4AXIA

Structure of the clostridium difficile euts protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
TEESKQRVIQEYVPGKQVTLAHIIANPNEDIYKKLGLVLDKKDAIGILTITPSEASIIAADVATKASNVSLGFIDRFSGSVVISGDVSSVESALNDVLEVLGNMLNFSSTKITRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight Into the Clostridium Difficile Ethanolamine Utilisation Microcompartment.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Structural protein
molecule keywords ETHANOLAMINE CARBOXYSOME STRUCTURAL PROTEIN
total genus 27
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4axiA00
4OX7A 3BN4A 3DNCA 3PACA 4QIEA 3CGIA 3IA0A 4QIGA 2A10A 3SSSA 3SSQA 2EWHA 3I6PA 3NWGA 3MPYA 4P7VA 3SSRA 4P2SA 5DJBA 4LIWA 3NGKA 3H8YA 5L38A 4RBVA 4OX8A 4DDFA 4RBTA 2A1BA 4RBUA 3VCDA 4AXIA 2G13A 2A18A 3DN9A 4PPDA 4AXJA 4OLOA 3MPWA 3CIMA 4QIFA 3N79A 3I96A 4OX6A 4OLPA 4P7TA 4QIVA
chains in the Genus database with same CATH superfamily
4DXLA 4Q5VA 3G87A 5K8OA 2CPEA 4F02A 1WG5A 5A8RA 2CADA 1P8GA 1GT8A 2A3JA 2Q3PA 3MWBA 4MIBA 5IC6B 2EFVA 1C0TA 3OJSA 2VQFJ 2HRYA 4LF9F 4K0KF 3OJUA 1VYAA 3EM1A 4QR1A 1VC5A 5KT4A 5EWFA 5DO2A 4EGLA 3ETOA 1IVZA 4RW8A 3ENWA 2ZKTA 2QJ3A 3D4JA 3BO4A 3RR7A 2HGLA 2HVEA 4WCEQ 3Q8RB 2BJ9A 3NNCA 1N52B 1VJQA 5IWAJ 5E2QA 1FX2A 2WTFA 5BXIA 4OLOA 4K2JA 4EYIB 3S8SA 1WOOA 3PG9A 2W2PP 1P1LA 2WK4A 2NR0A 1XR6A 3LP1B 1KTVA 4EEYA 4KHPJ 4RUCA 2VDHA 1SL1A 1VK8A 1NB2A 1FEHA 4K8RA 1N33F 3G86A 4J90A 3IBWA 5ETTA 5KFKA 3PW4A 4RNHA 1FJ7A 1UJ5A 1TU0B 3P3DA 5K14A 1V9OA 2MJNA 1XMOF 1K8AT 2QZ8A 3LP2A 3G96A 2QLXA 2CQIA 1Q5VA 3TO8A 2JNJA 2N82B 2HNZA 4RNOA 3C16A 2XSFA 3CCQS 1APSA 1BQNB 4CNYA 1S12A 2CNLB 3DOMA 4OYZA 4ELTA 2G2OA 1AROP 1X9WA 1R31A 4LBHA 1NK6A 3T6JA 1EETA 4ZHRB 1X4AA 1YGYA 2J8AA 2YVSA 3G82A 4ED4A 3PZPA 3ENQA 4Q7AA 4WKYA 1R89A 4EBEA 1U49A 1CLFA 3MTJA 4CO5A 4BS2A 4NZ7A 2RRBA 1S5ZA 3KUEA 2V67A 4J9UE 3KG0A 4YMEA 4AQYJ 3TI0A 2HHVA 3DLGB 3R7NB 3D1OA 2DCUB 2PFDA 1WEZA 3W7BA 5JMNA 1HD1A 4NASA 3U02A 1KN6A 4DF8A 4C4WA 3DFEA 1TUVA 1LWEA 2EFGA 3PR5B 2OD6A 5GMKa 1NM2A 2GJ2A 4KB7A 2QA2A 4EO6A 4QPTA 4YHHF 2FJVA 3Q8VA 4B9MA 3PTWA 5CABA 1U24A 1TK0A 3MAAB 4IKAA 2P6TA 4AXJA 1TL3A 3T5KA 2QL9B 2FLLA 1JLGA 2ACYA 4HI1A 4DR1J 2AQ4A 3HO1A 3HK2A 3PXGa 3KJVB 3QO9B 2FD2A 3CJ8A 4U95A 5B0BA 1EAYC 4YN3B 5AXMA 5DETA 1AZSB 1KQKA 4IOBA 3Q8QB 4PG5A 3OUYA 2HHPA 3UQSA 8AT1B 3Q23A 1IBMF 4ZP7A 2A6OA 2W4CA 1LWEB 4LQ9A 5KG7A 1KBRA 3NCQA 1KP6A 1F5BA 4EUVA 2IA6A 4EZ6A 3GG0A 3QFHA 1X60A 1U1PA 1FRMA 1BGXT 3LAKA 1IQZA 2DNRA 2ZH7A 1Y7PA 2WCXA 1F5AA 3MCMA 5C25B 1RHRB 3M30A 1IUJA 5D3GB 2FVCA 2C3UA 1C0TB 4JP8A 2DR7A 5J2PA 3D6HB 2NSBA 2OI2A 1UVLA 1TL4A 3MEDA 3CDWA 4F3QA 1OJ4A 1U8WA 2IVFB 1XQIA 1WKLA 2YY3A 1NKEA 2E7XA 2G1HA 2OFGX 1O5JA 4C8ZA 3GFXA 3F41A 1RYRA 2U1AA 4OI1A 2R2UA 4DV1J 4NYOA 3AD7C 4WIQA 1XERA 3PDNA 1HR0J 4QIEA 2M5YA 1FRKA 3OTOF 4JI7J 4ECSA 2OO4A 2V8PA 4O3NA 4IOAQ 1VIXA 3MPYA 2BYCA 5G4DA 2IVMA 3EX7B 1H6KX 2DNQA 4KE5A 1X7VA 3M8QA 4DV6F 2DO4A 1C2PA 1JIHA 2YKPA 4OX8A 5K14B 2HQDA 3EVMA 3KNAA 2B5JB 3M9MB 2MDAA 3MCOA 1TKTA 5KFZA 2FJAB 2I38A 1HD0A 3M2VB 2DT9A 3B54A 1FCAA 4H4KA 4LFBF 2I1RA 2YNHB 2LQ5A 4O3PA 2Y1LB 1PAUB 3BYRA 4URGA 5B0GA 5HQLA 2L3MA 2LA6A 2RHSB 3OUYB 1V3SA 3KTQA 2HZCA 3AA9A 4P7TA 2F1FA 3NAHA 2AZ1A 3MM5B 3GV5B 4CWBA 2CZ9A 4O23A 4A8SA 3PYGA 1JLCB 3UD4P 3TZYA 2VBYA 4QIGA 4WFNQ 3I5CA 2D3O1 4G3IA 2XQCA 4K5RA 3QRQA 1MWZA 2YQ3A 1KDNA 4EMDA 1MN7A 2ZZMA 1VS3A 3DGPA 3KG1A 2DCLA 2PMHA 3W5ZA 2L48A 3GU0A 2QL7B 3DDIA 4Z7YA 4OJ1A 5IS2A 4F04B 2AEMA 4F0HA 1F0XA 3EPIA 3BSOA 5I4MA 1BE4A 1UVKA 2DRAA 3M6UA 3AHPA 1U2RA 2H51B 2XEXA 4NA3A 5GVQA 2AIRB 3KLEA 4DV3F 4OZLA 4ZCIA 3P96A 2BRLA 2GO8A 1RBOB 1FF2A 1SPBP 3CJRA 5E3AA 3GIMA 1XC9A 2QO3A 2VFRA 3AY0A 3G8QA 4NMLA 5ETMA 5J2MA 1NHVA 2PI4A 5L1LA 3L95X 1IN0A 3DRXA 3W8GA 5KFBA 3CCUS 1T9TA 3TYTA 2HYIB 3BN4A 3H2LA 1VLOA 3A3PB 3EGWB 3IWXA 5H9FJ 2NS1B 1UMJA 3I56S 4KGKA 2WBMA 3IR6B 5K20B 4ECTA 5D4PA 4ES2A 1J5OB 3WC0A 1RU2A 4RNNA 2I5JA 3I6PA 3MCSA 1WSRA 3QSYB 3L9ZA 1RI7A 2B9XA 1P27B 2FC8A 3H59A 3C3LA 2RU3A 1ACMB 1FK9A 1CJVB 2OPPA 1UEUA 3ULHA 2C3PA 2YWKA 4G65A 5KFAA 1IKYB 3ISND 3J81U 1S1TA 3E3XA 5D4LA 3LALA 2DIUA 2V2QA 4FKXA 4G1QA 1EP4A 3LP0A 4NLRA 2AGOA 2OHDA 3M2RA 2EBGA 2BJ3A 1XN9A 1RTHB 3IBCB 3TAMB 1UFWA 4X66J 1S1XA 2XSJA 4C0BA 4RNFA 2QFJA 1NPPA 2LQBA 2Z58B 3D5MA 1BD6A 4FPIA 1BC6A 2VIHA 4WZMA 3MUTP 2J9DE 4FYVB 1HQEA 1KTQA 1S1XB 2W9AA 3S7RA 5IWAF 1M5OC 2UUAF 1G6BA 2QFIA 4DR4F 3VVUA 1VQYA 2HQIA 3FMBA 3LGMA 4KAIA 4LFCJ 4OYOA 1RUSA 2QLFB 3ZNUA 1PGZA 1ULRA 2G9OA 2MZQA 3AXKA 5F8IA 2W8LA 4EYHB 4DLGA 2VONA 5ETSA 4DR3J 4USIA 2FHOB 3H98A 1Y0HA 3OL6A 4PWDA 4LF1A 3ETMA 2LQ8A 4DZDA 1VBKA 4CH1A 3K5MA 4GKKF 3GCXP 3UN3A 1FDDA 2W7PA 1HW9A 1XTZA 3SCKE 2KYXA 3TVZA 2IM0A 1T05B 2RKIB 2G13A 2CPJA 4B02A 2B4UA 1RBAA 1AUDA 1AUSL 1Y9OA 2LXIA 3NBPA 2GGPB 1H2VZ 3Q0AA 5A8KA 2KN4A 4E98A 4LFAF 5ETQA 4EU0A 2YKNA 4QW9A 1V5VA 3B4MA 4IFVB 2FHKA 5KAKA 2MXYA 2RE1A 4CTAB 2KXHA 3RB0A 1QE1B 2VPYB 2PDAA 2M88A 1L3SA 1AW0A 2HGMA 1Q82T 2YX4A 4W4MA 5CCMA 5KFSA 2F4VF 2CQ2A 3JQMA 2JHEA 3IGNA 2W9CB 3QGHA 5CYMB 2DKOB 2ZWPA 3P45B 4RWWA 4B3MF 2GX8A 2QG9B 4JI0J 4XDCA 4IYQA 3PY8A 3UVJA 4TNOA 1X0PA 4HACB 3M32A 2X1GA 2KB2A 1WF2A 2JC0A 1VRUB 1FRLA 2ZKUA 2PA3A 4J9NA 1FKAF 3DN9A 1K73T 4PPDA 3CC2S 2HAFA 2HNYA 5KG6A 3TEHB 3KHHA 2F3JA 2O3DA 1HI0P 2YNHA 3IAM9 4J7CA 1BUXA 3EXCX 1EJ7L 1LKZA 1H38A 3CCVS 2HMIA 3K2YA 4O3OA 1IJFB 1HWJA 1MMDA 2AZ3A 2Z2ZA 3RAQA 4OHYA 3OR1B 3TQEA 5ADZA 2LQ9A 4KGVB 1FDNA 3GCWP 2A10A 5KFNA 1HKAA 1UW9A 4NZ6A 3TNVA 4X62F 3TUPA 2E9ZA 1FTRA 2VG7A 3NGKA 2QT7A 4CM2A 1RCOB 4NRTA 2GJIA 4F2RA 1RWXB 2H9ZA 4NMXA 1JLAB 2QLWA 3IXQA 3L09A 1R3NA 1UZDA 2K3IA 4NLXA 1R27B 1Q79A 2OMOA 4URSA 4LBPA 2N4CA 2KDOA 5HVFA 2ZBRA 4B08A 4RUHA 2R3VA 2ZH5A 1S9FA 4C8NA 1S97A 3O44A 4XDDA 4IRDA 2H1YA 5D77A 3CJKA 4ZN1A 1IKWA 1RTDA 4ECXA 1IXKA 5SUHA 3W8PA 2MKJA 2KFZA 4M95A 1K9MT 3D54A 2B9YA 3NLCA 2UUBJ 4D3HA 4WXWA 4ETXA 1XJWB 2EVZA 4ZVEA 1CPZA 1SJRA 2D9OA 4DZ6A 3BS9A 1RLDA 3SSSA 3LWLA 4OZ5A 1B0VA 1ZA2B 2ZVIA 1K0VA 1VRQC 1JB0C 1HR0F 1QAXA 2GCFA 2YQ0A 4NE9C 3CDUA 2ZM6J 5L1IA 1XNQJ 1XIQA 1M5PC 2E66A 3MEGB 2JRSA 4LJMA 4X4QA 2WZ1A 2A1BA 3N01A 4OZNA 4C8LA 4F4KA 3J80U 2IBOA 1N5SA 1CULA 4LSLA 1IKXB 3QSIA 3QJLA 4H4OB 2ZC4A 2QTWA 2FJEB 4QIWD 1RT2B 4ZPVR 1V3RA 2PD1A 4NA1A 3MM7A 3KLGA 2MLZA 5EWGA 1R8HA 4LIRA 4N5SA 4ZVUB 2R7UA 1RU1A 4LFBJ 3MAAA 2YTCA 2C2NA 2IYIA 4J5OA 3DNCA 2BA9A 4TN2A 3VALA 2DY1A 2DNKA 2XMJA 1EKRA 3JQKA 4CYUA 4ZVQB 1VGYA 3KLHB 4JI1J 4TU9A 1LFPA 2VASA 2RF2A 3Q24A 5DG7A 1GTHA 4DR6J 1U1OA 4C8YA 5CA5A 1BXNA 3DI6A 4DUYJ 4NXNJ 1RT5B 2GA7A 2X51A 3DLGA 2MZRA 3M8QB 5M2RA 2A0FB 2XCAA 3CCES 2BQRA 1M1KT 5DM7Q 1RDRA 2M70A 1SV5B 2WSCC 2R8HA 4J9MA 4A47A 2NZCA 3QATA 3IG1A 4WFAQ 1TMJA 2Q43A 2BW7A 1SQFA 2HG4A 2VUGA 2V50A 3M6XA 1Q95G 1NK0A 1WUUA 1YQHA 1FWPA 4ED6A 3BKUA 5KFYA 3I4PA 3MDFA 3MPUB 5LSOA 8ATCB 5T14A 4LVNP 2J9CA 2EW9A 1TUWA 2OP5A 4M5DB 3AJ1A 1F9EB 3GYNA 3DLKA 2KTQA 1RT1A 3POTA 2LU1A 3AD9C 3GIIA 3DOMB 2MEWA 1RWNB 3HT0A 3KLEB 1RK8A 2HWIA 2J6UA 1SIWB 3OTEA 3CGIA 1RTJB 2BANB 4WP8A 2RQMA 2HNZB 3KJQB 2VOPA 3R5DA 4RW6B 2CJBA 2CPZA 2G0CA 3OFGA 1S99A 4N7TA 4HDGA 3S1TA 4IH6A 4ZCLA 2RVJA 4M5LA 2AD9A 2YKOA 2B6AA 2ATCB 6FDRA 1ZM2A 3FK4A 3MXHP 1KQGB 5D8HB 3T1YF 3QIDA 2YNGA 4X65J 2J9DA 4DUZJ 4I7FA 4ZP9A 4DPYA 1T3NA 3MM5A 2Q66A 2DNOA 3I31A 4DPWA 2M4MA 2VU5A 4KFBB 4XTTA 3GLJA 1T7PA 1TFYA 3FBFA 2V68A 2DGWA 3V6KA 3HHDA 5C42A 3R1LA 4JI2J 2WSFC 3HSJA 3C66A 3MGJA 4MK7A 3W2WA 5E3CA 4QW8A 1X4BA 4IOCQ 4I7FB 5D0HA 1FJCA 2HVIA 1Q53A 1NSQA 4D3GA 2B6AB 1VQ8S 4ZVRB 5EHHA 2R8KA 4NCAA 2F8HA 2GIFA 1FFWB 2ZOFA 1K1QA 5A76A 2MKKA 2DR5A 3W65A 1QSSA 1KLMB 2DNHA 2VA3A 1N5YA 2LQJA 2W9BB 1DLOA 3PX0A 4DQIA 4NLGA 4ZIWA 2JL9A 3NMRA 4DV2J 5LL6d 4TY8A 4B9TA 1UP1A 3GFZA 5D78A 1OIAA 4CLFA 4PAAA 3GSDA 3MEEA 2VG5B 2UUTA 4WK3A 2GZOA 4MAKA 4J9QA 4URQU 5HBMB 2Y1JA 2XS2A 3TAQA 2V2VA 1LK5A 1Q7LB 5CCLA 1H98A 4K4XA 4ID5B 4DG1B 2Y3YA 1VK3A 3AQPA 1U2CA 3R7SB 2XZDB 1LW2A 5J2PB 2W7OA 4JI3J 3PACA 4C98A 2VODA 5D4OA 2HQFA 4LFAJ 3EZUA 2MZJA 2DRDA 3RG6A 3HX9A 3WIUA 4WK1A 2AF6A 3CF5Q 1QVFR 5I3UB 3NS6A 2EK6A 4USMA 3SQGA 3GIKA 1U6FA 3JTPA 4WYWA 2KHCA 3LPYA 3MMBB 4J9RA 1W2BR 1N5YB 1H7XA 1L3TA 3HVRA 2C3YA 4DHVA 2ALZA 2HBRB 2ZITA 4TVAB 1MROA 2DXFA 4CYUB 2MZSA 1SKWA 1RJJA 5F8JA 2E5LF 2B4OA 3SYZA 2UV8A 4LR8A 2V8GA 3Q89A 1QLNA 2ZHOA 3IS9A 3ZNJ1 4QIFA 2JWNA 4KRWA 5F8HA 1BWVA 4A8WA 1WTBA 1Q4RA 1NK7A 4ERDA 1KVIA 3FEZA 4MIWA 1E6YB 4LF7J 5E3PA 5FDLA 2MTLA 3MM6A 4HEA9 3MHYA 4HT7A 3R7BB 1F60B 4KHRA 4LR7A 3ZZ0A 4ZCKA 1HHTP 3W3SA 1UJ6A 4WFYA 3ZZOA 3RB4A 4ZLLA 1ZZFA 3GV8B 5K8MA 4RW8B 3TP2A 2LXFA 5IT9U 2NQPA 2KJWA 1RAAB 3CCJS 1RHKB 3BYPA 2XBPA 4B9LA 2IM3A 2SXLA 2J76E 2EG2A 1T9VA 3BEGB 3K17A 1WC0A 4FKYA 2Z2LA 2R7WA 1DRZA 1X4EA 3HHLB 1R7IA 2V34A 4PEOA 2E9TA 3RU0A 3KG4A 3G8SA 1N5TA 4M5DA 3CMAS 1TV6B 4QZVB 2AJ1A 2BMBA 2D3ZA 1S4FA 4MJKA 1B3TA 4PXDA 5HMYA 1FFSB 1BMQB 3OTBA 1VQNS 1UCNA 2NZ4A 9ATCB 9RUBA 5DQGA 4F36A 2RUGA 2WB4A 3PJWA 3RZAA 2ASYA 3LQVA 4YY3J 2KVQE 1CS4B 1LQ9A 2I0XA 2XYPB 3CMES 2R8JA 4MKYA 4NXMF 3GR0A 4GMKA 1YSJA 4UW2A 5KG3A 1RAGB 2AU0A 4P72A 2CQCA 4I6WA 3T9NA 2B4PA 1XMBA 4JI0F 3VF0B 3ZFVA 5JUMA 4B9UA 3EGZA 1OMSA 4ZPWR 5IOLA 2DGOA 2XS7A 3DRPA 4BC7A 3VAJA 2FVRA 1ZAVA 2QEXS 2QLBB 5I42B 1LXJA 3IRWP 1QJHA 2CPIA 5D15A 2CKWA 3DLEA 2ROEA 2ZUAA 3OSNA 2CPHA 2FIUA 4DLEA 4OIXA 2ZC3A 2R7RA 5LXYA 3DRRB 3DMJA 3IA0A 7FDRA 2CJXB 2PN6A 3GE9A 1VRTB 5BJRA 5C2CA 2FZGB 1PYTA 1VQMS 2LA4A 4RW9B 4Y2KA 3UD3P 4ETZA 1YX2A 2KRBA 3C6UA 4CLSA 2R7OA 1NK8A 1SKSA 1RABB 4C8OA 3FSIA 4AL5A 1X0FA 4IH5A 2FJXA 1RGVA 2IBKA 1Q86T 2JJ4D 4RBTA 4X2BA 2F5GA 4DN0A 1I94F 1EKSA 3ICLA 1B0TA 2OPSB 2DR8A 3NCRA 4Z2XA 4YP3A 2LMIA 5KFDA 1KOHA 3UCZP 3NS7B 3E01B 4DUTA 1ICEB 3RBZA 4DR4J 1G1XA 3VVTA 2MQQA 3WX8A 2RQKA 2IM1A 2BQ3A 4J91A 1T05A 3AFGA 2WVFA 1RWKB 4ZPCA 2GMLA 1G3OA 4UZBA 1RWOB 1LWFA 2ABYA 2MQ8A 1FDAA 3BM7A 3FDSA 2Z57B 2UXCF 1FKPB 4BDPA 1CC7A 5DLFA 2DRBA 4NWBA 2KT3A 4KYZA 4WFZA 4FXDA 2ZNZA 4PXEA 1J5EF 3CCWA 5AT1B 4LRCA 3GJSB 4F3OA 3H90A 1HA1A 4WXOA 1R43A 2NCKL 4ECUA 3CC4S 3DRRA 2FHJA 4OX9J 4FPRA 1ELOA 4LQ3A 1TKZB 2RRAA 2EFPA 3SZ2A 3RRHA 5B0DA 1BLUA 5FD1A 5DGAA 4Q0BB 4LF6F 1NCLA 1FA0A 4HR2A 2CQ0A 3KDOA 5T7LB 1TL1B 1IBLJ 1S79A 2CRLA 4AFFA 1CJVA 2OPPB 1S76D 2E29A 3KMSA 2IRYA 2H4YB 2VV5A 3MF5A 4JV0A 1BWEA 4FBUA 1SC4B 1DJ0A 3QQCD 2RT3A 1QUPA 4BWMA 1FE4A 1U0HA 2C2KB 3AH6A 4XIUA 4RU2A 2ERRA 2EXUA 3BGUA 2E5HA 2CQ3A 3QRPA 3ZZZA 3HZGA 4O44B 2XWXA 2HHSA 3I4HX 1SI9A 4MYTA 1CJTA 3TZXA 3VAMA 2HPUA 1JLQB 4Y2IA 1GNKA 3BQ1A 1T8EA 2AYMA 2R7QA 3EDRB 2GNKA 3NXZA 1UWBA 3C46A 1Z2LA 1YJ7A 3FRZA 4CI0B 1FRIA 3R5GA 4ER8A 1S72S 2PI5A 1W2IA 4CH0S 1D1UA 4LSNB 3W66A 1N5QA 3GMGA 4MYUA 3C6UB 5A8WB 1KC8T 2DPJA 1UZHA 5JVGQ 4OHWA 5KTQA 1Y4ZB 1K47A 2DIVA 2W2QP 4DDFA 1HBOA 1DTTA 1MLAA 4TU8A 3J7ZT 3CCTA 1UL3A 1KKHA 3CCZA 4DV4J 2B4VA 2M52A 2BM0A 4AXIA 1RAOA 3NOCA 4YFUA 1UEKA 5AJ3F 4DCJB 4O3RA 2IJRA 4TKTA 3T6BA 4YQWA 5I42A 2ASLA 1FJGJ 4S0MA 3OFFA 4RNMA 4ILLA 2DK2A 1KONA 2DNNA 4NLQA 4FS1A 1HQEB 5CQGA 4WWSA 2Z8QA 2RQ4A 3N6LA 3EMTA 4JI2F 4JI6F 4J9OA 4JYAF 1RWWB 2WW4A 4K0KJ 3TUIC 2P9EA 3M8WA 2XSJB 2XGPA 4KHMA 4UQGA 4CLYA 1S57A 2V94A 4OHXA 2QA4G 2BKNA 2FJBB 4L72B 3CMQA 2V8VA 2HHQA 4P6QA 3CT9A 2MHNA 4PKDB 3KYLA 2ZH1A 3HHKA 5KG5A 3MMBA 5CHCB 2DR6A 1U8SA 3H25A 1KQSR 2CQDA 4V19X 4WF9Q 1OPZA 3CJSA 3CTRA 1LW0B 1LWFB 2HEKA 3CNQP 2AX1A 2Q6CA 2VG6A 3FFIA 5BYQA 2QSFA 4X4SA 3FBCA 2X3GA 3VZHA 1U45A 1SL2A 1JX4A 4DSLA 1PCAA 1SJQA 3FCWA 4NYPA 2N7CA 2CQPA 1LOUA 3M1VA 7FD1A 3ZO7A 2V0NA 1D8ZA 2HLTA 4ID5A 4C0HA 4DG1A 3MEDB 3HFKA 4Q8EA 1NH7A 2F8EX 5GAGI 5CXTA 4QYZK 2CG8A 2AJQA 4KPYA 3IWNC 1H3DA 2OPSA 2MKHA 3M30B 3ZZYA 2VH7A 3DRYA 3K8WA 4U7CA 4WFBQ 2MGZB 5HP1A 3HVTA 4CLUA 2VBZA 4GO5X 3QIPB 2Y1RI 3OQ2A 1H73A 4PQAA 1ZYQA 1CQNA 1KVKA 1RISA 2AJ0A 2PGCA 1RSCA 2ZBQA 1DBDA 1G7CB 3C6TA 3KK2B 1NH8A 2QYGA 3HSZA 1SKUB 2P2CB 2ADBA 4U7UK 3ILOA 1NJWA 2JVRA 3LWMA 2DNGA 2UXBJ 4CLWA 1S49A 2Y0BB 3MMJA 3RAXA 1IM6A 3PRBA 5DLGA 3I55S 2KH9A 3ILJA 1X4GA 4LR9A 3KLFA 1U25A 3W2WB 5LMUJ 1D3WA 2P6SA 4FXWA 4K5SA 1QTNB 4OI0A 2RB7A 4ANCA 2C22A 3K5NA 2XHCA 1R6VA 2E1AA 2ZZTA 3BDEA 5L1JA 4FF1A 1HYSA 2RNEA 1P9YA 1VMBA 2W24A 3FRYA 2JDJA 4LF7F 2YWFA 3H2VE 1EARA 4QWEA 4YHHJ 1RAFB 2G4BA 3JQJA 1EZZB 3QIPA 4CH7A 3BR8A 3QWPA 2IC3B 2LEBA 2HZAA 3RUBL 1SC1B 2CWXA 4KPCA 3M6VA 2QN6B 4C11B 3RJMB 2IHR1 5H9EJ 2J7WA 4USUA 3WBZA 5KFQA 3I0SB 1AXQA 2FLNA 4B3TF 3QJJA 1YBTA 1ZAXA 2DXEA 2VDIA 4OYIA 4YS2A 4DV5F 4KKOB 2MQOA 3ZXWA 4ES3A 5HBMA 4LREA 2RMLA 4KO0A 2ZOMA 3OPKA 2J0WA 2VB6A 2NUHA 3BGFA 3QT8A 1M5SA 3GR1A 2YBVA 3BH6B 1PJ5A 2HAIA 2MJUA 2XMTA 2ZJQQ 4HYKA 1L5UA 4B3RJ 1NHKL 3I0SA 1N0UA 1C0UA 4FXVA 3AT1B 3PIPQ 1IBCB 3IG1B 3NWGA 1ZZNA 4JB8B 4IRCA 3HDSA 4PQUB 1DTQB 4V1Ak 1RAIB 1LWXA 3LP2B 4EWTA 1T95A 2CJQA 2XCPA 5IC4B 1MN9A 2V8HA 3DI6B 3ISNC 3J81Y 3V81B 3UR0A 3TWZA 2RILA 1HNWF 3EUNA 2Z56B 3O8WA 2XYGB 2ZJPQ 3MM6B 2QL5B 2GAHC 4IG3A 5F41A 2H3EB 5J2NB 4F7VA 3EVOA 1YRTA 5C42B 4B9VA 1AZSA 4IR1A 1XR7A 4QR0A 4ECWA 1QAYA 4USKA 2BDPA 2LEAA 2GS8A 4KR0B 4UOHA 2ZJRQ 3KK1A 1MWQA 2Y0SD 3AOBA 4HHJA 4U96A 1JLGB 4JI4J 4RJVA 2RDDA 5F8MA 2CPDA 2EFOA 2BVZA 4NLTA 3DHXA 1FRHA 1UTAA 3D1QA 3TJ8A 4JBCA 5IQ6A 1U1NA 3R6LB 4N56A 4USJC 2GO9A 3ILIA 4LRAA 4OZ1A 4OYMA 3TVYA 5HJYA 5JJBA 2XY6A 2NLWA 4DPTA 4PQUA 1FEEA 1RZMA 1IBLF 2AJFE 2LU2A 2FGCA 4RW4B 4ZCMA 5I3UA 3R5JB 4AUKA 2CDRB 3O6QA 4ZLPA 2MPUA 2BE2B 3HVTB 1O6XA 4DX7A 2FJDB 3DLKB 2H54B 1FKOA 3PKYA 3LF0A 1WHXA 1KSPA 4HH1A 5EDWA 3GB0A 2OPRB 2V4JB 1NK5A 1RHJB 3CD7A 1I94J 1GH8A 3A1YG 1PAEX 3DU6A 4MKAA 5U47A 4OLPA 1QM9A 3VGUA 4IO1A 5B0EA 3JYTB 1ZM3A 2HKEA 4ELVA 4WFXA 2FY8A 1X4DA 4AE5A 3MECB 4UT4A 2VICA 5L1KA 5J2QB 4KQZA 1NAQA 1WC6A 2DXDA 3Q8UA 5C7PA 4OYAA 4U8VA 2M8DB 4O4RA 2XB2D 2RF2B 1VISA 2KRRA 2XGQA 2R7SA 3PYFA 4K2XA 5ETVA 1N54B 4UOFA 1A0OB 5LM7E 3OHAA 5AE3A 1YJWS 4QYZJ 2YWWA 1OY9A 2P5VA 5KFEA 5A2QU 5LMNF 1QDUB 3CJQA 3GIRA 2NXEA 4OYWA 4AD6A 1J5EJ 4MTPA 1WDTA 1TKZA 2HHHF 5L9NA 1HBUA 1SCJB 2YWGA 3CD6S 3N4WA 1BY9A 1RWPB 4H4OA 4KH0B 1NDKA 1U48A 2OAUA 4J9PA 4RW7B 3NL0A 1S1UB 2XZWA 4I6YA 1FJGF 3VR1A 4Q2LA 5THWA 3M4XA 1WKKA 1Q5YA 1YWXA 3C6TB 1HPZA 3AB2B 2PMZD 1YJVA 2UP1A 4OJ3A 3KUGA 4DS4A 1XWLA 5BR8J 2KZMA 1X31C 2C3MA 4P2SA 4C7QA 1CJUB 4GVBA 1ZS6A 2ZWOA 1R8CA 3A8IA 3RRGA 1OY8A 4C9DA 2W9CA 1U4BA 1SQEA 4NL5A 1S9EA 2JFKA 2ZOGA 3B82A 1J2VA 2EEYA 2GMJA 2DNZA 3CEDA 3FBEA 5KT6A 4FS2A 1NKBA 4DR7J 2BANA 1RXOB 4RLEA 2P8IA 4IFVA 3CJKB 2ACMA 2XMVA 3KJFB 1YZ7A 5MLCV 5A2QY 4DPOA 3AB4B 3MAHA 3CXCR 4X64J 2DHGA 2FB0A 2I9SA 5E33A 2VC0A 2IYGA 3ONQA 3PEHA 2CPXA 1JJCB 1LW0A 5KFHA 3CW2C 1OY6A 1UVNA 3GV7B 1DQ9A 3SCIE 3M8RA 2Z2YB 4MFBB 2W2OP 3BREA 2CJAA 3K7RA 2D7SA 4RUBA 1VBZA 1F3FA 2VG7B 2ILZA 2MQLA 4E0DA 1T9YA 4LIWA 3P49B 4K4VA 1UJ4A 3JS9A 1RT5A 1VRTA 4ITSA 3D0IE 1OYDA 3DDNA 3KLIA 3IP0A 4UUXA 5LXRA 2X1FA 4PXCA 2HHTA 4ECVA 3D3CJ 5AXKA 3ITHA 3OV7A 2DPIA 2W01A 4HVZA 3THTA 4I2QB 4WIIA 5KT7A 5MAOA 4LF8F 1AT1B 2A2DA 5K8PA 2HNYB 1XMQF 2YH0A 1CG2A 2C2ZB 3DRPB 5AJ3J 1G2EA 1T9XA 5C24B 3AXMA 3AOAA 1N5VA 2E5GA 4LF5J 4ECYA 2HVHA 2Z4PA 2HHWA 2WHOA 1U6BA 2F4VJ 4A4JA 4V19J 3CD5A 4BBYA 4OYPA 5FIIA 1N0VC 1CBKA 1KHVA 1Q0NA 4FVCA 4JI6J 3G6ES 1CS4A 3D0HE 4DFKA 1ZA1B 1FWKA 2R9LA 1IKYA 4DR5F 1WC3A 4CNZA 1RT6A 2GHWA 2HIQA 2W8KA 1L3VA 4A48A 3AJDA 4RU9A 3L7OA 4IH7A 3K89A 3LPEA 3R2CJ 4CTAA 3M2UB 1NPKA 4CM0A 2XNRA 4DR2F 3VCDA 4KIAA 3UDVA 1WHVA 3V2UC 4KHPF 2V6AA 4OZJA 4PRFA 2M3DA 1HI8A 2PE8A 3LANA 5D0GA 2LLZA 2V4RA 5IQQA 3BDPA 2XS5A 4RWXA 1DQ8A 4YB7A 5LSRA 2FC9A 2ZE2B 3W9IA 3D68A 2N3LA 3LAMA 2N3OA 1NK9A 1PC4A 4N77A 1HWIA 1CJKA 3C14B 4F0KA 1JJ2R 3HULA 2ZVSA 1ZPVA 2PSZA 3FCVA 2E1CA 1KHWA 3P6YC 1BQMA 2PC6A 1CVJA 1Y3KA 4ED2A 5J2QA 1QUVA 1M90T 1OQ6A 3SSRA 1NJYA 2DEJA 3ISZA 2O5DA 4C3KA 2W1BA 5F9NA 3MR2A 1HBNB 1VQSA 4ID8A 4ZLJA 4P2MA 4OZ2A 4F50A 1MU2B 3PX4A 3FSYA 2ZZNA 1S9GB 3VAKA 5KT3A 2JH3A 2XLKA 1KNZA 2FHJD 1A9NB 5FLXU 2DTJA 4BHQA 2NSCA 1MMLA 3EJMA 2R2SA 4QR2A 2QV6A 3BJYA 1HW8A 4NEZA 5M2UA 4DFMA 1TK5A 4Q2MA 4DCOB 4WE1A 2Y8YA 2UXBF 2ZHAA 1RTHA 2HNDB 3GZ7A 3NAIA 2UU9F 1SC6A 1GXTA 4L76A 4QU6A 4X4NA 2LDIA 3BO2A 3MCNA 1U2FA 2R7VA 3K5OA 4HL9A 3NY0A 1HBMA 2O66A 1HQ2A 1U6ZA 2KO1A 2OELA 3NEKA 1FKPA 4FP9A 3JXOA 3ITHB 2BM1A 1R8AA 1PC5A 5KFTA 1FK9B 4TQSA 3BPSP 2VL1A 2ADCA 2OEMA 3QT7A 3UVJB 4C0OC 3J7A1 3KNGA 4K50A 2IIHA 2FLOA 4Y00A 4IDKB 1NJIT 4P75A 4B3OA 2K3KA 5CYMA 3T19A 1FX4A 1Y10A 3BSCA 3HF5A 3WHIA 4FF2A 1MSWD 2HBZB 1D0EA 4Z37A 3QT5A 4KGXB 4MK8A 5HN0A 1MG7A 2DGUA 2E5IA 2DGQA 1IBMJ 2C2MB 1RHMB 3SV4A 2ZBCA 3W64A 1ZBTA 4ZIVA 1HWLA 5F8LA 4ZITA 2VZ9A 4B3TJ 1S7IA 2VG5A 4QU7A 3EGNA 5EGYA 2HVDA 2HURA 1ZH5A 1K44A 1J5OA 4DR6F 4DQQA 1FHTA 2UXDJ 1S10A 2ZBIA 4DUYF 1UETA 1RHUB 2CAJA 4GRSA 1F2HA 1SUQB 2CPFA 3BPDA 4EZ9A 2R8IA 1Q16B 3VTIA 1NK4A 2QC3A 3L7PA 4LRDA 2E1RA 1YJUA 3D2WA 2XI3A 5KG1A 1X5SA 2LYVA 5L9XA 2F40A 5GMDA 3BZQA 4F3MA 3EPGA 3T3FA 1JXLA 2DD8S 2E7VA 1WG4A 2DNYA 3A4TA 2AYEA 2VBXA 3BGRB 3THPA 4ATNA 2KM8C 5AE2A 3BSNA 3SCLE 5B09A 4DSJA 4U8YA 2D3UA 2RRNA 1YTYA 2MMYA 4KT0C 2K8GA 2AKWB 3MURP 2GVZB 5KFWA 3PVXA 1VQKS 3I82A 3DGVA 2NXCA 3KJVA 4DL0C 2JX2A 1S1VB 4L6V3 4DL2A 2CNOB 1OWXA 2H4WB 3BGOP 2XMWA 2MHEA 3IS9B 2F9JA 3GILA 3TW0A 1TQLA 3S01A 2OH2A 4GVLA 5KOWA 1N88A 5FJ4A 1VC0A 1UW4A 2ZH2A 2CZVC 2DH9A 4JI8F 3T1YJ 4NOHA 2MKYA 2W2NP 4U9RA 5ETKA 5L39A 3CVKA 3I5AA 1RTJA 4MKVA 1QAIA 4K4ZA 2CG4A 2DJWA 4CIOA 3SIPB 1HNVB 2I5JB 3D6MB 1XNRF 4F26A 1YHQS 1URRA 4M1KA 4DMZA 2BABA 3BBCA 3I5BA 1SJ4P 2LECA 4QPXA 3R9LA 2DH7A 2AX0A 4XK8C 4YEAA 2KHDA 3HHLA 4MMOA 3UCUP 3CCMS 3OFEA 4NYZA 4DR7F 6AT1B 3AD8C 3B78A 5DDPC 1L3KA 2ZH6A 3GFHA 5IT9Y 1EETB 2CJ9A 2MY7A 4LT6A 1SV5A 1FKOB 4LBIA 4QWAA 5DS7A 3RGIA 1TKXA 4DV7J 2PEHA 4ZP8A 2C2RA 2BOAA 4LMZA 1UWAA 2XNQA 4DV3J 1WELA 2ZUGA 4DV2F 1RE1B 3HHLD 1TMMA 5I3QA 1CQMA 2W9BA 1S77D 3VQSA 3I0RA 3H0PA 3ZC4A 2MB0B 3OLBA 1OSCA 3DHWC 2COLA 2BR0A 1F5CA 1N4LA 4FYWB 4JV5J 2ROPA 1X9SA 2AW0A 3HM9A 4R5PA 4I68A 4O0NA 3FC9A 3OTDA 1N36F 2XMAA 3CJ2A 1FRJA 2XULA 3LA0A 4L74A 2MLYA 2VPZB 4R5PB 1IKXA 3ET6A 5CAAA 3TARA 3D3BJ 5HLFB 2HHHJ 2DBBA 2HWTA 4H4KC 3TJ9A 4YOEA 2AWZA 2AT1B 3HP6A 3KK2A 5GAGU 2G2YA 2WRMA 4DBQA 3UPFA 3MFHA 3M9NB 3PHEA 4U67Q 3BQ0A 4RUAA 5E3RA 1UA0A 2UVUA 5K5MA 2EI5A 4CO3A 3NKYA 5DJBA 2WVEA 4OMFG 3SQGB 3GP9A 4CDIA 1QTMA 3BKFA 1DHMA 1DAXA 2HGNA 2WW8A 4X66F 4U7UD 3MR5A 3VGVA 4F4AA 1GX5A 2LP4A 2JZ5A 4YDXA 3RAMA 4CLLA 4LF9J 3RR8A 4X4UA 5HI7A 2HIYA 2UZAA 4QBUA 1U1KA 2BJEA 5HJXA 4XO0A 1DFDA 5HO4A 1NSKL 3SI8A 1FRXA 5M2PA 4B3OB 3IM8A 4KO0B 1TL5A 4PG7A 1NDLA 3RRKA 4FNHA 1AB8A 4A8KA 1Q7YT 5B7WA 3V6HA 3GWCA 4L75A 2YWHA 2VF3A 4TY8B 4GKKJ 3LGHA 4WP9A 1JLAA 3FSXA 5KT5A 3J7YU 1JLEA 1TTHB 3DOLB 3QGGA 3VZIA 3CSKA 5HQMA 1RT3B 2L9DA 4DX6A 3KK3A 2QA1A 2DNLA 2HS4A 3MTKA 5J1NA 1S1WB 3BGLA 1F1BB 1FESA 4PYAA 4E8UA 3H4BA 3GYGA 2DVIA 2V2ZA 4AL7A 3LH2S 3MPVA 3VAGA 4IRKA 4NLWA 3FBBA 3J80Y 3G71S 1ZTTA 4PZVA 2GC8A 3T5LA 2WONB 4MK9A 2A6MA 5KFCA 2P9GA 2DITA 4ILRA 3BN7A 3TA0A 2ZH8A 1JJHA 5E3QA 4KY3A 3OR2A 2MQNA 1U1RA 2IMWP 1N32F 3CIMA 1PSDA 1GXLA 4N8OA 5KFPA 4C6AA 1TAQA 3ET6B 2AEFA 4ES1A 1IR1A 2MZ1A 1U1LA 3QO9A 3CDEA 4LF8J 1FNOA 4YB6A 3QPIA 2F8MA 3FKBA 4ILMA 1CSJA 3MM8B 1GEHA 2RDIA 4K4SA 3M32B 4B3MJ 4LSLB 1HBOB 4LF5F 2FVQA 3VWSA 4XPEA 3TX8A 1WORA 1WSVA 1X5OA 2OSQA 2MYFA 4NLPA 2KG1A 3BBBA 1N34F 2JEFA 1IJEB 3I0RB 2CVEA 1RWVB 4I69A 3M8ZA 5B0CA 3M8PB 3MM9A 5A8RB 4PYDA 2JOQA 3RB6A 1QSLA 2OIHA 2B9EA 2JEIA 5CD4A 4M94A 2M2BA 3KKFA 5ETPA 1TKXB 1XBWA 5HP1B 2MGZA 4FDFA 1RT1B 3POTB 2ZD1B 3H2UB 1B70B 3LUYA 5KFXA 1W25A 1JLQA 2CFXA 2XMUA 3C14A 2GGPA 2B43A 3NBPB 5F8NA 2IAJA 1PBAA 4KTQA 3PYEA 3BKTA 1FE0A 3H5SA 5KG0A 2X1AA 4PUOB 1D09B 4X62J 3VAFA 4O0IA 4GKJJ 3MUMP 2WAQD 2OKQA 5CD4H 1RTZA 2PA8D 3D66A 1NO8A 2X7IA 1J27A 3NOGA 4USWA 1U0HB 2XY7A 2FHMA 4IDKA 3TANA 4KC5A 3VQTA 1HNVA 2EWHA 4KSEB 4P7VA 1YRXA 2MQPA 1OPIA 4DPUA 3PJ9A 2FZCB 1WWHA 1URNA 1HIYA 1Q8KA 3HJVA 3RW6A 1YRUA 4PABA 2K2PA 3D6FB 3QAEA 5D6GA 5AXNA 2EK1A 1H2TZ 5HATA 1ZM4A 8RUCA 3OW2R 3RB3A 1UVIA 3M8YA 3QJPA 3SBMA 2HS3A 2YNFB 4L3NA 1P9QC 2GVDA 2K7KA 4HLBA 2VJUA 5HROA 2LVWA 3FVYA 3MM7B 3QWUA 4G1PA 3R5AA 4KH1B 3KLGB 2YNFA 2J0XA 5K9FA 1YDLA 2GVZA 2QYCA 1WACA 3M2RB 1OYEA 3DLHA 4OHVA 2J5AA 3SMZA 3TOQA 4UF4A 4C48A 1XNQF 3F44A 4NEYA 2UU9J 1UAWA 4L73A 1MNEA 1Z1ZA 5KFGA 3OXLA 5KFIA 1RYSA 1YK9A 3ELHA 5IV4A 3OTOJ 2XO6A 3CE8A 1BQMB 5KFVA 2L9NA 4DQSA 3LGNA 4WU2A 3G8TA 4IQXA 3CJ3A 1CJKB 4OI3A 3TZZA 3CDAA 1VLYA 5H1SV 1R8PA 3GONA 1S0MA 5D0RA 2WOMB 3JTNA 3I9V9 2VFUA 1NMEB 1VI7A 1WHYA 6FD1A 1UFKA 1TZ0A 2C2OB 2VPXB 4UOGA 5DG9A 1KWMA 1TKDA 2DGXA 3MMCA 3AODA 3PO5A 1XNRJ 2ZD1A 2OFHX 3BR9A 4U6PA 1U1QA 2DB1A 4I2PB 1WJ9A 5IV3A 1JWWA 1N6QB 4O44A 3HJFA 1O8BA 2W4PA 4K4UA 1H2UX 1TL7B 1WOSA 2B0GA 3PHTA 4FNIA 4DV0F 1T03B 1NEEA 1WD6A 2QLJB 3W62A 1VQ9S 3RBEA 1NSPA 2D41A 1I3OB 4M5NA 2FGOA 4PG4A 1UKUA 3DGPB 5E0OA 4E2FB 2IFXA 2AGQA 1K0TA 3W5YA 3HI9A 5SZTA 2ALYB 1HLWA 4GVBB 1RT7B 2QA4S 3DLBA 5GAEI 1JLCA 1HWKA 5F3TA 3V5RA 2VKRA 1H72C 3ZZTA 3MAQA 1SJ3P 3OT9A 4QCLA 1OO0B 5I3PA 1TL1A 4CLZA 1HBMB 3DLEB 1UA1A 1SH3A 2HMIB 1TUGB 3GYXB 3MD1A 4P74A 4J9LA 3W61A 4ZVHA 4RW7A 1REVB 1VHFA 3OR2B 1RTIA 1C1CB 3CUNA 3T5HA 2H5EA 3PNIA 3PM9A 1KEKA 1LEOA 1VRUA 2HRTA 4R0EA 4BC9A 1FXLA 2KFNA 4ZPAA 4LSZB 3Q2SC 5IT4A 2BJ8A 3KLIB 2B5JA 2MSSA 2FUG9 5EX3A 2LEPA 1CC8A 3ZTPA 2IY5B 4ZA1A 3EGVA 4X65F 2FZKB 3C15B 2DYAA 5DZ6A 1ZTWA 3AA8A 5D4NA 1LK7A 5A0YB 3IBFB 4UUWA 3A3NB 3KK3B 1JLEB 3DOLA 4WJBA 2GV1A 3JSBA 1RKJA 4JI8J 2MLXA 4NLUA 4I2PA 3C2PA 3MECA 4F8RA 2EC0A 1YKWA 3NGUA 3MMCB 2R7XA 5E5NA 5HMZA 4M63A 1JJ4A 3QNWB 4F67A 2H48B 4M5HA 1VQ4S 2AYBA 1JXVA 2ILYA 2IAJB 3F0NA 3FQKA 5DZ7A 4WP3A 4OZ0A 4DQRA 2PIIA 2E1MC 2V63A 1MWYA 4HKQA 2HHXA 1H0HB 4NLVA 4Y3CA 1I1GA 2FQQB 4OZ3A 1HNIA 2NYIA 3W2VA 1X4CA 2PT0A 2Y1IA 3BV8A 4F25A 4B3SJ 2UUAJ 3WX4A 1FD2A 2IJNA 4ECZA 1D9FA 2IPOB 1KFDA 2HLUA 4PR6A 1FO1A 1NJZA 1OSDA 2OD4A 4OX9F 2GW8A 3HCXA 4F0MA 4LUBA 2W7AA 4RW9A 3JSYA 5L8RC 4OYBA 4DR3F 1C4CA 2C1EB 2H65B 1VQ5S 5DM6Q 3WC2A 5HLFA 2PEBA 1JLBB 4NI2A 1NB7A 4F2SA 1FI4A 2HQGA 1SKRA 4FVMA 5LJ3Y 4J9KA 3PW7A 3MD3A 1OQ3A 3KK1B 2GVDB 4ZKAA 2OMLA 3D28A 4P2XA 5AXLA 3H5XA 1JKHA 5F3ZA 3UDEA 3WQPA 3PW2A 5J2NA 2V9KA 1N32J 2NREA 1S1TB 3TZWA 1S6PB 4K59A 3X3UA 5CZVA 3P4UB 1IR2A 3DYAB 2V4QA 2WONA 4HTIA 3HD2A 2ASDA 5B08A 3NCPA 4C8MA 1YJRA 1EQ0A 2MY8A 3ZZUA 4ELUA 2JLFA 4YR3A 2YPZA 1DTQA 5HANA 3G2XA 3R27A 5RUBA 4RBUA 3T1HF 1LXNA 2VKZG 3QAUA 5F0UA 3UNGC 2M0GB 3N5BA 1TVRA 1RADB 3G82B 4DI6A 3GTYX 1NU4A 3E8OA 3MPWA 5E7OB 2V4JA 3ENVA 3M7VA 3O2IA 7AT1B 3HHLC 4TYAA 3K57A 1SH0A 3QBCA 2NXUA 4F4YA 1M5HA 1SC3B 2UVWA 3CO0P 5F0WA 2XLJA 2J7KA 1T9UA 2QGFB 3C16B 1HMVA 3HVWA 4O3SA 1VFJA 1NXIA 3FGVA 4NLYA 2JEJA 1S9EB 4R25A 2YKMA 3IRXA 5C25A 4ZK7M 1HI1A 3FZ2A 3IWLA 4M5KA 2RS8A 1RAJA 2J0SD 4M8LA 2KVIA 3MMAA 1I51B 1U02A 1D9AA 2BEFA 3Q8YA 4KV8A 3U1NA 3CCRS 4LF4F 2LFVA 4DL6A 2KI2A 3K58A 1F9HA 3I9ZA 3UN2A 1NZAA 3O1LA 3HFVA 5EUHA 3L4BC 1UFLA 1PG5B 1RWUA 4IFYA 4DX5A 1IWGA 2DO0A 1LNQA 2K06A 4TY9A 1M0SA 1PILA 4DS5A 3ADAC 2DHAA 1L3UA 5GADI 1KVJA 2JSXA 3EXYA 4KFBA 3M2VA 4WTOB 2VD3A 5KFFA 2D69A 4B9NA 3F73A 1IKVA 3CWJA 1VHIA 3ZZPA 4NX9A 4YY3F 2IRXA 1VC6A 5J1PA 3NP5A 4DX8H 2RAQA 1U7LA 4A8XA 2CVIA 3V81A 2BRKA 1KOOA 4OV1A 4C97A 4DL3A 2PFFB 5C2GA 2XMKA 4N8NA 4DU8A 5KT2A 2OTLS 3HVAA 1B7FA 4QYRA 3Q86A 2YKMB 3IRXB 1YZ6A 2RQCA 1HNWJ 1SUQA 2BJDA 3KHGA 3KOAA 3A13A 3PYDA 1HL6A 5CYQA 3DXSX 1N48A 1WC1A 2AP6A 3W5XA 4F4WA 2KKHA 4RX6A 1WKJA 4FZVA 1WI8A 4RPFA 3K59A 1NKCA 2ZM6F 3T9ZA 2C2DA 4JV2A 4K7QA 2XY5A 3LO3A 4DJBA 4UQTA 3P8BB 4JI4F 3UI3A 2VQFF 2G1DA 1VBXA 4W92B 1FD8A 1X5PA 3FEYB 4WYLA 4G6VB 4X4TA 4I67A 5JXSA 2DH8A 4ZPTR 3QMQA 3VGSA 4UY85 2HFSA 3N6NA 4C11A 2AGPA 3MEEB 1FXDA 2HWHA 4GKJF 2LXUA 2AV5A 1S6QB 5BYRA 2BE2A 3HHEA 4YR2A 2QMXA 4CO1A 3GFYA 3GIJA 3HZEA 2R42A 1R0AA 3CO9A 4Y65A 4PG8A 4JI1F 2EKYA 4K4YA 1TAUA 1UPPA 2AEJA 1HYSB 1S48A 1NRKA 2JVOA 1D8YA 3Q8SB 5HSPA 3EYZA 4NXNF 3Q83A 3DM2B 4ICLB 5IT0A 3KHLA 1GK8A 1XK8A 2FYXA 1IKVB 1DY3A 2KT5A 4TQRA 3MR3A 3KHRA 4DF4A 1HARA 1YI2S 3NNHA 1VJWA 1GQEA 1TL3B 2WVBA 3I87A 2AJ4A 2KZZA 3OVBA 1RAHB 4ED1A 2DY9A 4HTJA 2R7TA 2DGSA 3HSDA 2B9WA 1MU2A 3CJ0A 3MR7A 1PJ6A 3MOZA 4YUDA 2EBEA 3CJTA 1YG0A 2LCWA 2VFSA 4ZPDA 1B7YB 4Y34A 3TVKA 1RHQB 3MR6A 4NLSA 1V5IB 1X4HA 2H5JB 1HHQA 3WIVA 1XEZA 5L38A 5KFLA 4NLOA 4ZN3A 3SXLA 4NCGB 3TUJC 2K7JA 2Q1LA 4HDHA 2AJ2A 3IFEA 3CJ5A 4EO8A 1FVSA 1X9MA 3IR7B 4CRJA 1KQFB 3G9CA 2J9EA 2A18A 1I6JA 2C42A 4UOCA 2DHHA 2ZE2A 2KG0A 2QMUB 2YQ1A 3A8EA 4LF6J 4FYDA 5AE1A 2HSEB 3TEGA 4DUZF 1GMWA 3NGRA 4P52A 3EWGA 4Y2CA 3FFIB 5KG4A 3HMJG 3IO1A 4NA2A 5D0EA 4GC6A 1Z4UA 3PKMA 2CPYA 3B8HA 1C1BB 4CZCA 1TK8A 1KRPA 5KFJA 4HT5A 3MEKA 1U0SA 2Z0GA 2BW2A 2OEJA 5A0YA 3C19A 3PO4A 3PFEA 1VQPS 4HHUA 3DOKA 2WVCA 2BE9B 4A8OA 2AMCB 3BB5A 3JTOA 2RS2A 4N76A 3N0VA 4IG0B 5G0RA 5DGBA 4AT1B 1Y3JA 3DYAA 3NMAA 4B3SF 2L9WA 3R2DJ 3IN5A 3OVSA 2VOOA 4ED8A 2Q79A 3LP1A 1QVGR 3J7AN 2DHXA 3KLHA 2RH3A 3KXDA 4KGZB 4TU7A 1RA6A 4A8YA 1ZETA 4Q0BA 3Q22A 1S6UA 3QLHB 1ITPA 2HNDA 4N41A 2VQEJ 2CJKA 4NRUA 1R0CB 4CLPA 4ECRA 1HNXF 4QJVA 4OX7A 2B8QA 2M7SA 4Q43A 4M5MA 1O51A 3GJTB 1RACB 4PCQA 1NJXA 1Y5NB 1JMTA 2J6SA 4X4RA 3LTOA 2G2ZA 2EFNA 4AL6A 3JB9k 3B4DA 2MSTA 4X4OA 4ZMMA 1M1HA 4JI3F 2YWEA 3H20A 3V6DA 2OUGA 2JEGA 2C3OA 4CP5A 2OSRA 1YJ9S 2AYGA 1QSYA 4DSFA 1LV5A 3TAMA 2BJ7A 2DHSA 2V5HG 4L3KA 3SDEA 2B51A 1QE1A 4C3LA 2FLPA 2PO4A 3VHQA 5K8NA 3UDCA 4X4VA 1HHSA 4PWWA 3OLAA 2HW3A 3AQOA 2YKNB 3F56A 5DDRC 1WEYA 4DFJA 2CYYA 1FVQA 3DKDA 3EICA 3R1HA 4WBFA 3N79A 3QGIA 4HH0A 3T1HJ 3H7HB 2CWKA 1QD1A 4W90B 1QY7A 1WDDA 3M1VB 4H54A 4I4BA 4R8UA 4ED0A 3K5PA 3W63A 2QMWA 1VOMA 2RUSA 2HFVA 1Y5LB 2FTRA 3G6XA 2VG6B 3NWRA 3UDLA 1JQGA 1HQUB 3D1HA 3M2UA 1NDCA 1NBEB 2HFUA 4OI6A 3VGTA 3H40A 3DU5A 4DL4A 1CJUA 1MMNA 2CQGA 1PO6A 1S4EA 1V6HA 2F63A 3LW5C 4DR2J 3DRSB 4ZVFA 3GJQB 2K1RA 3C15A 3NGDA 4OFZA 3S6EA 1S0VA 2WB1D 4M5JA 2D74B 3PRDA 3UCGA 3ZTSA 1I5OB 2OEKA 3D0GE 3DXBA 3M6WA 2OTJS 2EKNA 1DARA 2MQMA 1WC5A 3G4SS 5J1EA 1QAJA 3JAMY 3P5TL 4XAKA 3ZZRA 2EPIA 1R0BG 4CLKA 5J1EB 4JOUA 1KFSA 4I6AA 2WBRA 1FT8A 2WSEC 3KDNA 1EP4B 2GIQA 3LP0B 1IQTA 2HRUA 3OL9A 1S9GA 1YBUA 4DFPA 4IUFA 4NCBA 1VQ7S 4B9SA 2CQBA 2EG1A 1W7WA 1V3ZA 2L41A 3N9UC 1DTTB 1UPMB 2Y9HA 2E5JA 4OJHA 4LRFA 5HK4A 3R5BA 3SCJE 2JFDA 3CD0A 5IXUA 5LT5A 4Q44A 1C4AA 4WZQA 2FJWA 5A8WA 3ZTOA 2GIRA 1UVMA 1GTEA 3N28A 4I1TA 4MFBA 3A3OB 5LMUF 1F6TA 5KFRA 4ZJQA 1TL7A 2RU9A 4PWUA 4NXMJ 2N7YA 2HQ3A 2B7BB 1UWBB 2JLGA 2R2RA 5J2MB 3MUVP 1SL0A 1TV6A 2VHGA 1BQXA 1RAEB 3OSPA 3W1YC 4DWIA 1UVJA 4JUZA 4ED5A 4EK2A 5ETOA 4DL7A 1CJTB 1HFEL 2GQ2A 4I56A 1YJTA 1U47A 2YH1A 1Y5IB 3SDEB 3HLUA 4RW4A 3M8PA 3MM9B 3UD5A 5KFOA 2RKIA 2W4DA 2XWYA 1HWUA 4DSKA 2Q6BA 3PV8A 2YX1A 3H5YA 2ZHBA 2UUCJ 5HVHA 3CC7S 4PWDB 2I8EA 4ECQA 1E6VB 2L08A 2VC1A 4ZVOB 3EDQB 1B4SA 4W98A 4P2FA 3MM8A 3VAIA 1Q8BA 1HPZB 3NG8A 1AA1B 3PEJA 2YXLA 3KWMA 3U1MA 1O0PA 4C8KA 1FDBA 4Y2AA 1S1UA 1VQ6S 1U26A 2G0IA 2KFYA 1LWCA 4UZCA 4IG3B 2YX7A 2RDJA 2ZH3A 3DDKA 4A46A 2CA9A 2W25A 1IBKF 3A12A 4TXSA 3MZIA 2YKAA 4G1IA 1LFWA 1TKTB 4Y28C 1ZPWX 2O1PA 1ROFA 1RB0A 1Q8IA 3H4DA 2CQHA 2ZDPA 3IM9A 4F4XA 3UNYA 4YB1P 3BF4A 5DQHA 2UUBF 3DOKB 1MROB 4NPOA 1S1WA 1S0OA 2BBEA 2F4FA 4ZVSB 4LVOP 2UVRA 2GQQA 5F9LA 2GAGC 4LF4J 5LSLA 3QRRA 3CDBA 3ENAA 3R97A 1RWMB 3HSGA 1HQUA 3TA1A 2LKZA 2VPWB 3EZOA 3UO0A 2OGUA 3IAS9 4AYBD 4DEZA 4B17A 3KMQA 2UXCJ 2HHUA 3IGVA 1VQOS 5B0AA 2M8HA 4USHA 4R8UB 2O01C 2D1CA 4KKOA 4KJIA 3TRGA 3D9BA 2HVZA 1WG1A 2KJVA 1RT4B 3O5TB 4KBIA 1U1MA 2YNIB 3HKWA 2HS0A 4CCHA 5D3GA 2QIFA 4O3QA 1T9WA 4YR0A 3M05A 3FCHA 1NUEA 3CIZA 1FWLA 1VCTA 4BLGA 5A6PA 2HFOA 2IA0A 1YVFA 2ZNYA 1NPRA 1VR6A 2Z30B 3KLVA 1ZOTA 1M5VC 1EX8A 1GFWB 1KLMA 1RQ0A 2XTJP 5FDLB 3E2EA 2GFFA 4A8QA 1A7GE 1EIYB 2E7WA 3BSAA 2B7CB 2BXJA 3VAHA 1XR5A 4DPXA 3FNNA 3DMJB 1FXRA 3OD2A 2E44A 2BQUA 2KXNB 3DCAA 4ALZA 4DSIA 5H9FK 1VDHA 3E51A 1B0PA 2XMMA 2O67A 3MPDA 5ETNA 4RZRA 4LF2A 1FNXH 1HNZF 2R8GA 1AFIA 1SXLA 3G6YA 2DNPA 5KFMA 3CPWR 2CUYA 4H4MB 4IFYB 3SFGA 3T1AA 2VQEF 3PJXA 5HQ8A 1FTCA 2XC9A 2VBWA 1HNXJ 2R4FA 1R0AB 2FY1A 1JNRB 2DEIA 5LMNJ 4IQMA 3Q2TC 1S6QA 2MKSA 2Y8WA 2CJYB 2Z2MA 3GG1A 1N56A 1OS5A 2DGTA 4M5IA 5GAHU 3GPAA 2DISA 1WF0A 4RW6A 2V69A 1WEXA 1N36J 2YNIA 3H5UA 4LRBA 4JI5J 1C0UB 2RD5C 2OPQA 4DQPA 3OBIA 1WOPA 2HQCA 4DV4F 1SJFA 4KGMA 4NLDA 2OPRA 1RA7A 2CZ4A 4P73A 4OX6A 5IFMA 4QWDA 4CO0A 2E9RX 1Y11A 5EWEA 5GMEA 2KL8A 1Y00A 4C3MA 2W2MP 5BR8F 4X4PA 5B0FA 4EBCA 3T5JA 1BQNA 4CO2A 2GJFA 5BYSA 4TLQA 2HK2A 5LOQA 1T94A 2B56A 2OPQB 4TLRA 4WPAA 5CYQB 1DLOB 4CT9A 5KOXA 2ZH9A 2VFTA 1P6TA 1PYSB 2BX6A 2V8DA 4X84A 3J7Z5 2R2TA 4JYAJ 2ATLA 4MT1A 2RJZA 3K8VA 3HFZB 3NRBA 4NCGA 3H8YA 3NS5A 3A8KA 4J9VA 3QYYA 3V4IA 2BOPA 4ZVPB 1RP5A 4PPZA 1FERA 1S6PA 1DZ5A 1S1VA 4ZPBA 3DLJA 3NGSA 3PCOB 3JAMU 3NNAA 4H4MA 4TYBA 2IDEA 5ITHA 1AFJA 1H74A 4I64A 3R8YA 2F7VA 1JKHB 4QOTA 2BV3A 3U27A 4YDDB 3TJAA 4K4TA 2HK3A 4P71A 4DU7A 4EFAC 1EB0A 4Y0FA 2BKOA 3KLFB 3RBDA 1CEZA 3OL8A 3HD1A 1X4FA 4QIVA 4Y2MA 1KS2A 2MZTA 1EQMA 2VFVA 2ZBPA 4ZP6A 4ZVGA 3TX0A 2YNGB 1S0NA 3MMAB 4KV8B 4FF3A 1E6VA 3L3CA 3W60A 3V4IB 4FBTA 5CH7B 1JXEA 5JVHQ 1W26A 1WHWA 1NHUA 3NGTA 1AYEA 2M9KA 3MEGA 3ZTRA 2J0QD 1GMWD 2DGVA 2IDLA 2ZFHA 4FYXB 4OQJA 1GMUA 1T3OA 3SEOA 2ROGA 2ZEJA 3UE2A 4CLTA 3TQ1A 5C5JA 4PXBA 2CNNB 1BHNA 2RIJA 1S59A 4N47A 1XMQJ 2LDYA 5LJ5Y 1HNIB 3W2VB 2V2KA 4Z7CA 1S6OA 2NYHA 4QWBA 2JLEA 2ZH4A 2J6TA 3I32A 4ZDNA 2E5LJ 4RR5A 3W9JA 3ZTQA 4RKUC 4AQYF 1RTDB 3SQOP 4XPCA 1PKUA 5E41A 2G0JA 3BBFA 4ZHRA 3FMWA 4DR5J 4CQ1A 1N34J 1PBUA 2BACA 1X8DA 4JV1A 4GC7A 1A6LA 1M1GA 3PW0A 2WVDA 3SSQA 2IC3A 2XM3A 2I6WA 3BH7B 4OJGA 3LOUA 3AOCA 4ENOA 4A8MP 2BUNA 2OJ3A 2UVVA 1KLNA 2V9WA 1D9DA 3FJ2A 4J37A 1JNZB 1PJ7A 1RKIA 2ZDOA 2NUUG 3CCSS 2QRRA 4DR1F 2UUWA 5DDQC 3THVA 1KD1T 2KYZA 1B99A 3OXGA 1NSAA 1GXUA 1N33J 4CT8A 4OV6A 1Q1KA 1YITS 3B6BA 1WC4A 3GSIA 5FLXY 1RT2A 1RTIB 2F9DA 3RTVA 1XMOJ 1JLBA 3CB4A 4NI2B 3N5FA 3MI7X 1LWCB 2U2FA 4OI4A 3OVAA 3BO3A 3PX6A 1UEVA 3QZ7A 3US5A 2XO7A 4DV5J 3D6TB 3RBXA 4EI2A 2IJFA 1TR0A 3BGRA 3JSRA 2EC2A 3OFHA 3HHNB 2H5IB 3A8JA 3WZ0A 1HBNA 4I0WA 2KXFA 3EE3A 3TA2A 2XHWA 5ETRA 5DQIA 5GAEU 1TELA 1Q8LA 4B3RF 4RBVA 4P9SA 5CYJA 3OHBA 1EHWA 5L46A 3CULA 1SJ1A 1IM4A 1R6YA 2CIMA 2GHVC 2RSQA 4QQBA 3M8SA 3JSMA 3HT3A 4ZLNA 4LSNA 5KFUA 3L7UA 1T03A 2X1BA 1HMVB 5F8GA 1VBYA 4O4GB 1Z2ZA 1RT4A 4DV1F 3E01A 3HKZD 2DNMA 1IKWB 4J9SA 3V4MA 5H9EK 1F9FA 3R6GB 2MKCA 2QSWA 3HXMA 4JI7F 1G4CA 5CZXA 4ANEA 3GQCA 5A8KB 1SVDA 2P9CA 3FQLA 4FN5A 1MW7A 5T41A 3QZ8A 2HBQB 3O3LA 1TVRB 2B3TB 1T0TV 4ED3A 1T02A 1X5TA 3KUHA 2IVYA 4DV6J 4WTYA 2NPIA 1FNMA 1RT6B 5DRKA 2J7UA 2MKIA 1NLKL 2HFZA 2YPYA 3X1LB 2X3DA 3FEXB 3OL7A 1B64A 1P1TA 4FF4A 5IM0A 3V6JA 1REGX 1K1SA 1U09A 3RYLA 2XLIA 3PIOQ 3QFWA 1VQLS 2OLWA 1H7WA 2XZTB 2YKQA 3AJ2A 1JLFA 3R5CA 4WU3A 5EX0A 3UN5A 4EBDA 2D9PA 2UUCF 2EFQA 1YJNS 3K0JA 1C1CA 2KM8B 1FJEB 3SFUA 2NPFA 5HL7Q 4DN9A 3EVWA 3VV2B 4YB5A 2UXDF 3PW5A 3QLHA 1ZM9A 3C8YA 4WE1B 2KU7A 2CQ1A 4I2QA 2JC1A 3WDOA 4DV0J 3N6MA 4HHHA 1SQGA 5DG8A 5HVGA 2C28A 2HZVA 3CJ4A 5GADU 2CQ4A 3K5LA 1SH2A 2AHOB 4MKBA 1RT7A 1JK9B 5HMXA 1CULB 4DCPB 1IBKJ 5G0RB 1HNZJ 3TUZC 4HI2A 3D67A 4G1QB 4UY8T 3H42A 1YIJS 2BE7D 1GX6A 3W9HA 4GO7X 1RCXB 4WKRA 4BCAA 1IWAA 3TAPA 3BQ2A 4OHZA 4UTGA 3U7JA 1GMVA 3R3TA 2N4DA 2CDQA 3P5BP 1F2GA 2A2CA 1NZ8A 4BWJA 3D7SB 2GMHA 3J81j 2GQCA 2D3OR 1WTFA 4USVA 5HAOA 1F3VA 2APOA 3OXFA 4MH8A 3CCLS 1WF1A 3KFWX 3GJRB 1ZAWA 1GAOA 2NXNA 4O4GA 2WOMA 4MIAA 4P10A 2KT2A 3U1LA 1S7HA 4JI5F 3DLLQ 2FVPA 1PYOB 4OI2A 1RLCL 3J7YI 3JSMB 4RO0A 2XI2A 3SV3A 2C2EA 3UR3C 2E1PA 3FZBA 1DURA 2BKPA 3UFCX 2FVSA 1IR0A 2F65A 4IO9Q 1PIEA 2XYHB 4ANDA 1Q78A 3TR5A 2FDNA 3QGPA 5T7LA 5KG2A 4F4ZA 3V6DB 2IRUA 1M5KC 1WNEA 1SBRA 2XG8A 1E6YA 1R8BA 2RHQB 2DR9A 1TFWA 4PG6A 3DC2A 5DDOC 3OR1A 4ED7A 1HBUB 3AAWB 1Q81T 4ZVTB 2VA2A 3KJNB 4NZ0A 1T11A 2J8SA 3PRVA 5HROB 1SIZA 4DV7F 2ASJA 4Q45A 5C24A 3UWTA 3Q8PB 4A8FA 4LFCF 2NXJA 3DM2A 2HBYB 3ILLA 4ICLA 1REVA 4RL1A 2QX0A 4USTA 1YLXA 4Y6IA 3HPOA 3QT6A 2FPHX 1N8RT 5EN1A 4M5GA 5A6WA 1WI6A 4DL5A 3OTCA 3M9OB 2K1RB 2POKA 4OL8A 4X64F 2CXEA 3IMQJ 3DRSA 4FYYB 1NNDA 1JLFB 5ETLA 3G6VA 1VIOA 4Q8FA 1KR4A 4ZS6A 1SB6A 4HACA 2BZ2A 2IM2A 3IR5B 2UV8G 4IR9A 3RW7A 1DQAA 3PFOA 4IG0A 5IM0B 4C2MA 4JV5F 4R0JA 2BJ1A 4ZJLA 1TP7A 5IZHA 2I2YA 2QE5A 2IMOA 4ZJOA 3PR4A 3FUYA 2B8PA 1RBLA 3JYTA 3IC1A 1RT3A 4DOZA 3T41A 1LW2B 4ZOSA 5HMWA 1C1BA 1YBAA 4DSEA 4PUOA 3MFIA 2VJVA 1N6QA 2PMWA 4K4WA 2CNKB 4QWCA 1FFGB 1NDPA 3I96A 3EZ5A 3MOJB 2GHPA 2HFNA 4OYXA 3UW1A 4CO4A 5GAHI
chains in the Genus database with same CATH topology
4Q5VA 5K8OA 2CPEA 4F02A 1WG5A 5A8RA 2Q3PA 1P8GA 1GT8A 2A3JA 3MWBA 2EFVA 4MIBA 3TAMB 3OJSA 1C0TA 2HRYA 4LF9F 4K0KF 3OJUA 4QR1A 1VC5A 5KT4A 5EWFA 5DO2A 4EGLA 3ETOA 4RW8A 3ENWA 2ZKTA 3BO4A 3RR7A 2HGLA 4WCEQ 3Q8RB 3NNCA 1N52B 5E2QA 2WTFA 4OLOA 4EYIB 3S8SA 1P1LA 2WK4A 2NR0A 1XR6A 3LP1B 1KTVA 4EEYA 4RUCA 1SL1A 1VK8A 1FEHA 1N33F 3G86A 3IBWA 1FJ7A 5KFKA 3PW4A 4RNHA 1UJ5A 3P3DA 5K14A 1V9OA 2MJNA 1XMOF 1K8AT 2QZ8A 3LP2A 3G96A 2QLXA 2CQIA 3TO8A 2N82B 2HNZA 4RNOA 2XSFA 3CCQS 1APSA 1BQNB 4CNYA 3DOMA 4ELTA 1AROP 1X9WA 1R31A 1NK6A 3T6JA 1EETA 4ZHRB 1X4AA 1YGYA 2J8AA 2YVSA 3PZPA 3ENQA 4Q7AA 4WKYA 1R89A 4EBEA 1U49A 1CLFA 3MTJA 4CO5A 4BS2A 4NZ7A 2RRBA 4YMEA 3TI0A 2HHVA 3KG0A 3DLGB 3D1OA 2DCUB 1WEZA 3W7BA 1HD1A 3U02A 1KN6A 4DF8A 4C4WA 3DFEA 1TUVA 1LWEA 2EFGA 3PR5B 2OD6A 5GMKa 2GJ2A 4KB7A 4EO6A 2QA2A 4YHHF 4QPTA 2FJVA 4B9MA 1U24A 1TK0A 4IKAA 2P6TA 4AXJA 1TL3A 3T5KA 2FLLA 1JLGA 2ACYA 4HI1A 2AQ4A 3HO1A 3HK2A 3PXGa 3KJVB 3QO9B 2FD2A 5DETA 3Q8QB 5B0BA 2DR9A 5AXMA 3OUYA 1KQKA 4IOBA 4PG5A 2HHPA 3UQSA 3Q23A 1IBMF 4ZP7A 2W4CA 1LWEB 4LQ9A 5KG7A 4EUVA 3NCQA 2IA6A 1F5BA 4EZ6A 3GG0A 1U1PA 1FRMA 1BGXT 3LAKA 1IQZA 2DNRA 2ZH7A 1Y7PA 2WCXA 1F5AA 5C25B 3M30A 1IUJA 5D3GB 2FVCA 2C3UA 1C0TB 2DR7A 5J2PA 1UVLA 2NSBA 1TL4A 3MEDA 3CDWA 4F3QA 2IVFB 2YY3A 1NKEA 2E7XA 2OFGX 4C8ZA 1O5JA 3GFXA 3F41A 1RYRA 2U1AA 4OI1A 2R2UA 4NYOA 1XERA 3PDNA 4QIEA 2M5YA 1FRKA 3OTOF 4ECSA 2OO4A 4O3NA 4IOAQ 1VIXA 3MPYA 2BYCA 5G4DA 2IVMA 3EX7B 1H6KX 2DNQA 4KE5A 1X7VA 3M8QA 4DV6F 2DO4A 1C2PA 1JIHA 2YKPA 4OX8A 5K14B 3KNAA 2B5JB 3M9MB 2MDAA 1TKTA 5KFZA 2FJAB 2I38A 1HD0A 3M2VB 2DT9A 4LFBF 1FCAA 4H4KA 2I1RA 2YNHB 2LQ5A 4O3PA 4URGA 5B0GA 3OUYB 2L3MA 2LA6A 1V3SA 3KTQA 2HZCA 3AA9A 4P7TA 2F1FA 3NAHA 3MM5B 3GV5B 4A8SA 4O23A 3UD4P 1JLCB 2VBYA 4QIGA 4WFNQ 3I5CA 4G3IA 4K5RA 1MWZA 2YQ3A 2ZZMA 1VS3A 3DGPA 3KG1A 2DCLA 2PMHA 2L48A 5IS2A 4OJ1A 1F0XA 3EPIA 3BSOA 5I4MA 1UVKA 2DRAA 3M6UA 3AHPA 1U2RA 5GVQA 2XEXA 4NA3A 3KLEA 4DV3F 4OZLA 4ZCIA 3P96A 2BRLA 2GO8A 1XC9A 1FF2A 5E3AA 3GIMA 2QO3A 2VFRA 3AY0A 3G8QA 4NMLA 5J2MA 2PI4A 1NHVA 5L1LA 3L95X 1IN0A 3DRXA 5KFBA 3CCUS 3TYTA 2HYIB 3BN4A 3H2LA 5H9FJ 3EGWB 3IWXA 3I56S 4ECTA 2NS1B 1UMJA 4KGKA 2WBMA 3IR6B 5D4PA 4ES2A 3WC0A 4RNNA 2I5JA 3I6PA 3MCSA 1RI7A 2B9XA 1P27B 2FC8A 3H59A 3C3LA 2RU3A 1FK9A 2OPPA 1UEUA 3ULHA 2C3PA 2YWKA 5KFAA 1IKYB 3ISND 1S1TA 3E3XA 5D4LA 3LALA 2DIUA 4G1QA 4NLRA 2AGOA 1EP4A 3LP0A 3M2RA 2EBGA 1XN9A 1RTHB 1UFWA 4C0BA 1S1XA 2XSJA 4RNFA 2QFJA 1BC6A 2LQBA 3D5MA 1BD6A 4WZMA 3MUTP 2J9DE 1HQEA 1KTQA 1S1XB 2W9AA 3S7RA 5IWAF 1M5OC 2UUAF 1G6BA 4DR4F 1VQYA 2HQIA 3FMBA 3LGMA 4KAIA 1PGZA 1ULRA 2G9OA 2MZQA 2VONA 5F8IA 2W8LA 4EYHB 4DLGA 4USIA 2FHOB 3H98A 1Y0HA 3OL6A 4PWDA 3K5MA 4GKKF 4CH1A 2W7PA 1FDDA 1HW9A 1XTZA 3SCKE 2KYXA 3TVZA 2IM0A 1T05B 2RKIB 2G13A 2CPJA 4B02A 2B4UA 1AUDA 1Y9OA 2LXIA 3NBPA 2GGPB 1H2VZ 3Q0AA 5A8KA 2KN4A 4E98A 4LFAF 4EU0A 2YKNA 4QW9A 3B4MA 4IFVB 2FHKA 5KAKA 2MXYA 2RE1A 4CTAB 2KXHA 3RB0A 1QE1B 2VPYB 2PDAA 2M88A 1L3SA 1AW0A 2HGMA 1Q82T 2YX4A 5CCMA 5KFSA 2F4VF 2CQ2A 2JHEA 3IGNA 2W9CB 3QGHA 5CYMB 4RWWA 4B3MF 2GX8A 4XDCA 4IYQA 3PY8A 4TNOA 1X0PA 3M32A 2X1GA 2KB2A 1WF2A 2JC0A 1VRUB 1FRLA 2ZKUA 2PA3A 4J9NA 3DN9A 1K73T 4PPDA 3CC2S 5KG6A 2HNYA 3KHHA 2F3JA 2O3DA 1HI0P 2YNHA 3IAM9 3EXCX 1H38A 1LKZA 3CCVS 2HMIA 3K2YA 4O3OA 1IJFB 1HWJA 1MMDA 4OHYA 3RAQA 3OR1B 5ADZA 2LQ9A 1FDNA 2A10A 5KFNA 4NZ6A 3TNVA 4X62F 2E9ZA 1FTRA 2VG7A 3NGKA 2QT7A 4F2RA 4NRTA 2GJIA 2H9ZA 1JLAB 2QLWA 3IXQA 3L09A 1R3NA 2K3IA 4NLXA 4URSA 1R27B 1Q79A 2OMOA 4B08A 4RUHA 2N4CA 2KDOA 2ZH5A 5J2QB 1S9FA 4C8NA 1S97A 3O44A 4XDDA 4IRDA 5D77A 3CJKA 1RTDA 1IKWA 4ECXA 1IXKA 5SUHA 2MKJA 2KFZA 4M95A 1K9MT 3D54A 2B9YA 3NLCA 4D3HA 4WXWA 4ETXA 2EVZA 4ZVEA 1CPZA 1SJRA 2D9OA 3BS9A 3SSSA 3LWLA 4OZ5A 1B0VA 1K0VA 1JB0C 1HR0F 1QAXA 2GCFA 3CDUA 5L1IA 1M5PC 2E66A 3MEGB 2JRSA 4LJMA 4X4QA 2A1BA 3N01A 4OZNA 4F4KA 2IBOA 1N5SA 3QJLA 4LSLA 1IKXB 4H4OB 2ZC4A 4QIWD 2FJEB 4ZPVR 1RT2B 1V3RA 2PD1A 4NA1A 3MM7A 3KLGA 5EWGA 1R8HA 4LIRA 4N5SA 2R7UA 4J5OA 2YTCA 2IYIA 3DNCA 2BA9A 4TN2A 3VALA 2DNKA 2XMJA 3KLHB 1VGYA 4TU9A 1LFPA 2VASA 2RF2A 3Q24A 1GTHA 1U1OA 4C8YA 5CA5A 3DI6A 1RT5B 2GA7A 2X51A 3DLGA 2MZRA 3M8QB 5M2RA 2XCAA 3CCES 2BQRA 1M1KT 5DM7Q 1RDRA 2M70A 1SV5B 2WSCC 2R8HA 4J9MA 4A47A 3IG1A 4WFAQ 2Q43A 2HG4A 2VUGA 3M6XA 1NK0A 1YQHA 4ED6A 5KFYA 3I4PA 3MDFA 5LSOA 5T14A 4LVNP 2J9CA 2EW9A 4M5DB 2OP5A 2KTQA 3AJ1A 3GYNA 3DLKA 1RT1A 3POTA 2LU1A 3GIIA 3KLEB 1RK8A 2HWIA 2J6UA 1SIWB 3OTEA 3CGIA 1RTJB 2BANB 2RQMA 2HNZB 2VOPA 3R5DA 4RW6B 2CJBA 2CPZA 2G0CA 3OFGA 1S99A 4HDGA 3S1TA 4IH6A 4ZCLA 2RVJA 2AD9A 2YKOA 2B6AA 6FDRA 1ZM2A 3MXHP 5D8HB 1KQGB 3T1YF 3QIDA 2YNGA 2J9DA 4I7FA 4ZP9A 1T3NA 3MM5A 2Q66A 2DNOA 3I31A 2M4MA 4KFBB 1T7PA 1TFYA 2DGWA 3V6KA 3HHDA 5C42A 3R1LA 2WSFC 3W2WA 3C66A 3MGJA 4MK7A 5E3CA 4QW8A 1X4BA 4IOCQ 4I7FB 1FJCA 2HVIA 1Q53A 4D3GA 2B6AB 1VQ8S 5EHHA 2R8KA 4NCAA 2F8HA 2ZOFA 1K1QA 2MKKA 2DR5A 1QSSA 1KLMB 2DNHA 2VA3A 1N5YA 2LQJA 2W9BB 1DLOA 3PX0A 4DQIA 4NLGA 2JL9A 3NMRA 5LL6d 4TY8A 4B9TA 1UP1A 3GFZA 5D78A 1OIAA 3GSDA 3MEEA 2VG5B 2UUTA 4WK3A 4MAKA 4J9QA 4URQU 5HBMB 2Y1JA 2XS2A 3TAQA 1LK5A 1Q7LB 5CCLA 1H98A 4K4XA 4ID5B 4DG1B 1VK3A 3AQPA 2W7OA 1LW2A 5J2PB 3PACA 4C98A 2VODA 5D4OA 3EZUA 2MZJA 3CF5Q 3HX9A 4WK1A 2AF6A 1QVFR 5I3UB 3NS6A 2EK6A 3GIKA 3SQGA 1U6FA 3JTPA 4WYWA 2KHCA 3LPYA 3MMBB 4J9RA 1W2BR 1N5YB 1H7XA 1L3TA 3HVRA 2C3YA 4DHVA 2ALZA 2ZITA 1MROA 5F8JA 1SKWA 2MZSA 1RJJA 2E5LF 2B4OA 3SYZA 2UV8A 2V8GA 1QLNA 2ZHOA 3IS9A 4QIFA 2JWNA 4KRWA 5F8HA 4A8WA 1WTBA 1Q4RA 1NK7A 4ERDA 1KVIA 3FEZA 4MIWA 1E6YB 5E3PA 5FDLA 3MM6A 4HEA9 4KHRA 3MHYA 4HT7A 3ZZ0A 1F60B 4ZCKA 1HHTP 3W3SA 1UJ6A 4WFYA 3ZZOA 3RB4A 1ZZFA 3GV8B 5K8MA 4RW8B 3TP2A 2LXFA 2NQPA 2KJWA 3CCJS 2XBPA 4B9LA 2IM3A 2SXLA 2J76E 2EG2A 3BEGB 2Z2LA 2R7WA 1DRZA 1X4EA 3HHLB 1R7IA 2E9TA 3RU0A 3KG4A 3G8SA 1N5TA 4M5DA 3CMAS 1TV6B 4QZVB 2AJ1A 2D3ZA 1S4FA 4MJKA 4PXDA 5HMYA 3OTBA 1VQNS 2NZ4A 5DQGA 2RUGA 2WB4A 3PJWA 3RZAA 2ASYA 3LQVA 3CMES 1LQ9A 2I0XA 4MKYA 4NXMF 3GR0A 4GMKA 1YSJA 4UW2A 5KG3A 2AU0A 2CQCA 4I6WA 3T9NA 2B4PA 1XMBA 4JI0F 3VF0B 3ZFVA 5JUMA 4B9UA 3EGZA 4ZPWR 2DGOA 2XS7A 3DRPA 4BC7A 3VAJA 2FVRA 1ZAVA 2QEXS 5I42B 1LXJA 3IRWP 1QJHA 2CPIA 2CKWA 3DLEA 2ROEA 3OSNA 2CPHA 2FIUA 4DLEA 4OIXA 2ZC3A 2R7RA 5LXYA 3DRRB 3DMJA 3IA0A 7FDRA 2PN6A 3GE9A 1VRTB 5BJRA 1VQMS 2LA4A 4RW9B 4Y2KA 3UD3P 4ETZA 2KRBA 1NK8A 3C6UA 1SKSA 2R7OA 4C8OA 3FSIA 4AL5A 1X0FA 4IH5A 2FJXA 1RGVA 2IBKA 1Q86T 2JJ4D 4RBTA 4X2BA 4DN0A 1I94F 3ICLA 1B0TA 2OPSB 2DR8A 3NCRA 4Z2XA 4YP3A 2LMIA 5KFDA 1KOHA 3UCZP 3E01B 1G1XA 2MQQA 2RQKA 2IM1A 2BQ3A 1T05A 4ZPCA 2GMLA 1G3OA 1LWFA 2ABYA 1FDAA 3BM7A 3FDSA 2UXCF 1FKPB 4BDPA 1CC7A 5DLFA 2DRBA 4NWBA 2KT3A 4WFZA 4FXDA 2ZNZA 4PXEA 1J5EF 3CCWA 4F3OA 1HA1A 4WXOA 1R43A 4ECUA 3CC4S 3DRRA 2FHJA 4FPRA 1ELOA 4LQ3A 1TKZB 2RRAA 2EFPA 3SZ2A 3RRHA 5B0DA 1BLUA 5FD1A 5DGAA 4Q0BB 4LF6F 1FA0A 2CQ0A 5T7LB 1TL1B 1S79A 2CRLA 4AFFA 2OPPB 1S76D 2E29A 3KMSA 2IRYA 2VV5A 3MF5A 4JV0A 1BWEA 4FBUA 1DJ0A 2RT3A 1QUPA 4BWMA 1FE4A 3AH6A 4XIUA 4RU2A 2ERRA 3BGUA 2E5HA 2CQ3A 3ZZZA 3HZGA 4O44B 2XWXA 2HHSA 3I4HX 1SI9A 4MYTA 3VAMA 2HPUA 1JLQB 4Y2IA 1GNKA 3BQ1A 1T8EA 2AYMA 2R7QA 2GNKA 3C46A 1UWBA 1Z2LA 3FRZA 4CI0B 1FRIA 1S72S 2PI5A 1W2IA 4CH0S 1D1UA 4LSNB 1N5QA 3GMGA 4MYUA 3C6UB 5A8WB 1KC8T 2DPJA 5JVGQ 4OHWA 5KTQA 1Y4ZB 2DIVA 4DDFA 1HBOA 1DTTA 4TU8A 3J7ZT 3CCTA 1UL3A 3CCZA 2B4VA 2M52A 2BM0A 4AXIA 4YFUA 5AJ3F 4O3RA 4TKTA 3T6BA 4YQWA 2ASLA 3OFFA 4RNMA 4ILLA 2DK2A 1KONA 2DNNA 4NLQA 4FS1A 1HQEB 5CQGA 2Z8QA 2RQ4A 3N6LA 4JI2F 4JI6F 4J9OA 4JYAF 3TUIC 2P9EA 2XGPA 2XSJB 4KHMA 4UQGA 2V94A 4OHXA 2QA4G 2FJBB 4L72B 2V8VA 2HHQA 4P6QA 3CT9A 2MHNA 4PKDB 3KYLA 2ZH1A 3HHKA 5KG5A 3MMBA 5CHCB 3H25A 1U8SA 1KQSR 4V19X 2CQDA 4WF9Q 1OPZA 3CTRA 1LW0B 1LWFB 3FFIA 2AX1A 2Q6CA 2VG6A 5BYQA 1U45A 2QSFA 4X4SA 3VZHA 2X3GA 1SL2A 1JX4A 4DSLA 1SJQA 2N7CA 4NYPA 2CQPA 1LOUA 3M1VA 7FD1A 2V0NA 1D8ZA 2HLTA 4ID5A 4C0HA 4DG1A 3MEDB 3HFKA 4Q8EA 1NH7A 2F8EX 5GAGI 5CXTA 2AJQA 4KPYA 3IWNC 1H3DA 2OPSA 2MKHA 3M30B 3ZZYA 2VH7A 3DRYA 3K8WA 4U7CA 4WFBQ 2MGZB 5HP1A 3HVTA 2VBZA 4GO5X 3QIPB 2Y1RI 3OQ2A 4PQAA 1ZYQA 1CQNA 1RISA 2AJ0A 2PGCA 1DBDA 1G7CB 3C6TA 3KK2B 1NH8A 2ADBA 4U7UK 1NJWA 2JVRA 3LWMA 2DNGA 3RAXA 1S49A 3MMJA 3PRBA 5DLGA 3I55S 2KH9A 1X4GA 3KLFA 1U25A 3W2WB 1D3WA 2P6SA 4FXWA 4K5SA 4OI0A 2RB7A 2C22A 3K5NA 4FF1A 2E1AA 5L1JA 3BDEA 1HYSA 2RNEA 1VMBA 2W24A 3FRYA 2JDJA 4LF7F 2YWFA 3H2VE