4AXIA

Structure of the clostridium difficile euts protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
TEESKQRVIQEYVPGKQVTLAHIIANPNEDIYKKLGLVLDKKDAIGILTITPSEASIIAADVATKASNVSLGFIDRFSGSVVISGDVSSVESALNDVLEVLGNMLNFSSTKITRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight Into the Clostridium Difficile Ethanolamine Utilisation Microcompartment.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Structural protein
molecule keywords ETHANOLAMINE CARBOXYSOME STRUCTURAL PROTEIN
total genus 27
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4axiA00
3VCDA 3MPWA 2A1BA 3SSQA 4LIWA 4QIGA 4P7VA 3DN9A 4AXJA 5DJBA 3CGIA 4PPDA 4AXIA 3DNCA 3NWGA 4QIFA 2A10A 4RBVA 3CIMA 3NGKA 4P7TA 2A18A 4QIEA 4OLOA 4OX8A 4OX7A 4OLPA 3SSSA 3I96A 3MPYA 3I6PA 5L38A 4RBTA 3PACA 2G13A 4DDFA 4P2SA 3N79A 4RBUA 2EWHA 3SSRA 3BN4A 4OX6A 3IA0A 3H8YA 4QIVA
chains in the Genus database with same CATH superfamily
1R27B 1KD1T 1TAUA 4NX9A 1RSCA 1ZPVA 1WSVA 4Y2KA 2CPDA 2AW0A 2VJUA 3UNYA 3M05A 4F50A 4CO0A 1WF2A 4KAIA 4F36A 1X9SA 2CWXA 3PKYA 1J27A 1B0VA 4CNYA 2GQCA 4MMOA 2GHWA 6FD1A 2HNDA 5J1EB 1FXLA 2YH0A 3TZXA 1M1HA 2VJVA 4ZKAA 4IR9A 2GIQA 4NXMF 5CYMA 2AWZA 3LWMA 1JJHA 4QPTA 4A4JA 1REVB 2YTCA 1F3FA 1FX2A 1OSDA 1HQ2A 2WVBA 4ZPTR 2O3DA 4E2FB 2ZNYA 5KT6A 3BSOA 2G4BA 3QJPA 1WI6A 1N0VC 3BYRA 4RWXA 4F0KA 5A8RB 3L9ZA 2R2RA 1H2VZ 3IGVA 5B0CA 4LFAJ 4PUOA 1S1WA 1SL0A 3QATA 2C3OA 1ZAXA 1L3VA 4PKDB 3QGHA 3KLFB 3RUBL 2YY3A 4W4MA 5HLFB 2DPIA 2DGXA 4NOHA 4OZLA 3BEGB 2N4DA 2PEHA 2KDOA 4CM2A 2ACYA 1NKEA 2FB0A 2PGCA 1NHKL 1XR5A 1RAHB 1P9QC 1YLXA 2RKIB 2KG1A 1WF1A 1TK5A 4LQ3A 2FY8A 2EPIA 3I5BA 3ILJA 3DDIA 3IGNA 2JOQA 4LRDA 3JAMU 4WU3A 5HROB 3HP6A 4K4WA 1XEZA 1PC5A 4DR4F 1IWGA 2VPWB 2A0FB 3L95X 3D0IE 5E3RA 3BQ2A 4EYIB 2QYGA 3QMQA 2DHSA 1T03B 4C6AA 3Q8SB 5D78A 3MCSA 1L5UA 2DY1A 2MKSA 1HQEB 2LU1A 1FJCA 3MF5A 2EW9A 3PW5A 1Y11A 5HMZA 1BLUA 1F9EB 1JLCA 1Q78A 5D77A 1XNRF 1IXKA 2DBBA 2J9CA 2W4DA 4G65A 4JB8B 3LAKA 4S0MA 4DJBA 3P96A 3KK3B 2WRMA 3QNWB 1SQEA 1WELA 2LFVA 2DNLA 3EDQB 5KFQA 1UVLA 3NNAA 1YDLA 2FJDB 1JNRB 2UZAA 4HHUA 2W9AA 2ZITA 1T9YA 3ULHA 4FBTA 2CJ9A 1FI4A 3GSDA 2CZ4A 4HL9A 2RU3A 4FZVA 1Y7PA 4X65J 2ZHOA 3G96A 1HW8A 1RU1A 2WHOA 3F44A 3PHEA 3C6TA 6FDRA 2WAQD 2D41A 2EFGA 4JI1F 1EHWA 2NXEA 2QIFA 4NI2B 5D0GA 3MCMA 5F0WA 2RQMA 3DRPB 2I6WA 1VRUB 3HHLB 5KFNA 2D9PA 2IPOB 2XY6A 3GONA 3TWZA 3VV2B 4N47A 3TEHB 1ZTWA 1N4LA 3SSQA 2AP6A 5JXSA 1Q8KA 3I55S 4YHHF 1A9NB 1WEXA 2LDIA 4YOEA 3ZTSA 3NS7B 2HAFA 1LWEB 3BF4A 5F8MA 1S10A 4K0KF 5EN1A 2R7TA 2QMWA 2V2VA 2XEXA 3M2RA 3RGIA 4YS2A 1S6QB 2LDYA 1U0HA 2H3EB 4KRWA 2VG5A 5J2QA 3OR1A 1CVJA 2ZZMA 4X64J 2DRBA 1U1KA 1E6VB 2BANB 1O5JA 2J9EA 1NMEB 5A6WA 3NBPB 1HPZA 1DARA 2CQBA 4MJKA 1X4GA 5L8RC 4A8OA 4MFBB 2WK4A 5ETTA 1J5EJ 3DI6B 2QA1A 4TQRA 3ZTPA 3FEYB 2N4CA 5L39A 2GO9A 4I2QA 1OPZA 1A6LA 2CZVC 1I94F 2MGZB 2VG7B 3ZC4A 2R7XA 1FRMA 2VASA 4P71A 1UFLA 2ZKUA 4Y2MA 4X66J 4F4ZA 3PRVA 4IYQA 2IA6A 5I3QA 1NJWA 1B3TA 1JLGA 2GAHC 2WOMA 4LF4F 1R6YA 3GE9A 4CLWA 1RWNB 4MKVA 3M8QB 4WFNQ 3Q0AA 2FLNA 5K20B 2UUBJ 2OPRB 5BYSA 2VFRA 4DV5F 3QYYA 2VG5B 2Z30B 2XSFA 1HD1A 5D4OA 1Y5IB 5K14B 1WOPA 2BE2B 4I0WA 5KFGA 4P75A 3BGFA 4Q43A 1V3ZA 1EIYB 2QRRA 4RKUC 3K5NA 4A8FA 1JB0C 1OPIA 1FRJA 4Y2IA 3T6JA 5EX3A 3T1HF 4EGLA 3H98A 2DTJA 2HFNA 4X66F 2XSJA 1AT1B 2NPFA 4IG3B 1S99A 5C2CA 1SQFA 3C14B 4B17A 4M63A 2MKKA 2KM8B 3SYZA 2GVZA 1N36F 4Q7AA 4O3SA 4M95A 3UD5A 5HO4A 4M5MA 5HK4A 2OPQA 4RWWA 4CWBA 2W9BA 3CMES 1PYTA 3ETMA 3VAKA 1TKTB 3BKFA 4DR1J 1HBNB 4RW9A 3DCAA 4F26A 3QO9B 4KFBA 2V50A 2GJ2A 1S79A 2A10A 4LRBA 2ADBA 1V9OA 4QR0A 1B70B 2V4QA 4G1QA 2BZ2A 2FJAB 5K5MA 2LA4A 4IFVB 4OLPA 4M5DA 1JKHA 4ED2A 1N5YA 1FRKA 4RNOA 1HQUA 1TTHB 2ZBQA 3JSYA 1K47A 1RWOB 3UVJB 1WJ9A 1R8AA 3ILIA 3GIRA 4ILLA 1AW0A 5E3PA 3CC4S 3PYFA 3QGIA 4U9RA 3ITHA 2GVDB 4WE1B 1RKIA 3C6UB 3PEHA 4QOTA 1S1UB 3HHKA 1WKLA 3ENAA 4QR2A 3HM9A 1CJUA 4WFXA 3LGNA 3CJ0A 2DHXA 3TANA 1XC9A 4B3OA 4KO0A 3DLEB 4XTTA 2MMYA 1AZSB 3MEGA 1VQ5S 1GT8A 4LF1A 4WXWA 3UDCA 1R0AA 1HD0A 4OL8A 4C0OC 2QA4S 3MM5B 4WP3A 2X1BA 2HQCA 4DUYF 1X9WA 1HWIA 4HHHA 3EWGA 2AEJA 2PD1A 1TKDA 3IAM9 4CP5A 1LK7A 3KUGA 5DLGA 1D0EA 3ZZ0A 2M2BA 3THTA 1RISA 4NCAA 1VCTA 5JMNA 2E7WA 2OPSB 3ITHB 2D1CA 5FJ4A 3EXYA 3C3LA 3RRGA 2CPXA 4HEA9 5JVHQ 4DL5A 2DGWA 1S1WB 1BD6A 1SVDA 1XBWA 4FBUA 4NZ7A 1GTHA 2DGVA 3GCWP 4I7FB 2J8AA 3MR2A 1U7LA 3AB4B 1VYAA 2JRSA 2ZC4A 3K5PA 3I4PA 4JYAJ 4USTA 2HZCA 1F60B 2R8GA 3ZTQA 2UVWA 4XIUA 2MEWA 5L46A 1TV6A 4JI4J 1U02A 5G4DA 3FKBA 4RW4B 2BKNA 2ATCB 1NB2A 2CA9A 2ZD1A 3A3NB 3UDEA 1KWMA 2XYGB 3RB3A 1HNIA 2QN6B 3J81j 2HZAA 2IRYA 3GPAA 4O3QA 5KFFA 2ATLA 1SL2A 4KKOB 2Q43A 4J37A 4EU0A 5ADZA 1U24A 4GC7A 3Q23A 5CYQB 2FC9A 4HH0A 1LNQA 3W62A 2AJ1A 3GB0A 3NS5A 3CSKA 4N8OA 4U8VA 3AH6A 3OBIA 2BV3A 1JKHB 2XBPA 4JI8F 4TYAA 4DLEA 3C15B 2E5LF 1WHWA 3IG1B 4WPAA 3EZOA 4C8KA 1EP4A 3DHXA 1KOOA 2NXUA 3OTBA 4WK3A 4KHMA 3TA0A 2UP1A 5BR8J 2HLUA 2RHQB 3GJTB 4I64A 2YX1A 4U95A 2QA2A 2HS3A 3MECA 3NWGA 4UOHA 2F40A 4TU8A 4URQU 2IYIA 4F8RA 4QU6A 2W2NP 2UU9J 2HFSA 3F0NA 1HNZJ 1TQLA 4KGXB 2C2EA 4USVA 4B3TJ 3MZIA 3ENVA 1NSPA 2D69A 1LWFA 4JP8A 2PEBA 1QLNA 4NMXA 2PC6A 1VLYA 4C3LA 4H4MA 3EZ5A 3MMCA 4BC7A 2DISA 2HRYA 4ZVPB 2O1PA 3HHLA 1UZDA 3EUNA 5HMYA 1D8ZA 1N33J 2G2ZA 2YQ1A 4ZPDA 3RBZA 4R5PB 5HMXA 1SH2A 4ECUA 1U2CA 2JFKA 4ELUA 2KFYA 2ZBRA 3BN7A 5KOXA 3K5LA 2KO1A 2FLLA 2F4VF 4OZ5A 4PWDB 3I4HX 4QPXA 1HNZF 3BREA 2RS8A 4IG0A 2FJWA 5KTQA 1RYRA 3P4UB 3CJQA 2E5HA 4O44B 3SCJE 2MQMA 2AJFE 2ZE2B 1AXQA 2HVZA 1T3NA 4KGMA 1W26A 2F8MA 4D3GA 3AQPA 5MAOA 4O0IA 1K73T 2Z2MA 1TAQA 1HA1A 3MD1A 1UA1A 5HMWA 1EB0A 2HVEA 4BC9A 3HKZD 2I2YA 3KLIB 4NXNJ 2G9OA 5CD4H 2JLEA 5M2PA 4IFYB 3U02A 3KTQA 1NO8A 1RA6A 2C2KB 3PR4A 2PI5A 2QGFB 1WG5A 4UT4A 5M2UA 1GXUA 3OUYB 1NSKL 2U1AA 2XZWA 1JLGB 2RQKA 2WOMB 2HNYB 3LP1A 4ZJLA 2JDJA 3LP2B 5C24B 4RR5A 3PIPQ 4MT1A 3KLEA 3MM9B 4Q8FA 4NLDA 1H74A 2F5GA 2WCXA 4F4XA 2J9DE 2V2KA 2W01A 5CH7B 2ZWPA 4KB7A 4O3OA 2FVQA 4W90B 2VC0A 1CQMA 3ZXWA 3KK1A 2A18A 1JXEA 1VK8A 3HI9A 1FVSA 4YQWA 2ILYA 1S4EA 2KZMA 3VAGA 3B78A 1FKPB 1YZ7A 3CJTA 5ETSA 4I7FA 3EE3A 3CDUA 1YGYA 1JLQA 4OYAA 1VC5A 4ZITA 4JV5J 2D3UA 2JH3A 3FDSA 2F1FA 3ISNC 2NSCA 4F25A 2GMLA 3QRQA 4Z7YA 4ZVTB 4C0BA 3EPGA 2ASDA 1TFYA 5FLXY 1HARA 4C8MA 3OLBA 3Q8UA 4RLEA 1NDPA 1WUUA 3E8OA 1QDUB 1QTMA 1DQ8A 1IUJA 1C1BB 1C1BA 4I67A 2EEYA 2OEJA 2XM3A 4DV7J 3Q8PB 4A8WA 4HKQA 3EGNA 2EBGA 2HHQA 4ATNA 3GYNA 1RT1B 3D0GE 4JI0F 3UDVA 1M1KT 2AJ2A 3DLGB 3NGUA 1KFSA 2HNDB 3QJLA 3CTRA 3IO1A 2LVWA 1UJ4A 3T9ZA 4CLTA 4J9PA 4ZVFA 3U1LA 1TKZB 3HFKA 2JL9A 3H25A 1IR0A 1NDKA 2N3LA 2HHPA 4G3IA 3K5MA 2AJQA 3LQVA 5D4PA 2FDNA 3FSXA 4OI1A 2IJRA 3R5DA 4ZVHA 3E01B 3JS9A 2R7OA 4O23A 1MROA 1IR2A 1FEHA 2Z56B 5AXLA 1NSQA 4DR2J 2R8HA 1RAFB 1D8YA 3RRHA 4RL1A 3T5LA 2VD3A 4MIWA 5ETQA 2FY1A 1QJHA 3SQGB 3M9MB 3CF5Q 1QTNB 3R5GA 4UOCA 4JI0J 3BQ1A 4CT9A 1Y4ZB 2XULA 4ZIVA 3R1HA 2QJ3A 3DHWC 5A8WA 3GV5B 2Z0GA 1S5ZA 1PIEA 1LQ9A 2QL7B 4TLRA 5HJXA 2BQUA 1RABB 2R2TA 2YNGA 3AA9A 4TU9A 3B4DA 4LFAF 4GKKJ 2CJYB 1AROP 4JUZA 2WB4A 4DSKA 2XLIA 1RUSA 2KH9A 2UUTA 1WC0A 3KK2B 1JXVA 3UNGC 1JLBB 2XMTA 4EBDA 4ED1A 1CS4A 3HFVA 3KHRA 1N6QA 2ZUAA 4NLQA 2RSQA 2DNRA 2AZ3A 4YR2A 3ADAC 1UVKA 3MTKA 2Z8QA 1PCAA 4ZVUB 3C15A 4F4AA 4YDDB 4IO9Q 2UUAF 3VAJA 1ACMB 4DV0F 1FE4A 2M8DB 1APSA 2W2QP 1JQGA 2A3JA 3FQLA 3R7BB 2DT9A 2EK6A 2V34A 1RAJA 3A8JA 4P10A 4RW4A 1HHTP 4DR4J 1TL3A 1WD6A 5CHCB 5K8MA 4DS4A 4J9QA 4EZ9A 2A6MA 1IR1A 4GKKF 4ED5A 2W24A 1SJQA 2LYVA 2CJQA 2IM2A 4UUXA 3CO0P 1QY7A 1RBLA 3CCRS 2XMKA 3W65A 4DV4J 2AX0A 4ZPVR 1TL1B 5LMNJ 4G1PA 3RAXA 4DF4A 4ZMMA 5DZ7A 2QZ8A 5FDLA 3RBXA 1RT6B 5IM0B 3EPIA 5LOQA 3IBFB 1S1TA 2NYHA 3LF0A 3VQTA 1GK8A 3BB5A 4DV0J 3H5SA 2W2OP 3SCLE 2K3IA 1EP4B 2N3OA 3CJKB 2M5YA 4TVAB 3TZZA 1VFJA 1CULA 3CE8A 3FC9A 2FGOA 4PXBA 3O44A 2Z2LA 4UW2A 4DU7A 3E01A 1BQNA 1FWPA 4EYHB 2ALYB 3NOGA 2H5IB 1Y0HA 3KJVA 1S1XB 2RF2A 1FKOA 2RILA 2ZWOA 2AQ4A 3FJ2A 1ZM2A 4KGKA 3CVKA 1RT5B 1WTFA 1FRHA 2DJWA 2R7WA 4A8XA 2W7AA 1URRA 1R3NA 3PY8A 2BANA 4OYPA 4LBIA 3HSDA 4C11A 3R8YA 2R8JA 1ZM3A 3N6NA 2IIHA 1YQHA 2GIRA 2PA3A 3QPIA 2Y8YA 5LXYA 3KMQA 1RBOB 1WG1A 1HPZB 1RBAA 4TY8B 2A6OA 4N41A 3MMBA 3DDKA 3QFHA 1RWMB 4CH7A 4NLSA 3PRDA 2IBKA 4V19X 1RB0A 1TUGB 2YNFA 2H5JB 2VG6B 4LF9J 1KVIA 1XNQJ 1S4FA 1S7IA 1OS5A 2LMIA 2YX7A 4WP8A 5C42A 1H7XA 5KFYA 1N34J 5GMKa 3HD2A 1K0TA 2HBZB 4J90A 4J9RA 2KVIA 1SKWA 1FTCA 1PSDA 2BW2A 4ZOSA 1U48A 2EFVA 1N5QA 4WIIA 4WTOB 3RB0A 1RYSA 1PO6A 4OZJA 4DSLA 3AHPA 2SXLA 3NWRA 2ZVIA 2VQFF 2HS0A 5D15A 3DRSB 2F9JA 1RU2A 4M1KA 3G82B 4RU2A 4LUBA 3I5AA 1KQGB 4OZNA 4NXMJ 1S0OA 5ETLA 2Z2YB 1NRKA 2BMBA 1N0UA 2MQNA 1FWLA 4B08A 2CPZA 3IP0A 5GAEU 1VQ4S 4OX9F 5HVHA 4A48A 3HMJG 2HMIB 2CJXB 2OI2A 3K89A 3ZZOA 5DLFA 2DNQA 5DGBA 1ZZNA 4FXDA 2IAJA 1N36J 4KE5A 4QYRA 2K3KA 3TJ9A 2HK2A 1GMVA 2HNZB 2MLXA 3OTDA 2YNHB 3IM8A 1B64A 4LREA 2Y1LB 4XDCA 1M1GA 3AQOA 4YUDA 3C14A 4CTAA 4GO7X 4PWWA 5GAHI 2FHJD 3QJJA 3Q2SC 3T1YF 2MQLA 5DDPC 3CIMA 1DQ9A 2LQ5A 1CQNA 2XMVA 1VOMA 1JX4A 2PN6A 2AYBA 3LOUA 5SUHA 4DSIA 4LVOP 4IKAA 2XS7A 1HBMA 2AV5A 2HURA 2DR8A 2YWFA 4M5DB 1MMLA 4NYOA 3J81U 1N5YB 4LSLA 4JI8J 5CQGA 3PJXA 3KOAA 4C97A 4GVLA 1RHQB 1N52B 4H4OB 4O4RA 1IKVA 5AE2A 2XO6A 4QR1A 3GV7B 1CLFA 1E6YB 1B99A 4K0KJ 2RMLA 3J80Y 3ZFVA 2BJ3A 5GMDA 2HW3A 2B4OA 2UV8A 1HWJA 4X4TA 4ECYA 2EG2A 3VVUA 3W3SA 1X31C 4PPDA 2L9DA 5DS7A 3PG9A 3Q83A 4PEOA 5F8HA 4B3TF 3W9HA 1VQ8S 4PQUA 4QW9A 4ICLA 1TMMA 4ICLB 1H72C 2H65B 3HCXA 3QT5A 4PXDA 4JI2F 3J80U 2ASLA 3GMGA 2JEIA 4ZCLA 5J2MB 4PR6A 3HVTB 1NK5A 3HVTA 2IVFB 3VAHA 8AT1B 4NLWA 1DQAA 2CPHA 4KYZA 3MAAB 4ANDA 3W1YC 2XO7A 4USHA 3DOKB 2F8EX 2MHEA 2MB0B 1XR7A 3FCVA 2NXNA 3POTB 1CULB 2NXCA 2W4PA 3POTA 2IC3B 3VR1A 3W7BA 3VAIA 1PYOB 3W2VB 5DDRC 3MR5A 3V81B 1S0MA 2AZ1A 3V6DA 5HP1A 1HYSA 4B3OB 3K58A 1TL4A 2YKMB 4EUVA 1KS2A 3C19A 5KFIA 1FDAA 3K17A 4P7VA 4OV6A 4K8RA 3T9NA 4CO1A 2VBYA 3P6YC 4WFBQ 2H9ZA 2V67A 3CULA 2JZ5A 2JWNA 5T41A 1F9HA 1N5VA 1NEEA 4QIWD 5D0HA 3THPA 2BJ8A 1IQZA 5LMUJ 2CNLB 4RBVA 1S9EA 7FD1A 5IT4A 3D2WA 4EBEA 3AAWB 1Q86T 1FJGF 2OSQA 3T1HJ 3PZPA 1W25A 1WWHA 1X4FA 2FQQB 2YKQA 3JQJA 2XMAA 2Z57B 2HPUA 3W61A 1RCOB 3TYTA 4C98A 4ECXA 3FUYA 3SCKE 1OY8A 1NJYA 1M5KC 1VQNS 3ET6B 3U1MA 2CAJA 4H54A 3UN5A 4USJC 2DCUB 4EI2A 1DBDA 2ZH4A 1S72S 1QSSA 3KK1B 1TP7A 2MYFA 2ZBPA 4ITSA 3C2PA 2BJ1A 3AOAA 4FF2A 4PWDA 1JLBA 4Y3CA 4ZPWR 4X2BA 2HVHA 3TRGA 5B0FA 3KHHA 3PX6A 1MMDA 1K8AT 3VGUA 4YB6A 1RA7A 3IWNC 1ZAVA 3NGTA 2EG1A 3LANA 5DJBA 4Q44A 4DL0C 2HEKA 2V4RA 1TR0A 3CCQS 1FJEB 4YMEA 2AHOB 1F5CA 4ZVRB 1XR6A 3L3CA 2GMJA 3CCWA 3MCNA 1TK8A 3NNCA 2YWKA 3FGVA 3N6MA 3HULA 3S1TA 5HQ8A 4DUZJ 1OMSA 2DGSA 4F4YA 2RAQA 2L9WA 2GFFA 2M4MA 4OJGA 3SXLA 4DBQA 3MDFA 4DL6A 2AEMA 1CJVB 4UY8T 2DHAA 1SJ4P 1SIZA 1X4HA 2EWHA 2FZKB 4LF2A 2J6SA 1R8HA 4NLXA 4HDGA 3W9JA 2HQ3A 3D54A 4TKTA 1ZYQA 3DKDA 4WJBA 1UTAA 2N7YA 3MR7A 3GTYX 4C0HA 2IM1A 4LR9A 3QT7A 5L1KA 3IM9A 5GVQA 1U09A 1HKAA 3GZ7A 1QAXA 1VQKS 4W92B 2XTJP 2UUCJ 1RXOB 4JI7J 2M8HA 1P1TA 3HPOA 1WKKA 4AYBD 3S7RA 5EWFA 3PHTA 3FRZA 4H4KA 1PJ5A 4DL7A 1R8BA 3DOLA 2BA9A 3RTVA 3G2XA 4Q45A 2J6TA 2XG8A 2RDIA 3KLFA 5F8LA 5HLFA 3I82A 4IFVA 2QSFA 2MPUA 3DOMA 2FHMA 4U7CA 1QD1A 1R31A 2HRTA 4DLGA 2GQQA 4ZVOB 3G8SA 2CDQA 3IR7B 5E0OA 1HWUA 4N76A 2B3TB 3US5A 1TVRA 3MUTP 4ZJQA 3HHDA 2VPXB 3D67A 3TJ8A 3K7RA 1U2FA 4DR5F 2K1RB 2V68A 3I0RA 5EDWA 2XHCA 4LVNP 1Q16B 4KC5A 1WHVA 2GMHA 4OHYA 5KOWA 2LCWA 3OXGA 3OVBA 4ZPAA 1CBKA 1KOHA 2G0CA 3T1AA 4FPRA 1M5OC 4ZPBA 2KXNB 4CRJA 3W5YA 4ED6A 2HQIA 2IHR1 3VQSA 3W8GA 3OFHA 2IJNA 4FNIA 3C8YA 5LSLA 2YKMA 4ERDA 2GW8A 2KU7A 2MKYA 3GLJA 2XGQA 3MR6A 1HIYA 1SJ1A 3Q86A 1NKBA 1SKUB 3TJAA 3FMWA 4X4PA 3EVMA 5CABA 5D6GA 1KEKA 2P2CB 3ISZA 2FGCA 5L1LA 1JJ2R 2Q6BA 3VTIA 5FD1A 1LKZA 3OUYA 3KDOA 3MPWA 5D8HB 2CG4A 4LIWA 3KLHB 2NSBA 2Z58B 5FDLB 3JTPA 5IM0A 3HK2A 2HZVA 1VQMS 1U1PA 2FHOB 4DWIA 3OPKA 2HIQA 2UXCF 1U25A 1NDCA 3HVWA 4DV4F 4B9SA 2OGUA 2BX6A 3QWUA 2ADCA 2DEIA 1KTQA 3A8EA 2CWKA 3CB4A 1VISA 2B4VA 3IRXB 2DGUA 3O2IA 2VA2A 2B43A 4WYLA 2UVRA 4JV5F 5F8NA 4LIRA 5HROA 1VBYA 2LXFA 2CPYA 2VC1A 3T5HA 3OTOF 1UJ6A 3A3PB 2HGLA 1JXLA 1G1XA 4JI5F 2H48B 3GR1A 3NLCA 2HHHF 3N4WA 3ZTRA 3JSMA 2OEMA 3CW2C 4EO8A 2EBEA 4AE5A 2NCKL 2MQ8A 3D1OA 4ES1A 2IVMA 1KC8T 2FYXA 2QTWA 1EETB 3ZZUA 5HVGA 4KIAA 4CIOA 1UVIA 2UXCJ 1V3RA 2R2UA 4LF6F 4A8MP 1QVGR 4Y0FA 1B0TA 2PSZA 2K8GA 1DJ0A 3IMQJ 1IQTA 1KNZA 3DMJA 4PAAA 1IBMF 4J9LA 3B6BA 4LFBF 4XK8C 4ES3A 4KPYA 4PQUB 2VB6A 3FZBA 1UWAA 2MLYA 3AD7C 3KJFB 3N0VA 3DLKA 4EWTA 3UCUP 3IAS9 4OX8A 3R9LA 1VC6A 3M2VA 4EO6A 2BW7A 3M32B 2OMOA 2GX8A 2GC8A 3AOBA 2UU9F 3KHGA 3D3BJ 4C9DA 2DR5A 2RT3A 4ILRA 3R97A 1LK5A 2MJUA 5LJ3Y 5GADU 3KJNB 4WCEQ 3FRYA 2F7VA 3R5JB 3JYTB 2XLKA 3FSIA 1HBNA 4RW9B 5GAGI 4CM0A 3QSYB 4IOAQ 1KSPA 5CAAA 1K9MT 3J7YU 4UTGA 3ZNUA 2QFJA 3OL7A 2JEGA 2P9EA 1RQ0A 3HSJA 1BUXA 3BO4A 2CQ4A 4PQAA 5EGYA 5HQLA 4Z2XA 1RCXB 4QIFA 2MZ1A 2ROEA 3LALA 4BS2A 1N32J 1CJTA 1UAWA 1VR6A 2UVVA 1MSWD 3NXZA 3R2CJ 1UCNA 4C8OA 1TV6B 3MOJB 2X7IA 1TVRB 1H2UX 4NE9C 4ZIWA 3HVRA 2E1RA 4ZCKA 1M5VC 2IJFA 1G6BA 2ZOGA 3OR2A 2PMZD 4B9UA 4F02A 5K8NA 4TY8A 1AZSA 3MEGB 4NA1A 2BJEA 1KRPA 3I32A 2KN4A 1DTQB 4DS5A 4ZVGA 2OAUA 2COLA 2HFUA 2Q1LA 1HBUA 3LGHA 1KN6A 2V8PA 2OH2A 3T19A 2HHXA 2GV1A 1FFSB 1NZ8A 3IWLA 3DRRA 2CQGA 1XNRJ 4F2RA 2BE9B 2X3DA 2B0GA 2V63A 1LW2B 2EFPA 3BBCA 3NOCA 1VQ6S 4ED7A 5CCLA 2HVDA 4USWA 1EQMA 2BYCA 3FVYA 3KJQB 2KRRA 5KFSA 2MQPA 1PJ6A 4JI6J 1NH7A 3I5CA 2BM0A 3UWTA 2OSRA 3GG0A 2HQGA 2KXFA 4QWBA 2CUYA 2F9DA 3G6VA 1S48A 3JTNA 4BWMA 2G13A 1YRXA 4HTIA 5GAHU 1C4CA 4OMFG 3QLHA 1CJVA 2YXLA 4IOCQ 3KLIA 3TW0A 1NHUA 1WC5A 3PR5B 3H42A 1M5SA 3SMZA 1UZHA 5IZHA 1L3SA 5D3GA 2E7XA 1WDTA 2C2OB 3L09A 4FNHA 3IWXA 1RT7B 4FVCA 4BHQA 2CYYA 3GFZA 4CO3A 1YJRA 1T3OA 3Q8YA 3V2UC 4KHRA 4NWBA 2ZJRQ 1C1CB 1NPPA 4DU8A 4PG6A 1RWKB 2BRLA 5C5JA 4K4TA 4EK2A 1QUVA 2VH7A 5B0BA 5BJRA 3O3LA 2AMCB 2P6SA 3L7UA 4HI2A 4IG0B 4IOBA 4UOFA 2DXDA 2KYZA 2MQQA 1Q8BA 3UD3P 1GX6A 2DH7A 4KPCA 9ATCB 3LWLA 4G1QB 4URGA 2KM8C 2KXHA 1BWEA 2RB7A 3CDWA 2HYIB 1K1QA 5EWGA 1D3WA 1RI7A 4F04B 3NMAA 5D4NA 3N79A 4CZCA 2AYMA 4Y65A 2IMWP 2GCFA 3HHLC 1IKVB 3HHLD 3CIZA 4AFFA 1G4CA 3MUMP 4KGVB 2CG8A 1B0PA 4FP9A 1OIAA 3RU0A 4K59A 1XNQF 3D6HB 1S76D 1OO0B 4MK8A 2QLFB 1YBTA 2NREA 2QE5A 4C8YA 1N34F 1JJCB 1YJWS 1Z4UA 3SZ2A 3RR8A 2ZH5A 3FFIB 1TUWA 3NEKA 3KFWX 2BUNA 3SFUA 3QT6A 3UQSA 2FC8A 4C7QA 4DR2F 2KKHA 2WBRA 4BWJA 2YPZA 4O0NA 3SQOP 2CPJA 1LWFB 4DFJA 4IR1A 2G2YA 5LM7E 1RTDA 4OYZA 4F0HA 3D66A 5C2GA 1KQFB 3R7NB 5DG9A 4ECWA 4A46A 1HI1A 3R7SB 3V81A 4LR7A 2RRAA 1BQXA 4QZVB 4FKYA 3KDNA 4M5LA 2CQCA 2C3PA 3PYEA 1S57A 5BYQA 3OXLA 1RJJA 4USUA 4B02A 5GAGU 2HMIA 2V9WA 3AD8C 3ILLA 5GMEA 5IT0A 3HKWA 5T14A 1SQGA 2UVUA 2ZH9A 2W2MP 2B9WA 2RQCA 1T02A 3KLHA 5J2PB 1YX2A 4FYXB 2XCAA 4TYBA 3ZTOA 3LH2S 3DU6A 3GIKA 1QAJA 4DZDA 5D3GB 4NLOA 4R25A 1PAEX 1U6FA 3EVOA 1Q5VA 4K50A 2ZZNA 1P9YA 1X0FA 4QQBA 4FVMA 1C0TB 2MKHA 2OLWA 3SSSA 5JJBA 2KVQE 3W8PA 2VQEF 1U1MA 4P6QA 4MAKA 3MM6B 4RO0A 1U6ZA 1XMQF 1SIWB 1WG4A 1LXNA 2HNYA 3D68A 3LP1B 1UL3A 2J9DA 3H8YA 3NP5A 4QIVA 3W5ZA 4DCOB 4K2JA 2WB1D 4X62J 4YB1P 3M8YA 4P2XA 2ZH1A 4DSJA 3BDPA 3MEDB 2HIYA 4DFMA 1ZTTA 4ED4A 2ZM6J 1BE4A 1DAXA 3DMJB 1FHTA 1RTHB 3HT0A 4OJHA 1FNXH 4DFPA 1NNDA 4ECVA 5KFDA 2FPHX 2WSEC 1JLAA 2IRUA 1Q95G 5DRKA 4CLZA 4DPOA 2OD4A 3M32A 5KG5A 2E9ZA 1VGYA 2L9NA 3GG1A 2O67A 1MN7A 3N5FA 2X1AA 1ZA2B 5KFHA 2MZQA 3OLAA 1RT6A 2C3YA 3E2EA 2KT2A 2KT5A 1LV5A 1M5HA 2KI2A 3FEXB 4WWSA 2D3OR 2BJDA 1Y5NB 2QC3A 3DOLB 4R5PA 5I42A 1FJGJ 1T11A 4C2MA 1SJ3P 1S9FA 2J0SD 4DOZA 3DLBA 4F0MA 1BQNB 4KR0B 2N7CA 1S6PA 3OL6A 4L73A 1KONA 2B51A 4OI4A 4ZVQB 5C42B 5T7LA 5A76A 2ZBIA 1KP6A 4LF4J 1VMBA 5B0DA 1NZAA 4N56A 1JLAB 4LFCF 3BGOP 4CLYA 4KT0C 1JMTA 2MKIA 3A12A 5ETVA 5H9FJ 2UUBF 2DXEA 4B9MA 1IBKF 2CQ0A 1ULRA 4CLSA 2JEJA 1XQIA 3G86A 4A8KA 3PW7A 1YITS 4R0JA 1S1VA 3P3DA 2QX0A 4HTJA 4EBCA 2E5JA 4C3KA 4RBUA 4LSNB 3Q2TC 4DV1F 4PABA 2RRNA 2BKPA 1P8GA 3SSRA 3O5TB 2FVCA 3S6EA 3SBMA 1R0CB 6AT1B 2W7PA 3CC2S 2LECA 2XY5A 4OI0A 3R1LA 4DFKA 2GJFA 1GMWA 3DI6A 3I0SB 1HBUB 2C28A 1UVMA 1O51A 4YDXA 2C3UA 3KNGA 3MPVA 4WXOA 5CZXA 2WBMA 4J9NA 2R8KA 1REVA 3FNNA 3DNCA 4ILMA 4OYXA 1X8DA 5KFWA 3PCOB 4O3PA 4YHHJ 2YVSA 2YWWA 4C8LA 2DR6A 4WTYA 2C2MB 4AD6A 2JVRA 3ZZYA 3VGTA 1X5SA 4L3NA 3CCJS 4DXLA 1F5BA 3MPYA 3NMRA 1NHVA 3BR8A 4DQPA 2A2CA 5KFVA 4DG1A 4ZK7M 3PEJA 3MPUB 1RT5A 3S01A 2G2OA 1NLKL 3PW0A 4O3RA 3MXHP 2XLJA 2ASJA 2Q79A 3DDNA 2CVEA 3EZUA 4DPUA 3BN4A 3V6KA 3PFEA 3DGVA 5FLXU 1GNKA 3ZZRA 1KKHA 2BDPA 2MZSA 1IBMJ 3TAMB 4LFBJ 5IT9Y 2FTRA 2UUWA 1I94J 2M3DA 3R5BA 2MSSA 1SH0A 3BGLA 4PYAA 2E1AA 5H9FK 1H0HB 4LRAA 2H4YB 2NS1B 4OHVA 1HNWJ 3V4IA 4IDKA 1QVFR 5BXIA 1S0NA 1RTJB 1RTJA 4L72B 1UEVA 3VAFA 4MYUA 3HHEA 2CRLA 4P73A 3CJ4A 1QUPA 3WBZA 4CLKA 3CDAA 4DL3A 2ZH8A 1H7WA 1KLNA 3EXCX 4U7UD 2IM3A 3BKUA 1B7YB 1UFKA 3PACA 1H2TZ 2M52A 3R6GB 4QWEA 1TKXA 1ZZFA 4JV1A 3HSGA 2IRXA 3GWCA 1N56A 2VU5A 1JLCB 1H6KX 3DOKA 2E5IA 4I1TA 4DX5A 5DQHA 3KMSA 4FN5A 3FCWA 3PX0A 3K0JA 1AFJA 1RTZA 3RJMB 3OTCA 1VRQC 1HNVB 1U4BA 1X4CA 4RNNA 3ZZTA 2XMJA 1RKJA 2VODA 4NXNF 2O01C 1FF2A 1U6BA 5H9EK 4A8YA 1FTRA 5F9NA 3QAEA 4WE1A 2FIUA 2HNZA 4MKAA 2J7KA 3CD5A 1V3SA 4P2MA 3WQPA 3QZ8A 4AL6A 4I56A 3OVAA 1OY9A 2RS2A 2LLZA 1HBOA 3EICA 4B9LA 3ENWA 2MSTA 1NH8A 3SDEB 4FPIA 4C8ZA 4KH1B 2NUHA 3CJ2A 1JLFA 3VZHA 3MM9A 1IJFB 2J0WA 3MM5A 4JI4F 5EUHA 4P72A 4WKYA 3I96A 4ENOA 2UXDF 3FSYA 4RX6A 3OJSA 1UW4A 2ZH7A 2YNGB 4K4UA 2YKAA 3CCZA 3ELHA 4AQYJ 4DN0A 1GH8A 4NA3A 5F8IA 2GNKA 4AT1B 3A13A 3HD1A 1BMQB 4XDDA 4OI3A 3EGZA 1F2HA 3RRKA 4N8NA 4NLGA 2UUCF 3FZ2A 2KT3A 4IUFA 2RDDA 5G0RA 2OPSA 1Q8LA 3PV8A 1CPZA 5KFJA 2GJIA 4X4NA 4O3NA 1N54B 2QV6A 1FNOA 2W25A 3L4BC 2D9OA 2RUSA 2XSJB 1U0SA 2EVZA 4ZP7A 4LFCJ 4KHPJ 1U8SA 2ZE2A 3NCQA 1ZOTA 4M5KA 1IM6A 3MAHA 1KLMB 1RWPB 5KFLA 4YY3F 3FBFA 3BO2A 3LO3A 2BOAA 2M88A 5DM6Q 1N88A 5KT7A 3K5OA 1OQ3A 4P7TA 1R89A 4F3QA 4DV7F 2DR7A 2IMOA 2DRDA 5E3CA 4O4GB 1GAOA 1T9VA 2R7SA 5A2QU 1QAIA 4C48A 2AT1B 1XMOJ 2HHTA 2OIHA 4FYVB 4OZ3A 3CJRA 3DLKB 2R42A 1VQYA 3MD3A 2X3GA 3MM8B 1FFGB 4P2FA 5CCMA 2MXYA 2QYCA 5J1EA 3C46A 2W8LA 3RB4A 1K44A 1UA0A 4KHPF 3LTOA 1EAYC 3ZZPA 2F8HA 4HYKA 1V6HA 1YRTA 1HHQA 4PG7A 2E7VA 2PIIA 3K2YA 4KJIA 1C4AA 5LXRA 3MTJA 1BGXT 1OYDA 1V5IB 1YBAA 3DM2B 4FKXA 2JC0A 2M9KA 3V4MA 3DLLQ 3J7AN 3RW7A 1SC1B 2BE2A 3CDBA 3RB6A 1RTHA 4PPZA 1D9DA 5IV4A 1S9GB 2YKNB 4GC6A 1LFWA 2V8VA 4OJ1A 4QJVA 5CA5A 2MZRA 3OSNA 2J5AA 4U8YA 2V4JA 2DB1A 3TA2A 5THWA 4ZHRA 3KUEA 1O8BA 5AE3A 5JVGQ 1VIOA 1E6YA 4B3SF 2XS5A 3A1YG 1FFWB 2DGQA 1PKUA 1QAYA 2OTJS 4IG3A 1T9WA 1P27B 4H4MB 3UR3C 3VGVA 1DURA 1SUQB 2XMWA 3TQ1A 4B9NA 3I56S 1JNZB 3PNIA 4IQMA 1BHNA 4DCJB 3O1LA 2DY9A 4OJ3A 4WYWA 4I2PB 3UI3A 1JIHA 5AXMA 2BKOA 2C2ZB 4LSZB 2VFSA 3D5MA 1TELA 1SJRA 2CNNB 2LQ8A 3DRXA 1FERA 2K1RA 4CLPA 1X0PA 5JUMA 1DTQA 1T9XA 2YKOA 3MECB 1MWZA 3QIDA 3CCMS 1S9GA 2APOA 1RK8A 2V8HA 2VBZA 5KG1A 8ATCB 4B3RF 1VRTA 2HHHJ 4RW6A 4Y2AA 4X4RA 2VFTA 3PIOQ 4XPCA 2OUGA 2V94A 4DSEA 2JNJA 2NXJA 3C6UA 4FYYB 5A2QY 2QSWA 3H4DA 4NLYA 4ZVSB 2VUGA 3OFGA 1JJ4A 4OYIA 1Q1KA 1SUQA 4ECQA 3H4BA 1S1UA 4GRSA 4N5SA 3GFYA 3GJRB 1FVQA 3BH7B 5KFOA 2OTLS 2R7UA 2NPIA 1RT3A 3D4JA 3I0SA 5IC4B 3WIVA 5ETMA 2BABA 2AKWB 2V2ZA 1FE0A 5A8WB 3T3FA 1AFIA 4FYDA 2E1PA 1NM2A 3CJ3A 2U2FA 5E7OB 3CWJA 1WC1A 3Q8QB 4IQXA 1X4BA 3ILOA 1RWWB 1TMJA 1RZMA 4Y2CA 4DR7J 2PFDA 1SKSA 3M7VA 1C1CA 1X4EA 4BLGA 1EARA 3MEDA 3DRSA 1F3VA 1WSRA 1S6UA 3I6PA 1EX8A 2P9GA 4J9UE 3BV8A 3OXFA 1XN9A 2DNPA 5GADI 3H40A 4IH5A 5IC6B 3GP9A 3J7Z5 4DV6F 1JLEB 2HVIA 5DDOC 2QG9B 4TY9A 2ZHAA 1FRIA 1WF0A 1RAEB 1DTTA 5E3AA 1EJ7L 1MN9A 1UMJA 2I5JB 3M8SA 2BBEA 3AB2B 2A1BA 4ZVEA 1ICEB 4Q2MA 1KTVA 3QWPA 1NPKA 3D7SB 5J2QB 3TNVA 4C4WA 4LT6A 4D3HA 3LAMA 1HR0J 2W7OA 3LUYA 2JC1A 2HS4A 3GQCA 4X65F 3QO9A 2V6AA 4KFBB 1HBOB 4WK1A 2OHDA 3DU5A 1KQSR 1KHWA 4G6VB 3WDOA 2W9CB 3W64A 2Y1IA 1DRZA 5HBMB 1VBKA 3AOCA 5AXNA 4DV6J 2HKEA 3D1QA 4DEZA 2HWTA 1FT8A 4ZP6A 2DGTA 3RBEA 3MCOA 2HBRB 4P52A 3OW2R 3PO4A 3OJUA 3CO9A 3GJSB 4NI2A 3GR0A 2Q66A 3PTWA 4EMDA 3I87A 5E33A 5ETOA 4I69A 2R9LA 4RNMA 1VQ7S 2IBOA 1IBLJ 1NJIT 3PM9A 4ID5A 5IWAJ 1L3UA 3B54A 3UR0A 2LQBA 1S1XA 3BH6B 3BGRA 4A47A 3VALA 4K4ZA 2LU2A 4ZHRB 1DFDA 1WEYA 3H90A 2PMHA 4Z37A 3Q89A 3OTEA 1SKRA 1R0AB 1MLAA 2P9CA 3NCRA 3SDEA 5SZTA 3TARA 3RR7A 3M2RB 2FLPA 2DYAA 3NGKA 1FJ7A 4CH0S 2ASYA 3M2UA 4WBFA 2CVIA 3OFEA 3TI0A 5KFPA 3BJYA 2X1FA 4K5SA 1N8RT 1YHQS 2BE7D 2MKJA 3BQ0A 1D1UA 1YJUA 3DRPA 3HZGA 4OHWA 1YG0A 5IWAF 2AEFA 1FA0A 2RDJA 1YJNS 4WZMA 5DQGA 3HHNB 4I2QB 4L6V3 2X1GA 3MM8A 1T0TV 3H20A 3JTOA 4DV2F 4OYWA 1RAIB 1VHFA 3TOQA 4DG1B 3W63A 2ZVSA 3BPDA 3A8KA 1FD2A 5KFZA 1HLWA 3P8BB 1HMVA 2AYEA 2EK1A 2I1RA 2XZDB 5IV3A 5ETPA 1KLMA 1W7WA 2RH3A 3BSAA 1U0HB 4K4XA 1S1VB 3W2WA 4ZLNA 4J9SA 1VK3A 3E3XA 2MJNA 1NPRA 1PC4A 3CEDA 1VQLS 4IH7A 4JI1J 4QCLA 4CYUA 1VQPS 5I4MA 4JI2J 4WFYA 2P8IA 1OY6A 2JSXA 3C66A 3HJFA 2M0GB 5M2RA 4FF4A 1U1QA 4JV2A 3CT9A 5GAEI 2MLZA 2ZJQQ 1RADB 1PAUB 1MU2B 3KG0A 3UW1A 3EGWB 3FFIA 1T9TA 2MTLA 2WVCA 5DQIA 1XJWB 3RAQA 4CCHA 3R5CA 1HNXF 1KFDA 2WVEA 1T05B 1U8WA 4CTAB 2PI4A 1UPPA 2F4FA 2LEPA 5CYJA 5IS2A 1LXJA 4A8SA 1SC3B 4NLPA 2GZOA 5LL6d 1O6XA 2VV5A 3CGIA 3LPEA 2NZ4A 3W2WB 1A0OB 1MROB 2OELA 3KWMA 1HL6A 3MURP 4Y00A 1T7PA 2CJAA 5C25A 2ZEJA 3T5JA 2HG4A 1S12A 2E5GA 4IRCA 4A8QA 2I8EA 3VAMA 1RHJB 4YB7A 3WC2A 2QLJB 4U6PA 3EX7B 1DLOB 3H5YA 3HFZB 4PXCA 2CQPA 2VF3A 5IQ6A 1U1LA 1U49A 1S9EB 2HAIA 2RF2B 4KQZA 2OPPA 4PG5A 1LWXA 3CC7S 4UUWA 2HFOA 1Q0NA 4CLUA 2HBQB 1P6TA 5KG6A 1ZBTA 1RTIA 3M6VA 3H2VE 1CEZA 3C6TB 2CKWA 1S77D 4UZCA 1IN0A 1W2IA 4J91A 4BBYA 5KT5A 3FBEA 2Y8WA 4NRUA 1XWLA 1RP5A 3PXGa 2Z2ZA 3R6LB 3DXSX 4UZBA 5J2NA 4OX9J 1SPBP 1URNA 1RT4A 1AUSL 1QM9A 4F67A 3PVXA 1IVZA 5KFXA 2OKQA 1NJXA 1UFWA 3CJ5A 2XNQA 2VG7A 3EJMA 4OI6A 2HLTA 3U7JA 5T7LB 2H5EA 2YBVA 3TZWA 3JSBA 3MAAA 2OMLA 4YP3A 3MMJA 2ALZA 5AJ3J 1I6JA 1IBKJ 1VQ9S 2BOPA 2W4CA 3BYPA 2KYXA 5CYQA 2DD8S 2AGOA 3MFIA 2RHSB 4ED0A 3BZQA 3N6LA 7AT1B 1TKZA 4U67Q 3PJWA 2R4FA 3OL8A 3T1YJ 4JBCA 4JI3F 1IKYA 1M5PC 3Q24A 1X5PA 3AD9C 2DR9A 1KBRA 4F4KA 4LSNA 2E9TA 2V9KA 4ECRA 3QAUA 4L3KA 3TEGA 4NCBA 2JLFA 2KRBA 4KY3A 4YFUA 1F2GA 4ED3A 2HHWA 3TX0A 2C22A 1K1SA 2J7WA 4TQSA 1RT4B 2ZHBA 5CXTA 3M2UB 3K59A 2VG6A 3A4TA 3ZZZA 3M8ZA 1T8EA 5I42B 3SI8A 2HHSA 1OQ6A 3M2VB 1T9UA 2B7BB 3BR9A 2E1CA 3AXKA 1FRLA 5ETKA 1XMOF 2BRKA 2WW8A 2OFGX 4UOGA 5C24A 2L41A 1HW9A 1DY3A 4JI3J 2ZOMA 5L1JA 1RDRA 2Y1JA 3G4SS 2K2PA 4OFZA 4WF9Q 4R8UA 1F0XA 3FBBA 4OX7A 3G8QA 4RW7B 5H1SV 1YJ9S 1AYEA 3CJSA 4X4UA 2EFQA 2VQFJ 1HQEA 4FF3A 1ROFA 3UN3A 1IKXA 1WHYA 2DK2A 2J76E 3LW5C 4MK7A 1UWBA 1J5OA 3PDNA 2QO3A 4KH0B 4W98A 4OYMA 4QU7A 2IY5B 3PRBA 4PZVA 1NCLA 4RPFA 3KK3A 2E9RX 4NZ0A 4JI6F 1VIXA 2RKIA 1BXNA 3GJQB 5KFUA 4X4SA 3O8WA 4DR5J 2KB2A 4IDKB 4GKJJ 3TVZA 2EC0A 3AJDA 4B3SJ 3HO1A 4ZN1A 3M30A 2FVSA 2WW4A 4NL5A 2W9BB 4URSA 2ZJPQ 4FS1A 1FDNA 1T95A 2RVJA 3PX4A 2IFXA 4ETZA 4DV1J 3JAMY 2Y0SD 2B8QA 3PFOA 1HBMB 4IO1A 2LXIA 1VHIA 4C3MA 1MWYA 4DR3F 1T94A 4LRCA 1X5OA 3SV3A 5KT4A 3DYAA 2AJ0A 4V19J 4JYAF 2J7UA 1VRTB 3PO5A 1TL7A 5KG4A 4OZ2A 1FEEA 1HQUB 5FIIA 3CJKA 4DUTA 3TAPA 3L7OA 1Q4RA 2P5VA 2OPRA 1SC4B 3FQKA 1Q7YT 3CCUS 3HX9A 3OHAA 4DV5J 5DO2A 1WEZA 4F7VA 3T5KA 5K14A 3TZYA 1N5SA 5E2QA 1SV5A 3MEEB 5HL7Q 2ZDOA 5KFRA 5ITHA 4K4YA 1RLDA 1YVFA 2FHJA 1GXLA 4Z7CA 1U2RA 2QA4G 1YTYA 3M8PA 1S6PB 1YK9A 4UQGA 2M70A 3HLUA 1UKUA 3TAQA 5KG3A 3MMCB 3WX4A 4CO4A 4ZDNA 1LWCB 3J7ZT 1LWCA 2Q3PA 1NXIA 1F9FA 4IH6A 3NBPA 3NNHA 1RT7A 3AJ2A 2W2PP 5D0EA 3N9UC 3CCES 1HNIB 5J1NA 3MUVP 3VWSA 4DUZF 2IC3A 1HNWF 1HI8A 3R5AA 4JV0A 5B09A 2XI3A 5I3UA 4DPYA 5J1PA 2LQJA 4WFZA 4Q2LA 1PGZA 1Y5LB 2MY8A 3CCSS 1Y10A 3MHYA 1X5TA 3KUHA 3B4MA 3P5BP 3QGPA 3VF0B 4OZ1A 4OQJA 5IQQA 4DSFA 1CS4B 1RHKB 1RTDB 4NASA 4RW8A 3T41A 3W66A 4UY85 3F73A 4QWCA 4HT7A 2VIHA 1FXDA 4CQ1A 4Y28C 2PE8A 4OHXA 1C0UA 3G6XA 1Q7LB 2J0QD 2UXBJ 1S7HA 3EYZA 1PG5B 2HRUA 2VPYB 3JSRA 4WFAQ 2B7CB 2J8SA 2WSFC 1SJFA 2B4PA 2B6AB 2M7SA 2B6AA 2C2NA 2FLOA 2LQ9A 1N33F 4PWUA 3HXMA 3AXMA 1XIQA 3CCTA 3C16A 1D9FA 2HBYB 4DV3J 1QE1A 1RWXB 3MI7X 4EEYA 3I31A 1LEOA 2DNKA 3W9IA 3Q8RB 2KG0A 4NYPA 3HDSA 3TP2A 3UCGA 1HR0F 2B5JB 3AY0A 3MMAB 1OYEA 1R43A 2VPZB 4LRFA 2KJVA 3AFGA 1RGVA 2DO0A 2HGMA 2YQ3A 5KT2A 2DO4A 3JYTA 2ZH3A 1U1NA 4LMZA 2UXBF 1I5OB 2DEJA 3LP0A 2XS2A 2AJ4A 3SEOA 2AGPA 2BQ3A 4LF8F 1S6OA 3TUZC 1FRXA 2G1DA 2L48A 3FMBA 3N28A 3DC2A 4R0EA 3OQ2A 5DZ6A 3VVTA 5KG7A 3BGUA 3BO3A 2DNHA 2E66A 1NK8A 1LOUA 1UEUA 2FHKA 3OVSA 3CD6S 2W1BA 4OYBA 2XGPA 1G2EA 1DTTB 2Y3YA 5F3ZA 1N32F 1GQEA 3M9OB 4DQRA 3AJ1A 3P5TL 1IBLF 4M5JA 1KVKA 2VDHA 1CJKB 4F3OA 4P9SA 1MMNA 4O44A 3D9BA 4DCPB 4B9TA 4HHJA 3VZIA 4OX6A 4B3MF 2V8GA 4H4KC 2YX4A 1F6TA 3MR3A 2G0JA 4L75A 2HQFA 1R0BG 3A3OB 3FBCA 4I68A 5IXUA 5KT3A 5DG8A 4YB5A 1NK7A 5J2NB 4OZ0A 1S59A 3DLEA 3M6WA 4AXJA 1NK0A 1OSCA 1WOSA 2FVRA 1RT3B 4ANEA 1NK9A 2WSCC 4DR6F 4ELVA 1TFWA 3WHIA 4FDFA 1NDLA 2FJEB 3BBFA 3D0HE 3QIPB 4ES2A 1WOOA 2DNOA 3AODA 2RJZA 1MU2A 3DRRB 4QYZJ 4PG8A 4JI7F 2ZBCA 7FDRA 3KLVA 3GIJA 1UEKA 3UVJA 1GX5A 1I3OB 2BQRA 1FKAF 3CD0A 2V5HG 2XMMA 4GMKA 2KFNA 1EETA 1NAQA 2QL9B 3AA8A 3QRPA 2OEKA 2NUUG 2PT0A 3H2UB 3W2VA 3ISND 5KG0A 5DGAA 2UXDJ 2RNEA 2DITA 1TL5A 4J9VA 3X3UA 4ETXA 3OHBA 2YKPA 4HVZA 3D6FB 3JXOA 4AQYF 1F5AA 3H5UA 5U47A 1NU4A 2B9YA 2EC2A 4OHZA 3NGDA 1CJTB 3PKMA 1Q81T 3KKFA 3NGSA 2DIVA 2O5DA 2QT7A 5CYMB 3KYLA 4DR1F 4Q0BA 2DH9A 3K8VA 2IDLA 2Q6CA 2QMXA 3V4IB 1NUEA 3IS9B 4Y34A 4KTQA 1FK9B 3QZ7A 1VJWA 4MTPA 5E3QA 1U47A 2FJVA 2BVZA 1H73A 3J7YI 1SH3A 4DZ6A 2AD9A 2QLXA 2EKNA 4M5GA 1YRUA 2MY7A 4RW7A 5HN0A 2W9CA 4OYOA 1RT2A 2RD5C 2POKA 1VRUA 4TU7A 1LW0B 5HVFA 3ZO7A 1GXTA 5B0EA 2L08A 4FS2A 3EDRB 4H4OA 1H38A 1EKRA 1LWEA 3MEKA 5CZVA 2FZCB 2CXEA 2GGPB 2F3JA 2CJKA 5L9XA 5J2PA 1S6QA 4WU2A 4G1IA 1R8CA 2GVDA 4CT8A 2ZNZA 3IS9A 3OT9A 3BSCA 4ZN3A 1JK9B 5A0YA 2R2SA 1KQKA 3JQMA 1SXLA 2FJXA 4PYDA 4QIEA 5D4LA 3TR5A 2XYHB 4ALZA 4CYUB 3HVAA 4MFBA 4J9MA 5HANA 1PYSB 1WC3A 4AUKA 4DL4A 1NK4A 4USIA 1WC6A 2FJBB 2V4JB 2GHVC 1UW9A 2ROGA 4NA2A 4WIQA 2IAJB 3JB9k 4IRDA 3V5RA 2WZ1A 2KL8A 2B9XA 5B7WA 3WIUA 2OD6A 2JEFA 4CO2A 2XCPA 2UUAJ 2LP4A 1YJ7A 4FYWB 1RWVB 2BJ9A 3NG8A 5ETNA 1VJQA 4GO5X 1VS3A 4JI5J 2DGOA 3VCDA 2C42A 5KFBA 1Z2ZA 2JX2A 1ZPWX 3RAMA 4HT5A 2DNYA 3I9ZA 4KV8B 5B0AA 1U1RA 2ZKTA 5G0RB 4CLLA 1HI0P 2MHNA 3KLGB 3H2LA 1Y00A 1CJKA 2DNGA 2QLWA 2R7QA 2DXFA 2XYPB 3IC1A 3M8PB 3NAHA 4ZA1A 2B4UA 4NLTA 1JLEA 3TUJC 5B08A 5LMNF 4LBPA 2VBXA 2VICA 1VBXA 3LA0A 1CG2A 5L38A 5K8PA 5A8KB 4QWDA 3R3TA 4DX7A 3THVA 2I9SA 3IA0A 5MLCV 2ZD1B 1EKSA 3MAQA 2Y1RI 2VOPA 1KHVA 4NPOA 1N48A 2OJ3A 1RLCL 4M5NA 3MMBB 3RW6A 3TQEA 3LPYA 4JOUA 5KAKA 2XNRA 3IBCB 1UJ5A 1QE1B 5HI7A 2YNFB 3GFHA 4Y6IA 3S8SA 5KFCA 2B5JA 5HSPA 3QT8A 1W2BR 3IFEA 3DN9A 3OD2A 4N7TA 3SV4A 4ER8A 1U1OA 2YNIA 4CLFA 2VBWA 1Q53A 4X64F 3KHLA 1T05A 2XWXA 3IR6B 2VA3A 4WZQA 4X62F 1UETA 1X60A 2GIFA 1C0UB 1RHUB 3G82A 5RUBA 3QSIA 3M6UA 1GFWB 2ZM6F 4OI2A 1D9AA 1B4SA 2C1EB 2OO4A 3M1VA 2V0NA 2PFFB 1IKWA 4RBTA 4F3MA 1CC8A 1FCAA 3K57A 3V6JA 4GVBA 1GTEA 4C8NA 2QLBB 5A8RA 2X51A 1GMUA 4F2SA 2O66A 1DHMA 1ZM4A 4X4QA 3U27A 1UP1A 5HAOA 4MIBA 4NEZA 2CQ2A 2F65A 2MZTA 4GKJF 2JHEA 4KO0B 3MMAA 4NRTA 4LJMA 1MNEA 2I5JA 2HFVA 3BM7A 2OPQB 5KFAA 4HR2A 4MKBA 2MDAA 2YWGA 1YJVA 2H4WB 1PILA 4I2PA 3KG1A 4U96A 4RZRA 4CH1A 5KG2A 1EQ0A 2VFUA 2ROPA 1UVJA 2ACMA 4BCAA 1S0VA 4PCQA 1QSYA 1YI2S 3B82A 2P6TA 3BS9A 4RJVA 4J5OA 8RUCA 4X4VA 2AIRB 3DXBA 2R3VA 1SV5B 3MEEA 4KV8A 4ZLJA 2R7RA 3B8HA 3KJVB 3GSIA 4DDFA 4V1Ak 2GO8A 2GGPA 4E98A 3EGVA 2ZH2A 1FX4A 4ZP9A 3JSMB 4CDIA 2G1HA 5F8GA 5KFMA 1WDDA 1BY9A 3D6MB 2DHHA 3OR1B 4RW8B 3M8WA 3UN2A 2MQOA 4LR8A 2PMWA 2J0XA 3PW2A 4MYTA 1UVNA 5IFMA 4OIXA 1WC4A 3V6HA 2H54B 3T6BA 4ZPCA 1U26A 4RNFA 1MG7A 3G8TA 3P45B 9RUBA 3GIMA 3G9CA 2NLWA 5J2MA 2CDRB 2QEXS 3VHQA 4CO5A 5DG7A 3NS6A 2ZZTA 4ECZA 1Q8IA 4DPXA 3G87A 3TX8A 3GU0A 1H98A 2E1MC 4I4BA 3QBCA 1IWAA 3LP2A 3KLEB 2YNIB 1V5VA 1RHMB 1L3KA 1X4DA 3LGMA 1FESA 2F63A 3DGPB 3F41A 1RWUA 5HP1B 1N5TA 4NCGA 2HGNA 1Y9OA 1YKWA 2UV8G 1K0VA 3D28A 3KK2A 1YIJS 2HWIA 4L74A 2HHVA 3OSPA 1WORA 4DX6A 3IG1A 1LFPA 4ZLPA 4HI1A 2IVYA 3M9NB 2VQEJ 3IRWP 1G3OA 3FCHA 4EZ6A 4YR0A 2NQPA 1R6VA 2DNNA 1XMQJ 4B9VA 1Y3JA 1WKJA 3MM7B 3MM7A 2CPFA 4EFAC 1KR4A 1TZ0A 1ELOA 4PUOB 3R27A 3SFGA 3U1NA 4K4VA 1H3DA 1TUVA 1PBUA 4DQIA 2CQ3A 1SBRA 4X84A 4RUCA 5F0UA 2YH1A 2HQDA 4R8UB 5BYRA 1E6VA 2J6UA 4DX8H 3A8IA 2PA8D 2XHWA 1FD8A 3CD7A 2KTQA 1GEHA 3H0PA 4K7QA 2HHUA 5LSOA 4ZS6A 3IRXA 1LW0A 2CADA 2QFIA 3BPSP 3OV7A 1B7FA 5H9EJ 1IKXB 4NLUA 4Q5VA 2V2QA 3CNQP 4I6YA 1R7IA 2EKYA 2CZ9A 4DHVA 3GV8B 3UCZP 1X9MA 4LSLB 1LW2A 1UWBB 2I0XA 2A2DA 2CQIA 2BXJA 2XWYA 2K7JA 1I1GA 3CXCR 2RRBA 5I3PA 3SIPB 1HNXJ 1HNVA 4LF5J 1IKYB 1NKCA 5A0YB 1XTZA 4DR3J 3QLHB 4PXEA 2GA7A 1IJEB 4O4GA 3WC0A 2PO4A 2FD2A 1RE1B 2YKNA 2ZOFA 3DRYA 3ONQA 4K2XA 2D7SA 4M5HA 4NZ6A 5K9FA 1RT1A 4ZCMA 4DUYJ 1L3TA 1GMWD 1R8PA 2CFXA 2KFZA 5EX0A 3G6YA 1JLFB 4ID8A 3MM6A 4J9OA 3RBDA 1SL1A 1VC0A 2KHCA 4TLQA 4ECTA 5HJYA 1TK0A 3DLHA 1S97A 2YWHA 4M5IA 5BR8F 1RTIB 3M6XA 1OJ4A 4P74A 3RG6A 2N82B 3O6QA 2V8DA 1A7GE 3Q8VA 4KSEB 1VBZA 1WNEA 3R2DJ 5I3UB 1FK9A 2WVFA 2YPYA 1NBEB 1SCJB 1MWQA 5LT5A 3I0RB 4XO0A 4LF5F 4AL5A 2R8IA 2FVPA 1Q5YA 1RHRB 5E41A 3IN5A 2KHDA 3IBWA 1Z2LA 2CPIA 2K06A 3G6ES 1ZS6A 4TXSA 1ZM9A 4N77A 1ZA1B 4CNZA 2WTFA 1JLQB 3IR5B 2AGQA 3NCPA 2R7VA 2C2DA 2DVIA 1FKPA 4K4SA 2EFNA 3EVWA 1DLOA 4MIAA 2MZJA 1HHSA 5E5NA 5K8OA 3DOMB 3NRBA 3UPFA 1UPMB 4Q8EA 3M1VB 1SB6A 3J81Y 4E0DA 5AJ3F 2DNZA 4P2SA 3KNAA 1KVJA 2AX1A 2DPJA 4NLVA 4M94A 1VQSA 4L76A 2LEBA 1AA1B 3MOZA 2XMUA 3ET6A 4HACB 3GILA 3E51A 1F1BB 1PJ7A 3JQKA 1RT2B 1CJUB 2OP5A 3BSNA 3ZNJ1 2DRAA 3HZEA 2JJ4D 2ZH6A 2BM1A 2AYGA 1S49A 2H51B 2ZUGA 4HLBA 5HBMA 1WACA 3V6DB 3UD4P 3TO8A 2LKZA 3RZAA 2KZZA 5AT1B 3P49B 2OFHX 3LP0B 4TN2A 1TKXB 4OV1A 3QIPA 1DZ5A 5EHHA 5C25B 1J2VA 3CDEA 4NEYA 1Q82T 1ZH5A 4MKYA 3OTOJ 2BEFA 4RW6B 2XB2D 1X7VA 4ECSA 4RNHA 1AUDA 3QGGA 4DPWA 3G71S 1Y3KA 3GCXP 1D09B 3HT3A 1U45A 4E8UA 1JWWA 1WI8A 3BDEA 3GYGA 3C16B 5EWEA 2HFZA 3I9V9 2VKZG 4USKA 1NB7A 1C2PA 2PDAA 3D6TB 3EM1A 5IT9U 2AF6A 2DKOB 5KFTA 3KLGA 2EXUA 3D3CJ 4QBUA 1TL1A 1Z1ZA 3M4XA 5LSRA 4DQSA 1J5EF 1WHXA 2Y9HA 3BKTA 4LF8J 5LMUF 2E44A 4MK9A 3KG4A 2B8PA 2H1YA 5F41A 4AL7A 4F4WA 2AU0A 1M90T 3NL0A 5L9NA 3TVKA 5ETRA 2IYGA 4PG4A 4WP9A 3TA1A 4LF7F 1G7CB 4HH1A 2RE1A 1Q79A 5HATA 3VGSA 1C0TA 2CNKB 1FWKA 4ZP8A 3UO0A 5KFKA 3UDLA 4DI6A 1I51B 1HWLA 1YWXA 2BACA 2DH8A 2FZGB 3N5BA 1P1LA 1T03A 4FF1A 2VOOA 3SCIE 2ABYA 5CD4A 1N6QB 1XK8A 2GS8A 1CSJA 1XMBA 3GFXA 3DGPA 4FXWA 1HMVB 2RQ4A 2DNMA 3M8QA 1OWXA 1FDDA 2QMUB 4LBHA 2WONB 2CQ1A 4MH8A 4WKRA 2XZTB 2RUGA 1X4AA 4ZLLA 2D3ZA 3TAMA 4C11B 2GQ2A 3HJVA 1YBUA 2GAGC 1NJZA 4DR6J 3MWBA 4ID5B 4RUAA 3CCLS 2VZ9A 1TL3B 4LF7J 3X1LB 3Q22A 2GHPA 4J7CA 3CMAS 2B9EA 3GIIA 5KFEA 1MW7A 3N01A 4YEAA 2FUG9 4AXIA 5LJ5Y 4HACA 1SC6A 3DLGA 4Q0BB 3M30B 3IXQA 1IBCB 2QL5B 3NY0A 2VL1A 2CNOB 3WX8A 1REGX 3OL9A 2ZFHA 2HSEB 4KKOA 2DIUA 2YNHA 3H59A 1VLOA 5B0GA 4DV3F 1CC7A 4I6AA 4NYZA 4M8LA 4DMZA 2IA0A 3MPDA 2IM0A 4YY3J 2XC9A 2CQHA 2I38A 3OR2B 4DPTA 2IDEA 2JLGA 2K7KA 1S1TB 1BQMB 2XI2A 1ZAWA 1M0SA 2L3MA 1YJTA 2E29A 3DM2A 3FK4A 4I6WA 2BR0A 1O0PA 4LF6J 2EFOA 3GYXB 4XAKA 3D1HA 4RUHA 5F8JA 3NKYA 2CQDA 3H7HB 1KDNA 2VDIA 3CPWR 1NSAA 3ETOA 1WTBA 1FKOB 1XERA 2OPPB 2D74B 3TVYA 1HWKA 2F4VJ 2LEAA 5IOLA 4DF8A 2ZC3A 4ANCA 4YN3B 1TKTA 1VQOS 2CPEA 3CUNA 3PYDA 3PYGA 3UE2A 2HWHA 1QSLA 5C7PA 4ED8A 2V69A 4NMLA 5DM7Q 1BWVA 4UF4A 2WVDA 4DQQA 1YZ6A 2MKCA 3ICLA 3QFWA 1FO1A 1TL7B 3H5XA 1RACB 4XPEA 4UQTA 1FXRA 3DYAB 4CI0B 5DETA 4RU9A 2XY7A 3KXDA 2ERRA 4ELTA 4LQ9A 3AT1B 3MGJA 3MFHA 2JFDA 2VHGA 4KBIA 3M8RA 4PRFA 1PBAA 2KJWA 3DLJA 2DCLA 3TUIC 3WZ0A 3PW4A 1VI7A 2NZCA 2WONA 4NLRA 3W60A 4KGZB 2B56A 3QQCD 3DFEA 2LXUA 1VDHA 4ZJOA 4QWAA 3CJ8A 3HSZA 4NCGB 1HFEL 2VKRA 2JVOA 5HQMA 5AE1A 3SQGA 3RYLA 1RAGB 2G0IA 1IM4A 4DN9A 3NGRA 2ZDPA 2NR0A 1J5OB 2NYIA 4YR3A 4IFYA 2Y0BB 3HF5A 5AXKA 4K5RA 4USMA 2MGZA 4IRKA 1FNMA 4DL2A 3OFFA 5A8KA 4FXVA 4HDHA 2YQ0A 4RUBA 3UFCX 2VFVA 5F9LA 3BBBA 3CCVS 3EMTA 2VONA 2CIMA 2GVZB 3J7A1 1AB8A 1ZETA 4B3RJ 1ITPA 4X4OA 2C3MA 2RIJA 4QIGA 2C2RA 2EI5A 4BDPA 1BQMA 3L7PA 4DV2J 4B3MJ 1RAOA 3W5XA 1HYSB 1FDBA 2D3O1 2HK3A 2E5LJ 4QW8A 4ZCIA 5L1IA 2LA6A 1NK6A 3QRRA 4OLOA 3PJ9A 3CMQA 2W8KA 4TNOA 2Z4PA 1RAAB 3TUPA 2YWEA 2ILZA 3F56A 5D0RA 5DDQC 3NAIA 3ENQA 5A6PA 2XQCA 3FEZA 3K8WA 4J9KA 4DR7F 2BJ7A 4QYZK 1SI9A 2CJBA 1BC6A 4U7UK 2RU9A 4LF9F 4GVBB 5F3TA 1TU0B 2DHGA 3BGRB 1IKWB 1EZZB 1YSJA
chains in the Genus database with same CATH topology
1R27B 1KD1T 1TAUA 4NX9A 1ZPVA 4Y2KA 2CPDA 2AW0A 4F50A 1X9SA 3M05A 4CO0A 1WF2A 4KAIA 2JEGA 3PKYA 5J1EB 1B0VA 4CNYA 2GQCA 4MMOA 2GHWA 6FD1A 2HNDA 1FXLA 2YH0A 4ZKAA 4IR9A 2GIQA 4NXMF 5CYMA 2AWZA 3LWMA 1JJHA 4QPTA 4A4JA 1REVB 2YTCA 4ZPTR 1OSDA 3BSOA 2O3DA 2ZNYA 5KT6A 2G4BA 3QJPA 1WI6A 1N0VC 4RWXA 5A8RB 2R2RA 1H2VZ 3IGVA 5B0CA 4PUOA 1S1WA 1SL0A 2C3OA 1ZAXA 1L3VA 4PKDB 3QGHA 3KLFB 5HLFB 2YY3A 2DPIA 2DGXA 4NOHA 4OZLA 3BEGB 2N4DA 2PEHA 2KDOA 2ACYA 1NKEA 2FB0A 2PGCA 1XR5A 1P9QC 2RKIB 2KG1A 1TK5A 1WF1A 4LQ3A 2EPIA 3I5BA 3IGNA 2JOQA 4K4WA 4WU3A 5HROB 3HP6A 1XEZA 1PC5A 4DR4F 2VPWB 3L95X 5E3RA 3D0IE 4EYIB 1T03B 1L5UA 3QMQA 2DHSA 3Q8SB 5D78A 3MCSA 2MKSA 1HQEB 2LU1A 1FJCA 3MF5A 2EW9A 3PW5A 5HMZA 1BLUA 1JLCA 1Q78A 5D77A 1XNRF 1IXKA 2DBBA 2J9CA 2W4DA 4DJBA 3LAKA 3P96A 3KK3B 2WRMA 1SQEA 1WELA 5KFQA 2DNLA 1UVLA 3NNAA 2FJDB 1JNRB 2UZAA 2W9AA 2ZITA 3ULHA 2CJ9A 3GSDA 2CZ4A 4HL9A 2RU3A 4FZVA 1Y7PA 3G96A 2ZHOA 1HW8A 2WHOA 3F44A 3PHEA 6FDRA 3C6TA 2WAQD 2D41A 2EFGA 4JI1F 5F0WA 2QIFA 1NK0A 2RQMA 3DRPB 1VRUB 3HHLB 5KFNA 2D9PA 2XY6A 4N47A 1ZTWA 3SSQA 2AP6A 5JXSA 3I55S 4YHHF 1A9NB 1WEXA 2LDIA 4YOEA 5F8MA 4K0KF 1LWEB 3BF4A 1S10A 5EN1A 2R7TA 2QMWA 2XEXA 3M2RA 1S6QB 2LDYA 4KRWA 5J2QA 2VG5A 1CVJA 3OR1A 2ZZMA 2DRBA 1U1KA 1E6VB 2BANB 1O5JA 2J9EA 5A6WA 1NK9A 3NBPB 1HPZA 1DARA 2CQBA 4MJKA 1X4GA 5L8RC 4A8OA 4MFBB 2WK4A 3DI6B 2QA1A 4TQRA 3FEYB 2N4CA 5L39A 2GO9A 4I2QA 1OPZA 1A6LA 2CZVC 1I94F 2MGZB 2VG7B 3ZC4A 2R7XA 1FRMA 2VASA 4Y2MA 1UFLA 2ZKUA 4F4ZA 2IA6A 4IYQA 5I3QA 1NJWA 4LF4F 1JLGA 2WOMA 1R6YA 3GE9A 3Q0AA 4WFNQ 2FLNA 3M8QB 3RR8A 2OPRB 5BYSA 2VFRA 4DV5F 3QYYA 2VG5B 1HD1A 2XSFA 5D4OA 1Y5IB 5K14B 2BE2B 4I0WA 5KFGA 3BGFA 4Q43A 1V3ZA 2QRRA 4RKUC 3K5NA 4A8FA 1JB0C 1OPIA 1FRJA 4Y2IA 3T6JA 5EX3A 3T1HF 4EGLA 3H98A 2DTJA 2HFNA 4X66F 2XSJA 2NPFA 4IG3B 1S99A 2MKKA 4B17A 4M63A 2KM8B 3SYZA 4O3SA 4M95A 4Q7AA 5HO4A 2OPQA 4RWWA 2W9BA 3CMES 3VAKA 1TKTB 1HBNB 4RW9A 3DCAA 4F26A 3QO9B 4KFBA 2GJ2A 1S79A 2A10A 2ADBA 1V9OA 4QR0A 2V4QA 4G1QA 2BZ2A 2FJAB 5K5MA 2LA4A 4IFVB 4OLPA 4M5DA 1JKHA 4ED2A 1N5YA 1FRKA 4RNOA 1HQUA 3JSYA 4ILLA 1R8AA 1AW0A 5E3PA 3CC4S 3QGIA 4U9RA 3ITHA 4WE1B 1RKIA 3C6UB 3PEHA 4QOTA 1S1UB 3HHKA 4QR2A 3HM9A 4WFXA 3LGNA 3CJ0A 2DHXA 3TANA 1XC9A 4B3OA 4KO0A 3DLEB 2MMYA 3MEGA 1VQ5S 1GT8A 4WXWA 4OL8A 3UDCA 1R0AA 1HD0A 4C0OC 2QA4S 3MM5B 2X1BA 4DUYF 1X9WA 1HWIA 1TKDA 2PD1A 3IAM9 1LK7A 5DLGA 1D0EA 3ZZ0A 2M2BA 3THTA 1RISA 4NCAA 2E7WA 2OPSB 3ITHB 2D1CA 5FJ4A 3EXYA 3C3LA 3RRGA 2CPXA 4HEA9 5JVHQ 4DL5A 2DGWA 1S1WB 1BD6A 1XBWA 4FBUA 4NZ7A 1GTHA 2DGVA 4I7FB 3MR2A 2J8AA 1U7LA 3AB4B 2JRSA 2ZC4A 3K5PA 3I4PA 2HZCA 1F60B 2R8GA 2UVWA 4XIUA 1TV6A 5G4DA 4RW4B 2ZD1A 3RB3A 1HNIA 2IRYA 4O3QA 5KFFA 2ATLA 1SL2A 4KKOB 2Q43A 4J37A 4EU0A 5ADZA 1U24A 4GC7A 3Q23A 5CYQB 2FC9A 4HH0A 2AJ1A 3GB0A 3NS5A 3CSKA 4N8OA 3AH6A 3OBIA 2BV3A 1JKHB 2XBPA 4JI8F 4TYAA 4DLEA 2E5LF 1WHWA 3IG1B 4C8KA 1EP4A 3DHXA 1KOOA 2NXUA 3OTBA 4WK3A 4KHMA 3TA0A 2UP1A 2HLUA 4I64A 2YX1A 2QA2A 2HS3A 3MECA 3NWGA 4TU8A 2F40A 4F8RA 4URQU 2IYIA 4QU6A 1TQLA 2C2EA 3MZIA 3ENVA 1LWFA 1QLNA 2PC6A 1VLYA 4C3LA 4H4MA 3EZ5A 3MMCA 4BC7A 2DISA 2HRYA 2O1PA 3HHLA 3EUNA 5HMYA 1D8ZA 4ZPDA 4R5PB 5HMXA 1SH2A 4ECUA 2JFKA 4ELUA 2KFYA 3BN7A 5KOXA 3K5LA 2KO1A 2FLLA 2F4VF 4OZ5A 4PWDB 3I4HX 4QPXA 1HNZF 3BREA 2RS8A 4IG0A 2FJWA 5KTQA 1RYRA 2E5HA 4O44B 3SCJE 2MQMA 2AJFE 2ZE2B 1AXQA 2HVZA 1T3NA 4KGMA 2F8MA 4D3GA 5MAOA 3AQPA 4O0IA 1K73T 2Z2MA 1TAQA 1HA1A 3MD1A 1UA1A 5HMWA 4BC9A 3HKZD 2I2YA 3KLIB 2G9OA 5CD4H 2JLEA 5M2PA 4IFYB 3U02A 3KTQA 1RA6A 1NO8A 3PR4A 2PI5A 1WG5A 5M2UA 1GXUA 3OUYB 2U1AA 2XZWA 1JLGB 2RQKA 2WOMB 2HNYB 3LP1A 5C24B 2JDJA 3LP2B 3PIPQ 3KLEA 3MM9B 4Q8FA 4NLDA 2WCXA 4F4XA 4G3IA 2J9DE 2V2KA 5CH7B 2FVQA 4KB7A 4O3OA 4W90B 2VC0A 1CQMA 3KK1A 2A18A 1JXEA 1VK8A 3HI9A 1FVSA 4YQWA 2ILYA 2KZMA 3VAGA 3B78A 1FKPB 4I7FA 3CDUA 1YGYA 1JLQA 1VC5A 2D3UA 2JH3A 3FDSA 2F1FA 3ISNC 2NSCA 4F25A 2GMLA 4C0BA 3EPGA 2ASDA 1TFYA 5FLXY 1HARA 4C8MA 3OLBA 4RLEA 3E8OA 1QTMA 1DQ8A 1IUJA 1C1BB 1C1BA 4I67A 2HHQA 3Q8PB 4A8WA 4HKQA 3EGNA 2EBGA 4ATNA 3GYNA 1RT1B 3D0GE 4JI0F 1M1KT 3DLGB 1KFSA 2HNDB 3QJLA 3CTRA 3IO1A 2LVWA 1UJ4A 3T9ZA 4J9PA 4ZVFA 3U1LA 1TKZB 3HFKA 2JL9A 3H25A 1IR0A 2N3LA 2HHPA 3K5MA 2AJQA 3LQVA 5D4PA 2FDNA 3FSXA 4OI1A 3R5DA 4ZVHA 3E01B 2R7OA 4O23A 1MROA 1FEHA 5AXLA 4FBTA 1D8YA 2R8HA 3RRHA 3T5LA 2VD3A 4MIWA 2FY1A 1QJHA 3SQGB 3M9MB 3CF5Q 4UOCA 3BQ1A 4CT9A 1Y4ZB 2XULA 3R1HA 3DHWC 5A8WA 3GV5B 2Z0GA 1LQ9A 4TLRA 2BQUA 2R2TA 2YNGA 3AA9A 4TU9A 3B4DA 4LFAF 1AROP 4JUZA 2WB4A 4DSKA 2XLIA 2KH9A 2UUTA 3KK2B 3UNGC 1JLBB 2XMTA 4EBDA 4ED1A 3KHRA 1N6QA 4NLQA 2RSQA 2DNRA 4YR2A 1UVKA 3MTKA 2Z8QA 4YDDB 4IO9Q 2UUAF 3VAJA 4DV0F 2M8DB 1FE4A 1APSA 3FQLA 2A3JA 1S76D 4RW4A 2DT9A 2EK6A 1RAJA 1HHTP 1TL3A 1WD6A 5CHCB 5K8MA 4DS4A 4J9QA 4EZ9A 4GKKF 4ED5A 2W24A 1SJQA 2LYVA 2CJQA 2IM2A 4UUXA 1QY7A 3CCRS 2XMKA 2AX0A 4ZPVR 1TL1B 4G1PA 3RAXA 4DF4A 4ZMMA 5FDLA 2QZ8A 5IM0B 1RT6B 3EPIA 1S1TA 3LF0A 3VQTA 3BB5A 3H5SA 3SCLE 2K3IA 1EP4B 2N3OA 3CJKB 2M5YA 1VFJA 3CE8A 4PXBA 4UW2A 2FGOA 3O44A 2Z2LA 3E01A 1BQNA 4EYHB 1Y0HA 3KJVA 1S1XB 2RF2A 1FKOA 2RILA 2AQ4A 3FJ2A 1ZM2A 4KGKA 3CVKA 1RT5B 1WTFA 1FRHA 2DJWA 2R7WA 4A8XA 2W7AA 1URRA 1R3NA 3PY8A 2BANA 4C11A 2R8JA 1ZM3A 3N6NA 1YQHA 2GIRA 2PA3A 3QPIA 5LXYA 3KMQA 1WG1A 1HPZB 4TY8B 4N41A 3MMBA 3DDKA 4CH7A 4NLSA 3PRDA 2IBKA 4V19X 2YNFA 2VG6B 1KVIA 1S4FA 5C42A 1OS5A 2LMIA 2YX7A 1H7XA 5KFYA 5GMKa 1K0TA 4J9RA 2KVIA 1SKWA 1FTCA 1PSDA 2BW2A 4ZOSA 1U48A 2EFVA 1N5QA 4WIIA 3RB0A 1RYSA 1PO6A 4OZJA 4DSLA 3AHPA 2SXLA 2VQFF 2HS0A 3DRSB 2F9JA 4RU2A 4M1KA 4LUBA 3I5AA 1KQGB 4OZNA 1S0OA 1NRKA 2MQNA 1N0UA 1VQ4S 5GAEU 4B08A 2CPZA 4OX9F 3HMJG 4A48A 2HMIB 5DLFA 3ZZOA 2DNQA 5DGBA 1ZZNA 4FXDA 2IAJA 4KE5A 4QYRA 2K3KA 2HNZB 3OTDA 2YNHB 1B64A 4XDCA 3AQOA 4YUDA 4CTAA 4GO7X 5GAHI 2FHJD 3QJJA 3Q2SC 3T1YF 2MQLA 5DDPC 3CIMA 1DQ9A 2LQ5A 1CQNA 2XMVA 1VOMA 1JX4A 2PN6A 2AYBA 3LOUA 5SUHA 4DSIA 4LVOP 4IKAA 2XS7A 1HBMA 2AV5A 2DR8A 2YWFA 4M5DB 1MMLA 4NYOA 1N5YB 4LSLA 5CQGA 3PJXA 3KOAA 4C97A 4H4OB 1CLFA 1N52B 4O4RA 5AE2A 1IKVA 3GV7B 4QR1A 1E6YB 2RMLA 3J80Y 3ZFVA 2HW3A 2B4OA 2UV8A 1HWJA 4X4TA 2EG2A 3W3SA 4PPDA 2L9DA 5DS7A 5F8HA 4B3TF 1VQ8S 4PQUA 4QW9A 4ICLA 4JI2F 4ICLB 2ASLA 4F02A 4PXDA 3GMGA 2JEIA 4ZCLA 5J2MB 4PR6A 3HVTB 1NK5A 3HVTA 2IVFB 3VAHA 4NLWA 1DQAA 2CPHA 2XO7A 4USHA 3DOKB 2F8EX 2MHEA 2MB0B 1XR7A 3POTB 2W4PA 3POTA 3W7BA 2IC3B 3VR1A 3VAIA 3W2VB 5DDRC 3MR5A 3V81B 1S0MA 5HP1A 1HYSA 4B3OB 3K58A 1TL4A 2YKMB 4EUVA 1KS2A 5KFIA 1FDAA 4P7VA 3T9NA 4CO1A 2VBYA 3P6YC 4WFBQ 2H9ZA 3CULA 2JZ5A 2JWNA 5T41A 1N5VA 1NEEA 4QIWD 3THPA 4EBEA 1IQZA 4RBVA 7FD1A 1S9EA 5IT4A 3D2WA 1FJGF 3AAWB 1Q86T 2OSQA 3PZPA 1W25A 1WWHA 1X4FA 2YKQA 3TARA 4ECXA 1WTBA 4IRCA 2HPUA 4C98A 3TYTA 1M5KC 3SCKE 1NJYA 1VQNS 3U1MA 4H54A 4USJC 2DCUB 2ZH4A 1DBDA 1S72S 1QSSA 3KK1B 1TP7A 2MYFA 4ITSA 3C2PA 4PWDA 4FF2A 1JLBA 4Y3CA 4ZPWR 4X2BA 2HVHA 3TRGA 5B0FA 3KHHA 3PX6A 1MMDA 1K8AT 4YB6A 1RA7A 3IWNC 1ZAVA 2EG1A 3LANA 5DJBA 4Q44A 4DL0C 2V4RA 1TR0A 3CCQS 1FJEB 4YMEA 1F5CA 1XR6A 3L3CA 2GMJA 3CCWA 1TK8A 3NNCA 2YWKA 3FGVA 3N6MA 3S1TA 5HQ8A 4F4YA 2DGSA 2L9WA 2GFFA 2M4MA 4OJGA 3SXLA 4DBQA 3MDFA 4DL6A 4UY8T 2DHAA 1SJ4P 1SIZA 1X4HA 2EWHA 2J6SA 1R8HA 4NLXA 4HDGA 2HQ3A 3D54A 4TKTA 1ZYQA 4WJBA 2N7YA 4C0HA 2IM1A 5L1KA 5GVQA 1U09A 3GZ7A 1QAXA 1VQKS 4W92B 2M8HA 1P1TA 3HPOA 5EWFA 4AYBD 3S7RA 4H4KA 3FRZA 4DL7A 1R8BA 3DOLA 2BA9A 3RTVA 4Q45A 2J6TA 2XG8A 2RDIA 3KLFA 5F8LA 5HLFA 3I82A 4IFVA 2QSFA 2MPUA 3DOMA 2FHMA 4U7CA 1R31A 4DLGA 2GQQA 3G8SA 2CDQA 3IR7B 5E0OA 1HWUA 4N76A 2B3TB 3US5A 1TVRA 3MUTP 3HHDA 2VPXB 3K7RA 1U2FA 4DR5F 2K1RB 3I0RA 5EDWA 4LVNP 1Q16B 4KC5A 1WHVA 2GMHA 4OHYA 5KOWA 2LCWA 3OXGA 3OVBA 4ZPAA 1KOHA 2G0CA 3T1AA 4FPRA 1M5OC 4ZPBA 2KXNB 4ED6A 2HQIA 2IHR1 3VQSA 3OFHA 2IJNA 4FNIA 3C8YA 5LSLA 2YKMA 4ERDA 2GW8A 2KU7A 3MR6A 1SJ1A 1NKBA 1B7FA 4X4PA 3FMWA 5D6GA 1KEKA 3ISZA 2FGCA 5L1LA 1JJ2R 2Q6BA 3VTIA 5FD1A 1LKZA 3OUYA 3MPWA 2CG4A 4LIWA 3KLHB 2NSBA 5FDLB 3JTPA 5IM0A 3HK2A 1VQMS 1U1PA 2FHOB 4DWIA 3OPKA 2HIQA 2UXCF 1U25A 3HVWA 4B9SA 4DV4F 2ADCA 3QWUA 1N4LA 5I42B 1KTQA 3A8EA 3O2IA 3CB4A 3IRXB 2B4VA 2VA2A 2DGUA 4JV5F 2B43A 4WYLA 2UVRA 5F8NA 4LIRA 5HROA 1VBYA 2LXFA 2CPYA 2VC1A 3T5HA 3OTOF 1UJ6A 2HGLA 1JXLA 1G1XA 4JI5F 3NLCA 3GR1A 2HHHF 3N4WA 3JSMA 4EO8A 2EBEA 4AE5A 3D1OA 4ES1A 2IVMA 1KC8T 1EETB 3ZZUA 4KIAA 4CIOA 1UVIA 1V3RA 2R2UA 4LF6F 4A8MP 1QVGR 4Y0FA 1B0TA 2PSZA 2K8GA 1DJ0A 1IQTA