4AXOA

Structure of the clostridium difficile eutq protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
126
structure length
126
Chain Sequence
DTVDFVRNKDISGITSIKLPTVKVSESDRLDTGNPSDVVYTKDLFTLEESPRLGCGMMEMKETTFDWTLNYDEIDYVIDGTLDIIIDGRKVSASSGELIFIPKGSKIQFSVPDYARFIYVTYPADW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight Into the Clostridium Difficile Ethanolamine Utilisation Microcompartment.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Structural protein
molecule keywords ETHANOLAMINE UTILIZATION PROTEIN
total genus 23
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4axoA00
3ES4A 5C8WA 5I0TA 3WW3A 3H3UA 3USSA 5C6CA 4AXOA 4IESA 2F4PA 3CL1A 3EQEA 3HQXA 4KU7A 2GH2A 4I09A 3NJZA 2Q0AA 3WW1A 3SCFA 5BY5A 3U11A 4EWAA 3RZZA 2UYAA 1YWKA 5HI0A 2HJIA 2ETEA 5KHKA 3CLPA 1YFXA 1UD1A 5E1RA 3FJSA 4IEYA 4MZUA 3I59B 4JTNA 5BXXA 1QY4A 4I3PA 2K0GA 4XETA 5JR7B 4I0AA 3NL1A 2N7GA 1H1MA 1CX4A 4YNIA 5KHHA 4H7LA 1VJ2A 1EY2A 4XEZA 2H0VA 1ZZ7A 2PAKA 4ZU5A 1ZNPA 1EP0A 2OZ6A 3G7DA 4Q0VA 1CAWA 4TLFA 1HW5A 4EWDA 4HVQA 4BIFA 1O3RA 3C3VA 3BCWA 3E6DA 4QM9A 4YARA 1V70A 4NVPA 5EFUA 1O5LA 2IXJA 3ETQA 4QGMA 1O7FA 4YRDA 4UBHA 3UKNA 1CAXB 4F7ZA 1NZCA 2CV6A 2OA2A 2CGPA 2GZWA 5FCCA 1OMIA 4ZU7A 4KWKA 4MGZE 1GQHA 2Z2SB 4META 3MDPA 5I0UA 1DZTA 3HIFA 4Q0UA 4MGYE 2QNKA 5LRRA 1ZRRA 4I01A 1WLTA 1YUDA 3BALA 3SMHA 4HSJA 2BYVE 1YLLA 2VPVA 4IEOA 5I8SA 4X6QB 1SEFA 2GC3A 2ET1A 4EV0A 3ELNA 4LUMA 4XF1A 2PQQA 3E5QA 1Q43A 2HKXA 4K8FA 1NXMA 1SQ4A 3E6BA 4EROA 5K8SA 2CAVA 5JSRA 1ZZBA 1GQGA 1ZRDA 2Z69A 4JV4A 4D7TA 2H6BA 4XFAA 4HLTA 3LOIA 5T3NA 1YFWA 3BB6A 4UXAA 2D5HA 2IXKA 4YSFA 3FFQA 3IBMA 3S7EA 4LA2A 4MX3A 1OFNA 2PYTA 3QACA 4WVZA 2IC1A 1CAXA 1J1LA 5BV6A 3H3ZA 3H9AA 3U10A 3H1WA 4IERA 4AVBA 3ROUA 4ZU4A 3EJKA 4QMAA 3D0JA 1QXJA 4AVAA 3RDIA 2BNNA 4MGKE 1DGWA 4HSLA 1FT9A 4FAHA 4IEPA 2XL7A 1J58A 4XF4A 2Y0OA 4QGNA 3N4MA 2OYZA 1UPIA 1QXRA 1DGRA 1EYBA 3FHIB 2PHLA 4Q29A 5JSOA 1UIJA 3BU7A 3I59A 5FLHA 4X6RB 4XFGA 1ZX5A 4KWJA 3DKWA 2QJVA 1YFYA 5FPXA 3CJXA 3ES1A 3H1MA 3MZHA 5FDBA 1FXZA 2Q4SA 2ET7A 4Q0QA 2WFPA 2MHFA 3NW4A 2QVSB 4O9GA 4HN1A 3QOPA 1IPKA 3IWZA 5CVRA 2XL9A 4PIZA 3HT2A 5J48A 5LRSA 2V09A 1U12A 3ST7A 2MPFA 1LKNA 3DN7A 3OGJA 1CAVB 3D0SA 3O14A 4LTAA 1SFNA 4L11A 4RD7A 5I8TA 4WBBA 4AQ6A 3RPQA 2VECA 1EPZA 2QDRA 2UY8A 3CF6E 3H7JA 3LA7A 4BH9A 4ORFA 4BHPA 5I0RA 2O8QA 4FT8A 1YHFA 1XE7A 4I0BA 1I6XA 3B02A 3KGZA 5D1IA 5I8YA 5FLIA 1RC6A 1X7NA 3H7YA 4IEXA 2FMYA 2MNGA 4BYYA 1WGPA 2UY9A 2OPKA 3FZ3A 4R8HA 3H8UA 1O3QA 3LA3A 4R52A 4EWEA 2PTMA 5F1RA 5I93A 5J3UA 4XF0A 1J59A 4L2NA 4XF3A 4PIYA 3R6SA 1RGSA 2IXHA 1J3PA 1Q5OA 1TQ5A 3SCHA 5FPZA 1VP6A 2GC2A 1X8EA 3M3IA 3MYXA 5BPXA 1LB2A 1I5ZA 2C0ZA 4A2UA 4HMZA 1CAWB 3E6CC 4N9IA 4FBFA 2D5FA 4I02A 3E5XA 4QXKA 3KCCA 1Y3TA 1IPJA 3GYDA 4HBNA 4OLLA 3PNAA 2PFWA 2B9UA 1O3TA 3VHRA 4Z07A 3WW2A 5EZWA 2GAUA 2BEOA 4LUKA 3JZVA 2GU9A 5LEJA 1ZZ6A 4PJYA 3NVCA 1WA4A 4IEWA 4LLOA 2EVXA 3CEWA 4IEQA 3I7DA 5I91A 1J3QA 3E97A 2OZJA 1UW8A 5KHJA 2K9ZA 3CO2A 1RUNA 4XF9A 3RYPA 4MUVA 5FLJA 4YYOA 4E2SA 1LRHA 4FAGA 1X82A 5FQ0B 1CAUA 1O5UA 3H50A 3SCGA 3RNSA 1ZVFA 5AVPA 1PMIA 2PAMA 3S7IA 3RYRA 3NKTA 4GULA 3EHKA 1PM7A 1NE6A 3IDCB 3MPBA 3BPZA 1NE4A 2EA7A 2XKPA 5BUVA 1OD5A 2BGCA 3FX3A 3PVBB 1CAVA 3DV8A 2CAUA 1YFUA 4XFCA 3SHRA 4LEJA 3DL3A 4N9HA 1ZRFA 1ZZ8A 1QWRA 3H1YA 4HN0A 2O1QA 4LA3A 2GC1A 3FE5A 2ZKLA 3OD0A 4KWLA 4DINB 5KBFA 1CAUB 2PA7A 1J3RA 1FI2A 4QGLA 3GBFA 3IDBB 4IEZA 1UCXA 4IETA 2VQAA 3LZZA 4Q0PA 1Y9QA 3ZDSA 1ZZ9A 2E9QA 4QX5A 1XRUA 3EBRA 3I54A 4AVCA 1CGPA 1UIKA 4KL1A 2P17A 5CU1A 1RTVA 4KU8A 3D82A 3KGLA 1ZREA 2DCTA 2IXIA 4AQ2A 5E16A 4HVRA 4HVOA 1H1IA 3IIAA 3L2HA 3U0ZA 2XKOA 4PIXA 5FQ0A 2PAEA 2D93A 3NSTA 1O3SA 5JSPA 4LULA 4JVAA 2ATFA 2Q1ZB 5LEKA 3SXWA 3LWCA 3RYKA 1X8MA 2XLFA 3OTFA 2XHKA 5JAXA 2B8MA 3TNPB 4IEUA 4UBGA 3HT1A 4CYDA 2IXCA 5KHGA 3KMHA 3UKVA 4ONUA 4XFBA 5CADA 1NYWA 1RL3A 3OF1A 4P9GA 4IEVA 3ACLA 3UKTA 3S0MA 2PHDA 4JTOA 4MGIE 4OFGA 3PLQA 1DZRA 1O4TA 1RUOA 5KHIA 4E2QA 5JCTA 4MV2A 1ZRCA 4HZFA 2Q30A 4B29A 2EAAA 2XLGA 4D7SA 2FQPA 2XLAA 3M70A 4MH0E 3TNQA 5J7MA 4E2GA 2QCSB 2I45A 2UYBA 1Q3EA 3WW4A 3E5UA 4Q0SA 1XE8A 4QM8A 4J1XA 1G6NA 2B5HA 4Z82A 1ZZCA 2ZCWA 2BNMA 4XFHA 2D40A 1VR3A 1LR5A 2WC2A 3OCPA 4WZCA 4J1WA 3FWEA 1JUHA 2H6CA 4XFFA 2IXLA 3LAGA 4XFIA 4F8AA 2GC0A 2KXLA 3EO6A 3KSCA 5I0SA 1OI6A 1L3JA 3LA2A 4I2OA 2XGXA 4O9EA 2BNOA
chains in the Genus database with same CATH superfamily
3ES4A 3DECA 1NA1C 3OEBA 2RDNA 4AG4A 4XURA 2C9KA 3BYWA 1QJU3 3CZJA 3NV4A 5CIRA 4LBKA 1HQWA 2CDPA 4IESA 4K40A 1UZ0A 2TBVA 2DF7A 2QQLA 4OULA 4C8DA 2VMIA 2EALA 4W4ZA 2RM22 3NJZA 1BQPA 2G9GA 4GB32 5C70A 1D2QA 4OUEA 1D0HA 3NAPB 4Y5Z0 2WABA 4IGPA 4QQOA 4YW3A 3V0BB 2CU5A 4EE2A 3RSJA 1YWKA 1K3IA 4WZFA 1VAVA 3O12A 2Y6GA 5CFCC 4PQ9A 4B1MA 3SH5A 2ETEA 3TRSB 4FCAA 4BQ4A 5JVVA 3RMYA 4LK7A 3ZIWA 3VN4A 1NCQB 1DP0A 1GP5A 1S55A 1YFXA 4NRPA 4IGOA 4ZZ8A 1HX6A 2HBUA 5DUVA 1CJDA 4RS5A 3ZYPA 1X9TA 4C0BA 3I59B 5A7PA 1T6GC 3VL9A 3AKPA 3WINE 4CUGA 3MGUA 2K0GA 3ZFGC 1UU6A 2V4AA 2VUDA 1DQ1A 4BMBA 3U1XA 3AJZA 3NL1A 5FWJA 1H1MA 3USUA 2DUPA 2XJPA 4HPKA 1UKGA 3N9NA 5HCFA 4H7LA 1GZCA 3VKNA 1G9FA 4BZ4A 1GWLA 1OKQA 1ZZ7A 1F15A 2VG9A 1NAEA 2JB4A 2JJ6A 1PO11 4LO8A 1OLME 2Y64A 3OOXA 1LOFC 5FZBA 3AK0A 4DXTA 2AH2A 4XXPA 1DGLA 2R0HA 3VGIA 1LULA 4QPYA 3D3AA 2DCJA 2ZX4A 4TLFA 4AEKA 1BEV1 3PMSA 3BCWA 4BK5A 1LOEA 1V70A 3WF2A 3ETQA 1W3VA 3VKFC 2WNUA 3K46A 3M3QA 5FYYA 5L7OB 3V0AB 3HPNA 3NV1A 2FD8A 1H4GA 1QH7A 2A6XA 2OA2A 2TEPA 5FPXA 2OUHA 2FZ1A 2CGPA 3N7KA 5JZGB 4CXXA 4Q4V1 2ZHKA 2OUJA 2IFRA 5CKNA 2VOXA 5T54A 1GQHA 4BPZA 1RUC1 1AR62 4META 3U07A 1GUIA 4Q4Y2 1OPOA 2FCTA 3LCPA 1S2KA 3LDRA 2FMDA 4WM8A 2WN2A 4XHXA 1ULCA 1O59A 4MGYE 2GNBA 1BYHA 4PI2A 4BWOA 5JZGC 1HV0A 1AR82 4YGBA 4JHTA 3DXUA 3MW4A 1WLTA 1YUDA 4R4ZA 2LTNA 5FY8A 3QH7A 2W87A 3MHZA 2Y0IA 5DDJ3 2LROA 2R0FA 1PGL1 1OA2A 5FY0A 1UYZA 2DYCA 2ZS6B 1MZ6A 3OPWA 1H2NA 1SEFA 2D97A 3NQHA 2ET1A 3LGRA 2GP5A 5LY1A 1KD7A 3AMQA 1LHUA 4XF1A 2HKXA 4K8FA 1BZWA 1V0AA 5K8SA 3OGGA 4CDUB 2CAVA 5D8AC 1LOCA 2VU9A 5JSRA 3DYOA 1CJPA 4AOCA 4YZ3A 1GQGA 3Q8AA 4Q4V3 3HNMA 5FKBA 1HXS1 5A32B 4JV4A 1UXXX 4QPWA 4D7TA 3S30A 3RZLA 3ZFEB 5CA6A 4FPLA 2IFWA 4RL7A 4WM8B 2VW1A 2VOWA 4FOQA 4YZ2A 1IKQA 1R082 3GBWA 4UXAA 2HWD2 4S2FA 3U78A 4AGVA 2ZMLA 5DAVA 2PYTA 4B4RA 4PI0A 1VE0A 1BLZA 2JDKA 3OGRA 1N3PA 4CDQA 4DQAA 4DZGA 5ANNA 1PGL2 3SC7X 1JZ6A 2R1BA 4X8PA 4AI8A 1UO9A 3J4UH 1TME1 4KQ7A 4Y1XA 4Z8BA 2R7EB 5CFCB 3JXSA 5F37A 2YU1A 4AAPA 1UMIA 4RR3C 2G4IA 1DU3D 1RB8G 1OF3A 1N1VA 1PO21 2A6ZA 4XW3A 3ZVXA 3IPVA 4TZDA 1RUF1 2BNNA 2RMU1 2WYFA 5FPLA 4P9YA 4YVWB 3AFKA 1SBFA 4LITA 4IUGA 4KNCA 3BTXA 1W9SA 2VD7A 2JDYA 5FMDA 1MEC2 4G9SB 4AQTA 3N3HA 1QGLA 3N9OA 3O1SA 1EYBA 2OQ7A 5BNQA 4P9LA 2XBO1 3AJYA 1RUE2 2Y6KA 4YM0A 5JSOA 4MGTA 2ZHNA 4PHZA 5FZKA 1KJLA 4OI4A 1FOD3 3IB3A 1GYKA 1LHVA 2NYYA 3A23A 4W6WA 4CUAA 5T5OA 5FBZA 5CFCA 1B35C 4Q8LA 4OQ8A 2B7YA 2P4EA 4DPNA 2LALA 5GJ6A 3VHOA 2MEV2 2PHTA 3U75A 5BNPB 1U5XA 4FFGA 1SPPA 2RS52 5K4LA 5FDBA 1YNAA 2Q4SA 4RS5C 2JKBA 3VKOA 3RZGA 2Y6FA 2XH6A 1R1A2 2OX0A 2MHFA 2VZPA 3VKLA 3NNFA 4HN1A 2BGOA 3J8F1 1LGBA 4YFWA 5FZHA 3QOPA 4Q1PA 2QE3A 2YUEA 3UL2A 3UNPA 4PDWA 1JZ4A 3C7FA 3ZSKA 5J48A 1SCSA 1VLNA 4O61A 5LRSA 1RHI2 2YGLA 3GHNA 4XABA 3RWNA 2F4LA 1O8SA 3ST7A 3JCIA 2MPFA 4ITCA 1J83A 3DN7A 2YV8A 2ZAHA 3O14A 4D7YA 1SFNA 3PUSA 4DEQA 2VBBA 1LOFA 4A41A 3I4IA 4AI1A 2PHRA 2RVAA 1BMV1 4WBBA 3VBHB 4JGZB 3RPQA 1LENA 4YZ4A 3ZSMA 5IHRA 1H4HA 4LR4A 1WBFA 2WAAA 4BQ2A 1MS1A 2G1MA 4H14A 3MV11 1SLTA 5KHJA 3T2PA 4ZHNA 3GGLA 3C7HA 3C7GA 4MG2A 1JUIA 3M8LA 3JBG1 2D6LX 1RYYA 2O8QA 4R9DA 4B3NA 2VW0A 1RMU2 5L73A 1US3A 1UZVA 4QU1A 2ERFA 2WNEA 1JZ5A 5D1IA 5G05L 5IUQA 2OQ6A 2JEMA 2RR12 1Q8VA 1X7NA 4OI1A 2AACA 4H2AA 3JBG2 5TSWA 1LECA 1W0PA 1JYWA 3THCA 3FZ3A 4R8HA 3H8UA 1O3QA 3H42B 3AZWA 3ZXLA 2RS32 4PDWB 1H6YA 1L7LA 1LODA 4WM8C 1JU3A 2XMLA 4L2NA 3WNLA 1VPHA 3IN9A 2RR13 1DQ4A 1R1ZA 1TE1B 4OUSA 2V4VA 4NN0A 3TOJA 2ZGTA 1QQP1 3NWKA 4DXRA 5JZGA 4M4PA 1IQAA 3R6SA 4CCMA 1A8DA 2ZEWA 4AAXA 4AI3A 1UF2C 3OYWA 5CG9A 4F83A 1UOBA 2VXRA 5JOZA 1ENXA 3RZKA 2ZGMA 3ZDVA 4ES8A 5FYBA 4K6BA 3WP4A 3SEEA 1XC6A 5GZCA 4HONA 4XQWA 2DVFA 5EIYB 3E6CC 4NRMA 1POV3 4ARYA 1MS4A 1VBA3 4LIVA 2D5FA 1DQ0A 2BDRA 1EUUA 2ZPXA 4QXKA 3KCCA 3WVJA 2CDOA 1IPJA 1QIQA 1RIRA 3O1MA 5JWPA 1WMXA 3AP9A 5DQ0A 4UFLA 3HQUA 2G9FA 3BI3A 1ODMA 1I3HA 2GAUA 4M3CB 2BEOA 2BZDA 4NRQA 1EPWA 4AHYA 5LCWL 4HPKB 3D5OA 3JZVA 1FNYA 3I97A 1OLRA 1WD3A 1SMVA 3Q8FA 1XB9A 2VCCA 1VBE2 4IEWA 1YRZA 3V65A 3VL8A 2EVXA 4B1LA 5I91A 5T5PA 2YC0A 4CXYA 3ZSLA 5GZFA 3U37A 1UQXA 1VB4A 1SBDA 2WYSA 4Y24A 4YYOA 2HEVF 4QU2A 3RYPA 5J1XA 2JB8A 2DU1A 3N36A 5A7WA 5K9YA 4CEYC 5JUVA 2GDFA 3H50A 1K12A 1V6OA 4XDQA 4Y20B 2JE7A 3IAQA 3ZPOA 1JZ3A 4RR3B 1OOPB 2SLIA 3CKHA 1OVPA 5JMOA 2PAMA 3S7IA 3RYRA 3BPZA 3MPBA 1RITA 5LBBA 3WEZA 4P14A 1OA3A 5LA9A 5BUVA 1OD5A 1OH4A 3FX3A 4Y5TA 4WM7B 3DV8A 4ASLA 2A71A 1YFUA 4CP9A 2EIDA 3TEWA 4UW4A 2PHXA 4U2AA 4A3ZA 1AR61 2Q1MA 2VCBA 5FP9A 3IIIA 5DN2A 2A1XA 3MI8A 1QWRA 1W8UA 2JG8A 1FX5A 2WO2A 2O1QA 2X53S 1QJEA 2ZEYA 2GC1A 4HN0A 2WA4A 2X5IA 2AUYA 4UT5A 5JPMB 2YPJA 4MXWA 5ERLA 4AEDC 2RG4A 5IW0A 2GNMA 1W6OB 3HAGA 2D6PA 4RR3A 4ZY9A 1QQP3 2NZ9A 2ZGNA 1AVBA 3I2GA 4YGEA 1XNCA 5KBFA 1X50A 5FZFA 3WD5A 4AI9A 2WQZC 4ZONA 2ARCA 1UX7A 2DVDA 2VZVA 3AM2A 1C4RA 1IS3A 1O91A 4QGLA 3WNOA 3KT4A 4IEZA 1AX0A 3TEXA 1Q8SA 1A3KA 2VC9A 3ZDSA 2E9QA 1XRUA 3EBRA 4QQLA 4Y33A 1CGPA 1UIKA 4FVVA 2W08A 1RHI1 2VNGA 4CCDA 4CUCA 5C9AC 2PLV2 4WVMA 2ZMNA 4AFDA 2V5DA 3OPZA 4NMIA 4Y1YA 1QHDA 1ZREA 4QKNA 1PO12 2EICA 3ZX7A 5FY5A 5JMCA 5EYXA 4RQPB 3VBFB 2W1SA 1PVC1 2EIGA 1H1IA 4NPRA 3L2HA 3S6PA 1WZXA 3ZYBA 4CP1A 3WQ7A 1GQPA 2UURA 2PAEA 5DUXA 2CWMA 3I49A 3LSEA 4A44A 2V5YA 3JB8A 1UXZA 2WN3A 4ZXKA 4OZOA 3UJOA 2IUWA 1E57A 2J42A 4P9WA 5F32A 5FPVA 5JSPA 2HWF2 4LULA 4JVAA 3OGVA 1N47A 4ES9A 3SKVA 3ZM8A 5JXGA 2P1BA 4QX0A 3MICA 1CR7A 1JOBA 4G4FA 4B7KA 4LKDA 5CNAA 3OYWB 3OTFA 5LK5A 2E53A 5L36A 1C57A 2JD9A 2BVBA 3X29B 5JAXA 2B8MA 4EJRA 1WCDJ 1MQTC 3RZHA 4IEUA 1KGYA 1HIXA 4GB31 5AC93 3ZSEA 4UBGA 2FDJA 2VUCA 2WQ8A 4JGZC 4RGKA 3ZXDA 4P00B 1W6MA 5EV7A 4CYDA 1PIV3 4QKFA 3ME2A 2DBNA 4WVWA 4XFBA 5FUNA 4BISA 4DFSA 5C8CA 3BIWE 5CADA 3H8XA 1R1A1 1VBC3 4R9CA 2D3PA 2QQKA 3UKTA 2NP0A 1BVP1 2PHDA 4QB1A 4W8JA 2Q1FA 5CKMA 1OVSA 3KV6A 3WOGA 1DZRA 2DV9A 1JYIA 3I2DA 3I2JA 1O4TA 1RUOA 2W3JA 1PM4A 4CXWA 1F35A 4QX7A 3WY6A 4TN7A 1ZRCA 3ILFA 2RM23 4HZFA 2Q30A 2GMEA 5FZAA 4B29A 1ULFA 2J1TA 2EAAA 4D7SA 2GP3A 1FMD1 3SNMA 2WWSA 4XC9A 5J7MA 5EJ3A 3I3DA 3VBOC 2QCSB 3IDAA 2PHWA 1Q3EA 3R0RA 4Y1ZA 3WW4A 3VDDA 3LEMA 2XJQA 1H0BA 3FBMA 4DUVA 1IOAA 5F39A 2Z4FA 4J1XA 1OBNA 3T2QA 2BNMA 2Y6JA 1C8M1 4COZA 1RUD2 1IQDC 2D40A 4LE3A 1VR3A 1WLDA 2WC2A 4COYA 4Q8KA 1T6BX 3LFIA 3OCPA 4P9IA 4R4XA 1G9DA 3VDBA 1OC1A 1N1SA 2WNUC 4GXLA 3MIBA 3ACHA 4LHLA 4XFFA 2IXLA 4XFIA 2VTXA 1UZYA 4BU2A 4LO4B 3EO6A 3HNYM 4FPOB 5FUPA 1L3JA 3D4KA 1ACCA 1WMFA 4OCTA 4V1PA 2C4XA 3AL5A 4CDXB 5ACA1 5CEHA 5L7OA 1JYVA 4I2OA 3VBHA 1LGNA 3CJIB 5A3NA 2BNOA 2QQUA 1FPN2 2CY6A 3AZXA 3MW3A 4D6SA 3WW3A 5JIAA 3USSA 4OHZA 3JD71 3POBA 4N43B 4AXOA 3T09A 1PK6A 3Q8BA 3OG2A 5IWFA 2B39A 4XMAA 2VQTA 1JYNA 3CL1A 3HN3A 4KU7A 4RGGA 3JUUA 1DQ6A 2W68A 5JR2A 1JBCA 1HB3A 4AGRA 5DDJ2 2ZGRA 3VB9A 3BKZA 1AL22 5BY5A 5J98B 4C1XA 4CU9A 1AR91 4UFHA 2DDUA 3I3EA 1PGSA 1DLLA 1VBE1 1EV11 5JXIA 4FQZA 2HEYF 3VBRB 5JOWA 4Y1UA 2HWE1 2X5IC 2NMNA 3IKWA 4FXGB 3CLPA 3ON7A 5L9BA 2X10A 1V6NA 4Z1VA 4AEDB 4AFMA 1PX3A 2W47A 5L19A 3POIA 2K2SA 1SFYA 4JTNA 3KWVA 3VD7A 2FBEA 2HWB2 3AZVA 1SZBA 2F17A 1HRI2 2DVAA 5A6QA 4I0AA 1VAMA 2N7GA 1VBD2 3MLLA 1CX4A 3VBUA 1E5HA 4UOJA 4YNIA 1C8M3 3QBQA 3BPSA 1EY2A 4XEZA 4N90A 3P1IA 3UK9A 5C4WB 4RFT0 2PAKA 4YVWA 2E7QA 2AEZA 2AZ5A 2I74A 3NNMA 5FXZA 1RVF2 5AFBA 1VBB1 4CP2A 3BN6A 3POEA 2HBTA 3S5AA 1EP0A 4LO7A 4N43C 4MVTA 1C1LA 1ULPA 3HD8B 4Q0VA 1HW5A 2VTFA 4W50A 3JD72 4K9SA 1O3RA 4AEDA 5AC92 3MF6A 1AR73 2ZGPA 5EFUA 2AGSA 4XCBA 2IXJA 4QGMA 4NWVA 2XJRA 1Z7S2 4JRAA 2RS31 4UF0B 4UBHA 2OIIA 3MUZ1 5FK7A 4FPCA 4FI9A 1CAXB 1NZCA 3K3NA 4IE6A 1JU4A 5FUIA 3SH4A 1TVGA 1BEV2 4E4ZA 2WNVC 2Q5TA 1FAYA 1XE0A 2Y8KA 3KV4A 4NUBA 3W20A 1AR72 1GSLA 1ONAA 2EIEA 1LHWA 4HK9A 5FCCA 4ZU7A 5C9AA 2FCUA 2ZMKA 1QOSA 1TMF2 3T2TA 2YGMA 2IZWA 3O7OA 4GQ7A 5J96B 5BNNA 2YB7A 4Q0UA 1I1EA 4XQDA 4LKSA 2AENA 1PMJX 1GU3A 3K4DA 3GCWA 2Q8CA 4ZKTB 4NROA 3PU3A 2DFBA 4LE4A 5KR7A 1AJOA 2BYVE 4YGCA 5EYYA 3ZR5A 2E63A 2YBSA 1UN1A 2XVGA 1DBNA 4QDSA 2BJSA 5FZEA 1S0JA 4CPBA 2DU0A 3P3PA 2C24A 3WNNA 4XDOA 1W8FA 2ZKNA 2WA3A 4G3YC 4RGAA 1YJKA 1PNGA 4JQTA 1G86A 2VQUA 1NXMA 1SQ4A 4LHKA 4AFCA 2GN3A 1SLCA 1JN2P 4FPHA 1OD3A 5H9PA 4EQVA 2JE9A 2HWF1 3WF3A 5FOBB 5GKAC 3M3EA 2YDEA 2C5DA 4X8NA 5LBFA 4DOUA 1PVXA 3H8OA 4GZ9A 4HLTA 4OI0A 3LOIA 1Y4WA 4IV1C 5BNNB 3PDQA 4CU8A 4N7IA 3PTYA 2C9AA 4DMIA 3POJA 1UY0A 3BB6A 3BGAA 5F3GA 2PN5A 1KRIA 4BLIA 2FDIA 3FFQA 4QXBA 3S7EA 4HKLA 4MX3A 1OFNA 4CU7A 4R9AA 5FYSA 3WT3A 1GKBA 1SHWB 4GWNA 1BMV2 1NA1B 2Y38A 1NY71 2ZJCA 3U11A 2ARBA 1NOVA 1CAXA 3HBKA 5IATA 1JYXA 4GJYA 1QDCA 2VW2A 3H3ZA 2JDHA 2JICA 2NM1A 5EP9A 3U10A 1QXPA 4NAMA 1HRV2 5E89A 4Y26A 5A6ZA 1AYN2 1EUTA 2R30A 3GNEA 1V6MA 4TWTA 1LEMA 2NMOA 1CX1A 4WM7C 5A1LA 4QMAA 2QQMA 3D0JA 1VBB2 4IXLA 5EPAA 3VBHC 4AVAA 4EN9B 3VBOA 4XXAA 4FTBA 1LEDA 2R063 2ZX1A 1HRV3 2LS6A 1FT9A 2ID4A 4GKYA 5C4WA 4JX0A 3T4HB 4FAHA 4FPYA 1AR93 4CUBA 1J58A 2FDGA 2Y0OA 5FR3A 4LK6A 2OYZA 4YM3A 2VZ3A 1GFF2 3W5MA 2VXJA 3WF0A 4I0WB 4B7EA 4Q4Y3 3PIJA 2QZ2A 1ULEA 3FHIB 4Q29A 1OKOA 5A3UA 1PZ7A 2A6YA 3FUQA 2YYOA 1BJQA 1KS5A 2VTXJ 2ADDA 3I59A 3JU9A 3BTAA 1MS0A 4XFGA 5FLHA 3TB0A 4KWJA 1REEA 1MEC1 5FZIA 1L7QA 4LJHA 4UFKA 5FXWA 1VRBA 3Q8EA 2CSGA 2ARXA 1XBFA 3DPRC 4TTGA 3CJXA 1R081 1R083 1RUH2 2OVUA 1W2TA 5L7OC 3B3QE 1RXFA 2VVDA 5FZOA 1OHFA 3ZFFC 2B9VA 1GLHA 2ZZJA 1W6OA 5DZGA 2O0OA 2WFPA 4IQPA 1E5IA 3KHCA 3NV2A 4AYUA 3POYA 1MS9A 3RI8A 3AZZA 4LHSA 1IPKA 1GZWA 5CVRA 2DCZA 2VUJA 1WCUA 5FYCA 2EXKA 1F5JA 2V09A 1TG7A 2GMPA 3WG1A 3GF6A 1U12A 3A22A 1LKNA 2WINB 1QEXA 1CN1A 1QJX2 1QOOA 2P5BA 2W1QA 3LFMA 3A0NA 2B45X 3D0SA 3FC0A 1LJ7A 4L11A 2HWC2 4RD7A 1NCQC 3MLJA 3ZR6A 1HDKA 3D6EA 4AHZA 2YPDA 5ACA2 1HQLA 1RUI1 1UY2A 1EPZA 2EXIA 2KD7A 3AC0A 1OXCA 3H7JA 1TEIA 5GLWA 4CRQA 3LA7A 2W1WA 1OT5A 3N7JA 1EV12 5FZ3A 1T2XA 4L0PA 1XJAA 1Y43B 5HXVA 2C26A 4BHPA 4GA9A 4M01A 5IVCA 2WS91 5JI9A 1I6XA 5JOYA 1RJ8A 3KGZA 2R16A 4KI5M 1S0EA 2YBPA 5A7OA 2WNVA 4Q27A 3VBUC 2F6BA 1SACA 1AYN1 5IK4A 2PHFA 3B94A 2BP6A 3FUOA 4IEXA 2FMYA 4Y4YA 4BYYA 3TEZA 1WGPA 5LB6A 5HBAA 4E9KA 1V9U3 4R52A 1H8TC 3NNJA 5FPAA 2PTMA 3TN93 2MEV3 5LATA 2XUMA 4L92A 5I93A 4ZZ5A 3THDA 1XXNA 5A3PA 5EHDA 2JG8C 4LNVA 4AGGA 1REDA 1DLCA 4QPGA 4UFIA 1MEC3 3OY8A 4LORA 5FBJA 4NHLA 4CE8A 4C91A 1UY4A 5B4NA 1I5PA 5F7UA 1F31A 3V0AA 2W94A 2BPA2 3WHUA 1BHGA 2GC2A 1Z0HA 3UESA 3M3IA 4Q4Y1 3IPVB 5BPXA 1LHNA 2Y34A 4FO9A 5A6YA 1ULOA 4BDVB 2C0ZA 3LD8A 1BXHA 2VCMA 2WO1A 3HVDA 4BOWA 1CZSA 2WR9A 5FOJB 3OGSA 2D3SA 2VMEA 3MIHA 1F8VA 4I02A 4GKXA 1F5FA 1N3OA 2VMCA 5ABJB 1YIFA 5D2AA 5ISLA 1NUKA 4HBNA 1WCKA 5IT6A 1F4HA 4D69A 1V00A 2TUNA 1W05A 2P3JA 4IV1A 2WFF1 4Q2FA 4IV1B 5BNNC 1XOYA 5H9RA 5FP7A 4PLNA 1RMU3 5EJ1B 5LEJA 1YJLA 1H1AA 3KT1A 3NVCA 5K0UB 1D4M3 3U4XA 5F2WA 2ZGUA 2BTVC 3CEWA 5A7NA 3I7DA 5IVJA 1YC61 3E97A 1GR3A 2D6NA 2HYKA 2Y33A 4B8EA 3B7MA 3J7HA 4MGQA 4Q4W1 1QJY3 1ND2C 2JXAA 2RS51 5FLJA 4BXSV 4E2SA 1SLLA 1D7PM 1DGWX 4IV3B 3PTRB 2WZPP 1W90A 1X82A 2WZR1 3GM8A 1YO8A 5A3LA 2L9LA 2ZGKA 3C2UA 1RMU1 2NQYA 2X29A 2GMMA 3NMBA 4A7KA 1PMIA 1Y9GA 4GH4A 1UX6A 1NLQA 4YVSC 4GULA 2RJ2A 4GWIA 4IL7A 2YBKA 4YLZA 5F3EA 1NE6A 5FZDA 3VDCA 4IV3C 1DQ2A 4FP3A 4Z2AA 1OSGA 1NE4A 2PMWB 2WS93 1YYNA 4JGZA 3OBAA 2RE9A 2E32A 5DUWA 4YPJA 3O1RA 2XJVA 2XKPA 2BGCA 5C8CC 2WLQA 2CAUA 4OHWA 3GJBA 4W6YA 4XFCA 4QXHA 1DG6A 4N9HA 4OQ9A 4K7JA 2VBDA 4A6SA 1RUF2 1W9FA 3VDDB 3FN9A 2X05A 1XU2A 3H1YA 1PO23 2JE8A 3KCYA 3IM0A 4MO3M 3FE5A 1ZA7A 3OD0A 4PF1A 1CESA 4DNYA 1W8OA 3ZYGA 5FZ7A 4DINB 1QJU2 1TME2 2VZSA 3ZKUA 2XR4A 2PA7A 2VZTA 1J3RA 1IG0A 5CISA 2WNUB 2Z79A 3LKJA 1NG0A 1R093 4IETA 2VQAA 3LZZA 1ZZ9A 1DGRN 3I54A 4AVCA 1TME3 1VBA2 2E31A 2G9ZA 1GV9A 4K3UA 3ZYJB 4ISQA 1NQJA 3AP6A 3ZN6B 4XJUA 3HJRA 4EN8B 5A1AA 1XNDA 3KGLA 4EZHA 1UOJA 4HKWA 1WCSA 4A3XA 2BWAA 4BQWA 5I0DA 2KM2A 1HV1A 5C7GA 3J7MA 3NRUA 1WLCA 2DVBA 2GSYA 2ZAAA 2LM3A 4HVRA 4HVOA 4LBLA 4XPVA 4RA0A 4LLFA 2D43A 1SPPB 2XQXA 2XKOA 4GIQA 3AKQA 4NHKA 5FY7A 1KEXA 4NO4A 4Q4X1 1RUI3 1OA4A 4AWDA 4UFMA 1B35B 3A21A 2VMHA 3WUCA 1YEWA 1YXWA 1W2OA 2ZX0A 2W52A 3ZFFA 2OXBA 1ASJ3 1ASJ1 2DUOA 1DIWA 1LOAA 2Q1ZB 4I3GA 4XJAA 3SXWA 4D94A 5BYNA 2BOIA 1ZA4A 3PUAA 4LBQD 5EQUA 1MR5A 2BV4A 1RUI2 2DCYA 3ZXAC 4OUMA 3K2OA 1X8MA 3UGGA 5HPOA 3VBFC 2XHKA 4JCKA 1ASJ2 4LPLA 2VZQA 1WLWA 2QQOA 3AMMA 5IVBA 2W5FA 3RMXA 4UW5A 4BQXA 3HT1A 2ZA9A 4LBQA 1AR81 2IXCA 5KHGA 1PK6B 3KMHA 3QCWA 4J6GA 4JKMA 2RS13 4ONUA 4D6RA 1H2LA 3LE0A 3OF1A 2BVVA 5FMCA 1YQ8A 3ZFEA 1UZWA 3DYMA 2D6OX 3BUCA 3ABZA 4MGIE 2JX9A 2A75A 4UWDA 2CL2A 5SV5A 2GH8A 1R091 5FJKA 3MPPG 1W2UA 5FZMA 1M4WA 4K21A 3WNMA 1XNTA 4E2QA 5F3CA 5JCTA 5DZFA 1FNZA 1Z78A 1UZZA 5EWSA 5A3OA 2YHJA 2FQPA 5L9RA 4CDQB 2BW8A 4ET7A 5KWRA 3DEMA 4MH0E 2E7TA 3TNQA 5CFDC 5GLVA 2I45A 4NIHA 3B01A 3DXTA 4XE9A 2LUWA 3MFAA 1H8TA 2VAUA 2B5HA 5F9TA 4GMP3 1HLCA 5GZDA 4N43A 1H8VA 4HT1T 4XFHA 3RQ0A 2ZOEB 2IVIB 1ZBA2 4MSVA 3CMGA 4QPGC 5C3QA 1WW4A 2QTWB 1COV2 3BIEA 1S0CA 1HRV1 2RDSA 4J1WA 3WCSA 1Z7S3 5IVVA 1JYTA 1SBEA 4YW1A 3PVNA 3LAGA 3KM5A 4P9XA 4OZXA 2IWGB 4CZSA 3DYPA 3WQBA 1RUNA 5A70A 1CIYA 2DFCA 2P6HA 1YQCA 1W28A 5KXEA 1PGW2 1ENSA 2R042 1DF0A 5FWEA 1YQ5A 4BB3A 1WD4A 3R4UA 1QF3A 2DTYA 2I07B 2E51A 5I0TA 3KF5A 4QX1A 3B93A 3H3UA 1JHNA 4KH9A 1A78A 2BUKA 3AFGA 3AYDA 4XJ9A 2P3YA 2OKXA 5FZ6A 3GBGA 2ZTNA 2A6WA 1M06G 1V6IA 3AXDA 1WA6X 4CVUA 3FHAA 1S0BA 3QD6A 1AR71 2GH2A 3Q9OA 4S2DA 1PVC2 4ATEA 4DRRA 4GJZA 1MS5A 2Q0AA 5APAA 4SLIA 5JPNB 5DG2A 5DMYA 4KBBA 5FYUA 1ND3A 1HJGA 2VMGA 2VMFA 4PBPA 4EWAA 3RZZA 4A7ZA 2NLRA 5HI0A 3TYJA 5KXDA 4FOWA 5CZKA 2HJIA 1IZ3A 3B00A 2Q8EA 3CJIC 4EN6B 5ABJA 5T50A 3I2FA 3ORJA 1BBT2 1LESA 4AZZA 1UYPA 2ZGLA 2BRTA 5JI7A 5KC6A 5LA0A 5T5JA 3UYJA 3IAPA 2FDHA 2VY0A 4GH4C 1NLSA 1JYCA 4I3PA 3KLSA 4YVSA 1RVF1 5KXCA 3PVOA 5JR7B 4CU6A 4M3CE 4HL0A 3FL7A 2DUQA 4AR2A 1VJ2A 4KMQA 1WMDA 1RXGA 2ZGOA 3L9JT 4LO6B 4BQ5A 1XNAA 2EXJA 4ATFA 1CVNA 5JLVA 3FLPA 3EMRA 4ASMB 3O1UA 1GOGA 2ZGSA 1AYM3 4JDOA 4XZUG 4ZU5A 4AVVA 3ZFGB 5LW9A 1ZNPA 2QFEA 4XUQA 2PLV1 2OZ6A 1W06A 4QDRA 4JDNA 1MS8A 2FCVA 4XBNA 3K4ZA 5FYTA 2ILMA 4C90A 1HXS3 3POFA 4NVPA 3J9SA 3OSDA 1WMEA 1FV3A 1HKDA 1POV0 4YRDA 3UKNA 1JTZX 4FPGA 4K1YA 2XBO2 4D6QA 3M7AA 4F7ZA 2R062 2CV6A 1RHI3 1W9YA 4JRLA 5FP8A 4CEWB 3MLKA 2GZWA 1RUJ2 3WZ1A 1AR83 4UI9L 4YM1A 4XTMA 4QQPA 3RZJA 4KWKA 4MGZE 3O5SA 4H3WA 2CYFA 3RZMA 2XBO3 1DYOA 3MDPA 5I0UA 4CP0A 4RN5A 1DZTA 4DY5A 3VKMA 4QHZA 3HIFA 3M4FA 3WDWA 1AYN3 5DUUA 1JZ2A 4O65A 3O1PA 3VLBB 1RUG3 1RUG1 3WF4A 5FAXA 3WXPA 1VMFA 3H0OA 5C5UA 1RJ7A 3LEIA 4I01A 1JS9A 3SISA 3SMHA 2FDKA 1XSQA 1Q8OA 3AKRA 5I8SA 2VPVA 1VBD3 4IEOA 4DS0A 4JKLA 5FYHA 3T3YA 3BODA 4NJ4A 4X6QB 3NKGA 4QPIB 2GC3A 1RUG2 4K1ZA 3ZYFA 3ELNA 3RWKX 1AR92 4AK3A 5D21A 1Q43A 5T55A 1K45A 1QH6A 2GNTA 4GMP1 4EROA 4YZ5A 3T1LA 1UWWA 1ZYBA 3S57A 2HWD1 4S2GA 1WW6A 1ZZBA 3P3NA 2VBPA 5A7QA 1KJRA 2H6BA 4XFAA 4RHV2 3UGFA 1C3HA 5CFDA 3ACIA 4KGQA 3MIFA 2W91A 4Q4X3 1V6KA 2R32A 2J1VA 2D5HA 4YSFA 1GP4A 5D8AB 1GZTA 1RUD1 3IBMA 3TBDA 1PZ9A 2QUOA 3O1VA 4HK8A 3QACA 1BEV3 4WVZA 3CZUA 4UW3A 1H9WA 2IC1A 3CHXA 3O0WA 3ZFEC 4BIOA 3IDEA 3O1TA 4P9JA 4PF5A 4ASKA 4YVSB 3I2OA 5A3MA 3E1F1 4IERA 3BOPA 1Q8PA 4P5YA 5E6HA 4N8MA 3M1HA 4JQRA 5GZEA 4ZU4A 2P37A 2GALA 4LHNA 3ZN4A 1R64A 5C8CB 3VD3A 2HWC3 5K0UA 4BMEA 4LBQB 1KS4A 3RDIA 4D0QA 5ACA3 1OQDA 2VNOA 2O14A 3WP5A 5HCHA 4FTEA 1DGWA 1F2NA 1U5YA 5C3RA 2VOTA 4Y5SA 4BXFA 2P2KA 2XQRA 4ZS3A 3AYCA 1NCRA 3MFCA 2W95A 3R4DB 5CKQA 4LBOA 1O4ZA 4HFSA 2AC1A 1UPIA 1QXRA 2VULA 2R041 3O0XA 4ZPIA 2PHLA 3NO8A 2D98A 2RV9A 1UIJA 1AXYA 1QNWA 1US2A 3BU7A 2V73A 1APNA 2Y6LA 1O6UA 2XPJA 4X6RB 4OVEA 2VZUA 4LOSA 3DKWA 2QJVA 3FBYA 1N1TA 4C0HA 3THPA 3J7LA 1BBT1 4FOVA 2EAKA 3CJIA 5FP4A 1V9U2 3U14A 4AI2A 3DUIA 5A3TA 1KXGA 1WKYA 2J1UA 3TN92 3ES1A 5BNOC 4AFAA 4FP2A 1W39A 3H1MA 3QH6A 4NOTA 4XOGA 1FXZA 5A33B 1AF9A 3MF9A 1GNYA 1FMD3 1W03A 4CTEA 4Q0QA 4D3WA 4XQ4A 5C3OA 4O9GA 3NW4A 5LA1A 3V0BA 3INAA 4JKKA 3CU7A 3ZIXA 4CCEA 5JXHA 4QQHA 1MQTA 3JQWA 2YFZA 4MGSA 4Z92B 2R071 1ODNA 3LSDA 5FMOS 3W21A 4YW4A 4COWA 3ZLIA 1GZ9A 4YWAA 3BTZA 1B09A 3NNGA 5IFTA 1KITA 1ZBE1 4P08A 3WV6A 4LTAA 3ZOIA 3SITA 1ND3C 1ND2A 1AUYA 1QJY2 1Z7S1 3PIGA 5GZGA 4JC1A 3HN1A 5LASA 1LU1A 2UY8A 1LHOA 2ORXA 5F5IA 5L9VA 2JG9A 1ZBE2 2J22A 3AMHA 4A42A 4BH9A 1VRH1 2JG9B 4ORFA 4QB2A 3URFA 5I0RA 5FZOB 5A33A 5CAZA 1XE7A 2ORZA 3GHMA 3OD4A 1IS5A 2ES3A 3DKQA 3B02A 3VDDC 3ILRA 4KGGA 2W0XA 1D4M2 3KV9A 4HETA 4IGQA 4COVA 5LZ6A 4CDWA 4IE0A 1SLIA 4K8RB 1S1AA 3LDKA 2MNGA 1GOHA 4L9BA 1W9TA 2OPKA 4XILA 2C1FA 4FFFA 3LA3A 3TN91 1RUH3 3ZYIB 1W6PB 4EWEA 1ULDA 5DAXA 5F1RA 2Q8DA 5F5CA 3ZXFA 2FHRA 3J8F3 4XF0A 3NV3A 4SBVA 1U5IA 1X33A 3ZXEA 2WQ4A 3A4UA 4B4QA 4BE3A 4Y1VA 2OS2A 4ISRA 4Q4X2 1RGSA 2IXHA 1Q5OA 3W5NA 4URAA 5B2GB 2XUEA 2BGPA 5CG8A 1BCXA 3AP4A 2TNFA 1F4AA 3MYXA 4MLOA 4A4AA 4MADA 1GBGA 4CCKA 1DYPA 1AL21 1SDWA 2JIJA 2JDAA 5F2SA 3WNPA 4E27A 2O8OA 2NPIA 2QDNA 3RVHA 1YCIA 1TNFA 4N9IA 1OUSA 3F2ZA 1ENQA 5LK7B 4FBFA 3OUJA 1MVQA 3E5XA 5FZ8A 4TYSA 2RDQA 1Y3TA 2XVLA 3LF7A 3N9LA 4IW3A 3GYDA 4LMFA 4TXWA 3PNAA 5FTTC 2HWC1 2PFWA 1PIV2 1OH3A 2PXJA 4NPLA 5EJZB 1O3TA 1H2MA 2JWPA 3WW2A 3C7OA 2DCKA 3FLRA 3K51A 2UWAA 1IS4A 3OJBA 1CONA 2GU9A 4Q26A 1G8WA 2VUAA 2ZX2A 4PJYA 5FO8B 4XUTA 4UAPA 1V6LA 1VIWB 1WBLA 1FV2A 2ZGQA 3OUIA 3P5BA 4FPKA 3N9MA 1OOPC 2PELA 1KDMA 1W0OA 4FFHA 1D0GA 2OZJA 4RHV1 1BKZA 2VVEA 1UW8A 2K9ZA 3CO2A 2WIIB 5A32A 1W04A 3MW2A 4MUVA 2ARAA 3DF0A 3DCQA 4EN7B 3AX4A 1LRHA 1A34A 4FAGA 4A7YA 3WSOA 1W8NA 4YM2A 1JW6A 1CAUA 1O5UA 5FQ0B 1AJKA 3GZUC 3O1OA 1XNBA 3HEIA 2JENA 5C33A 1ZVFA 1HN0A 3N9QA 3AKTA 5AFEA 1QU0A 2LRPA 5K0UC 2X8KA 1A8MA 1RUD3 1FPN1 3NKTA 4OMDA 4YVWC 5FK8A 2XONA 3AVSA 1PM7A 2I2SA 3CIHA 4Y22B 3ZN6A 4W6XA 4WVVA 1HQNA 1S4CA 1VBA1 3AVRA 3WP3A 1NCRC 1DHKB 3THTA 2B42B 2R49A 4YFZA 5M0TA 2CGOA 2R1DA 3SHRA 4M0HA 4DXZA 3LOBA 1W99A 1OFSA 3LDBA 5F8PA 1ZRFA 5SV8A 3T1MA 3PUIA 3WHTA 3OBRA 3PMEA 1ZZ8A 3IMMA 4QKDA 2PQSA 2BOJA 1VALA 4CPBD 1OQEA 1K5MA 4QHBA 3EB7A 3WG4A 5T5LA 3T0DA 1KDKA 2X5IB 4BQYA 1VB2A 2R061 4DEVA 4H55A 2GNDA 4XAEA 3FMGA 3W9AA 1OQ1A 2AYHA 5BNOB 1YI7A 1FI2A 3PL0A 5HV4A 1XSRA 5FZCA 3IDBB 1D4VB 4Y4RA 3FFZA 1DZQA 2WBKA 5EXOA 1Y9QA 3UT0A 1TZOA 2Q8OA 1AL23 4NR1A 1IS6A 1ZBA3 1QNYA 3ACGA 2FDFA 3VZKA 2VNRA 2EXHA 2RR11 1JOPA 4JAAA 5FPBA 3RGBA 1H8TB 1COV3 5CU1A 1G7YA 1DCSA 3NJYA 2A3XA 2E6VA 4Y22A 3WUDA 1E5SA 3D82A 4AEJA 2JDUA 4XMIA 2IXIA 1UY3A 3WNKA 1OPMA 4P02B 3RS6A 3W58A 3JBG3 4UYBA 1UYXA 1C5HA 1VRH3 4CCNA 4E4HA 2RM21 2VVFA 4XDPA 2HWF3 4Y20A 5IJRA 5FREA 5KC5A 5CYYA 4PIXA 3VV1A 4FOYA 4QX3A 5A7WB 4QD2A 3R4SA 1AYM1 3D8CA 4CEWC 2D93A 4L8QA 1SLAA 1CZTA 4OMCA 3ZXGA 2D6MA 2Y26A 4C1WA 2XDVA 4E4SA 1C8M2 3T4VA 2ATFA 5LEKA 2QQPA 1QKQA 4V2VA 2WWUA 3OUHA 1RUF3 5K7PA 3LWCA 1QMJA 1I9RA 3I8TA 2XLFA 5DG1A 3DGTA 1DYKA 3M3CA 1XPWA 4E4DX 4Q1RA 4YW7A 3J7NA 4IE7A 3BOWA 4PQQA 2P3IA 4XBQA 5JXJA 3T08A 2OPWA 4CCJA 2PHUA 3AXEA 2WS92 4YG6A 3KD4A 2WZR2 1XU1A 2MEV1 2WO7A 1H9PA 2QBXA 4Q5OA 3AYAA 1NYWA 3APBA 4P9GA 1CZVA 3HR9A 2EIBA 2JG9C 5A6XA 3S0MA 4HOOA 4JTOA 2OT7A 4OFGA 1S0DA 3PLQA 3NJVA 2WNOA 3SQOA 2VR4A 2XWJB 3ZXKA 1P8JA 1PO22 5KHIA 3GZAA 5IK8A 4MV2A 1PVC3 5E8AA 1DFQA 1VBC2 2J1SA 3EXUA 3V56A 5C4WC 5C71A 2LW8A 4N7UA 4CDWC 1FOD1 3M70A 5FPUA 5FZ0A 4NIAA 4LQRA 1HB2A 4XYXA 2YU2A 2JKXA 3M3OA 3E5UA 4FXKB 3CNAA 3K4AA 1AYM2 1XE8A 4WVMB 1C1FA 2ADEA 5IVEA 2BFUL 1O4YA 1ZZCA 5JIUA 2XWBB 3MUY1 4J25A 2J1AA 5CFDB 1UPSA 1STMA 4CDWB 4P5HA 1LR5A 2DWRA 3B9IA 4WZCA 3W59A 3DPRA 1HRI1 2RJLA 1JUHA 2VM9A 3FWEA 2H6CA 2WWJA 1GZWB 4XUNA 4F8AA 2AREA 3ZPYA 1FPN3 3ZYHA 3H8RA 2GC0A 5I0SA 2VGDA 2W2IA 1POQA 1REFA 3VHNA 5LBEA 2RMU3 1RUJ3 4OYUA 2YFUA 2RDRA 2A3WA 3P6BA 4UF0A 3VD4A 2XGXA 1LOGA 1QJZA 2Z42A 3ZMOA 2WL1A 2AEYA 4O9EA 1MZ5A 3CDZB 5C8WA 3ASIA 4CP9B 4LKFA 2DVGA 1JZ7A 2UU8A 5C6CA 1W0NA 4PLMA 5LWBA 3AYEA 3NAPC 3GZTB 1HXS2 5HXMA 1PMHX 2F4PA 2HWE3 2WSVA 3EQEA 2YY1A 3HQXA 3L2YA 1MPXA 4AE2A 4I09A 4XJZA 3ETPA 1GANA 5FRAA 5IAXA 4XACA 1JHJA 4KG8A 1C8NA 3WW1A 4XIKA 5FMOL 3SCFA 3B69A 1OOPA 1SG3A 2BU9A 4INDA 3AP7A 1JI6A 1IGOA 4FPEA 2ZACA 4OI2A 5DPNA 2VO5A 5AVAA 1LAJA 2UYAA 3NNLA 2D6KA 4YW5A 2D7FA 1V6JA 5IVFA 4PCRA 5KHKA 1K5MC 3GXUA 2W1UA 2XHNA 2Y6HA 3KS7A 3LB9A 3MIGA 1UD1A 2WO3A 4YZ1A 3ZFFB 3I3MA 1OURA 2ZBJA 5E1RA 3FJSA 4IEYA 3SH3A 4MZUA 5BXXA 4FFIA 5IAVA 1QY4A 4A45A 3WLUA 1RVF3 4XETA 4ZS2A 4CEYA 2JDPA 2E33A 1S0FA 3PURA 4GD4A 1HN1A 3ZXJA 4RSUA 5DXDA 5KHHA 1ND3B 2VZ1A 2XJUA 3ILNA 4QPIC 3AZYA 3VZJA 2H0VA 2VL4A 4QWNA 4MHUA 5DDJ1 1OUXA 3JB4C 2DURA 1L7RA 1AXKA 1W8HA 2GN7A 2ZXQA 3BVCA 2P3KA 3I2IA 3OEAA 4HXCA 1IHMA 5A3WA 3VZNA 5GM0A 3GZEA 5KXBA 1JMUB 3AKSA 3T0AA 4S2HA 1EAH2 3G7DA 4WV8A 1CAWA 4EWDA 3HNBM 1NLRA 1X9PA 4HVQA 4BIFA 4LBJA 1NXD1 5FYIA 3C3VA 2CHHA 1UNBA 1WCQA 3E6DA 4M3CF 4QM9A 4YARA 3NJXA 4EN0A 1YI9A 2JIGA 1O5LA 2WZR3 3T30A 4CSWA 1O7FA 3VZOA 5DAWA 5BNPC 4MOAA 3LPGA 4RFRB 1EAH3 1QJU1 4KWUA 2YXSA 4CCLA 3JD73 4RQPA 4E8CA 4E8DA 1UU4A 3A7QA 5A7SA 5FXXA 1D4M1 4Z2WA 4BCUA 3VBSA 1UU5A 1OMIA 3T0BA 2Z2SB 4NPMA 4AHWA 3FHQA 1RUE3 4M00A 4BA6A 2JDNA 1W6QB 2A73B 2P6CA 3I3BA 4NWWA 2QNKA 3ALQA 1FOD2 2WNVB 4JZRA 5LRRA 1ZRRA 2SBAA 3MIEA 4O7XA 1AX1A 3BALA 1S2BA 2XG3A 5LBCA 2WDBA 4GB33 4HSJA 2D3RA 1YLLA 2XB6C 2WKKA 4LXLA 5AC91 5JDBA 1ZM1A 1PGW1 1Q8QA 1VAKA 4CEWA 4AHXA 1FMD2 4EV0A 4DO0A 4LUMA 2NN8A 2PQQA 3E5QA 3CQOA 3LQCA 3E6BA 2J7MA 2WT2A 2R072 3H3LA 3K48A 3KB5A 3VBRC 4IV3A 5F6LB 3KVBA 4QB6A 3IMNA 1ZRDA 2Z69A 1MZEA 2A7AA 2VZOA 5FZ1A 4K20A 2JECA 3TAYA 1PX4A 1ZBA1 3WQ0A 4MXVA 5GLTA 2HH9A 3PJYA 5HCBA 5T3NA 2QZ3A 1QOTA 3WCRA 2RMU2 3RJ2X 5JOXA 3MIDA 3VZMA 4CA9A 3SKJE 4DIQA 3KQRA 1YFWA 2R073 3ZFGA 1W6MB 4XJ8A 3RFRA 2IXKA 1XNKA 4FQ4A 3VUOA 1MQTB 3QLQA 4LA2A 3HWJA 4M3CA 4GH4B 2KR2A 1QJY1 2CGNA 2WFF2 4AW7A 1W2AX 3OBZA 2VE1A 3Q8CA 4LBNA 2B46X 4PLOA 3RJRA 2YMZA 4N53B 1J1LA 1CQ9A 3KCXA 1G9CA 5BV6A 4BJ0A 1HJFA 1VBB3 3IZOA 3H9AA 4AFBA 4IE5A 3HBZA 1A6CA 3H1WA 1IPSA 1E5RA 5DAQA 2A6VA 3B9CA 1NZIA 5B4XA 3RG0A 2FZ2A 1CWPA 1HB1A 2QKDA 4AVBA 3ROUA 2VJXA 3EJKA 1JODA 2ZEZA 2EF6A 1QXJA 2XVKA 4MGKE 4A6OA 3OB8A 2HYXA 2HWB1 4HSLA 1LNSA 1KFUL 3J8F2 3T2OA 3FLTA 4XZPA 3CBNA 5F3IA 4IEPA 1OF4A 2J1RA 2XL7A 3NAPA 4Q4W2 2J1EA 4XF4A 4QGNA 5A1FA 3N4MA 4UFJA 1BVVA 1DGRA 5CB7A 1AR63 3AL6A 3G6JB 1JZ8A 4JHZA 3BU0A 1DQ5A 3ECQA 3U4SA 5FZLA 1W8ZA 1UMHA 2CTVA 3WNXA 1ZX5A 4HKOA 3TEYA 4RS5B 2ENRA 1YFYA 1N1YA 1PHMA 4AVSA 4BK4A 3HMYA 1GICA 2HWD3 4EZ4A 2XOMA 4CDUA 1ST8A 4URTA 5IK5A 3MZHA 2ZZQA 2WJSA 1RUJ1 2WSUA 3WX5A 2ET7A 4DB5A 2AR6A 5G04L 3VBFA 1OLQA 2QVSB 1Y7BA 3KQ4B 4PBOA 4FSJA 1UOFA 2QQNA 3OPTA 4AVTA 3KF3A 3WDYA 2RS11 4DY3A 1O8PA 1WW5A 2XL9A 3IWZA 4PIZA 5D8AA 2K46A 3WDXA 1F9KA 1K42A 3HT2A 1N3QA 4AI0A 3DPRB 4COUA 4Q4V2 4BM8A 3K77A 4I30A 4XAAA 4JGYA 4RHV3 2VOVA 3N7MA 4LLOA 1GOFA 3OGJA 3WG2A 1CAVB 2VOKA 1U0AA 4IE4A 2YG0A 4QXCA 1PK6C 5I8TA 1VMHA 5C3SA 1W2NA 3GJAA 1GNHA 3HQRA 3ITQA 1PNFA 2BWCA 4AQ6A 5F5AA 5FKCA 1TMF3 2VECA 2VQ0A 5FZ9A 2QDRA 3ZO0B 3CF6E 3VZLA 1C5IA 2UWBA 1J1TA 1R092 4NE9A 1QJX1 1QJX3 2Z5WA 4GWMA 4ZXEA 1CPMA 1FYUA 1XYNA 2WT0A 1YIPA 3ZN5A 2R6QA 2UWCA 4FT8A 3N9PA 4W65A 2BFUS 1YHFA 2JG8B 2G19A 2CNAA 4I0BA 5BNPA 3KHBA 4OHYA 4PT6A 3ATGA 1POV1 5I8YA 4OHXA 5FLIA 2JDZA 1EV13 1SFPA 1WWYA 4RQPC 4YGDA 3BTYA 3LEGA 1RC6A 2A70A 3H7YA 3PUQA 2C6SA 1W6QA 2VNVA 3MO4A 3VBSC 2WZ8A 2UY9A 4JGYB 3AMNA 2Y60A 1IKPA 1YQ6A 1PIV1 1RUH1 4YW2A 1G9AA 2E26A 2KA3A 3UGHA 4D8MA 1BK0A 1JOJA 2RS53 3LIHA 4FPJA 2JD4A 5J3UA 3J26N 1J59A 2DBIA 1J84A 4LKEA 4XF3A 1DDLA 1R1A3 1VBC1 1XYOA 4PIYA 2QQJA 4AF9A 3S5QA 1J3PA 2ZEXA 5DZEA 3ENRA 3USUB 3WF1A 3VBUB 1TQ5A 3SCHA 5FPZA 2H0BA 3UV9A 5CBLA 1TNRA 1VP6A 5T52A 2XJSA 1X8EA 4KBZA 5C5TA 1K5JA 3MBWA 1LB2A 4CDXC 1I5ZA 3MEPA 1HB4A 2P34A 2WFF3 4N53C 4QT6A 4LBMA 5FYVA 1CPNA 1KQRA 4A2UA 4HMZA 3WDTA 4F3JA 1CAWB 1SDDB 1B35A 5FIXA 3PVEA 2BQPA 3N7LA 3OBTA 4YG0A 3GDBA 5FMBA 2A3YA 4YW6A 2HLEA 4OLLA 3WDVA 2IVJA 1ZBE3 4TSVA 2B9UA 1NCRB 4BQ1A 3VHRA 4Z07A 4QDQA 3PU8A 1RUE1 2VMDA 5EZWA 4DXSA 1OLMA 4UW6A 1MZFA 4LUKA 1H2KA 1H30A 3V64A 1W8WA 4PDWC 4V2WA 3SEPA 3AMPA 1CD3G 3EYPA 4LO5B 1ZZ6A 4ARXA 5ABJC 5FFOC 1WA4A 4NAOA 1COV1 1RINA 3ZKYA 3MV01 1KFXL 4IEQA 1IG3A 5J37A 1J3QA 1MACA 4Q4W3 3GCXA 3ACFA 1X36A 5DAPA 4MYEA 1UYYA 4XF9A 4QX8A 1WUVA 2YC2A 1LGCA 4L97A 2VCAA 1WW7A 2RS33 3VDAA 3VBRA 4XJWA 3SCGA 3RNSA 1AL0G 5A80A 2WRAA 4NHYA 3LPFA 1NA1A 5AVPA 4LIUA 4TLGA 4MXWB 3PHMA 1VRH2 4NHMA 3POSA 4AEMA 3ZYRA 3EHKA 3POGA 4QHOA 1PZ8A 4XHBA 2W39A 3IDCB 4BQ3A 1W6PA 1ND2B 5FO9B 2EA7A 5FO7B 3PVBB 1CAVA 1UY1A 1W6NB 4M0NA 2ZABA 1Q56A 3KT7A 3POWA 1U5ZA 4LEJA 3DL3A 4AL9A 2JDMA 4GALA 2WZEA 1AZDA 1SLBA 4DUXA 1S2EA 2R043 1UMZA 4GWJA 5C9AB 1Y9MA 2W9XA 5LA2A 2E7AA 4LA3A 2ZKLA 1MS3A 3KZ4C 4KWLA 5IVYA 1ULGA 1AXZA 5FYMA 5FY1A 1K5MB 2WUHA 1UKRA 1VMJA 3VD9A 2WAOA 1CAUB 4OHVA 4CDUC 1UAIA 1VBE3 5IYYA 3GBFA 1V9U1 1UCXA 4Q0PA 4XTPA 2XXZA 1GMMA 2A5ZA 3LIGA 4QX5A 3PUHA 3TWIA 1AHSA 1W6NA 4WM7A 5H9QA 1QDOA 4KL1A 2V72A 1GWKA 1EAH1 2P17A 2WT1A 3RI9A 1RTVA 4KU8A 1NKGA 4XBLA 4H7MA 1CIWA 4JGYC 5E88A 2YROA 4RYDA 4U36A 3VBSB 2DCTA 1BBT3 5ANQA 1W3XA 5FYZA 4AQ2A 5FV3A 4CCCA 1D2SA 2CWSA 4XIOA 5E16A 5GALA 3IIAA 3VHPA 1G9BA 3U0ZA 2WLPA 1AX2A 3AB0A 4Y3OA 3WP6A 5FQ0A 4FTSA 3B5LB 3N35A 4NIDA 1TMF1 5GLUA 2W46A 4MHRA 3K75B 1QJFA 3NSTA 4XUPA 4B4PA 5F6KA 1O3SA 4KG0A 3UJQA 2ZHLA 3F95A 3O0VA 4IDZA 1VBD1 5FZGA 5HCAA 2HWE2 1GP6A 3K3OA 1NQDA 1RUC3 3PJQA 3RYKA 4DRVA 3UETA 2B4KA 2RS12 1GNZA 3KV5A 3OY8B 3WQ1A 1URXA 4XUOA 2QQWA 5C3PA 3ZSJA 3TNPB 4QQ2A 5IFPA 1JXNA 5DABA 4GAZA 4QAWA 1SCRA 3VBOB 2D44A 1ZRIA 3AP5A 5LY2A 1RUC2 4CEYB 3UKVA 3I2KA 4CDQC 3WG3A 1UL9A 4QKBA 3C7EA 4XVHA 3WDUA 1RL3A 1FATA 2QQIA 2YZ4A 4DUWA 3C8XA 4AQSA 4IEVA 3ACLA 1XQNA 1YQ2A 2DTWA 1W9WA 4NHXA 3M2MA 1NCQA 4CCOA 2PLV3 1NX9A 5H9SA 4HG6B 1S0GA 5FZ4A 2OW4A 2ZX3A 4CDXA 3R05A 2BBVA 2XJTA 2BERA 4N53A 4NIGA 2ZHMA 1LU2A 5FY4A 1LOBA 1H6XA 1UOGA 1LCLA 1NY72 2XLGA 4QPGB 1QQP2 4QPIA 4YG3A 2VH9A 4LOTA 2RJKA 3VD5A 2XLAA 3KVAA 5FXVA 1C28A 1W8TA 4BLJA 4E2GA 4JDMA 2UYBA 1BK1A 1NT0A 4FPFA 4Q0SA 4R9BA 5FY9A 3WR0A 5HV0A 4QM8A 1JH5A 4EYUA 1G6NA 3HOBA 1GWMA 4Z82A 2ZCWA 4NIIA 2RHPA 4QX2A 2QQVA 3RRDA 3JQXA 1XYPA 4XCAA 2HWB3 5GLZA 5J09A 5J36A 5F5QA 4L99A 1HRI3 1S0IA 1PO13 2HEWF 2VZRA 5BNOA 3I3QA 3SLIA 1LTEA 2X09A 3IT8A 5IK7A 4GMP0 2W92A 2KXLA 3GALA 3KSCA 2YC4A 1OI6A 3A0KA 3I2HA 3LEKA 2BBAA 3LA2A 1ALYA 4M4RA 1MVEA 5FJHA 5FP3A 1ENRA 4HANA 3ZMNA 4LT5A
chains in the Genus database with same CATH topology
3ES4A 1NA1C 4AG4A 1QJU3 3NV4A 5CIRA 4LBKA 1HQWA 4IESA 4K40A 2TBVA 2DF7A 4OULA 2VMIA 2EALA 2RM22 3NJZA 1BQPA 2G9GA 4GB32 1D2QA 1D0HA 3NAPB 4Y5Z0 3V0BB 4QQOA 4YW3A 3RSJA 1YWKA 4WZFA 1VAVA 3O12A 5CFCC 4PQ9A 3SH5A 2ETEA 3TRSB 4FCAA 5JVVA 3RMYA 3ZIWA 3VN4A 1NCQB 1S55A 1YFXA 1HX6A 3ZYPA 5DUVA 1CJDA 4RS5A 4C0BA 3I59B 1T6GC 3VL9A 3AKPA 3WINE 3MGUA 2K0GA 3ZFGC 1UU6A 4BMBA 1DQ1A 3AJZA 3NL1A 1H1MA 3USUA 2DUPA 2XJPA 4HPKA 1UKGA 5HCFA 4H7LA 1GZCA 3VKNA 1G9FA 4BZ4A 1OKQA 1ZZ7A 2VG9A 2JJ6A 1PO11 4LO8A 1LOFC 3AK0A 2AH2A 4XXPA 1DGLA 2R0HA 3VGIA 1LULA 4QPYA 2DCJA 2ZX4A 4TLFA 4AEKA 1BEV1 3PMSA 3BCWA 1LOEA 1V70A 3ETQA 3VKFC 2WNUA 3M3QA 5L7OB 3V0AB 3NV1A 1H4GA 1QH7A 2A6XA 2OA2A 2TEPA 2OUHA 2FZ1A 2CGPA 3N7KA 5JZGB 4Q4V1 2ZHKA 2OUJA 2IFRA 2VOXA 5T54A 1GQHA 4BPZA 1RUC1 1AR62 4META 3U07A 4Q4Y2 1OPOA 3LCPA 1S2KA 2FMDA 4WM8A 1ULCA 4MGYE 2GNBA 1BYHA 4BWOA 5JZGC 1HV0A 1AR82 4YGBA 3MW4A 1WLTA 1YUDA 4R4ZA 2LTNA 3QH7A 2Y0IA 5DDJ3 2R0FA 1PGL1 1OA2A 2ZS6B 2DYCA 1MZ6A 1H2NA 1SEFA 2D97A 2ET1A 3LGRA 1KD7A 3AMQA 1LHUA 4XF1A 2HKXA 4K8FA 1BZWA 5K8SA 3OGGA 4CDUB 2CAVA 5D8AC 1LOCA 2VU9A 5JSRA 1CJPA 4YZ3A 1GQGA 4Q4V3 5A32B 1HXS1 4JV4A 4D7TA 3S30A 3ZFEB 5CA6A 4FPLA 2IFWA 4RL7A 4WM8B 2VW1A 2VOWA 4FOQA 4YZ2A 1IKQA 1R082 3GBWA 4UXAA 2HWD2 4S2FA 4AGVA 2ZMLA 2PYTA 4B4RA 1N3PA 4CDQA 4DQAA 4DZGA 1PGL2 2R1BA 4X8PA 4AI8A 3J4UH 1TME1 4KQ7A 4Y1XA 4Z8BA 5CFCB 4RR3C 2G4IA 1DU3D 1RB8G 1N1VA 1PO21 2A6ZA 4XW3A 3ZVXA 3IPVA 4TZDA 1RUF1 2BNNA 2RMU1 4P9YA 4YVWB 3AFKA 1SBFA 4KNCA 1MEC2 4G9SB 4AQTA 3N3HA 1QGLA 1EYBA 5BNQA 4P9LA 2XBO1 3AJYA 1RUE2 4YM0A 5JSOA 2ZHNA 1KJLA 4OI4A 1FOD3 1GYKA 1LHVA 2NYYA 4W6WA 5T5OA 5FBZA 5CFCA 1B35C 4Q8LA 2B7YA 4DPNA 2LALA 5GJ6A 3VHOA 2MEV2 2PHTA 5BNPB 1U5XA 2RS52 5FDBA 1YNAA 2Q4SA 4RS5C 2JKBA 3VKOA 2XH6A 1R1A2 2MHFA 3VKLA 4HN1A 3J8F1 1LGBA 4YFWA 3UL2A 3QOPA 4Q1PA 2QE3A 2YUEA 4PDWA 5J48A 3ZSKA 1SCSA 1VLNA 5LRSA 1RHI2 2YGLA 3GHNA 3RWNA 3ST7A 3JCIA 2MPFA 4ITCA 3DN7A 2YV8A 2ZAHA 3O14A 4D7YA 1SFNA 1LOFA 3I4IA 4AI1A 2PHRA 1BMV1 4WBBA 3VBHB 4JGZB 3RPQA 1LENA 4YZ4A 3ZSMA 1H4HA 4LR4A 1WBFA 1MS1A 4H14A 1SLTA 1JUIA 3M8LA 3JBG1 2D6LX 2O8QA 4R9DA 4B3NA 2VW0A 1RMU2 5L73A 2ERFA 2WNEA 5D1IA 5IUQA 2JEMA 2RR12 1Q8VA 1X7NA 4OI1A 3JBG2 5TSWA 1LECA 1W0PA 3FZ3A 4R8HA 3H8UA 1O3QA 3AZWA 3ZXLA 2RS32 4PDWB 4WM8C 1LODA 4L2NA 3IN9A 2RR13 1DQ4A 1R1ZA 1TE1B 4OUSA 4NN0A 3TOJA 5JZGA 2ZGTA 1QQP1 3NWKA 1IQAA 3R6SA 1A8DA 4AI3A 1UF2C 3OYWA 5CG9A 4F83A 2VXRA 5JOZA 1ENXA 2ZGMA 4ES8A 4K6BA 3WP4A 5GZCA 4XQWA 2DVFA 3E6CC 1POV3 1MS4A 1VBA3 2D5FA 1DQ0A 2ZPXA 4QXKA 3KCCA 3WVJA 1IPJA 1RIRA 5JWPA 3AP9A 2G9FA 1I3HA 2GAUA 4M3CB 2BEOA 4AHYA 1EPWA 4HPKB 3D5OA 3JZVA 1FNYA 1OLRA 1WD3A 1SMVA 4IEWA 1VBE2 3V65A 1YRZA 3VL8A 2EVXA 5I91A 5T5PA 2YC0A 3ZSLA 5GZFA 1VB4A 4Y24A 1SBDA 3RYPA 4YYOA 2HEVF 4QU2A 2DU1A 3N36A 5K9YA 4CEYC 2GDFA 3H50A 1V6OA 4XDQA 4Y20B 2JE7A 4RR3B 1OOPB 2SLIA 2PAMA 3S7IA 3RYRA 3BPZA 3MPBA 1RITA 4P14A 1OA3A 5BUVA 1OD5A 3FX3A 4WM7B 3DV8A 4ASLA 2A71A 1YFUA 4UW4A 2PHXA 4U2AA 1AR61 2Q1MA 3MI8A 1QWRA 1FX5A 2JG8A 4HN0A 2O1QA 2X53S 2GC1A 2WA4A 2X5IA 2AUYA 5JPMB 2YPJA 4MXWA 4AEDC 2GNMA 1W6OB 3HAGA 2D6PA 4RR3A 1QQP3 2NZ9A 2ZGNA 1AVBA 4YGEA 1XNCA 5KBFA 1X50A 3WD5A 2WQZC 2DVDA 3AM2A 1C4RA 1IS3A 1O91A 4QGLA 3KT4A 4IEZA 1AX0A 1Q8SA 1A3KA 3ZDSA 2E9QA 1XRUA 3EBRA 4QQLA 1CGPA 1UIKA 4FVVA 2W08A 1RHI1 2VNGA 5C9AC 2PLV2 4WVMA 2ZMNA 4AFDA 4Y1YA 3OPZA 1QHDA 1ZREA 1PO12 3ZX7A 5JMCA 5EYXA 4RQPB 3VBFB 1PVC1 2EIGA 1H1IA 4NPRA 3L2HA 3S6PA 4CP1A 3WQ7A 2UURA 2PAEA 5DUXA 2CWMA 3LSEA 2V5YA 3JB8A 4ZXKA 3UJOA 1E57A 4P9WA 5JSPA 2HWF2 4LULA 4JVAA 4ES9A 1N47A 3MICA 1CR7A 4G4FA 4B7KA 5CNAA 3OYWB 3OTFA 5LK5A 2E53A 5L36A 1C57A 2BVBA 3X29B 5JAXA 2B8MA 4EJRA 1WCDJ 1MQTC 4IEUA 4GB31 1HIXA 5AC93 3ZSEA 4UBGA 3ZXDA 4JGZC 1W6MA 5EV7A 4CYDA 1PIV3 3ME2A 4DFSA 4WVWA 4XFBA 5C8CA 5CADA 3BIWE 1R1A1 1VBC3 4R9CA 2D3PA 3UKTA 2NP0A 1BVP1 2PHDA 3WOGA 1DZRA 2DV9A 1JYIA 3I2DA 1O4TA 1RUOA 3WY6A 1ZRCA 3ILFA 2RM23 4HZFA 2Q30A 2GMEA 4B29A 1ULFA 2EAAA 4D7SA 1FMD1 3SNMA 2WWSA 5J7MA 5EJ3A 3VBOC 2QCSB 3R0RA 2PHWA 1Q3EA 4Y1ZA 3WW4A 3VDDA 2XJQA 1H0BA 3FBMA 1IOAA 4J1XA 2BNMA 1C8M1 4COZA 1RUD2 2D40A 4LE3A 4COYA 1VR3A 1WLDA 2WC2A 4Q8KA 4P9IA 3OCPA 4R4XA 1G9DA 2WNUC 1N1SA 4GXLA 3MIBA 4LHLA 4XFFA 2IXLA 4XFIA 1UZYA 4LO4B 3EO6A 4FPOB 1L3JA 3D4KA 1WMFA 4V1PA 4CDXB 5ACA1 5L7OA 4I2OA 3VBHA 1LGNA 3CJIB 2BNOA 1FPN2 2CY6A 3AZXA 3MW3A 3WW3A 5JIAA 3USSA 4OHZA 3JD71 4N43B 4AXOA 1PK6A 2B39A 4XMAA 3CL1A 4KU7A 4RGGA 3JUUA 1DQ6A 2W68A 1JBCA 4AGRA 5DDJ2 2ZGRA 1AL22 5BY5A 5J98B 4C1XA 1AR91 1PGSA 1DLLA 1VBE1 1EV11 4FQZA 2HEYF 3VBRB 5JOWA 4Y1UA 2HWE1 2X5IC 2NMNA 3IKWA 4FXGB 3CLPA 1V6NA 4Z1VA 4AEDB 4AFMA 5L19A 2K2SA 1SFYA 4JTNA 2FBEA 2HWB2 3AZVA 1HRI2 2DVAA 4I0AA 1VAMA 2N7GA 1VBD2 3MLLA 1CX4A 3VBUA 4YNIA 1C8M3 3QBQA 1EY2A 4XEZA 4N90A 3UK9A 5C4WB 4RFT0 2PAKA 4YVWA 2E7QA 2I74A 2AZ5A 1RVF2 5AFBA 1VBB1 4CP2A 1EP0A 4LO7A 4N43C 4MVTA 1C1LA 3HD8B 4Q0VA 1HW5A 3JD72 4K9SA 1O3RA 4AEDA 5AC92 3MF6A 2ZGPA 1AR73 5EFUA 2AGSA 2IXJA 4QGMA 4NWVA 2XJRA 1Z7S2 4JRAA 2RS31 4UBHA 2OIIA 4FPCA 1CAXB 1NZCA 3SH4A 1BEV2 4E4ZA 2WNVC 2Q5TA 1FAYA 1AR72 1GSLA 1ONAA 1LHWA 4HK9A 5FCCA 4ZU7A 5C9AA 2ZMKA 1QOSA 1TMF2 3T2TA 2YGMA 2IZWA 3O7OA 4GQ7A 5J96B 5BNNA 4Q0UA 1I1EA 4XQDA 2AENA 4ZKTB 2DFBA 4LE4A 1AJOA 2BYVE 4YGCA 5EYYA 2E63A 1UN1A 2XVGA 1DBNA 1S0JA 2DU0A 3P3PA 2ZKNA 2WA3A 4G3YC 4RGAA 1YJKA 1PNGA 1G86A 1NXMA 1SQ4A 4LHKA 4AFCA 2GN3A 1SLCA 1JN2P 4FPHA 5H9PA 2JE9A 2HWF1 5FOBB 5GKAC 3M3EA 2YDEA 2C5DA 4X8NA 4DOUA 1PVXA 4HLTA 4OI0A 3LOIA 4IV1C 5BNNB 4N7IA 3PTYA 2C9AA 4DMIA 3BB6A 2PN5A 1KRIA 4BLIA 3FFQA 3S7EA 4HKLA 4MX3A 1OFNA 4R9AA 3WT3A 1GKBA 1BMV2 4GWNA 1NA1B 2Y38A 1NY71 2ZJCA 2ARBA 1NOVA 1CAXA 1QDCA 2VW2A 3H3ZA 2NM1A 2JICA 3U10A 1QXPA 1HRV2 5E89A 4Y26A 1AYN2 2R30A 3GNEA 1V6MA 4TWTA 1LEMA 2NMOA 4WM7C 4QMAA 3D0JA 1VBB2 4IXLA 3VBHC 4AVAA 4EN9B 3VBOA 4XXAA 4FTBA 1LEDA 2R063 2ZX1A 1HRV3 1FT9A 5C4WA 4GKYA 4FAHA 4FPYA 1AR93 1J58A 2Y0OA 2OYZA 4YM3A 1GFF2 4I0WB 4B7EA 4Q4Y3 2QZ2A 1ULEA 3FHIB 4Q29A 1PZ7A 2A6YA 3FUQA 2YYOA 1BJQA 1KS5A 3I59A 3JU9A 3BTAA 1MS0A 4XFGA 5FLHA 3TB0A 4KWJA 1REEA 1MEC1 2ARXA 3DPRC 3CJXA 1R081 1R083 1RUH2 2OVUA 5L7OC 3B3QE 2VVDA 1OHFA 3ZFFC 1GLHA 2ZZJA 1W6OA 5DZGA 2O0OA 2WFPA 4IQPA 3NV2A 4AYUA 3POYA 1MS9A 3RI8A 3AZZA 1IPKA 1GZWA 5CVRA 2DCZA 2VUJA 2EXKA 1F5JA 2V09A 2GMPA 3WG1A 3GF6A 1U12A 1LKNA 2WINB 1QJX2 1CN1A 1QOOA 3A0NA 3D0SA 2B45X 3FC0A 1LJ7A 4L11A 2HWC2 4RD7A 1NCQC 3MLJA 4AHZA 1HDKA 3D6EA 5ACA2 1HQLA 1RUI1 1EPZA 2EXIA 3H7JA 1TEIA 5GLWA 4CRQA 3LA7A 3N7JA 1EV12 1Y43B 5HXVA 4BHPA 4GA9A 4M01A 5JI9A 2WS91 1I6XA 5JOYA 1RJ8A 3KGZA 2R16A 1S0EA 2WNVA 4Q27A 3VBUC 2F6BA 1SACA 1AYN1 5IK4A 2PHFA 3B94A 3FUOA 4Y4YA 4IEXA 2FMYA 4BYYA 1WGPA 5HBAA 4E9KA 1V9U3 4R52A 1H8TC 3TN93 2PTMA 2MEV3 2XUMA 4L92A 5I93A 1XXNA 2JG8C 4LNVA 4AGGA 1REDA 4QPGA 4C91A 1MEC3 3OY8A 4NHLA 3V0AA 1F31A 2BPA2 3WHUA 2GC2A 1Z0HA 3M3IA 4Q4Y1 3IPVB 5BPXA 1LHNA 4FO9A 2C0ZA 1BXHA 4BOWA 5FOJB 1F8VA 2D3SA 3MIHA 4I02A 4GKXA 1F5FA 1N3OA 5ABJB 1YIFA 4HBNA 1WCKA 5IT6A 4D69A 1V00A 2TUNA 2P3JA 4IV1A 2WFF1 4Q2FA 4IV1B 5BNNC 5H9RA 4PLNA 1RMU3 5LEJA 1YJLA 1H1AA 3KT1A 3NVCA 5K0UB 1D4M3 3U4XA 2ZGUA 2BTVC 3CEWA 3I7DA 3E97A 1GR3A 2D6NA 2HYKA 4B8EA 5KHJA 3B7MA 4Q4W1 1RUNA 1QJY3 1ND2C 2JXAA 2RS51 5FLJA 4E2SA 1SLLA 1DGWX 4IV3B 2WZPP 1X82A 2WZR1 1YO8A 5A3LA 2ZGKA 3C2UA 1RMU1 2NQYA 2X29A 2GMMA 4A7KA 1PMIA 4GH4A 1UX6A 4YVSC 4GULA 4IL7A 4YLZA 1NE6A 4IV3C 1DQ2A 4FP3A 1OSGA 1NE4A 2WS93 4JGZA 1YYNA 5DUWA 2RE9A 2XJVA 2XKPA 2BGCA 5C8CC 2WLQA 2CAUA 4OHWA 4W6YA 4XFCA 1DG6A 4N9HA 4K7JA 1RUF2 3VDDB 1XU2A 3H1YA 1PO23 3KCYA 3IM0A 3FE5A 3OD0A 1CESA 4DNYA 3ZYGA 4DINB 1QJU2 1TME2 2PA7A 1J3RA 2WNUB 2Z79A 3LKJA 1NG0A 1R093 4IETA 2VQAA 3LZZA 1ZZ9A 1DGRN 3I54A 4AVCA 1TME3 1VBA2 3ZYJB 1GV9A 4K3UA 4ISQA 1NQJA 3AP6A 3ZN6B 4XJUA 4EN8B 1XNDA 3KGLA 4HKWA 1WCSA 4A3XA 2BWAA 2KM2A 1HV1A 1WLCA 2DVBA 2GSYA 2ZAAA 2LM3A 4HVRA 4HVOA 4LBLA 4XPVA 4RA0A 4LLFA 2D43A 4NHKA 2XKOA 4GIQA 3AKQA 4NO4A 4Q4X1 1RUI3 1OA4A 4AWDA 1B35B 3WUCA 2VMHA 1YXWA 2ZX0A 2W52A 3ZFFA 1ASJ3 1ASJ1 2DUOA 1DIWA 1LOAA 2Q1ZB 4I3GA 4XJAA 3SXWA 4D94A 5BYNA 1ZA4A 4LBQD 1MR5A 1RUI2 2DCYA 3ZXAC 4OUMA 1X8MA 3VBFC 2XHKA 4JCKA 1ASJ2 1WLWA 3AMMA 3RMXA 4UW5A 3HT1A 2ZA9A 4LBQA 1AR81 2IXCA 5KHGA 1PK6B 3KMHA 3QCWA 4J6GA 4ONUA 2RS13 1H2LA 3OF1A 2BVVA 3ZFEA 2D6OX 4MGIE 2JX9A 2A75A 5SV5A 2CL2A 2GH8A 1R091 3MPPG 1W2UA 1M4WA 4K21A 4E2QA 5JCTA 5DZFA 1FNZA 1Z78A 1UZZA 5EWSA 4CDQB 2YHJA 2FQPA 2BW8A 5KWRA 4MH0E 2E7TA 3TNQA 5CFDC 5GLVA 2I45A 3B01A 4XE9A 2LUWA 3MFAA 1H8TA 2B5HA 5F9TA 4GMP3 1HLCA 5GZDA 4N43A 1H8VA 4HT1T 4XFHA 3RQ0A 2ZOEB 1ZBA2 4MSVA 4QPGC 1WW4A 1COV2 1S0CA 1HRV1 4J1WA 3WCSA 1Z7S3 1SBEA 4YW1A 3PVNA 3LAGA 3KM5A 4P9XA 4OZXA 2IWGB 4CZSA 2DFCA 5KXEA 1PGW2 1ENSA 2R042 1DF0A 1WD4A 3R4UA 1QF3A 2DTYA 2I07B 2E51A 5I0TA 3SISA 3B93A 3H3UA 1JHNA 4KH9A 1A78A 2BUKA 3AFGA 3AYDA 4XJ9A 3GBGA 2ZTNA 2A6WA 1M06G 1V6IA 3AXDA 1S0BA 3QD6A 1AR71 2GH2A 3Q9OA 4S2DA 1PVC2 4ATEA 4DRRA 1MS5A 2Q0AA 4SLIA 5JPNB 5DG2A 4KBBA 1ND3A 2VMGA 4PBPA 4EWAA 3RZZA 4A7ZA 2NLRA 5HI0A 3TYJA 5KXDA 4FOWA 2HJIA 1IZ3A 3B00A 3CJIC 4EN6B 5ABJA 5T50A 1BBT2 1LESA 2ZGLA 5JI7A 5KC6A 5T5JA 2VY0A 4GH4C 1NLSA 1JYCA 4I3PA 3KLSA 4YVSA 1RVF1 5KXCA 3PVOA 5JR7B 4M3CE 4HL0A 2DUQA 1VJ2A 1WMDA 2ZGOA 3L9JT 4LO6B 4ATFA 2EXJA 5JLVA 1CVNA 3FLPA 4ASMB 2ZGSA 1AYM3 4JDOA 4AVVA 4ZU5A 3ZFGB 1ZNPA 2QFEA 2PLV1 2OZ6A 4JDNA 1MS8A 4XBNA 2ILMA 4C90A 1HXS3 4NVPA 3J9SA 1WMEA 1FV3A 1HKDA 1POV0 4YRDA 3UKNA 1JTZX 4FPGA 4K1YA 2XBO2 3M7AA 4F7ZA 2R062 2CV6A 1RHI3 4JRLA 4CEWB 3MLKA 2GZWA 1RUJ2 3WZ1A 1AR83 4YM1A 4XTMA 4QQPA 4KWKA 4MGZE 3O5SA 4H3WA 2CYFA 2XBO3 3MDPA 5I0UA 4CP0A 1DZTA 4DY5A 3VKMA 3HIFA 3M4FA 3WDWA 1AYN3 5DUUA 3VLBB 1RUG3 1RUG1 5FAXA 3WXPA 3H0OA 1RJ7A 4I01A 3SMHA 1Q8OA 3AKRA 5I8SA 2VPVA 1VBD3 4IEOA 4DS0A 3BODA 4X6QB 3NKGA 4QPIB 2GC3A 1RUG2 4K1ZA 3ELNA 1AR92 4AK3A 1Q43A 5T55A 1QH6A 2GNTA 4GMP1 4EROA 4YZ5A 3T1LA 1ZYBA 2HWD1 4S2GA 1WW6A 1ZZBA 3P3NA 1KJRA 2H6BA 4XFAA 4RHV2 1C3HA 5CFDA 4KGQA 3MIFA 4Q4X3 1V6KA 2R32A 2D5HA 4YSFA 5D8AB 3IBMA 1RUD1 3TBDA 1PZ9A 2QUOA 4HK8A 3QACA 1BEV3 4WVZA 4UW3A 1H9WA 2IC1A 3O0WA 3ZFEC 4BIOA 3IDEA 4P9JA 4PF5A 4YVSB