 3M4XA 5FDLB 4Y34A 1O8BA 3P6YC 3PHEA 4DG1A 4TN2A 3C6UB 3MGJA 4X62F 1K9MT 4RNMA 1T05B 2JL9A 1WTBA 2FHJA 1RTDA 1EETB 4WTYA 1WI8A 5KFWA 4K4ZA 2EK6A 1KQSR 2HHPA 4LSLA 4ED0A 2HRYA 4QIFA 1SB6A 3JTPA 4KE5A 2V9KA 4TNOA 2EKYA 2DBBA 2EG2A 1Z4UA 4TQSA 3BQ0A 4X4VA 1QM9A 1G3OA 5IT9Y 3LANA 2PEHA 3G86A 4BC9A 4WXOA 1FK9B 2A10A 2DNHA 1U1QA 2WW8A 3CE8A 1QVFR 1RT3A 3G6VA 3EZ5A 5EHHA 4DV1F 3ETOA 4WFZA 4EZ9A 1S0VA 3KLHB 2HIQA 3ZZRA 1R0AB 5K9FA 3MMJA 2CQGA 2ILYA 3LW5C 4FPRA 2R7OA 1T8EA 3PFOA 3M2RA 1VIOA 3KLFB 1WHYA 1C4CA 2RH3A 3DRSA 1N34F 5LL6d 1Q79A 1HA1A 1X5TA 3QLHB 1S76D 2HVZA 4Y2CA 1ZBTA 3ITHB 4HDHA 2MYFA 2C42A 1X9MA 1DTTA 4X4UA 3NCPA 1YVFA 1MROB 4QIVA 3MR5A 1IBKF 3M9MB 1S1XA 4OLOA 3J7A1 3D2WA 1KFDA 3MHYA 1RDRA 4RUCA 3VAHA 2WB4A 3SEOA 4FS2A 5ITHA 2J9CA 3CD7A 2CPXA 3BR8A 3DRRB 2B9YA 3KFWX 4OI1A 5HMWA 5DQGA 2N4DA 5KT7A 3V6DB 2V4JB 3U7JA 1MSWD 1ZH5A 1OS5A 3QWUA 4XAKA 3BQ2A 2W7OA 2ZC3A 3KHLA 2GMJA 1JXLA 2CJAA 1JIHA 3MDFA 3J81Y 3M2UB 4DFMA 3UCUP 5A6PA 2DPJA 4LF8F 5C25A 1XMBA 3FEXB 1Y7PA 2RQKA 1RT2B 2E29A 1IXKA 1DRZA 4DQPA 1FDNA 3IO1A 4A4JA 2RD5C 1HWIA 1ZAWA 2V8VA 2IFXA 3KK1B 2BZ2A 2W4PA 3H59A 4J9NA 3ENQA 3MAHA 5IS2A 1UFWA 4WIIA 3GSDA 2HS0A 3QGGA 4I68A 3TA0A 4F3MA 1L3UA 1D8ZA 4JYAF 5IT0A 2ZHOA 3C66A 4NLSA 1DTQA 2O01C 2IM1A 3WX4A 2QO3A 2MQLA 1WG1A 2YX1A 1M5OC 3JYTB 3CCMS 3O2IA 4JUZA 1S6PB 3OVBA 2A1BA 3MEDB 1KQFB 1T95A 3QJJA 4NL5A 4KHRA 1V3RA 1P1TA 1JLFB 4HTJA 4Q44A 1VBXA 4F8RA 4QOTA 4LJMA 2QIFA 4C7QA 1UWBB 4WU3A 5T7LA 4ZHRA 3NGKA 1R8PA 1S0OA 1TL1B 3IS9B 3MOJB 1TFYA 4NLUA 2JC0A 4OJHA 3UPFA 1J5OB 3CC7S 2VG7A 1TL3B 4Q8FA 2KFNA 4I2QB 4KJIA 5I42A 5T41A 3F56A 2MB0B 1VK3A 3CSKA 4DS4A 1Q7YT 4DSIA 2CKWA 3HT3A 2RU9A 4KO0A 1ZM9A 2YKNB 1RTJB 3KNAA 1REVB 2WHOA 3VAIA 4DL2A 2Z2LA 2F4VF 3TR5A 3CULA 4NX9A 4J9SA 4IR1A 2YKPA 1JLBA 5MLCV 3E3XA 2I2YA 2KU7A 3A8EA 4YP3A 1QE1B 1JLAA 3PEJA 4ILMA 4EGLA 1GH8A 4U7UK 2U2FA 3FSYA 3DLJA 3R5BA 4EYHB 1UJ6A 4DV6F 4ZKAA 3DI6A 1KHWA 1LW2B 4FXWA 5C24A 4IFVB 5AJ3F 1UVLA 4Y2MA 2ERRA 2DH9A 4ZPTR 3ZZZA 3CB4A 3OFFA 3DMJA 1YGYA 2AJ4A 3VTIA 3DXBA 2VZ9A 5D78A 4RW8B 1S0NA 2FY1A 2VFUA 5HI7A 5M2UA 2R9LA 1C4AA 2FLLA 3M6WA 2I38A 2IVFB 1XN9A 2WRMA 4DV2F 5DGAA 1UETA 3G71S 3IFEA 4YFUA 3TW0A 3JTNA 1FF2A 1DLOB 1YJVA 2EFOA 2J7UA 1N5YA 4ALZA 3PVXA 3WC2A 3F73A 2Q66A 1S6QA 2MHNA 3T3FA 5KFOA 5D77A 3S01A 4CI0B 4LQ3A 3S1TA 4Q2MA 3RTVA 4U67Q 2JFDA 2V2KA 2NUHA 5IZHA 2R2TA 3MEGB 4MK7A 1A9NB 1WWHA 1JLEA 2YNHB 4RW6A 5J2MB 2R7TA 1CPZA 2CQ3A 3VAJA 2C3PA 3RW7A 1R43A 3ZC4A 1IQZA 3N9UC 2EG1A 5FIIA 3HHLC 2R7SA 4C4WA 2K1RB 2R8HA 1TKTA 4RW7A 3DLEA 1U6FA 4D3GA 4P6QA 4YEAA 2ZE2A 1X4HA 5A8WA 1HWJA 2NUUG 4QIWD 2FJBB 1FD2A 1FKPB 1JLCB 2HS3A 4KGKA 1T3OA 2CPHA 4KB7A 1V3SA 2OP5A 2A2DA 3EZUA 3NG8A 4IQMA 2HQ3A 3RAMA 4ILRA 3KG0A 2B0GA 2MPUA 3CD5A 1IKWA 5MAOA 4N56A 3C6TA 2DR8A 4O0IA 1NO8A 4TYBA 3R1HA 1KFSA 3EUNA 3R5CA 2D3ZA 4F3QA 5KFSA 4IOCQ 4EZ6A 1SUQB 3CGIA 3CCWA 2R7QA 1F60B 1CSJA 1F5BA 3TQ1A 1B0VA 1NK0A 2WK4A 5KG2A 4L3NA 4FYDA 2DTJA 2MHEA 3CCJS 4ZCKA 1WHXA 5KG6A 1SJ1A 2CQPA 1M5KC 2CPFA 1OQ3A 5E3RA 5CYMA 2BE2B 3ISNC 4FBTA 2BJDA 3MM6A 2DHSA 5IM0B 4UY8T 2MZ1A 3BN7A 5KFNA 2QMXA 4IDKB 1NKCA 1S49A 4QPXA 4ZK7M 3OHBA 2MGZA 2FDNA 4CIOA 7FDRA 2HWTA 2RQ4A 4MKYA 1WI6A 4AXIA 1D0EA 3IG1B 1JJHA 4JV1A 4FXVA 5J2NA 2V4RA 2D41A 4A8MP 2ZJQQ 1FVSA 5B0EA 1X7VA 2IHR1 2I5JB 4ZVGA 2DNKA 1U2RA 3OHAA 4O3SA 1HW9A 2CVEA 2B43A 3CDAA 4PUOB 1WHVA 3BS9A 5JXSA 2CJKA 4TLQA 4KRWA 3NMAA 4M5DB 5CYJA 2R2UA 3DLHA 4W92B 4RNHA 2LMIA 2XWYA 3HFKA 3EGZA 3IN5A 3Q8QB 1HMVA 4QWCA 4JI5F 2VASA 3NBPB 2MDAA 3GZ7A 1RT7A 1Q8BA 2CQ1A 5B0GA 5HN0A 2EFGA 4KFBB 5EWFA 5HROB 4PXDA 4NRTA 3GV5B 1B0PA 1IQTA 5DLGA 1VHFA 1KONA 3QIPA 2UXCF 5K8PA 1N5VA 1BC6A 2ROEA 5DG8A 4YOEA 2VFSA 2UU9F 3IA0A 2UUBF 2MJNA 4UY85 1SV5A 1FTCA 2BJEA 3FMWA 2PI4A 4J37A 1TVRA 5D6GA 3THTA 3IAM9 4PWUA 2LQ5A 4TLRA 3M32B 2XS5A 4TU8A 4YDDB 2B6AB 1S9GA 3SCIE 3V81A 1BD6A 1GTHA 2X3GA 1QY7A 2SXLA 4OX8A 2VPWB 3G6ES 3GYXB 4ZVHA 4LVOP 2L9DA 2E5HA 4JV5F 1FXDA 2GGPA 2LKZA 1PSDA 5FD1A 1FXRA 3DOLB 2ZHBA 3US5A 2DD8S 2W9CA 4JI4F 1TAUA 1RI7A 3E01A 2DB1A 4NLXA 4ZCMA 4NYOA 3C8YA 1KLMB 1BLUA 3OQ2A 2EI5A 5ADZA 2AJQA 5E3QA 1RKIA 1H98A 1KTQA 1IJEB 1LWFB 3VAMA 4K5RA 2ZH7A 1Q8IA 1M0SA 2OPPB 1NU4A 1EP4B 2ZVSA 2UVVA 4ES2A 4C0OC 3WC0A 1N54B 3CJ3A 2BANB 3G6YA 3CCZA 5HBMA 2E5GA 4C11A 2JVRA 2EFVA 3WBZA 4IR9A 4PWDB 2RQCA 4R0EA 2B56A 2BR0A 1JLGB 3J7YI 2GX8A 1LXNA 2YNFA 2DGQA 3WZ0A 1ZPVA 2VFRA 3P5TL 3H5YA 1FTRA 4KKOA 1VQ9S 1GXLA 2JDJA 3MMAA 3TRGA 5L8RC 5L39A 4J9OA 1VC6A 2Z0GA 4C98A 3BDEA 3I56S 1QAYA 2VKZG 1DURA 2UUCF 1MMDA 3QGIA 2V4QA 1S1VB 4HT7A 5GAGI 3G96A 4DV5F 2PMHA 3LO3A 1MU2A 3GIMA 1NJIT 2B7BB 2DIUA 2HFNA 5L9XA 1U8SA 1C0UA 3HHKA 2HMIA 4ED8A 3HX9A 3JSYA 1FJ7A 2OFGX 4QR2A 1S9EB 2CJBA 4B3RF 3MR3A 3QWPA 3KHHA 5KT2A 7FD1A 1QAJA 4A47A 2B4UA 3MMCB 2HGNA 4B9TA 2UP1A 2M3DA 4X4OA 4NYZA 1KQGB 4O4GA 3OSNA 4EO6A 4EWTA 1VQ5S 2XLKA 4AL6A 3MPVA 1DAXA 1F5AA 3N6MA 1JLQA 2ZH5A 1G6BA 2JWNA 1BQXA 2RIJA 5CXTA 1GAOA 2OPSA 4WF9Q 4OJ1A 2KT3A 1HBUB 3BGRB 2HFOA 5DGBA 1FNMA 1ZPWX 2EC0A 4DV3F 1C1BA 2GNKA 2V94A 5T14A 1E6VB 1I6JA 4IO1A 1VQPS 1RTHA 3KMSA 3I0SB 4WE1A 2JHEA 3FRZA 1U1KA 2FJWA 2OMLA 1HPZA 4ZP6A 2BQ3A 4ZPVR 1JNZB 4ED6A 1SJ3P 1SBRA 2XY7A 3RBEA 3J7YU 1RTIB 4RUAA 4IG3A 3KK2A 3MTJA 5HQ8A 2VUGA 2RKIB 3VAKA 1O5JA 2J0XA 2BDPA 1MMLA 1SI9A 4MJKA 2CDQA 4DEZA 5GAGU 2G0CA 2WSEC 1UMJA 4DSFA 2BM0A 1N6QA 3DLKA 3GG0A 1J5EF 2HQIA 3LGNA 2YWHA 3HHDA 3F41A 4ZPDA 2LQ9A 2XCPA 1X4BA 3D1HA 4RNNA 1FT8A 1R8AA 2CQDA 3DOKB 1X9SA 2ALZA 1SXLA 2LLZA 4Q7AA 2WBRA 2J0WA 3OR1A 2AGOA 5DM7Q 4ID5A 4NLTA 3VAGA 2FLNA 1DARA 2QYCA 3FSXA 4EU0A 2N3OA 4LFCF 4JBCA 2QE5A 2JVOA 3BDPA 5HLFA 1U1PA 3HHEA 1S97A 3I96A 3W3SA 2KXNB 3H5XA 4M95A 2BA9A 2IC3A 2LDYA 1APSA 2XEXA 5BR8F 3RAQA 3MURP 2E9RX 2BXJA 2PE8A 3V4IB 1T7PA 3S6EA 2M0GB 3D54A 5F9LA 4HI1A 3PDNA 5KFMA 1O51A 2B51A 3IWLA 3EYZA 4C8LA 3DU6A 3I0RB 2AYMA 3B4MA 2ZD1A 5E3AA 3AH6A 5AXMA 5A8KA 2YX7A 1MNEA 2LEAA 3H8YA 1IKYA 3M9OB 4ZPAA 3L7OA 1WG5A 4EEYA 5A8RA 2ADBA 2JLFA 4DR2F 3PKMA 3KG4A 4I2PB 2ZH4A 5F41A 3P49B 4DSJA 3QIDA 3C6UA 2MY8A 3MM7B 4WFYA 1BGXT 3FQLA 3PNIA 3UW1A 3AB4B 1VRUB 2FPHX 2W9BB 1OO0B 2OH2A 3DLGB 4MYTA 2OD4A 4DR1F 4MYUA 2J5AA 4OI4A 5KFRA 1NJXA 1O0PA 2ACYA 2X1GA 3OSPA 1RYSA 4IRCA 4RW4B 3J80Y 1S1TA 4J5OA 3TUJC 2D7SA 3DU5A 1RT1B 4PPDA 2R8KA 4MKBA 2FVCA 2HNDB 2LXFA 4A48A 4HKQA 3DHWC 5B0AA 5KFIA 2WOMB 3CJKA 2J0QD 2DGTA 2F8EX 1H2UX 2LXIA 3WDOA 4RBTA 3E2EA 4ZPCA 3CCQS 3OR1B 1GXUA 1FEHA 4LSNA 4TQRA 4R25A 4LMZA 1TK8A 1P9QC 3PX0A 1N8RT 3MD3A 5A0YA 3OVAA 1N5TA 1CQMA 4MTPA 1FO1A 2CJQA 4PKDB 5J2PA 1JMTA 1RT5A 3SFGA 3HJFA 1DJ0A 1LOUA 4QPTA 1NH8A 3KLVA 5A6WA 4IRKA 3ITHA 1KLNA 4B9SA 4DDFA 1GX6A 3TA1A 2HHWA 1J2VA 1T03A 1AFIA 3J7ZT 3BQ1A 1MROA 5JVGQ 1NRKA 4NA2A 3ZZTA 2YNIB 4JI0F 1HBOB 1PC4A 5K14B 1RK8A 3JSMA 1VQ6S 1ZETA 4NMLA 3N4WA 3HM9A 3VWSA 5J2QA 3QGPA 3K5LA 3BZQA 3DRRA 2HHTA 3MD1A 4ECTA 2CZVC 4MAKA 2KZZA 2FJXA 2V4JA 4KHMA 1N0VC 3GR0A 4GKKF 1H7XA 1OPZA 3MZIA 1Q53A 4ETZA 4NWBA 4OL8A 1XTZA 1LWEB 3M2UA 1KNZA 2AD9A 3RRGA 1SL1A 1YTYA 1UVMA 4XO0A 4YR3A 1UVJA 1RJJA 2CYYA 4DN9A 3HHLA 3K8VA 4R8UB 1RT2A 4Q8EA 3BGUA 4JI7F 4Y2IA 3C3LA 4QU7A 4ELVA 2Z8QA 2R7RA 3OLAA 3EPGA 4GC6A 1FNXH 2O1PA 3KK1A 2EPIA 3GFXA 1M5PC 3UWTA 1G7CB 1QAIA 1S77D 2BOPA 2VA2A 5HMXA 3PV8A 1SIWB 4MH8A 4ETXA 2MQQA 3R3TA 4LFAF 2LA4A 1D8YA 3KLEB 3Q24A 4HEA9 5I4MA 4ED1A 1JNRB 2YKMB 1UVNA 4CO1A 1F9FA 3QJPA 2ZZMA 2B3TB 2MZQA 3JYTA 4N8OA 4NLWA 4ZLPA 1S6PA 3J7Z5 2RSQA 1IKVB 2YWGA 4OMFG 4KV8A 5U47A 4B3OB 1VQ4S 1S1WA 5DDOC 3POTA 2Y1JA 1OPIA 3IBWA 1MMNA 5DQHA 3H5SA 1VI7A 4UOCA 4MIBA 1UWBA 2KRRA 2LEPA 2N3LA 4DMZA 4F2SA 3W2VA 1H3DA 3AA9A 2BUNA 1TL1A 3AY0A 2ASYA 1X5PA 3FRYA 1VC0A 3ZZOA 1TR0A 1H7WA 2G1DA 1TL3A 3OTEA 3JB9k 4I2QA 1ZZNA 1V6HA 2CPEA 3I82A 5G0RA 4NCGB 5FJ4A 1HQUA 3KHRA 2YKNA 2IMWP 5C5JA 1REVA 2CQIA 1K1QA 2BAC