4AXIA

Structure of the clostridium difficile euts protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
b'TEESKQRVIQEYVPGKQVTLAHIIANPNEDIYKKLGLVLDKKDAIGILTITPSEASIIAADVATKASNVSLGFIDRFSGSVVISGDVSSVESALNDVLEVLGNMLNFSSTKITRTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ETHANOLAMINE CARBOXYSOME STRUCTURAL PROTEIN
publication title Structural Insight Into the Clostridium Difficile Ethanolamine Utilisation Microcompartment.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Structural protein
total genus 27
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4axiA00
2A18A 4LIWA 3I96A 4OLPA 2A10A 5L38A 4OLOA 4QIFA 2G13A 3BN4A 3SSQA 4DDFA 3SSSA 4PPDA 4QIVA 4AXIA 4P2SA 4RBVA 3PACA 3NWGA 3SSRA 3MPWA 4QIEA 3CGIA 3VCDA 2A1BA 3N79A 4P7TA 2EWHA 4AXJA 5DJBA 4QIGA 3H8YA 4OX6A 4RBTA 4OX7A 3MPYA 3DN9A 4P7VA 3I6PA 4RBUA 3DNCA 3NGKA 3CIMA 4OX8A 3IA0A
chains in the Genus database with same CATH superfamily
1O8BA 2MKCA 3MM6A 4IFVA 1PBAA 3CMAS 3MMCA 4TU8A 3RRHA 4TY8A 3AT1B 3KOAA 1C1BB 3E8OA 3GYXB 3HHLC 3TZWA 4N41A 1Q16B 4ALZA 1S5ZA 4DS5A 2V2QA 4CLTA 1FCAA 1TKTA 4NPOA 3HO1A 1RT6B 4DR7J 2YKQA 5DGAA 3FBEA 1JLQB 4KYZA 4AL6A 3OR1A 3D2WA 4OI6A 2JEFA 4WKYA 2F4VF 3N79A 4OIXA 2ABYA 1VJWA 3H8YA 1WG5A 1GMUA 3I31A 1C4CA 4E0DA 4A8SA 3SSSA 4ZVRB 4O0NA 1GX6A 1I5OB 2VG6A 4JV5J 4KGVB 6FD1A 4M5GA 4WZMA 3AH6A 1Y10A 2B4PA 1NB2A 3CCES 1H7XA 2HGMA 2QA2A 3T1YF 1PC5A 1IKYA 2A2CA 4EEYA 1RKIA 1RT2B 3BGLA 5EWEA 1NSPA 3RB0A 2ZBQA 4R5PA 3CCZA 1K9MT 1HNVB 5KFPA 5E2QA 2MKHA 4ZVSB 1RUSA 4J37A 2F8MA 3RBXA 2LA4A 3TANA 1HNWF 4DUYF 4DG1A 3W8GA 3MWBA 3FMBA 2DD8S 1UVMA 4LIWA 4OI0A 3BO2A 4KO0A 2XMWA 2EI5A 5AJ3F 4M5JA 2XMKA 3KK1A 1LNQA 1IVZA 4Q45A 4WP3A 1SUQA 4OQJA 2GZOA 4GC6A 2PEHA 1JLFA 4X64F 2IYGA 1JLAB 2BJ1A 1QAJA 3QSYB 3DHWC 4ZHRA 1C1CB 2RD5C 3GMGA 2MB0B 3SZ2A 1TL1B 3FCWA 2RDJA 3V6DB 2RS2A 2R2UA 3KHLA 3U1MA 1B4SA 1T9VA 5J2QA 3R1LA 1VC5A 1X4BA 1RAFB 2UXCF 2CG4A 1AROP 3MM5A 2YWWA 1RE1B 4JUZA 5HAOA 3GSIA 2FIUA 3LOUA 4I6WA 4XO0A 5EX0A 5F0WA 3TVZA 2VD3A 3OBIA 1LWFB 1WDTA 4DZ6A 1HNIB 1RJJA 2IRUA 4A8OA 3NL0A 2LMIA 2MZSA 4EZ9A 3MF5A 3K5NA 2XMUA 3QFWA 3TO8A 4LQ9A 4HH0A 1ZS6A 2G1DA 3PYDA 3CJ3A 4X4VA 4YY3J 1WEZA 1FJ7A 4EK2A 1H6KX 3V2UC 4LF8J 3UO0A 1QAYA 2B0GA 2R7WA 2MQOA 4ILRA 1U6BA 3MM7A 3GIJA 1KHVA 4B3RF 4FXDA 3QAUA 1YG0A 1UJ6A 2VQFF 3UN3A 2D9PA 4PWDA 2KM8C 1KONA 2NXJA 2E7XA 1JJCB 4ZJOA 3TZZA 1LW0A 3N6LA 3BH7B 3IXQA 5KOXA 3GCWP 2MXYA 2CVEA 5KT2A 3SIPB 5CH7B 1D3WA 1YWXA 4JI8J 3MPWA 3MEDB 3NKYA 1PAEX 5LXYA 2ZC3A 1IM4A 3S01A 1S10A 4MYUA 4DUTA 2VZ9A 3TVYA 1EJ7L 4UY85 1IBMF 2DNRA 2AEJA 3SBMA 3CDEA 3M7VA 5KFOA 5BXIA 2FHKA 4K4ZA 3ZZOA 2FTRA 5K9FA 3CCQS 1TFWA 1JX4A 4DFKA 4CRJA 2B6AB 3ZTQA 4J90A 1RA7A 3NMRA 2LU2A 3DRRA 3GFYA 1HLWA 3PO4A 1SI9A 3D54A 4EFAC 4AL5A 2K3KA 3M2RA 3DOLA 3GR0A 1NHUA 3C14A 3WX8A 3H5UA 3BS9A 2KXNB 1L3UA 2ZHAA 2UV8G 3OXLA 4DR6F 2W25A 1OQ3A 3KUEA 5FDLB 1YJ9S 4I67A 1VBYA 4XDCA 2VC1A 4WCEQ 1D9AA 3NMAA 2GHWA 3CO0P 4N8NA 3LGNA 3EGNA 3PW2A 1M1HA 1F5AA 2Y0BB 3NWGA 4O3OA 4USIA 1RP5A 2YWHA 1LWEB 5KG6A 1XWLA 3QWPA 4WFYA 2UXDJ 1EHWA 2ZH9A 3KLIA 1GNKA 1BQNB 3M32B 4M95A 4J9KA 3JSMB 1VBKA 1DTTA 4CLKA 3K89A 2HHHF 3DOMB 1YRTA 2HRTA 3HVTB 1FFGB 2BJ7A 3PHTA 1FRJA 4KKOB 1XR6A 1DARA 5K5MA 4OHXA 2JDJA 2CQ3A 4CH0S 3C16A 3V4IA 1PYTA 3G6YA 4MFBB 4LJMA 2EBGA 2H4WB 3TEGA 3UW1A 2DGTA 4OZNA 1VRTA 4ZP9A 1BC6A 1PKUA 4ES1A 1YJNS 2JSXA 1FX2A 2KFNA 4P75A 5ETNA 2Y9HA 2UU9J 1WF1A 4Q8EA 1E6VA 1X9MA 2L3MA 1GK8A 5KAKA 1FFWB 3POTB 1K1QA 2UUBF 2MQPA 1CLFA 3RUBL 5HVFA 2DB1A 3BGFA 3SCKE 3EX7B 4X2BA 4FDFA 2COLA 5D78A 3K2YA 2MQNA 1KWMA 1RDRA 3BKTA 3CDBA 3ZO7A 1N8RT 2CDQA 2GIFA 3CCLS 2DNQA 3M8YA 2UUCF 4WTYA 3ELHA 4FYXB 2PE8A 1LW2A 1MWQA 4X65F 4IR9A 3LP2B 2QMXA 1RWMB 3PIOQ 1RT4B 5FJ4A 2AEFA 2QLXA 2CPHA 3CCJS 4OX9J 1HBOA 3G8TA 4WJBA 1MLAA 3ZZUA 4NLXA 4ZPTR 2FZCB 2ADCA 2VFVA 4OZ5A 2H54B 5H9EK 4LRCA 4RX6A 2XSFA 1S1TB 4R25A 1ZYQA 2DNMA 4PRFA 1XMOF 3OR2A 2WBRA 2JLFA 4OYZA 3TAPA 2ZNYA 3KMSA 3A3PB 4EZ6A 4LT6A 1GH8A 3BGRA 1S0OA 3G2XA 1NKBA 2AGPA 4OL8A 1S4FA 1CJVA 1WHWA 2LVWA 2C2EA 4ZVHA 3LGMA 1FXLA 4FVCA 1BGXT 4HVZA 4KH0B 1SQEA 2CDRB 2ATCB 2Y8WA 3G6VA 1NHKL 1U6ZA 4ZPVR 4F7VA 1R8BA 2AX0A 2ZUAA 2WAQD 4WK3A 2D1CA 1NRKA 4MMOA 2LCWA 4YB5A 2MQMA 3PM9A 3HI9A 2A6OA 1CQNA 4QWCA 5D77A 2KO1A 5KG4A 1XJWB 2LXIA 3QFHA 5BYSA 3OFGA 2CJBA 3S8SA 4ANEA 1U1PA 1U49A 2XLJA 4ZOSA 4RU2A 4DPTA 3R2DJ 2F7VA 4DV4F 3RGIA 3IWXA 2VH7A 3CPWR 1RXOB 1IR0A 2VU5A 1DJ0A 3DDIA 4GVBB 3EDRB 4NLRA 1UW9A 2P9EA 1OYDA 1H72C 2LEAA 3CNQP 3PHEA 2KXHA 3A4TA 4BDPA 2RF2B 4HT7A 2DXEA 2R2TA 5J2NA 4NRUA 3NEKA 1DTQB 4QIGA 1WORA 3FMWA 3OPKA 1SH2A 2PGCA 4USJC 1HA1A 1YJ7A 1SJFA 5D4OA 5JVGQ 1EX8A 1S9FA 4TN2A 4DPYA 2DNLA 4DSFA 5KFAA 1QE1B 2A1BA 1HWUA 4JI6F 3ZTSA 1JK9B 2F5GA 3R5AA 1W2BR 4O3QA 2HGLA 3IN5A 2DITA 1RT5A 4F0KA 3RAXA 1TKDA 4JI7J 3VAMA 4P7TA 5B0GA 2XI3A 5BR8F 1XQIA 3PX0A 3BH6B 3MEGA 4H4OB 2XMJA 2HHUA 4DV7J 4YS2A 3GB0A 2HNDB 1WEXA 1FWKA 4Y2MA 2OSRA 1WOOA 5ETPA 1W2IA 4HT5A 1TAQA 2BW2A 2CPXA 4CZCA 3HFKA 1MMNA 1X5TA 1JXEA 2DT9A 4O4GB 4MKYA 2ZVSA 1C2PA 3IG1A 2IMWP 1HQEB 2ZDOA 2KZMA 2HFUA 3DOKB 3IR6B 3MURP 4F4KA 5F0UA 1LWCB 3J7A1 4DV2F 1Q7LB 4DFJA 3ISND 2JOQA 1TK8A 2WW4A 1HBUB 3PY8A 2L48A 3I0RA 2DEIA 2GQ2A 4P74A 2M7SA 5B0EA 1RBAA 1Z2LA 2OLWA 4FNIA 4IDKB 5I3UB 3P49B 2VBYA 5M2RA 3TUJC 3TYTA 2N82B 3JQMA 4WKRA 4A8YA 4WFBQ 2IM3A 2QGFB 4ZPWR 4LIRA 3FC9A 1UWBA 5DZ7A 2B9YA 3W2WB 3JB9k 4YDDB 1DBDA 3FZ2A 4CYUB 1LV5A 1XNRF 4GO7X 3SV3A 2WOMB 4WP9A 2VASA 3X1LB 4WXOA 4DV3F 2DRDA 1R6YA 3Q8PB 4WK1A 1IKXB 1VQMS 1NK8A 1RAOA 3ILIA 2R4FA 1SV5A 3M8PB 2V2KA 3IFEA 3QMQA 3AY0A 4U6PA 1KQKA 3OL7A 1NXIA 2W9BB 3FSXA 2ATLA 2DR5A 4K4UA 5F3TA 1O6XA 2ZDPA 2MPUA 3U02A 2W2PP 2CQ0A 1M5HA 1QJHA 4OZ3A 3IWNC 4A8MP 4DL2A 2BVZA 1Q5VA 3V81B 5E7OB 2AIRB 1WSVA 4RW7A 3LQVA 1KP6A 5HLFB 5KG7A 1U1MA 3ENQA 2NXEA 4FYDA 3I5AA 4UQGA 8ATCB 1I1GA 4PWUA 3GYNA 2QLBB 1Y5NB 3WBZA 4U9RA 3BO4A 4KPYA 1V3SA 2H48B 4WFNQ 4FXWA 3IGVA 3KLVA 2N3OA 2PD1A 4X4PA 2QV6A 1U09A 5HP1B 2JWNA 2XHWA 2HK2A 4G1QA 3I96A 3QIDA 4OYXA 2LU1A 2BW7A 2W4DA 4HHHA 5C5JA 1REVA 3D66A 1VBZA 1HNZF 3MPUB 1FTRA 3N0VA 2ZH6A 4ANCA 3KKFA 2GJIA 4DL4A 5IV3A 4LRAA 4R0JA 2FVSA 4OZ1A 5D0GA 1H7WA 1NM2A 2ZOMA 5F8MA 2CG8A 2BE2B 3OHAA 1UVLA 1S6OA 3OV7A 2IAJA 2UP1A 4CLYA 2OPRA 1T3OA 4QYRA 2B8PA 2B56A 2DNKA 4DL0C 2NQPA 3L09A 2G0IA 3RTVA 3RJMB 2RIJA 4NLWA 2OO4A 3F73A 1H74A 3BDPA 2NXCA 4DR5J 3C8YA 1ZH5A 4DPOA 1HPZB 1S76D 4QU7A 2OFGX 1QD1A 4WTOB 2G1HA 4RUHA 1ELOA 1NJYA 4DDFA 2E5JA 5HMXA 1RB0A 4OZ2A 4QR1A 4JI2F 2MHNA 1QSLA 5DZ6A 2JRSA 4V19J 1FKAF 3KUHA 1BY9A 3GTYX 4ENOA 1MN9A 2OPQA 4I2PA 5KG2A 2DISA 1VQ6S 2YNIA 2QA4G 2IYIA 4PXCA 5A8WB 1WC1A 3D0IE 1RKJA 3QJLA 3FSYA 3J7YU 3A3NB 1EQ0A 2J0QD 1TUGB 3QZ8A 1QAXA 4TQRA 1HI1A 1IQTA 3AD7C 3FK4A 2I9SA 4B9UA 5F8LA 1KOOA 4QWAA 3OFEA 4H4KC 1GXLA 4B3SF 2GAGC 4GKKF 4B9LA 3KWMA 3QPIA 1ZZFA 2R7SA 4R8UA 1SJ1A 1S9GA 4OLOA 1R0AA 4YHHJ 4O44A 1QM9A 4F25A 4N7TA 3OVBA 4USTA 1FJGJ 2MJNA 2XO7A 4DOZA 4EO8A 2E66A 2JLEA 4QR0A 3EUNA 5KFGA 2MZQA 2VDHA 2DIUA 4RUCA 3DKDA 5DS7A 4LF4F 3THTA 4DV6J 1RTDB 3AA9A 2HKEA 3IMQJ 1X4HA 2NREA 1FE0A 1JLEB 3IR5B 3OTDA 4FF1A 1RWKB 1HW8A 2GNKA 2C3OA 3CEDA 4DQIA 2G0CA 2KT3A 3TP2A 3T5HA 4LFAF 2CJ9A 5B09A 1OWXA 4OX6A 2V6AA 1KVKA 3J7AN 2V2VA 1D1UA 1E6YB 5HBMB 4CM2A 4AL7A 1T9XA 2FZKB 4KGZB 3T5JA 1U2FA 3I6PA 3N01A 4UQTA 2FJXA 3W1YC 5HK4A 3K5LA 2BKOA 2XLKA 1TZ0A 4RO0A 3BV8A 2XCPA 1FKPB 4YR2A 5D4PA 4YB1P 1RLDA 4UOGA 4NX9A 2A18A 1UEVA 2AJQA 3JTOA 2FHJD 1FNXH 5D8HB 2ZD1A 3M2UB 2ZM6F 3JS9A 2E5IA 3L95X 3N5FA 1UKUA 3LW5C 4X4UA 4F4WA 1B0VA 4WYWA 1VQ4S 3W65A 3UD5A 1TL4A 1K0VA 3M6WA 4A8QA 3NWRA 2DKOB 2VFRA 4D3HA 2W9AA 1VCTA 5KFWA 2DPJA 4CO4A 1SJRA 3N6MA 1AUDA 5KFRA 3W64A 3CF5Q 1RAJA 1YGYA 2DR8A 5H9FJ 2GVDB 1FEEA 5E33A 2J6TA 4MK8A 3BO3A 2KL8A 3NNAA 2CPYA 4IUFA 4I2QA 2MY7A 5B0BA 5HJYA 1U7LA 5GADU 3AA8A 4A8WA 3VAJA 2X51A 3L9ZA 4Q7AA 3PRVA 4FZVA 1HW9A 1BWEA 3ADAC 1U2RA 3ZNJ1 4NZ6A 4YN3B 5LJ3Y 1G2EA 2OGUA 3OHBA 3TI0A 4NE9C 3TJAA 3MTJA 3BZQA 1H38A 1F60B 1WDDA 2BM1A 4IQMA 5F8HA 2FDNA 4ILMA 1S9EB 5HO4A 2XO6A 3Q2SC 4K4YA 3C2PA 4RKUC 4AXJA 4C3LA 2GJ2A 2CJXB 5M2UA 3QT6A 1OYEA 1X9WA 1Q95G 2EFNA 1W25A 1N36J 4RW6B 2X1GA 1KVJA 4ZITA 1LK7A 3Q8QB 3FRYA 4PG8A 2F4FA 4L76A 5KFEA 1R31A 4Z7YA 2LA6A 4DPUA 4ZPCA 3THVA 1C1BA 2DO0A 3BQ2A 2EXUA 1U0SA 1TFYA 2BRKA 3KJNB 2KJVA 1R43A 3ZFVA 3HKZD 2DNOA 4QIFA 2U2FA 3GV5B 1RT6A 4TLRA 4DV0F 2FY1A 2VODA 1JLQA 4B02A 1SC3B 2OEKA 4P7VA 2XMAA 4CCHA 4QBUA 2RT3A 4LREA 4J9OA 4AXIA 4JI4J 4RLEA 2ADBA 2JZ5A 2DHGA 4MKVA 2C2MB 4ELUA 3KLHB 2AJFE 1X9SA 3PJXA 2XZDB 2RUGA 1NK7A 2EPIA 1N54B 4CIOA 1VMBA 3FEYB 3VAGA 2W2MP 4YFUA 4DF8A 3BBCA 1C0TB 1V3RA 5I42B 4JV1A 3EGWB 4YR0A 1IBLF 4J9UE 1EZZB 2PA3A 3VALA 3UVJB 2V94A 2LP4A 1D0EA 1RGVA 4F36A 3QWUA 3AQOA 1H0HB 5MAOA 4XPEA 4NYZA 4IFYB 2GMJA 1RT2A 2LEBA 3G96A 4LQ3A 3LO3A 2UUWA 1XMQF 2FD2A 5HATA 3GP9A 3MI7X 3NGSA 4EMDA 1HNVA 1QVGR 2W2OP 2I8EA 4G65A 2J76E 4ZLLA 4QWBA 3U1NA 4M5KA 1RHUB 4ZVTB 2XY6A 1SL2A 1WTFA 1TUWA 4ZCLA 3MGJA 4BWMA 2HK3A 4NA3A 2W7AA 4ID5B 4E8UA 1XC9A 1FNOA 2FUG9 4F8RA 2NYIA 3DLGB 3SCIE 2CPEA 4KC5A 3SSQA 5J2MB 3TX0A 2OTJS 4HEA9 2ZBPA 1TU0B 5KFQA 4J9SA 5CYMB 3JSYA 1JLAA 4QYZJ 2NZCA 3AOAA 1C1CA 1X4CA 1BLUA 2ZEJA 3KK2B 4ECVA 1TL1A 5LL6d 5KFCA 4HDHA 2VBWA 5GAEI 4M5LA 3V6DA 2V9KA 3KTQA 1YRUA 1WOPA 3HF5A 5D0RA 2AWZA 1VQ7S 4V19X 3CJ5A 3CXCR 4PG6A 5LMUF 5GVQA 4DEZA 3DLJA 1P27B 2JEJA 2F3JA 2VONA 3HLUA 1VLOA 3E51A 4YUDA 4ZP7A 4DHVA 1UETA 1FJGF 2M2BA 5K8OA 2HVHA 1QLNA 4DX5A 1EARA 2AD9A 4M5HA 2XEXA 1K1SA 1N5SA 3H2VE 5DQIA 4P2FA 1LWFA 3I32A 4USKA 2HGNA 2B5JB 3RBDA 1HNIA 5IWAJ 2HVDA 3EM1A 2CJKA 2M8DB 3WIVA 1SJ3P 2WZ1A 2QX0A 4X4RA 2BQRA 3T3FA 2V5HG 3DM2B 5KT4A 3D4JA 3TJ9A 2PO4A 3CD0A 1F6TA 4LFBJ 5CYQA 2R7OA 1KD1T 2VKZG 1TR0A 3ETMA 4V1Ak 1WELA 3L3CA 2R8HA 3N28A 1S79A 2UVVA 4Y00A 2IY5B 1UP1A 4TXSA 4I7FB 3GSDA 4P10A 2KTQA 3OTOF 5B08A 2G2YA 5E3CA 3TQ1A 3G71S 3N5BA 1A6LA 4FXVA 2RHSB 2YNGB 1HMVB 2BANB 1ZPWX 4LF2A 4C8LA 3IRWP 2DR7A 2HQIA 2KRBA 3OL6A 4CH7A 4CLLA 3MXHP 3MEDA 4C0BA 1X4EA 3GILA 3TW0A 2BA9A 3VAHA 4L75A 4NLPA 4AQYJ 3H25A 1EQMA 1PIEA 2RDIA 3PW4A 2FJBB 4LF6J 4LBPA 2E5GA 3V4MA 3NGTA 3RZAA 2OP5A 1U1LA 2B6AA 2V4QA 3VQSA 5J1NA 2MSTA 1L3KA 4RBTA 1H3DA 1S1VB 4XTTA 5ETLA 4FF4A 2RU9A 3H5YA 4F4AA 2K3IA 3D67A 2HNZB 1RLCL 4NRTA 2A2DA 1NEEA 2V8HA 4NLSA 4K2JA 4KB7A 3NS7B 4JBCA 2MTLA 1HARA 3T9NA 5FDLA 2QSWA 4MKAA 3ZTOA 3M8ZA 4FNHA 2ASJA 3DMJB 4C97A 3HT0A 2OUGA 4QIVA 1RHMB 1LWEA 2VPYB 2YKNB 2KN4A 1TKZB 1BD6A 3GE9A 1BQNA 2XWYA 3M32A 1UEUA 5KFLA 2HRYA 3JSMA 3NG8A 4IG3B 1VIOA 2V63A 1CC7A 3DC2A 4I1TA 3DOMA 5IC4B 1N36F 1U0HB 4NZ0A 2KH9A 3HVTA 5F8IA 1J5EJ 2XM3A 2W7PA 4ED8A 5KFDA 3GZ7A 2VPXB 4KKOA 4J9PA 4OZ0A 1CEZA 2HZCA 3JTNA 2V9WA 3JSBA 2NS1B 3J7Z5 2AJ1A 1QUVA 2J9CA 4MFBA 3CC4S 4YEAA 3QGPA 2J9EA 5KT3A 3HKWA 2ALYB 4HL9A 1CULB 1I94F 4PZVA 2ZUGA 3VZHA 3Q8YA 3I0SB 1KN6A 1FF2A 3BM7A 5EX3A 5HROB 5D0HA 2H9ZA 4PWWA 2B7BB 3CSKA 3POTA 5HMYA 3CCSS 1G4CA 3BKFA 2VG5B 2YQ3A 2DNGA 3UNYA 2QFJA 1S7HA 4WE1B 4NI2B 4CT9A 2YVSA 4PXEA 4TQSA 1NPPA 3IO1A 2PN6A 3HD2A 3IGNA 3O44A 5DLFA 2Z30B 1HHQA 3H90A 2XG8A 2IVYA 2BJ3A 2Q6BA 2MLXA 3LP2A 1RT4A 1M5OC 1HWKA 3VQTA 4TYAA 3GIKA 4IOBA 3BF4A 4CO5A 1VQYA 2CQ4A 3NNHA 1K47A 1P6TA 3MFHA 1O0PA 3T1HF 1ZA2B 1JWWA 2CQGA 3Q22A 4N8OA 3MM9B 4O3RA 1S1TA 1CG2A 2ZH3A 1RAEB 1KDNA 1SC4B 4E98A 3Q83A 1U1KA 4CDIA 1F9FA 3NS6A 3P8BB 2V8VA 1S1UB 2R9LA 1UEKA 5ETMA 2I2YA 3BSAA 2OFHX 3UQSA 4PAAA 1XNQJ 5EN1A 4IH5A 3DGPB 2R8IA 1VQ9S 3KLGB 4LSLB 3Q8UA 3ITHB 2J0XA 2B3TB 4RNFA 1LQ9A 2FLPA 3JXOA 3HHLB 3SDEB 4H54A 1TL3B 3TZXA 2HWTA 3MAHA 5JUMA 5BYRA 3FSIA 2ZNZA 2JVRA 3V6HA 4J9NA 4NEYA 3HD1A 4RW4B 4PG4A 2V8GA 4AFFA 2MZRA 2AYBA 3AB4B 4WU2A 3DI6B 3B82A 3VCDA 3ONQA 4WU3A 5DM7Q 5DETA 1PYSB 1SQFA 1AB8A 2XTJP 2ROEA 4Y2CA 2WW8A 5G4DA 5A76A 4FKXA 4QIWD 4C6AA 3OSNA 3KG1A 4JYAJ 3BYRA 4ZJQA 2AYGA 5ETRA 3CWJA 2J9DE 2A3JA 1UA0A 5DDOC 4GVBA 1U6FA 4FYYB 2QZ8A 2CQ1A 2AX1A 3H59A 2RF2A 4DX8H 3LPEA 4C8NA 1UAWA 2V69A 3CO9A 1DTQA 5DDRC 3MMAA 2F4VJ 4RUAA 4C8MA 3PRBA 4HR2A 5HVHA 3DRXA 2ASYA 4J9MA 3HULA 2P9GA 2M5YA 4ED2A 1QE1A 2VIHA 1XTZA 2YNHB 3SQGB 2XYGB 4B3MF 1SIZA 2ZFHA 5CD4H 2MQLA 3RR8A 5D3GB 1FFSB 5LOQA 1YHQS 2Y8YA 2PMWA 1RAGB 2IBKA 5GAEU 1VISA 3MECB 3D5MA 2DY9A 4EUVA 3R97A 5KT6A 2GAHC 2IDLA 3T1YJ 2YWEA 3OLAA 1TQLA 2EG2A 1ZETA 5B0AA 2OIHA 1X7VA 3BSCA 4NCGB 5T7LB 1T0TV 1GMVA 4H4OA 1T95A 3B54A 1GTHA 3LP1B 4DQRA 3TWZA 3HPOA 1ZM4A 3UCGA 2HNDA 7AT1B 1WACA 4OI3A 2CA9A 1HNWJ 2HFSA 4DUYJ 1N0VC 4C3MA 3OLBA 2C3PA 1YJWS 4IRKA 1MG7A 4EBCA 4OHYA 3A3OB 3ZNUA 4W4MA 3NOGA 1KBRA 3I9ZA 4FS1A 1T3NA 3RR7A 4JV2A 1KVIA 1MWZA 1FTCA 5AJ3J 4OYOA 4O4GA 1SC6A 2BMBA 2OPQB 1HQEA 3JAMY 4LRFA 2Z56B 3C15B 3IC1A 1SCJB 2BKNA 3DU6A 1TTHB 4X64J 2X1BA 4PQAA 1LWCA 3PO5A 3TQEA 2V67A 4KRWA 2DXDA 2VC0A 1FWPA 5L46A 2F40A 4EO6A 2ZH5A 1HBUA 2KG0A 2EFQA 1FWLA 3L7UA 1OSCA 4K2XA 4IDKA 5I3UA 4KR0B 1SIWB 3C3LA 1NDLA 3KLEB 4EBDA 1S9GB 2J5AA 1FDBA 2GIRA 4ZCKA 1RT3B 1ZOTA 2NXNA 3Q2TC 1FE4A 2UXCJ 2IJRA 5EDWA 1WG4A 3E01B 3GV8B 5DJBA 4JI0F 1NO8A 2ZH2A 1S6PB 2VKRA 3W2WA 3QJPA 3R5BA 1B3TA 4CYUA 4I69A 2CJAA 2WOMA 2V8DA 4C0OC 2JC0A 1XR7A 1F2GA 3WQPA 1IKXA 2IHR1 3M8PA 3D68A 4DR3F 1SJ4P 1F0XA 2BDPA 3DXSX 5AE1A 4FBUA 2W9BA 4H4MB 2FHMA 5LSOA 1F2HA 3S1TA 2O67A 3MDFA 5CAAA 2WHOA 2RMLA 3S7RA 3NBPB 1UW4A 2DTJA 2GCFA 3DRPB 1K73T 4IOAQ 1CPZA 5HSPA 2BE9B 4NASA 1NMEB 3P3DA 3MZIA 1YDLA 4C48A 4HTIA 4KJIA 4B3RJ 1Y5IB 3AQPA 3NGKA 3H40A 2E1AA 2VQFJ 2JEGA 3MCSA 2MZJA 4ZPBA 1X5SA 3MUTP 1IBCB 5HLFA 1F5BA 2E9ZA 1I51B 3D1QA 3SYZA 1VRUB 3WX4A 2G4BA 2CQPA 1PG5B 5F9LA 2JFKA 2YKAA 4GKJF 4LF9F 1AA1B 2UXBF 1VHFA 5HP1A 4MH8A 5M2PA 3ENWA 3TJ8A 4WWSA 1R8AA 2QT7A 1WHVA 2DCUB 2Z0GA 1WUUA 4RWWA 1VQSA 2DNHA 1U25A 3UR3C 5AE3A 1DURA 3JAMU 4D3GA 3R1HA 5AXKA 2HHSA 1T05A 4WPAA 1VI7A 1URRA 1VQOS 4O4RA 4F4XA 3HHNB 2MYFA 4XK8C 1P9YA 5KFTA 2M9KA 5E41A 3C66A 2BE2A 1U4BA 5LT5A 1VQ8S 4Z7CA 1T9TA 1JLBB 1FRKA 3MUVP 2JX2A 1H2UX 4NXNF 4DR6J 1PO6A 2WVBA 2ZITA 2P2CB 4M5DB 1FJEB 4OLPA 3BEGB 1JMTA 4DUZF 1VYAA 1U1NA 3OXGA 1WOSA 3DU5A 1HPZA 4ID8A 4URSA 2XMVA 1S97A 2CPFA 1ICEB 2VFUA 3TNVA 3GFHA 1P1TA 3T1AA 4HYKA 5HMWA 4ETZA 4NXMF 3ZTPA 3PW7A 2VJVA 3JYTB 1VLYA 4RL1A 2RQCA 2NYHA 4K7QA 2H1YA 1WI6A 1GQEA 2HHHJ 5IOLA 2XCAA 2PA8D 3MD3A 4Y28C 5B0FA 5A8WA 3BDEA 4DCPB 2MKSA 2ASDA 3BYPA 2AKWB 4ZLNA 2CWXA 2KRRA 3HFZB 3KG4A 4DR2F 4KFBB 1X4FA 1UA1A 2YXLA 3M8QB 1Y00A 2W01A 4JYAF 2DGWA 2FJEB 3FQKA 4W92B 1UZDA 4NLUA 2LQ5A 4LR9A 2HPUA 3MEKA 1ZTWA 3SCLE 3CD6S 2QA4S 5LM7E 2B51A 3ZZTA 4PPDA 1AZSB 2ZKUA 1NK4A 3D6MB 1FD8A 2FY8A 5GAGI 4IOCQ 4MKBA 1WHYA 4KHPF 2UUBJ 4JP8A 3MPYA 4NA2A 1IM6A 3B8HA 2R7XA 2GJFA 3TAMB 3I4PA 4ZN3A 1WEYA 4WFXA 4PG7A 2I0XA 4KHMA 4DN0A 1RTDA 4NWBA 1G6BA 2D7SA 2HNYB 1M1KT 1N4LA 3O1LA 1YJVA 4EGLA 1JLEA 2UUCJ 4MT1A 1NAQA 1G3OA 1YJRA 4ECYA 2XQCA 4U7CA 1S1WB 4X65J 4FP9A 4OZJA 5F8JA 2CFXA 2V0NA 5K8PA 3IAS9 3SFUA 2XNQA 4DN9A 4ECRA 2X1FA 1VGYA 4RW9B 1WC6A 1E6YA 1DQ9A 2RRBA 5HBMA 1SL1A 1HR0J 3BQ1A 4LRBA 3WDOA 3BR9A 1A9NB 4LSNB 1HBMB 2BXJA 4DX6A 2DEJA 3UI3A 3MOZA 2O3DA 5ETOA 2JC1A 3Q24A 1FKPA 2VV5A 3EZUA 3V5RA 1T7PA 2HQFA 4RU9A 2AJ4A 1OS5A 4RUBA 1XMOJ 4OZLA 5IM0B 5GAHI 3W2VB 3ZZRA 2W8LA 4HTJA 2E1PA 2RRNA 1D9DA 2VG7B 3M2UA 3MEEB 3OTCA 1CJTB 2BABA 4P52A 3EYZA 3AAWB 4PYAA 2RRAA 1NKCA 3RU0A 2KI2A 2EWHA 3KDNA 4QW9A 1T9UA 2VFSA 2V50A 1FKOB 2DGQA 3Q89A 2XSJB 4C8OA 5K8MA 1RTJB 1GTEA 2QIFA 4CM0A 3MHYA 1NBEB 5SUHA 5B0CA 3DLLQ 4R0EA 3FBFA 9RUBA 2GVDA 2CNLB 3CJKB 1RTZA 4TYBA 2HMIB 1UVNA 3R6LB 4F4YA 2HHWA 4BS2A 5HQMA 2GO8A 5DQHA 3J80Y 1ZM3A 2QO3A 2VF3A 4PCQA 2OH2A 1QTNB 1HQ2A 1FDNA 2OPSB 2W24A 2Z58B 3TA0A 4DV4J 2RNEA 4J9QA 4ED0A 2JH3A 1FERA 4HKQA 3CJ0A 1N33F 1NKEA 1J2VA 3LANA 4I4BA 3PX4A 3LP0B 4WFAQ 3H42A 3PW0A 3DN9A 2LECA 1HQUB 3W5ZA 5CYQB 3PCOB 4JI1F 1S9EA 4K5SA 2ZH4A 3H5SA 1L3SA 3AODA 3FBBA 3DLKB 2CZVC 2DXFA 1D9FA 2XYPB 3AJ1A 2CPJA 3T6BA 1YIJS 2MMYA 1MMDA 4RW6A 3OJSA 2AGOA 1S6QB 4JI6J 4MIWA 2XYHB 1KLNA 2WSCC 3KFWX 4JV0A 4CLUA 2YX1A 5E3PA 3VVTA 5HQ8A 2UV8A 2XBPA 1JLCB 5BR8J 4AT1B 4Q44A 2QSFA 3QO9B 3FBCA 3W60A 2EK1A 2GFFA 1RACB 1NDKA 3Q23A 4M63A 2YNFB 3P5TL 1RK8A 3BGOP 2AMCB 3AJDA 2ACMA 1YBUA 3PZPA 2HW3A 2FJWA 1RT1B 4BLGA 2J8SA 5D4LA 2LDIA 4EWTA 3CCWA 3TAQA 2YKMB 2X3GA 3KMQA 1YRXA 3D28A 1RT7B 3KLHA 2P9CA 1NH7A 3OVAA 1WTBA 2DRBA 3HJVA 2IJFA 1FT8A 4CTAB 3G8QA 5LSRA 1C0TA 4B9SA 1BQMB 5I42A 1QDUB 3LA0A 2WK4A 1Q81T 2ZZNA 4DV2J 4DXLA 3UVJA 1KLMB 1F9HA 3VGTA 3GJRB 5H9FK 2AT1B 3VGSA 4IFYA 3MAAB 4LF7F 1AT1B 2HQGA 3ZZZA 4TU7A 1W7WA 3MMBB 3E3XA 2VQEJ 3R7BB 3QRPA 4BC9A 3EVWA 3J80U 3WZ0A 4JI5F 1RAAB 1S49A 1SPBP 1OJ4A 4N77A 3A8KA 1KQSR 1KSPA 1X8DA 2KDOA 3VAKA 1M1GA 4C2MA 4ID5A 1XNRJ 2HLTA 3TR5A 3DLGA 5J2MA 3VWSA 3EZOA 2DJWA 2J9DA 4DV3J 2HEKA 3M1VB 4ES2A 1PCAA 2DCLA 2WONB 4NLVA 1SH3A 1B70B 1RISA 2PFFB 5CYMA 4W90B 1WNEA 1LFWA 5HJXA 4CO1A 1PJ6A 3WIUA 2RSQA 1Q8LA 3KK2A 1X4GA 5F3ZA 2LXFA 3VR1A 3A1YG 4F2SA 2WVCA 3HCXA 4NCAA 3QNWB 3KJFB 4LF1A 1DHMA 4RNNA 1XERA 5LXRA 2EK6A 2AJ0A 2CPIA 5ETSA 1YZ6A 2P6SA 1CBKA 3Q8VA 4Q0BB 3FGVA 1U48A 2K1RB 4U7UK 2YTCA 2CWKA 1T94A 3K57A 1BHNA 1IKVB 5ETVA 1UFWA 3MD1A 3IA0A 4IYQA 1ITPA 4FF3A 3WHIA 1TKXB 3W3SA 2B5JA 2J7KA 1OPZA 2V4JB 3FVYA 4LBIA 2G0JA 1MU2B 1KTVA 1JNZB 4X84A 4KTQA 3KDOA 4ECXA 4X62F 1EP4B 3DDKA 3ET6B 3DM2A 1M5PC 4B9MA 3KK3B 3H4DA 2R7UA 1MN7A 1HNZJ 5A0YB 3I9V9 2BBEA 5FD1A 3G86A 3NCQA 2C2KB 3EPGA 3GIRA 3AB2B 2CYYA 4PABA 1YI2S 4ZPAA 1H98A 3I55S 3PKMA 1KOHA 4A46A 4ECWA 1L5UA 1RHQB 2RH3A 3H4BA 1HR0F 2KG1A 4ZP6A 2Y1IA 4I7FA 1I6JA 1WC0A 3EWGA 4GC7A 2OJ3A 5KG0A 5F41A 3IBWA 1KQGB 4ZS6A 4JOUA 4J9LA 4LBHA 4ZVFA 4I56A 4J5OA 1JJ2R 2W9CB 1FESA 1O51A 2XZWA 2YNGA 1HMVA 2BANA 2Y1RI 4LVOP 2DNYA 4ZCMA 2GQCA 1JNRB 3UPFA 2B7CB 2HBZB 3GIIA 2D41A 1RWNB 4GVLA 5JVHQ 2BUNA 2CXEA 3F44A 3N6NA 3RW7A 1M0SA 1S72S 1IXKA 1YBTA 1PILA 2JEIA 4DLEA 1VC6A 4QZVB 3ZC4A 1WKKA 1HFEL 2B4UA 2BE7D 5CD4A 4FYVB 1LXNA 3VGVA 3UD3P 5CCMA 4DL7A 4QYZK 1CS4B 1FX4A 3EDQB 2AZ1A 4JI2J 1S1VA 1MWYA 2BRLA 1RAHB 4QJVA 4ECQA 3DGVA 5IT9Y 3H5XA 1AFJA 1S7IA 4ED3A 1RCOB 4RNOA 3MR5A 4QPTA 2HNZA 2ZWOA 4N47A 5L9XA 2XZTB 3MCNA 4IH6A 4PPZA 5SZTA 4N56A 5ETTA 2E9TA 2HSEB 4M94A 4WF9Q 1UZHA 4RW8A 3MR3A 3DMJA 4B3SJ 2GHVC 4GKKJ 2DGUA 2KKHA 1PJ5A 1N32F 2ILYA 4F26A 2E1RA 2IPOB 4MIAA 3FJ2A 2GX8A 5KFUA 2BM0A 4DR4F 1IBKF 2YKNA 4KHRA 4ZJLA 4B9VA 3VHQA 1TKZA 2R7VA 1ZPVA 2GS8A 3R8YA 2H3EB 4X66F 3MMAB 3NGDA 3H20A 2ZOFA 4IG3A 2UVRA 3ISNC 5RUBA 3BKUA 2FVRA 1SB6A 1T9WA 1U0HA 2WVEA 3W63A 4LF4J 2ZOGA 2PEBA 2CNKB 3O3LA 3CCVS 2H65B 1NUEA 4JI3F 5KFFA 2C1EB 3E2EA 2FGCA 2AV5A 1REGX 2KYXA 4UUXA 2EBEA 1QTMA 2CUYA 2GMHA 4LFAJ 2EFOA 2ASLA 3RYLA 2FHOB 1ZM2A 4IG0B 1WWHA 2N7YA 2HYIB 2HBYB 1A7GE 1NHVA 5AXNA 3HX9A 5H1SV 1RU1A 1CULA 3I0SA 2DR9A 5HROA 4UY8T 2NCKL 4FYWB 1DFDA 5IQQA 4RBUA 3O2IA 2I1RA 4PQUB 4N76A 1BXNA 4LMZA 2PMZD 2VG5A 3NCRA 4X4NA 3QSIA 4O3SA 4LFCF 4J7CA 3NXZA 2E7VA 5ETQA 4WE1A 2W2QP 3AFGA 4NI2A 2QEXS 4PKDB 2BV3A 3FEZA 1ZAVA 2HZVA 2ZM6J 4DR1F 2RQ4A 1JXVA 1IUJA 1BE4A 4KGMA 3G6XA 4AD6A 3EXYA 3EE3A 5IT9U 4MK7A 2VBXA 1RTIB 1U2CA 3TEHB 3RBEA 2K2PA 3HHKA 2VQEF 2FVPA 4Y65A 1RWPB 1KQFB 1ZA1B 2Y1JA 3ICLA 2Q79A 2WRMA 3NLCA 4U8VA 2M0GB 3L7PA 1ZTTA 1TL7B 2J8AA 2OKQA 1VS3A 4ZVQB 2HHQA 2LEPA 1ZBTA 1TK0A 3IBCB 1SH0A 1K44A 4WFZA 4ZLJA 3MM9A 5LMNF 5KFBA 1AUSL 3CDAA 3LALA 4AE5A 1N5TA 2YX4A 2PC6A 3AXKA 3EVMA 1RU2A 2B9EA 1C4AA 4URQU 3LUYA 2OELA 3FZBA 1D09B 1S1UA 3DLEB 1NPKA 4DPWA 3K5OA 2AJ2A 4G1PA 1KTQA 4LRDA 3DGPA 4KPCA 3KLGA 4LSLA 1Z4UA 3ITHA 5CYJA 2H51B 3HHLA 1RI7A 3SDEA 2V8PA 5HVGA 1IJFB 1TL3A 2W4CA 3C6TB 1NB7A 1DLOB 4RW4A 1YSJA 2IA0A 2DBBA 1N34F 3DI6A 1JXLA 3ILLA 2CQCA 4ZP8A 3RBZA 4YP3A 4EU0A 3K17A 4I64A 3LF0A 1T9YA 2NSBA 3I82A 2C3MA 3K0JA 1M5VC 3QGIA 3M05A 2UVWA 5HN0A 2OMLA 4CI0B 1SKSA 3CUNA 1N6QB 2KJWA 2CIMA 4OX7A 4LUBA 2DPIA 2KB2A 2XGQA 1UMJA 4I6AA 1ZAXA 3VGUA 5C2GA 5F8NA 2CQHA 3LAMA 2Z2YB 4HACB 1S0NA 2FJAB 4DV0J 4B3TF 5K14B 1RCXB 1HHSA 2EFVA 1T05B 3DNCA 2Q1LA 3BR8A 3CC7S 2BJ9A 2DO4A 2PT0A 3KJVB 2XHCA 2HS3A 3NRBA 1S0MA 2CQBA 3R6GB 2QLFB 2OEJA 2YNHA 3ENVA 3SQGA 4USMA 1GFWB 3K5MA 4ED7A 5D3GA 5KFVA 1FK9B 1IBLJ 5KT5A 1U8WA 5G0RB 2J7UA 2FLNA 3MECA 2OAUA 2IDEA 5KFZA 2DRAA 3GIMA 4I0WA 5IFMA 4NCGA 5T7LA 2UUTA 2WSEC 3MUMP 3W9IA 1RSCA 1EETB 1XMQJ 2HHPA 4B08A 2GC8A 2VPWB 2JJ4D 3LP1A 1RWOB 2R7TA 2HVEA 3R5JB 1JQGA 2C2NA 3BBFA 1Q82T 4QOTA 1G1XA 5MLCV 1RWUA 2AZ3A 4F04B 4KBIA 3UDVA 5KFIA 4X4SA 4RZRA 2CQIA 2HBRB 5C7PA 4ED1A 1NK9A 2XI2A 2G2OA 4DSKA 2FHJA 2IRYA 3KUGA 1CC8A 3HHLD 1R0BG 4KV8B 1RWVB 3C15A 1UVIA 1N5VA 1HBNB 4C3KA 1Q53A 3EMTA 4MJKA 2HQ3A 2GQQA 2KFZA 2AYMA 2ROGA 2Z4PA 4LR8A 4NA1A 2RQMA 4TLQA 1YZ7A 2PDAA 3RAMA 1Y0HA 3HZGA 2AHOB 4WIIA 2Q66A 3F0NA 3RAQA 2JNJA 2XS2A 3GFXA 1S48A 1Q8IA 2VPZB 3HFVA 4Y6IA 2HHVA 4O23A 3KLEA 4F02A 3PEJA 3B4DA 3ZTRA 1L3VA 1RT3A 5LMUJ 2DY1A 3NP5A 1HWIA 2HVIA 4P6QA 1WC5A 3NGUA 4ZMMA 3E01A 4M5MA 3T9ZA 3DXBA 4NMXA 1S6PA 3IM9A 1FA0A 1S57A 2JFDA 1Y7PA 1NSKL 3GPAA 3OVSA 3M9NB 1N5QA 1FDDA 2ALZA 2G9OA 4H4MA 2DNNA 4DQSA 5L1IA 3MM8B 3NBPA 3DRPA 2DNPA 2LQ8A 5DG8A 3G9CA 4CLWA 4DU8A 2CPZA 2EKYA 1QSSA 4Y2AA 1JKHB 3QQCD 2CVIA 2FQQB 4F3OA 1KFDA 1FDAA 2QYGA 3GONA 1HWJA 2IVFB 4QIEA 3HSZA 1WHXA 5JJBA 1S1XB 1U24A 3NCPA 1HIYA 3OTOJ 4NLTA 4ICLB 2MKIA 3BSOA 1DY3A 2N4CA 2MDAA 2IA6A 2KFYA 4K0KF 1VRUA 2NR0A 1Y3JA 1YJTA 3G8SA 2HG4A 1GEHA 2FC9A 4OYIA 4UF4A 5C42B 3HSJA 1V3ZA 1EB0A 5A8RB 5AE2A 4AYBD 4DBQA 5HANA 3M30B 3UCUP 1X5OA 1N5YB 3KLFB 3CE8A 3IBFB 1U1RA 2EEYA 1FRLA 4F2RA 3HVWA 2H5EA 1Q78A 3P4UB 4NMLA 3MR6A 2HS4A 2I5JB 4RWXA 1X0FA 1NPRA 1OSDA 4P71A 2AF6A 3A8EA 4K8RA 4QW8A 1UTAA 5ETKA 3VVUA 2YPZA 1JLBA 1N88A 4DZDA 3T6JA 3D7SB 1FXDA 3IWLA 2G2ZA 3QT5A 1WI8A 3W9HA 3D1HA 4M5DA 4QPXA 1JLGB 2NSCA 3K8WA 3P45B 3QRRA 2IM1A 1IWGA 3BBBA 3GQCA 2N7CA 4ELVA 1FRIA 2IFXA 1YKWA 4URGA 4TY9A 5DGBA 2Z8QA 4OHWA 3JYTA 3MR7A 5C24B 4PEOA 1JJHA 2A10A 5CABA 2WTFA 1HNXF 2BX6A 5A8KB 1XBWA 1T03B 1U47A 4KSEB 1DQAA 1KKHA 3PXGa 4USWA 2P8IA 4DF4A 4P2XA 4B9TA 5I3QA 1OY8A 2G13A 3J81Y 2PI4A 4KFBA 4P73A 2VICA 1VBXA 1UWAA 2LQ9A 4EI2A 3GWCA 3M8QA 1RAIB 3OXFA 2K06A 2VHGA 4IKAA 4ZDNA 4ED4A 1ULRA 3BJYA 3BN7A 5KFYA 3IAM9 3BREA 3K58A 3F56A 5KFSA 4IO9Q 4HH1A 4J9VA 5CZXA 8AT1B 1AZSA 1I94J 4YB7A 1V9OA 3BPSP 3MPVA 5HI7A 3I4HX 1H2TZ 2PMHA 1RBOB 5D15A 2FC8A 3HVAA 3KXDA 3P6YC 2CRLA 2HFVA 5AXMA 4AUKA 1R27B 3JQKA 2IJNA 4NL5A 4HI2A 4DR7F 3TAMA 5EHHA 1UJ4A 4I6YA 6FDRA 3CDUA 1MROB 3SMZA 2HNYA 3OD2A 2CQ2A 3HT3A 1RA6A 3HJFA 3PYGA 1RYSA 2C42A 4CLZA 3K8VA 4B3OB 3C6UB 1TK5A 5L38A 1S1WA 3FNNA 4DV1J 1RTHB 5C2CA 1VQPS 4RW9A 5KFKA 4JV5F 3EICA 2M8HA 3PR5B 3PRDA 2B8QA 1UJ5A 4FKYA 2C2RA 4LSNA 1HBMA 2HRUA 2WCXA 3T1HJ 3J7YI 3VAIA 1KRPA 4HLBA 1B99A 4OFZA 3OFHA 3TA1A 2M52A 3NGRA 4M1KA 2ACYA 4IQXA 8RUCA 5IM0A 3W2VA 3M6XA 3V6JA 4P2SA 2RJZA 4YB6A 2QMUB 3TVKA 4M5IA 3LPYA 2VG7A 4C8YA 4DCJB 2AP6A 3MEEA 1CJTA 3SI8A 2YX7A 3K7RA 1XN9A 1TV6A 4CLFA 2GO9A 1UPPA 2KYZA 1VC0A 1X5PA 2O1PA 3DFEA 1FKOA 1SJQA 1MW7A 2J0WA 4L72B 1KS2A 4J91A 5KFNA 1F5CA 4G1IA 1Y4ZB 2XSJA 3B6BA 4LR7A 1RTJA 4DS4A 1IKWB 1K0TA 3J81U 4M5NA 1KHWA 1TP7A 1EKSA 1S59A 2YKPA 4O3NA 3CJKA 4GMKA 4NLYA 3I56S 5KG1A 2HMIA 1TVRB 4XPCA 5I3PA 3GV7B 3OSPA 1RHRB 1Y5LB 3SSRA 3PFEA 2N3LA 1YK9A 2OPSA 3PJ9A 4C8ZA 2DR6A 2WB1D 3RRGA 4UUWA 3GJSB 2XULA 4DPXA 5ITHA 4P9SA 3D1OA 1PGZA 3LP0A 1X0PA 1Y11A 2PSZA 1HQUA 2UZAA 3VZIA 4CQ1A 1DZ5A 4RR5A 7FDRA 1XIQA 3HXMA 4E2FB 2X7IA 2IBOA 2DH9A 2ZJPQ 3HZEA 1CJKB 4DL6A 3DLKA 3G82B 2NUHA 3MTKA 1U26A 1A0OB 4OYPA 5CQGA 3OUYB 4FS2A 3W62A 4QR2A 4YY3F 4B9NA 1NZ8A 5CA5A 3TZYA 5J2PB 1S6QA 4LF8F 1UCNA 4B3MJ 1M5KC 2R7RA 2RILA 1ZM9A 1NDCA 2Z2MA 3PG9A 3QGGA 3RG6A 2QMWA 3PV8A 2J6SA 4UZCA 1JLCA 3W61A 4CO0A 3THPA 1FVQA 3QO9A 1VRQC 3M9OB 3DCAA 2YNFA 3T5LA 3X3UA 3LH2S 1SKRA 3H7HB 2Q6CA 1Q79A 2YWFA 2ZHOA 4ES3A 1RT1A 4JI8F 5GADI 2XMMA 4CO2A 2YKMA 2HZAA 3DRSB 1PYOB 1RT7A 5GMDA 1TMMA 4ZPDA 5CHCB 2MKJA 2CAJA 4CTAA 4HHJA 1BQMA 4QQBA 3N9UC 1R8CA 4Q43A 1UL3A 3ISZA 3LTOA 1KLMA 1IN0A 3UFCX 3UWTA 2YH1A 2MSSA 4ZN1A 2PI5A 2V34A 5B7WA 3MAAA 1V6HA 4C11B 1O5JA 4RW8B 4UW2A 3MMBA 2WVFA 2MLYA 2H4YB 5KTQA 2XNRA 3M2VB 3W5YA 2LKZA 3PTWA 1CJUB 2F9JA 4WYLA 2F1FA 4PUOA 4DL5A 4JI0J 2C2OB 3CJQA 5EUHA 2V4RA 2EC0A 3IS9B 3DHXA 3U27A 1HWLA 2B4VA 2YY3A 3M1VA 4ECTA 2WONA 2VB6A 2UXDF 4JB8B 3A8IA 4W98A 4DR3J 6AT1B 5B0DA 1B64A 3BQ0A 2B9WA 2ZBCA 1J5OB 5DRKA 4ZVEA 3CCUS 3J81j 2MGZB 4ED6A 4USUA 2MQ8A 1LKZA 1FEHA 1VJQA 2D69A 5BJRA 3SV4A 1Y9OA 5KT7A 3BGUA 1VFJA 1ZZNA 2M70A 4Q0BA 3CJTA 4C9DA 2K1RA 5DO2A 1RQ0A 2RHQB 1QAIA 4LSZB 1RZMA 4DSJA 1EIYB 2EFPA 3QZ7A 1NNDA 1IKVA 5J1EA 5IT0A 2GVZB 2YH0A 2IRXA 1U1OA 5JMNA 4DQPA 1TKXA 3D6FB 1KFSA 4GKJJ 4LF9J 3TUZC 2V4JA 3FFIA 4DX7A 2UXBJ 2UU9F 1MU2A 1BWVA 2IC3B 4CNZA 5L1LA 1EP4A 3ET6A 4K4XA 1WSRA 3KK3A 1S4EA 2XY5A 5A0YA 2D3OR 5DG7A 1WKJA 4ZVOB 4DV1F 4G3IA 4DFMA 2QTWA 3PYFA 2JVOA 2QE5A 2DGOA 3M9MB 4RBVA 3PR4A 1F3FA 1F1BB 2RQKA 3H0PA 5A6WA 2W9CA 4U8YA 4BWJA 2Z57B 4NXNJ 4OX9F 2ZE2B 4FN5A 3QLHB 2UUAJ 1HYSB 1B7FA 4Z37A 3TUIC 3UE2A 3JTPA 5KG3A 1VIXA 4DSEA 4DUZJ 4K5RA 1FO1A 5J1PA 4UOFA 4NYOA 1T11A 2WVDA 2J7WA 2OPPB 5KFHA 3T41A 2CADA 3TOQA 4YR3A 1OY9A 4NXMJ 1CS4A 2A0FB 3CTRA 1X60A 5IT4A 2KHDA 2RKIB 2B9XA 1QUPA 1NH8A 2DGVA 3QIPB 1P9QC 4H4KA 4YMEA 5C25A 1APSA 1C0UB 3IRXB 1LXJA 1XK8A 3JQJA 2DHXA 3LAKA 1RHJB 4DR2J 3PX6A 3DYAB 3I5BA 4FBTA 2Q3PA 3HK2A 2OD4A 4NLGA 3MM6B 3CMQA 2HWIA 4IFVB 1GX5A 2KVIA 3MMCB 1Q5YA 4TY8B 3LWLA 3VAFA 2JL9A 1OY6A 4BCAA 2YWGA 3UDCA 2AU0A 4RNMA 1NDPA 1IWAA 2KVQE 4Z2XA 2F65A 3D6TB 2QLWA 4KHPJ 4FPRA 1YLXA 1AFIA 2I38A 4HDGA 3HP6A 4DV5J 1T02A 5DDQC 1TKTB 2MLZA 1VQLS 2VA2A 5U47A 1U8SA 4CLSA 4X4QA 4LVNP 5GMEA 3OR1B 2FLLA 2HWHA 5HMZA 4KE5A 1VQ5S 4NCBA 5KFXA 1EAYC 1Q8KA 4CLPA 2L9WA 3FCVA 3D9BA 1B0PA 3MAQA 2FYXA 3KG0A 5HL7Q 4M8LA 5T41A 3FDSA 2EC2A 2W1BA 3OT9A 4I68A 5IXUA 1KNZA 4IG0A 3CB4A 3HSDA 3QT7A 2D3UA 2VG6B 4G6VB 2E5LJ 4WZQA 3UR0A 2BJ8A 1Z1ZA 3CMES 5KOWA 3R27A 1NJWA 4U95A 1RWXB 3M8RA 2HHTA 1DAXA 1IKYB 3TA2A 1FRMA 4JI7F 2KXFA 3EPIA 4KH1B 3DLHA 4PQUA 2RU3A 1NSQA 1H2VZ 2VOOA 3DRYA 4TKTA 4R5PB 4DV7F 5JXSA 2LQJA 1GXUA 3UCZP 4Y2KA 3OFFA 1UVKA 3FRZA 3A12A 4DG1B 2GV1A 2RS8A 3CIMA 4ZIWA 2ROPA 2W8KA 1D8ZA 1VQKS 3A8JA 4DFPA 2ZZTA 3ZZ0A 4KO0B 5LSLA 3CD7A 1VOMA 1NJIT 2QLJB 3RB4A 2X3DA 2R8KA 1RTIA 3KK1B 1NK0A 3NY0A 3NAIA 2B4OA 3CULA 1SUQB 3OTBA 1JLFB 3W66A 1KR4A 1HL6A 1MNEA 2K7JA 4ZHRB 4UZBA 4YOEA 2OTLS 2YQ0A 2I6WA 4ATNA 1S12A 3HHEA 1TL7A 4Y0FA 1HI8A 1LWXA 1DQ8A 2P6TA 4XDDA 5IQ6A 3B78A 2RB7A 1Q86T 3UN5A 4ZLPA 3IM8A 2LQBA 1QVFR 2H5IB 2R7QA 3EGVA 1YVFA 4FVMA 5I4MA 2XC9A 2Y0SD 5J2QB 4TU9A 4DL3A 3MM5B 4B17A 2RUSA 2XWXA 1N33J 3PACA 3CGIA 3DLEA 2KM8B 2XS7A 2C2ZB 1RHKB 1SC1B 1WC3A 1VQNS 4L3NA 4A4JA 4JI1J 3EXCX 2GGPA 4U67Q 3GG1A 4WIQA 4NOHA 3NOCA 3DDNA 4OYMA 3J7ZT 3HSGA 2ZH7A 2BQUA 4MK9A 2POKA 4DCOB 5KG5A 2VOPA 1TL5A 3CT9A 1MMLA 4KGKA 3C6TA 1DLOA 2VJUA 2IMOA 3FEXB 3KJQB 4OJ1A 2VFTA 3PFOA 1NJXA 4NLOA 3RW6A 1R0CB 1UFKA 1NZAA 1R6VA 3MM7B 2AEMA 4C0HA 1NJZA 2GW8A 2OHDA 1L3TA 4C8KA 3UDEA 1N6QA 4PWDB 3MPDA 4TNOA 1LFPA 1LW0B 1YX2A 4HACA 1M90T 2QA1A 4IH7A 5K14A 3AHPA 2BR0A 2FZGB 2J0SD 1TAUA 4X4TA 4C7QA 2CZ4A 2R3VA 3WC2A 3D3BJ 2C3YA 3K5PA 4RJVA 2BZ2A 3AXMA 2KU7A 3VF0B 3KJVA 4EYIB 1VK8A 1NLKL 3ETOA 4Q8FA 3A13A 1VR6A 2D3ZA 3MMJA 4Y2IA 2SXLA 2Y1LB 2E44A 3BPDA 4OX8A 4OYWA 3R7NB 1FK9A 1AYEA 4F3QA 5G0RA 5FIIA 3GR1A 2KT2A 2GMLA 3DRRB 2UUAF 4RPFA 3R2CJ 1RYRA 5A6PA 1I3OB 2ILZA 2VL1A 4LF7J 3KYLA 3OL8A 3M2RB 1XEZA 4DWIA 2HQCA 1TMJA 3DOLB 1EETA 4OJ3A 2BEFA 2NUUG 2ZBRA 2HBQB 3C14B 4K59A 1BMQB 3TUPA 4JI5J 1S99A 2CZ9A 2M4MA 1Q7YT 2C2DA 1OO0B 1UFLA 4ITSA 3AOCA 1P8GA 2LLZA 2HURA 3K59A 5T14A 4ZVGA 4U7UD 2WSFC 5H9EJ 4DR5F 5D0EA 5E3AA 2XY7A 1S77D 4QWEA 4KV8A 3PJWA 3FCHA 1HBNA 2M88A 1DRZA 4OI1A 7FD1A 1PJ7A 1CVJA 5GMKa 3HVRA 2ZJRQ 5KFMA 3KLIB 2IM0A 3H2UB 5IV4A 1FRHA 5A2QY 1FVSA 1XMBA 1DTTB 3KHRA 3JSRA 4OI4A 4OMFG 1RBLA 4DMZA 2F8HA 2MZTA 2MHEA 5EGYA 3QATA 4KAIA 1YITS 2QG9B 3P96A 4ILLA 2FJVA 3FUYA 2EKNA 2DHSA 3EVOA 3SCJE 2APOA 3C16B 3V4IB 3D3CJ 4IRCA 2MEWA 2MZ1A 2ZC4A 5E0OA 1JJ4A 2B43A 1VRTB 4DV5F 2HLUA 4F0MA 5THWA 1BUXA 2CJQA 4TVAB 2Z2ZA 3QT8A 4YHHF 2BOPA 1WJ9A 3B4MA 2QL5B 2C3UA 1GAOA 1E6VB 4X62J 2BJDA 5D6GA 1XR5A 2QYCA 2RDDA 2BYCA 3P5BP 1SBRA 3MM8A 3W9JA 3CC2S 4BHQA 2DNZA 1JKHA 4DV6F 4HI1A 3D6HB 2E5LF 2DK2A 1SXLA 2ZBIA 5K20B 5L1KA 1FD2A 1S1XA 4OJHA 1IJEB 4L74A 4ICLA 2R2RA 5IS2A 1FHTA 1LW2B 1SKWA 1CQMA 2R8JA 4YQWA 4OHZA 3EJMA 1NK5A 4ELTA 4NLQA 5DM6Q 2XS5A 1J27A 2OSQA 1HBOB 4UOHA 3CCTA 5C42A 2NPFA 3CDWA 4CO3A 2W2NP 1AW0A 5A8RA 1RADB 1TV6B 1PC4A 2ZH1A 3CJ8A 3M30A 1SL0A 1R3NA 5L39A 3PKYA 2HS0A 3OR2B 3IR7B 3V6KA 1F9EB 4ZIVA 1N5YA 3KLFA 3W7BA 3CJSA 3QAEA 3CCMS 3BGRB 4A48A 1V5IB 1BQXA 1HHTP 1WD6A 3UD4P 5A2QU 1CJVB 2I5JA 2HAFA 2L9NA 4K4VA 2ERRA 4A8FA 2FJDB 3T5KA 2CNNB 1ZAWA 3KHGA 2C28A 3PW5A 4K4WA 3CCRS 3GG0A 1N56A 3CW2C 1Y3KA 1X4AA 3ZZYA 4J9RA 4IO1A 2HFZA 4Q5VA 4ZA1A 2XB2D 3I5CA 2FVCA 1YBAA 1JLGA 3KNGA 2ZKTA 4F0HA 4MYTA 1N32J 4L6V3 2XGPA 4DR4J 2DIVA 3MCOA 1RABB 4A8XA 1IBKJ 4CNYA 3L7OA 3VV2B 1WF2A 1LOUA 1VDHA 4X66J 2QFIA 2UVUA 5C24A 4RNHA 1RWWB 3WC0A 2A6MA 3I87A 2VDIA 2IM2A 1HD1A 4S0MA 5A8KA 1AXQA 1T03A 3H2LA 4FPIA 4L73A 2CPDA 2BKPA 2VA3A 1FJCA 3ULHA 3QGHA 4WP8A 4JI3J 2V68A 5J2NB 3F41A 2RAQA 4Q2LA 2ZJQQ 1GXTA 1R7IA 2O01C 4PXDA 2XMTA 4DQQA 2E29A 3GYGA 2QL9B 3PVXA 4PR6A 2BQ3A 3CJRA 1N0UA 2CJYB 2E5HA 2NXUA 4XAKA 3PYEA 4KIAA 4BC7A 5EWGA 1RT5B 3BSNA 3G4SS 2KHCA 1H73A 4KGXB 4QWDA 2QN6B 1K8AT 3GJQB 5CZVA 1SKUB 4KQZA 2DHHA 2W4PA 3MEGB 1HD0A 3PIPQ 1U45A 2GA7A 3FKBA 4LFCJ 1U1QA 2QRRA 5BYQA 1MROA 4Y3CA 2PIIA 4OV1A 4A47A 3G6ES 3R5DA 1V5VA 1IR2A 4DR1J 4UTGA 3R5CA 5IC6B 1CSJA 1FI4A 1NK6A 4JI4F 4C4WA 2NPIA 4B3OA 1EKRA 3C6UA 3O6QA 4OYBA 1WF0A 4ETXA 4USHA 1T8EA 3IG1B 4MIBA 3ENAA 1NSAA 4UOCA 1G7CB 1RTHA 4ZVPB 4MTPA 2E9RX 3HHDA 5DDPC 2OD6A 2OEMA 2HHXA 4NYPA 3GFZA 4PUOB 4PXBA 2R8GA 4DJBA 1TELA 1WG1A 3Q8SB 3I0RB 1YJUA 3KHHA 4A8KA 4GO5X 5LMNJ 2L9DA 2DH8A 3AOBA 2F8EX 4C98A 1Z2ZA 2C22A 3Q86A 3Q8RB 2KZZA 3ILJA 3N4WA 2DHAA 4BBYA 2WBMA 1VK3A 1PSDA 3RRKA 1KC8T 4ECZA 2RVJA 3U1LA 1UWBB 4K4SA 4OV6A 4F67A 4CT8A 4FF2A 2QL7B 3DLBA 1WC4A 3GLJA 2OMOA 2MJUA 1GMWA 5L9NA 3NS5A 3OW2R 3T19A 3W8PA 4HHUA 1TUVA 2M3DA 3PDNA 3G87A 4PYDA 1SV5B 2Y3YA 1IKWA 5DG9A 4P2MA 4K50A 3MR2A 2AQ4A 1HI0P 4ER8A 4ANDA 1IQZA 3VTIA 1N34J 4OYAA 1TVRA 5J1EB 3ZZPA 3US5A 2ZHBA 3LWMA 2LXUA 3W5XA 4UT4A 3RB3A 1B0TA 3FFIB 4LF5J 4RW7B 3GU0A 1OMSA 4N5SA 3D0GE 5E5NA 2K7KA 4X4OA 4P72A 4CWBA 2DGXA 3OJUA 4B3TJ 3O8WA 3NAHA 3CJ4A 4MAKA 2NZ4A 4ECUA 2MKKA 2IVMA 5IWAF 2HAIA 1CJKA 3Q0AA 3G82A 2E7WA 1FRXA 2L41A 2PFDA 4G1QB 2X1AA 5AXLA 1P1LA 4NLDA 2YBVA 1REVB 3OUYA 4ZCIA 2D3O1 3HM9A 3TX8A 3BB5A 3SXLA 1GT8A 2E1CA 4LFBF 4K4TA 3SFGA 5J2PA 1W26A 3H98A 2KT5A 5HQLA 4Y34A 2ZZMA 4ZK7M 4USVA 1OIAA 3PNIA 2R2SA 3ZXWA 4CP5A 2FLOA 3R3TA 3FQLA 5FLXY 1OQ6A 2IAJB 3R7SB 4WBFA 2HIYA 2OPRB 1S0VA 2DGSA 3EGZA 3LGHA 5GAGU 2ZVIA 1SQGA 3C46A 4Q2MA 1OPIA 3AJ2A 4ZKAA 2HFNA 3HDSA 1PAUB 2YPYA 1GMWD 5IZHA 3CVKA 2F63A 5DQGA 3HMJG 3DRSA 4AQYF 3M8WA 1U02A 2FPHX 2ZH8A 5F9NA 5F8GA 4LF6F 3AD8C 5C25B 3ILOA 1ROFA 1JIHA 2IIHA 1WKLA 2HIQA 1Q4RA 4OI2A 3M6VA 5E3QA 4QCLA 2D74B 9ATCB 4C11A 3GCXP 4IR1A 4I2PB 2O66A 1R89A 2F9DA 2YNIB 3CD5A 3L4BC 1M5SA 1HKAA 4F3MA 3DOKA 2AGQA 3SQOP 3M2VA 4WXWA 2AW0A 3U7JA 1YQHA 3BN4A 4DSIA 5D4NA 1CJUA 1Q0NA 3C19A 3M8SA 2YWKA 3IS9A 2FVQA 5GAHU 2Z2LA 2GIQA 2O5DA 2MY8A 4R8UB 3QRQA 4F4ZA 3MCMA 2MQQA 2VBZA 4KT0C 4GRSA 1R0AB 1UVJA 2QJ3A 4O44B 2V2ZA 2Q43A 4DI6A 1D8YA 3S6EA 1X31C 2R42A 1YTYA 1R8HA 1FXRA 4OJGA 1J5OA 2LFVA 3SEOA 2ZWPA 2QC3A 3M4XA 2EW9A 4ECSA 2MGZA 1VHIA 4XIUA 1J5EF 1Q8BA 3OL9A 3D0HE 1Q1KA 2D9OA 5E3RA 4DLGA 1QSYA 4NZ7A 2CKWA 2MKYA 2WB4A 4OHVA 1N48A 2GVZA 5FLXU 2HQDA 4K0KJ 3QYYA 5DLGA 2HFOA 1JB0C 2DVIA 1NU4A 3V81A 5L8RC 4NEZA 1KEKA 3CIZA 1LK5A 2IC3A 4DSLA 2BACA 3R9LA 1MSWD 5AT1B 2L08A 1F3VA 2FGOA 1LEOA 4ZVUB 2FB0A 5L1JA 3UN2A 2W7OA 5LJ5Y 5CCLA 2NLWA 2XLIA 2ZD1B 4U96A 1X4DA 5ADZA 4ERDA 4O0IA 2DYAA 2VUGA 1IBMJ 2E1MC 4EYHB 4DU7A 4ED5A 1NCLA 2YKOA 1PBUA 3R5GA 1FNMA 2YQ1A 2CNOB 2OI2A 3NNCA 4YDXA 5K8NA 4O3PA 2LDYA 2JLGA 2CQDA 3IP0A 2ZE2A 2H5JB 3QLHA 2BOAA 1HYSA 1QY7A 2RE1A 1B7YB 1N52B 2K8GA 1IR1A 2AYEA 3KNAA 4I2QB 4L3KA 2BJEA 3PEHA 4QU6A 2EFGA 2OPPA 1SVDA 4PG5A 3QJJA 4IRDA 2GGPB 3GJTB 2EG1A 4CH1A 3M6UA 5EWFA 3OTEA 2N4DA 3QBCA 3MOJB 2HVZA 2DH7A 2RKIA 2LYVA 3TARA 3UDLA 3TRGA 1HNXJ 3EZ5A 1S6UA 3RB6A 3UNGC 1R8PA 3OQ2A 2P5VA 3O5TB 1UPMB 3QIPA 5KFJA 2J6UA 5CXTA 1XNQF 1C0UA 2U1AA 2EVZA 2JHEA 2GHPA 3IRXA 3CJ2A 4EBEA 4F50A 1ACMB 1URNA 3DYAA 3AD9C 4LF5F 3MFIA 4KY3A
chains in the Genus database with same CATH topology
1O8BA 4Q0BB 3FGVA 2MKCA 3MM6A 4NYZA 4BWJA 4IFYB 4IFVA 1U48A 2GMJA 1RT2A 4OX9F 2K1RB 4U7UK 2LEBA 3CMAS 3MMCA 2ZE2B 4FN5A 4TU8A 2YTCA 3RRHA 3G96A 3QLHB 4LQ3A 1T94A 1HYSB 4TY8A 3LO3A 3KOAA 2UUWA 1B7FA 1XMQF 2FD2A 4Z37A 3MI7X 3K57A 1HNVA 1IKVB 1C1BB 3E8OA 3GYXB 3HHLC 4N41A 1Q16B 3TUIC 1QVGR 4ALZA 3UE2A 2I8EA 3JTPA 1UFWA 2J76E 3MD1A 4QWBA 3IA0A 4IYQA 3U1NA 5KG3A 1VIXA 4DSEA 4K5RA 1FO1A 4FF3A 5J1PA 1TKXB 2XY6A 4DS5A 4NYOA 1SL2A 3W3SA 1WTFA 2B5JA 2J7WA 2J7KA 1OPZA 2V4JB 2OPPB 3FVYA 1FCAA 4ZCLA 3MGJA 4BWMA 5KFHA 1TKTA 4NPOA 3TOQA 4YR3A 1MU2B 4NA3A 1KTVA 1JNZB 3HO1A 1RT6B 2YKQA 2W7AA 4X84A 5DGAA 4KTQA 4ID5B 4E8UA 1XC9A 1FNOA 4ECXA 1JLQB 4X62F 4AL6A 1EP4B 3DDKA 3DM2A 3CTRA 1M5PC 2FUG9 4B9MA 2NYIA 3DLGB 3SCIE 3KK3B 4F8RA 2CPEA 3OR1A 3H4DA 2R7UA 4KC5A 3SSQA 5J2MB 3D2WA 2OTJS 5IT4A 2KHDA 5A0YB 3I9V9 2BBEA 5FD1A 3G86A 3NCQA 2RKIB 2B9XA 4OI6A 4HEA9 2JEFA 1QUPA 4WKYA 3EPGA 2F4VF 5KFQA 3N79A 4J9SA 4OIXA 5CYMB 3AB2B 2ABYA 1NH8A 1VJWA 2CYYA 2DGVA 3QIPB 1P9QC 3JSYA 3H8YA 4H4KA 1JLAA 4QYZJ 4YMEA 1YI2S 4ZPAA 1WG5A 3I31A 1C4CA 4E0DA 5C25A 1APSA 1H98A 1C1CA 1X4CA 1BLUA 3I55S 1C0UB 4A8SA 3PKMA 1KOHA 4A46A 3IRXB 4ECWA 1LXJA 1L5UA 2RH3A 3SSSA 3H4BA 3KK2B 4ECVA 1TL1A 1HR0F 2KG1A 5LL6d 5KFCA 1XK8A 4HDHA 4ZP6A 2DHXA 2VBWA 2Y1IA 3LAKA 5GAEI 3V6DA 1GX6A 4I7FA 1I6JA 2V9KA 2VG6A 3PX6A 3KTQA 4GC7A 4NLGA 6FD1A 2OJ3A 5KG0A 3DYAB 3I5BA 5F41A 1YRUA 3IBWA 1KQGB 4WZMA 4ZS6A 4FBTA 3HF5A 3AH6A 2AWZA 2Q3PA 1VQ7S 4V19X 2B4PA 3CJ5A 4JOUA 4J9LA 3CXCR 4ZVFA 4I56A 1H7XA 2HGMA 2OD4A 2QA2A 4J5OA 3CCES 3T1YF 1JJ2R 3HK2A 1PC5A 1IKYA 2A2CA 2W9CB 1FESA 4EEYA 1O51A 2XZWA 2YNGA 4PG6A 1HMVA 2BANA 5GVQA 5LMUF 3MM6B 4DEZA 3DLJA 2HWIA 1RKIA 1GX5A 2Y1RI 4IFVB 1P27B 1RT2B 4LVOP 2DNYA 3BGLA 2KVIA 4ZCMA 2JEJA 2GQCA 3MMCB 1JNRB 3UPFA 2F3JA 5EWEA 2VONA 2B7CB 3RB0A 4TY8B 3HLUA 3LWLA 3E51A 3GIIA 2D41A 3VAFA 4YUDA 2JL9A 4ZP7A 4DHVA 4R5PA 1UETA 1FJGF 4BCAA 2YWGA 2BUNA 2M2BA 3CCZA 3UDCA 5JVHQ 3F44A 1HNVB 5K8OA 5KFPA 2AU0A 3N6NA 5E2QA 1K9MT 1QLNA 2HVHA 2MKHA 3RW7A 2AD9A 4RNMA 1M0SA 4J37A 1S72S 4Z2XA 2XEXA 1K1SA 1IXKA 2F8MA 1N5SA 3H2VE 5DQIA 2LA4A 1PILA 2QLWA 1LWFA 3I32A 3TANA 4DUYF 1HNWF 2JEIA 4DG1A 4FPRA 2HGNA 4DLEA 2B5JB 1VC6A 3RBDA 4QZVB 1AFIA 1HNIA 3ZC4A 3MWBA 2I38A 4HDGA 3HP6A 2CJKA 3FMBA 1T02A 2DD8S 5DDQC 2M8DB 1HFEL 1TKTB 2B4UA 1SJ3P 1VQLS 2VA2A 1UVMA 5U47A 1LXNA 4LIWA 4OI0A 3BO2A 3UD3P 1U8SA 4KO0A 5CCMA 2XMWA 4X4RA 2EI5A 4X4QA 5AJ3F 4DL7A 4LVNP 2BQRA 3T3FA 2V5HG 3DM2B 5KT4A 2XMKA 3OR1B 2FLLA 3KK1A 1S1VA 2PO4A 3CD0A 1MWYA 2BRLA 4QJVA 4ECQA 2HWHA 5CYQA 2R7OA 5HMZA 4KE5A 1KD1T 2VKZG 4Q45A 1SUQA 4OQJA 5IT9Y 4GC6A 1VQ5S 2PEHA 1TR0A 4NCBA 5KFXA 3H5XA 1JLFA 2L9WA 1AFJA 4ED3A 4X64F 2IYGA 1JLAB 1WELA 3L3CA 1QAJA 1B0PA 3MAQA 2R8HA 3KG0A 3N28A 4RNOA 5HL7Q 3MR5A 4M8LA 5T41A 4QPTA 2HNZA 3DHWC 4ZHRA 1S79A 1C1CB 2RD5C 3GMGA 4N47A 3FDSA 5L9XA 2MB0B 4Y00A 2UVVA 4IH6A 3SZ2A 4PPZA 5SZTA 4N56A 1TL1B 1KNZA 4I68A 5IXUA 2RDJA 4IG0A 3CB4A 1UP1A 4TXSA 3V6DB 4I7FB 2D3UA 3GSDA 2KTQA 2VG6B 4G6VB 3OTOF 2E9TA 2RS2A 4WZQA 4M94A 3UR0A 1Z1ZA 5B08A 5E3CA 2R2UA 3KHLA 3TQ1A 3CMES 3G71S 3U1MA 4WF9Q 5KOWA 3R27A 1NJWA 3N5BA 4RW8A 3MR3A 1A6LA 4FXVA 5J2QA 3M8RA 2HHTA 1DAXA 1IKYB 3R1LA 3DMJA 1VC5A 2YNGB 1HMVB 2BANB 1X4BA 1ZPWX 1FRMA 3TA2A 4JI7F 2UXCF 2KXFA 2CG4A 1AROP 2GHVC 3MM5A 3EPIA 4C8LA 3IRWP 2DR7A 2DGUA 2KKHA 3DLHA 4PQUA 2RU3A 2HQIA 4JUZA 1N32F 1H2VZ 2ILYA 2KRBA 2E1RA 4F26A 3OL6A 2VOOA 4CH7A 4MIAA 3FJ2A 2GX8A 5KFUA 2BM0A 3DRYA 4TKTA 4DR4F 2FIUA 4R5PB 3MXHP 3MEDA 3LOUA 1X4EA 4C0BA 3GILA 4I6WA 4XO0A 4DV7F 3TW0A 1IBKF 5EX0A 2YKNA 2LQJA 5JXSA 5F0WA 4KHRA 2BA9A 4B9VA 1GXUA 1TKZA 4Y2KA 3TVZA 3UCZP 2R7VA 3VAHA 1ZPVA 2VD3A 3OBIA 3OFFA 4NLPA 4X66F 3MMAB 3NGDA 1LWFB 1UVKA 3FRZA 3H20A 2ZOFA 3H25A 4K4VA 4DG1B 2GV1A 2RDIA 2RS8A 3CIMA 4IG3A 3PW4A 2FJBB 2ROPA 2W8KA 1HNIB 1D8ZA 1RJJA 1VQKS 2IRUA 4A8OA 3NL0A 2UVRA 2E5GA 2LMIA 2MZSA 4DFPA 4EZ9A 3ISNC 3V4MA 3ZZ0A 3MF5A 3RZAA 3K5NA 2FVRA 1SB6A 2OP5A 4KO0B 1U1LA 2XMUA 3TO8A 2B6AA 5LSLA 2V4QA 4LQ9A 3CD7A 2ZOGA 3O3LA 1VOMA 3VQSA 3CCVS 1NJIT 4HH0A 2G1DA 3RB4A 2R8KA 5J1NA 1RTIA 1L3KA 2MSTA 3CJ3A 3KK1B 4RBTA 1NK0A 1H3DA 1S1VB 4JI3F 5KFFA 4X4VA 1WEZA 1FJ7A 3E2EA 2FGCA 3NAIA 4FF4A 2B4OA 1H6KX 3CULA 2AV5A 2RU9A 1SUQB 3V2UC 3H5YA 2KYXA 4UUXA 1QAYA 2EBEA 1QTMA 2B0GA 3OTBA 2R7WA 1JLFB 2GMHA 2MQOA 4ILRA 1KR4A 1HL6A 1MNEA 2K7JA 2EFOA 2K3IA 2HNZB 4ZHRB 4ED2A 2ASLA 4YOEA 2OTLS 1U6BA 3RYLA 3MM7A 4ATNA 3GIJA 2FHOB 1KHVA 3HHEA 4NRTA 2A2DA 4B3RF 4FXDA 3QAUA 1YG0A 4Y0FA 1NEEA 2V8HA 1HI8A 1ZM2A 4NLSA 4IG0B 1DQ8A 1UJ6A 2P6TA 4XDDA 4KB7A 5IQ6A 1WWHA 2N7YA 4JBCA 2VQFF 2HYIB 2D9PA 3B78A 4PWDA 1A7GE 2KM8C 1NHVA 1HARA 1KONA 2RB7A 3T9NA 5FDLA 5AXNA 2E7XA 1Q86T 3HX9A 2QSWA 4ZLPA 5H1SV 2LQBA 1QVFR 4MKAA 1LW0A 2R7QA 3I0SA 3N6LA 4FVMA 1YVFA 5I4MA 2XC9A 4FNHA 2ASJA 2DR9A 2Y0SD 5J2QB 5HROA 4UY8T 3IXQA 3DMJB 1DFDA 5IQQA 5KOXA 4RBUA 4TU9A 4C97A 4DL3A 3O2IA 2MXYA 2I1RA 3MM5B 2CVEA 4PQUB 4N76A 4B17A 2XWXA 5KT2A 4LMZA 2PMZD 4QIVA 2VG5A 5CH7B 3NCRA 1LWEA 1D3WA 1YWXA 3PACA 4X4NA 3MPWA 3MEDB 3NKYA 3CGIA 2VPYB 3DLEA 4O3SA 2YKNB 2KM8B 4LFCF 2XS7A 5LXYA 2KN4A 2ZC3A 1IM4A 3S01A 4WE1A 1TKZB 1BD6A 1S10A 4MYUA 2VZ9A 1VQNS 3TVYA 4L3NA 3GE9A 1BQNA 2XWYA 3M32A 1UEUA 3EXCX 4PKDB 5KFLA 4A4JA 2QEXS 4UY85 1IBMF 2HRYA 2BV3A 2DNRA 3JSMA 3FEZA 1ZAVA 3NG8A 2GGPA 4U67Q 3GG1A 4IG3B 3CDEA 4DR1F 4NOHA 5KFOA 1VIOA 3DDNA 2RQ4A 3J7ZT 2FHKA 1CC7A 3DC2A 3ZZOA 4K4ZA 4I1TA 1IUJA 3DOMA 2ZH7A 2FTRA 5K9FA 4KGMA 3G6XA 3CCQS 1TFWA 2BQUA 4MK9A 2POKA 1JX4A 5KG5A 4DFKA 1TL5A 1N36F 3CT9A 3EXYA 2VOPA 2B6AB 1MMLA 4KGKA 4NZ0A 3C6TA 3HVTA 4MK7A 5F8IA 2KH9A 2W7PA 4ED8A 5KFDA 1RA7A 3NMRA 1DLOA 2LU2A 3GZ7A 2VBXA 1RTIB 2VPXB 2IMOA 3DRRA 3RBEA 4KKOA 3GFYA 3PO4A 2K2PA 3HHKA 2VQEF 4J9PA 4OZ0A 1SI9A 3FEXB 2FVPA 1CEZA 3D54A 2HZCA 4EFAC 4Y65A 4OJ1A 1KQFB 2K3KA 4AL5A 2VFTA 3PFOA 3M2RA 3JTNA 2V9WA 2Y1JA 3JSBA 2NS1B 3J7Z5 3DOLA 1NJXA 2AJ1A 3ICLA 3GR0A 2Q79A 1NHUA 2WRMA 4NLOA 3RW6A 1QUVA 2J9CA 3NLCA 4MFBA 1NZAA 3MM7B 3CC4S 4C0HA 2M0GB 3H5UA 3L7PA 1ZTTA 3BS9A 2KXNB 4YEAA 1L3UA 1NJZA 3QGPA 2ZHAA 2J9EA 2J8AA 1VS3A 2GW8A 2OKQA 2UV8G 1L3TA 2HHQA 3OXLA 2LEPA 1ZBTA 1TK0A 4C8KA 4DR6F 1N6QA 5KT3A 1SH0A 3HKWA 4WFZA 4PWDB 4HL9A 2W25A 1OQ3A 3MM9A 5FDLB 1YJ9S 4I67A 1VBYA 4TNOA 4XDCA 5KFBA 5LMNF 3CDAA 3LALA 2VC1A 4AE5A 1D9AA 1LFPA 1N5TA 4WCEQ 1LW0B 1I94F 3VZHA 2ZUGA 3NMAA 2GHWA 2YX4A 3I0SB 2PC6A 4N8NA 1M90T 1KN6A 3LGNA 3EGNA 1FF2A 3BM7A 5EX3A 5HROB 3PW2A 2QA1A 4IH7A 5K14A 3AHPA 2BR0A 2H9ZA 2J0SD 1F5AA 2B7BB 1TAUA 3CSKA 1C4AA 4URQU 4X4TA 3LUYA 3POTA 3NWGA 4O3OA 5HMYA 4C7QA 4USIA 3CCSS 2CZ4A 1RP5A 2YWHA 2VG5B 3WC2A 2YQ3A 1LWEB 5KG6A 1XWLA 2DNGA 2C3YA 3FZBA 3K5PA 3QWPA 1S1UA 3DLEB 2BZ2A 2KU7A 2QFJA 4WFYA 1S7HA 3K5OA 3VF0B 2ZH9A 4WE1B 3KJVA 4EYIB 1VK8A 4CT9A 3KLIA 1GNKA 1BQNB 3ETOA 3M32B 4M95A 4G1PA 4J9KA 1KTQA 4Q8FA 3JSMB 3DGPA 2YVSA 3KLGA 4LSLA 1DTTA 1Z4UA 2D3ZA 3MMJA 4Y2IA 3ITHA 4PXEA 4TQSA 5CYJA 2HHHF 2SXLA 3IO1A 2PN6A 3IGNA 1YRTA 3HHLA 2E44A 1RI7A 3O44A 3SDEA 5DLFA 4OX8A 1FK9A 1IJFB 1TL3A 2W4CA 4F3QA 2XG8A 3C6TB 3HVTB 5G0RA 2IVYA 1FKAF 2Q6BA 1NB7A 1DLOB 5FIIA 3GR1A 2KT2A 2GMLA 3LP2A 4RW4A 3DRRB 1FRJA 2UUAF 1YSJA 4KKOB 2IA0A 2DBBA 1RT4A 1M5OC 1RYRA 1XR6A 3DI6A 5A6PA 1N34F 1HWKA 2ILZA 2VL1A 1DARA 5K5MA 1JXLA 2CQCA 3VQTA 4TYAA 4ZP8A 3KYLA 3OL8A 4YP3A 4OHXA 4EU0A 3M2RB 2JDJA 2CQ3A 3GIKA 4CH0S 1XEZA 4DWIA 4IOBA 3DOLB 4OJ3A 1EETA 3V4IA 3G6YA 3BF4A 4I64A 4CO5A 2NUUG 4MFBB 3LF0A 4LJMA 1VQYA 2EBGA 2CQ4A 2NSBA 4K59A 3NNHA 3I82A 3UW1A 2C3MA 1P6TA 2DGTA 3MFHA 3K0JA 1M5VC 4OZNA 1O0PA 1VRTA 3M05A 3QGIA 4ZP9A 2UVWA 3T1HF 1BC6A 5HN0A 2OMLA 4CI0B 4ES1A 1YJNS 1SKSA 2JSXA 3CUNA 1N6QB 1S99A 2KJWA 2CIMA 2M4MA 1JWWA 4OX7A 2CQGA 3Q22A 4N8OA 4LUBA 3MM9B 2KB2A 2XGQA 2DPIA 1UMJA 1Q7YT 4O3RA 4I6AA 2C2DA 1ZAXA 1OO0B 1S1TA 2KFNA 5F8NA 1CG2A 2CQHA 3LAMA 2ZH3A 1UFLA 4ITSA 1S0NA 1P8GA 2LLZA 2FJAB 1WF1A 4E98A 3K59A 4B3TF 1E6VA 4Q8EA 5T14A 5K14B 4ZVGA 1U1KA 1HHSA 2WSFC 5H9EJ 4DR5F 1X9MA 2L3MA 1F9FA 3NS6A 5KAKA 3POTB 1K1QA 2EFVA 2V8VA 2UUBF 5E3AA 2MQPA 2XY7A 1T05B 1CLFA 1S77D 4QWEA 3DNCA 2Q1LA 4KV8A 3BR8A 2DB1A 3BGFA 3SCKE 3PJWA 3EX7B 3FCHA 1HBNA 2M88A 3CC7S 1S1UB 1DRZA 2R9LA 4X2BA 4OI1A 7FD1A 2COLA 2I2YA 1CVJA 3BSAA 2OFHX 2DO4A 2PT0A 3UQSA 5GMKa 3KJVB 3HVRA 5D78A 2ZJRQ 5KFMA 3K2YA 2HS3A 2MQNA 3KLIB 2IM0A 3H2UB 1RDRA 3CDBA 1N8RT 3NRBA 5EN1A 1FRHA 5A2QY 1FVSA 4IH5A 2R8IA 2CDQA 2CQBA 1S0MA 3CCLS 1VQ9S 1XMBA 3KLGB 4LSLB 2DNQA