4AXOA

Structure of the clostridium difficile eutq protein
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
126
structure length
126
Chain Sequence
b'DTVDFVRNKDISGITSIKLPTVKVSESDRLDTGNPSDVVYTKDLFTLEESPRLGCGMMEMKETTFDWTLNYDEIDYVIDGTLDIIIDGRKVSASSGELIFIPKGSKIQFSVPDYARFIYVTYPADW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ETHANOLAMINE UTILIZATION PROTEIN
molecule tags Structural protein
source organism Clostridium difficile
publication title Structural Insight Into the Clostridium Difficile Ethanolamine Utilisation Microcompartment.
pubmed doi rcsb
total genus 23
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4axoA00
4AQ2A 1Q3EA 2B5HA 4YARA 1XE7A 1EYBA 4F8AA 4I2OA 4IEZA 4Q29A 4XFGA 1RGSA 5BPXA 1UCXA 3ZDSA 3NL1A 2BNOA 5JR7B 3H7YA 5I91A 3LA7A 5J7MA 4J1WA 2O1QA 2BNNA 2WFPA 4QM9A 4Q0VA 2ET1A 1O3QA 2OZJA 1V70A 4ORFA 2GC3A 5I8YA 1CAVB 4X6QB 1ZNPA 3H8UA 3H50A 1CAWB 3MDPA 1O3TA 3SHRA 2XLGA 4LULA 4O9EA 4E2GA 3OCPA 2O8QA 3S7EA 1NZCA 4MGZE 3PLQA 2P17A 1CGPA 1CAXA 3HQXA 2V09A 4QGNA 2ZKLA 2PFWA 4B29A 4LLOA 5HI0A 1Q43A 4YYOA 5FPZA 5I0RA 3MYXA 1CAXB 4Z82A 4EV0A 4WZCA 5BUVA 1ZRFA 4D7TA 4IEYA 3G7DA 4QXKA 5I0SA 3BALA 3EJKA 2IXIA 2IXCA 1WA4A 2PAEA 3E5UA 2Q30A 2GC1A 4PJYA 4QGLA 5JCTA 4O9GA 3KCCA 2QDRA 3QOPA 2IXLA 4Q0UA 3DN7A 1QXRA 4XF1A 1OMIA 1ZZ9A 4AXOA 4GULA 2D40A 3JZVA 3E6BA 3H9AA 1ZZBA 4IEPA 4IEWA 4FBFA 2XKPA 2BGCA 1IPJA 3UKVA 3SCGA 3I59A 1WLTA 3FX3A 1X8EA 3H3ZA 3CL1A 4JV4A 2WC2A 3OD0A 3HIFA 5I8SA 4L2NA 3FWEA 3I59B 1ZZ7A 2CV6A 1CAUA 3ROUA 3KSCA 5FDBA 4QMAA 4HN0A 4I0AA 5KBFA 2QVSB 4Z07A 1ZZ8A 4F7ZA 1DZTA 5C6CA 4I01A 3TNPB 1Y3TA 1ZRRA 4XFAA 4XFHA 2ETEA 2PYTA 1L3JA 4PIYA 1J3RA 2B9UA 1IPKA 5E16A 3E97A 3NJZA 4MH0E 4XF9A 4LUKA 5I0UA 4HVQA 4IEQA 4QM8A 2PAKA 2Q1ZB 3D82A 4DINB 1J1LA 1X82A 1YLLA 2OZ6A 3IDBB 3OGJA 1X7NA 2OA2A 2Q4SA 5AVPA 4BHPA 2XLAA 3EQEA 1ZVFA 4MUVA 2XLFA 4MZUA 1ZRDA 5BV6A 5I93A 5T3NA 2EAAA 3NSTA 3O14A 4J1XA 1O3RA 4XF0A 4D7SA 4ONUA 3H1YA 3KGZA 4MGYE 3N4MA 3LZZA 3MPBA 1NYWA 2Q0AA 3PNAA 4N9IA 4HMZA 5KHGA 5BXXA 4KWLA 1DGWA 1ZZ6A 3BB6A 3M70A 3UKTA 4XETA 1XRUA 5F1RA 2GZWA 3ES1A 4I09A 4LUMA 3VHRA 3SCHA 5KHKA 4QX5A 2GC0A 1H1MA 1X8MA 4I02A 2CAVA 4HLTA 4AVBA 2IXKA 4IEXA 4BH9A 5FLIA 4I0BA 3RYPA 4IERA 3LA3A 3SCFA 3E6CC 4MGKE 5CVRA 2ATFA 3M3IA 3I7DA 1DZRA 2XHKA 4META 5FQ0B 1UIKA 1FT9A 3ST7A 3EO6A 5EZWA 4KU8A 4XFBA 1YHFA 3NVCA 1VP6A 2B8MA 4LEJA 4CYDA 5J3UA 4OLLA 3CEWA 3FHIB 3RZZA 1ZRCA 3BPZA 1O3SA 1FXZA 4MV2A 2UYBA 3DKWA 2PA7A 3C3VA 4IEUA 4XF3A 4EWDA 1YFXA 5JSRA 2HJIA 1OI6A 2Y0OA 3ACLA 1ZX5A 5JSPA 1O4TA 2PHLA 4XFFA 3DV8A 1DGRA 1JUHA 1UD1A 3LA2A 1RTVA 5KHJA 3IWZA 4R52A 2GC2A 4UBHA 1CAVA 3FFQA 3CO2A 1H1IA 2EVXA 1U12A 3UKNA 3E5QA 3WW2A 4LA3A 3WW3A 2UY9A 3RYRA 3E6DA 2QCSB 5LRRA 1QWRA 1YWKA 4HSLA 1O5LA 2CGPA 4Q0SA 4HVRA 2QNKA 5FLJA 5C8WA 3WW1A 2HKXA 3CJXA 5D1IA 4A2UA 1EPZA 4QGMA 2MHFA 2DCTA 2I45A 1Q5OA 4HZFA 2VPVA 3QACA 2N7GA 4Q0PA 3IDCB 2E9QA 2MNGA 1GQGA 1EY2A 3WW4A 2Z69A 3CF6E 1I5ZA 3LOIA 2D5FA 4ZU5A 4HBNA 1CAWA 4PIZA 4YRDA 1EP0A 5EFUA 1J3PA 5FLHA 4KWKA 4LTAA 2ZCWA 2FQPA 2PHDA 3ETQA 5JSOA 2EA7A 1J59A 5K8SA 4NVPA 2UYAA 3H3UA 5JAXA 1LR5A 2OYZA 2F4PA 4FT8A 4JTOA 2BEOA 2Z2SB 4HVOA 3H1MA 4RD7A 4XFCA 1SEFA 3S7IA 3HT1A 4K8FA 5KHHA 1TQ5A 1J3QA 3IIAA 3H1WA 3GBFA 5CADA 1CAUB 1QXJA 2IXHA 1FI2A 4IETA 3GYDA 1PMIA 4WBBA 2PAMA 4AVAA 4I3PA 2IXJA 1YFWA 3L2HA 4IEVA 2OPKA 3OTFA 2K9ZA 3TNQA 2MPFA 4ZU7A 4EROA 3USSA 2VQAA 1PM7A 2XGXA 5E1RA 1UPIA 4TLFA 1O5UA 4WVZA 3CLPA 4KWJA 5FPXA 1ZZCA 1LKNA 1G6NA 4FAHA 1Y9QA 3B02A 5J48A 1I6XA 4AQ6A 1OFNA 1SFNA 3FJSA 1VR3A 2ET7A 4L11A 4KL1A 4YNIA 5CU1A 4IEOA 3D0SA 1RL3A 3SMHA 2H0VA 3NW4A 2H6BA 2GAUA 1UW8A 5LEJA 3LWCA 5LRSA 2GU9A 4E2SA 3S0MA 4HN1A 4FAGA 2XKOA 2D5HA 2FMYA 2BYVE 2IC1A 4P9GA 4MGIE 5I0TA 3RNSA 3U0ZA 1UIJA 1XE8A 4E2QA 3LAGA 1SQ4A 2UY8A 4BIFA 4EWAA 3RPQA 4R8HA 4LA2A 2PTMA 1WGPA 3FE5A 3H7JA 4OFGA 4UXAA 4AVCA 4EWEA 4H7LA 4PIXA 3BU7A 4X6RB 3BCWA 1YFUA 1NE4A 2PQQA 3ELNA 2D93A 4Q0QA 5FQ0A 3KGLA 3EHKA 1NE6A 2K0GA 1CX4A 2QJVA 5I8TA 2VECA 3EBRA 4KU7A 3OF1A 3I54A 3PVBB 1RUOA 3RYKA 4HSJA 5KHIA 1HW5A 4BYYA 1NXMA 5FCCA 1ZREA 1J58A 4JVAA 2BNMA 1YFYA 5LEKA 4ZU4A 3SXWA 4XFIA 4MX3A 3U10A 1O7FA 5BY5A 2GH2A 1GQHA 3U11A 1YUDA 3FZ3A 4IESA 2KXLA 3ES4A 4XF4A 3HT2A 3R6SA 3IBMA 3RDIA 1QY4A 1RUNA 1RC6A 1LB2A 1LRHA 2CAUA 3D0JA 3E5XA 3KMHA 4N9HA 4YSFA 2XL7A 4JTNA 4XEZA 3MZHA 2XL9A 2H6CA 4UBGA 3DL3A 3NKTA 2C0ZA 1OD5A 1VJ2A
chains in the Genus database with same CATH superfamily
4AQ2A 1Q3EA 2J1AA 3A23A 4YARA 2JDKA 2VH9A 2DU0A 4XABA 1LJ7A 1WCSA 4F8AA 1D2QA 3NNFA 3IT8A 3MICA 3GCXA 1DQ6A 1JOPA 1R1A3 4KH9A 3NJVA 2EIBA 4D69A 3Q9OA 4XTPA 5BPXA 4OQ9A 1C5HA 2VD7A 3ZDSA 4Q8KA 5T54A 1FOD1 2JJ6A 5K4LA 5KXBA 3H7YA 1WLCA 2WZPP 4XC9A 1ZA7A 1WLDA 4PF5A 4LJHA 2O1QA 3OYWB 1UL9A 2X29A 2XHNA 3CQOA 2ZMLA 1O3QA 2WLPA 3MUZ1 2RS31 4ORFA 1AX2A 4K7JA 1ULPA 4BB3A 3LGRA 3PVNA 2JE7A 4RS5B 2XVGA 4G4FA 3IMMA 1SLLA 1GZ9A 2YHJA 3HQUA 4NE9A 4R9AA 4E2GA 2Q8EA 4NIGA 3S7EA 2VUAA 2Q8DA 2HWB2 3ZYBA 1PGW2 2P17A 1OPOA 5LCWL 4AL9A 1VB2A 2ZKLA 3ILRA 3BKZA 2FDGA 2PHFA 2ZAHA 3GF6A 4LLOA 3ZXGA 2TNFA 4QKDA 3MEPA 1UKGA 4RQPC 4YYOA 1B35A 1HIXA 2GMPA 5A7WB 4ATFA 2C1FA 3VD3A 4WZCA 3SH5A 5JOZA 1W0NA 3AYCA 4YVSC 1VBA1 1WCKA 3WQ7A 4D7TA 4G9SB 3LPFA 1STMA 4JGZB 4OUEA 4QQLA 5BNQA 4YM0A 1UWWA 2VTXJ 3ENRA 1ASJ1 3KB5A 3GHNA 2IXCA 4GQ7A 3RJ2X 2GC1A 3AP6A 4OZXA 2EIDA 1VBC3 4O9GA 2QQMA 2P3YA 4AGRA 4L9BA 1ZBA2 5FYMA 1CESA 5KXCA 2QQJA 1W6MB 1JYCA 4XF1A 2ZOEB 4O61A 2FBEA 4CDQB 2TBVA 1C1FA 4FFFA 2D40A 4ES8A 2HWE1 1C28A 3E6BA 1K42A 1JBCA 2XJRA 4IUGA 1LOAA 1YYNA 1ZZBA 4GIQA 4MXWB 4OI1A 2V5YA 5A32A 2WO7A 2HWF3 3T4HB 4XUQA 1VBC1 2NPIA 2VNVA 2BGCA 2WZR2 4CCOA 1RJ8A 2EXKA 2HWD3 1UZYA 1WCUA 3ZYGA 1W8OA 3CL1A 1GZCA 2DBIA 2WC2A 2VBDA 1KD7A 2X10A 1C1LA 1V6LA 2XQRA 3HD8B 4L92A 2V5DA 1C8M3 4QKBA 2A7AA 1O59A 1MZ5A 5FK8A 1Q56A 3JB4C 5HPOA 2XDVA 5FY5A 1V6NA 4PQQA 3WD5A 4IV1B 2QQNA 3DPRC 3KSCA 5E89A 1WA6X 4CDQC 5J36A 3CZUA 1XYOA 3KHCA 1RHI2 3AP5A 5AC92 1FATA 2DU1A 1W03A 1REDA 1ZZ8A 3MBWA 3NJYA 3MW2A 1LOEA 5ABJB 4NIDA 4CEWC 3JQXA 4YW3A 4HOOA 1HQWA 2B46X 1ZRRA 3H0OA 4GMP1 4XFAA 1D0HA 1UY3A 4B8EA 2ETEA 1MEC1 4IE0A 4W65A 4UW3A 5KWRA 1J3RA 1IPKA 2GN7A 5E16A 1BQPA 5FWJA 5F6KA 1J1TA 4FQZA 1NUKA 2XJVA 4U2AA 3ME2A 1RUC2 1W9YA 1OQDA 2C26A 2PQSA 5D8AC 4AI0A 5FOJB 2X8KA 1AJKA 1MS1A 1UZWA 3O0VA 4Q4V3 4S2HA 3SH4A 1JW6A 2O14A 5IAXA 2FDKA 3RI9A 2OS2A 4D6SA 1C5IA 4QM8A 1DQ5A 2C4XA 5JPNB 4CDUC 3BGAA 3PTYA 3D82A 5JOWA 4IV3A 5FZIA 1D4M2 3I2JA 4L0PA 4V2WA 3JBG1 4ISRA 3IDBB 3OGJA 3VBRB 2GDFA 2DURA 1X7NA 3TOJA 3UNPA 4GH4A 2Q4SA 4RSUA 3U07A 4BHPA 5ANQA 1OLMA 3ACIA 4IE7A 2XLAA 2W3JA 2R6QA 4JQTA 4MZUA 4XYXA 3QBQA 1IOAA 3U75A 1ZRDA 3VBRA 2CNAA 4NIAA 5I93A 4JGYC 3LD8A 4LHSA 3NSTA 3O14A 4NN0A 2RJ2A 4D94A 3B01A 1DCSA 2WT2A 4A42A 3H1YA 2HYKA 3N4MA 1REFA 3MPBA 1CZVA 2JIGA 3PNAA 5KHGA 1WZXA 2WO1A 2WBKA 4DRVA 4KWLA 4CP9A 4FFGA 4FQ4A 3WF0A 1XB9A 1ZZ6A 4BWOA 2LUWA 4YGDA 1I5PA 4PBPA 3DPRB 1W6QB 4XETA 5AFBA 2VMGA 3HN1A 1QJX1 3T4VA 1W8HA 2IUWA 4L8QA 4D7YA 2VQUA 1SLAA 4I09A 4LUMA 2D6KA 2RHPA 5KHKA 5L19A 1LU1A 3O1TA 4HK9A 4FFIA 4UI9L 4OYUA 5L9BA 4NRPA 1CVNA 3EXUA 4FPHA 4RR3C 5CFDB 4JGYB 4IEXA 4BH9A 5HBAA 5FZ7A 3T0AA 4HG6B 1QH6A 4LBQD 1IHMA 1LEMA 1ND3C 4RGKA 3ZDVA 1GYKA 5BNOB 3OGGA 3BTYA 1LOBA 1RITA 3M3IA 4UFIA 5DG2A 1DZRA 3ZXAC 2XONA 3OBRA 3AL6A 3ITQA 1W9SA 2FDJA 3S30A 1DFQA 3KV5A 1BEV2 1S0EA 3EO6A 5T5OA 3OPTA 4AVTA 1H4HA 2DFCA 5JXJA 3AP7A 4ARXA 4CYDA 2P34A 4CU6A 2QQOA 5J3UA 5J37A 1COV1 3FHIB 2PLV1 4RHV2 1QJY1 1R082 2P1BA 1O3SA 1FMD3 2ZGMA 1F15A 2I07B 2UYBA 4MV2A 4UW5A 2ZTNA 4AI3A 2W94A 2HYXA 4IEUA 3C3VA 4JKMA 3VHNA 5HV0A 1YFXA 1W0PA 5CFDC 4NRQA 5D2AA 3RVHA 1TEIA 5GM0A 2Q1MA 4BJ0A 5JSPA 2BUKA 5BNOC 4QHOA 2Z42A 3KT4A 2WS91 5F39A 4Z2AA 3UL2A 2GNBA 2PHLA 3IPVB 4WVMB 2WO2A 3I3MA 2PLV3 1UD1A 3I2HA 1LODA 2P6CA 5FZAA 1AR81 1H8TA 1RVF2 1RTVA 1A8MA 4COWA 1LULA 2RV9A 4L97A 4KI5M 2GC2A 3IN9A 4EZ4A 4UBHA 1WW4A 2YB7A 4KBBA 1AZDA 3EYPA 3MF6A 5J98B 2EVXA 1H2NA 1K12A 4NHKA 3UKNA 1HB1A 1FYUA 1W6OB 4TZDA 3KLSA 5C71A 3S5QA 1HXS3 1R093 5FXZA 5JI9A 2HWD2 4E27A 3RYRA 4AFCA 1GLHA 2GNTA 2OT7A 4IE6A 5IFTA 1O5LA 1GZTA 2ZX1A 4YVSB 4LBNA 5LY2A 4N7UA 2Q1FA 4JGZC 4LHLA 3PU3A 1BVP1 4RR3B 3KVAA 5A7WA 3UYJA 5HCFA 5C8WA 4MYEA 3WNPA 1S2BA 1V6IA 4HKOA 3MIBA 3RZLA 1RHI1 2QDNA 4XTMA 1SCSA 5AC91 2Y0IA 1O4ZA 4XCBA 1EPZA 4XHXA 4DUVA 4QGMA 5ACA1 1SBEA 3ZPYA 2GMMA 2VPVA 1WKYA 3ZFFB 4Q0PA 3MF9A 1O91A 1XXNA 4CU8A 1GQGA 1EY2A 2FZ2A 4NIHA 2P3IA 3CF6E 2RS32 1KGYA 3POFA 4DFSA 2J1UA 5A6QA 2D5FA 2WNVA 5GLVA 3I8TA 2VW1A 4JKLA 3BTAA 5H9RA 3WF4A 3MUY1 5EFUA 4QXCA 2JKBA 3KV9A 3KWVA 1SLBA 1AUYA 1PZ9A 3IMNA 3S6PA 2A6WA 2MEV2 4H7MA 4LTAA 3ZYJB 2FQPA 4AAXA 4AVSA 1KJRA 3J4UH 2D3RA 3R4DB 5K8SA 3VZOA 1LOFA 2OQ6A 5F3IA 4FP2A 2GSYA 1ULGA 2JICA 3TB0A 5IK4A 4GMP0 2F4PA 3DEMA 1W3VA 2Z2SB 1GWMA 3I3EA 4LKSA 2JG8C 2RM21 4K3UA 1HRI3 3T0DA 1DYPA 4K8FA 5FZ6A 1ENRA 1TQ5A 2RR13 4S2DA 1J84A 1LOFC 5C8CB 2VVDA 4ES9A 1AYN3 1LGCA 1PNGA 4CDXB 3GBFA 1KEXA 1PVXA 1AF9A 4ZKTB 4IXLA 5GZDA 5CA6A 4FVVA 1AR62 4CDWA 3DXTA 5LBCA 3WQBA 1UNBA 2RS52 3BPSA 3GYDA 3WNXA 1NLQA 3T1MA 1E57A 1X50A 3K77A 2AEYA 1TG7A 3NQHA 1AR92 4QWNA 4C8DA 2Y38A 2IXJA 1KQRA 2OPKA 3JQWA 1LAJA 1ULOA 3GCWA 4FPCA 4HKWA 4QPGB 5BNPC 1A34A 3ZKYA 3AMNA 3UGHA 1BVVA 2VW0A 5D8AB 3TNQA 1HQLA 2VZOA 2LW8A 4LK6A 1XNKA 4NROA 4CDUB 4AGGA 5F37A 3M3OA 3K3NA 1ND2C 4C91A 1RUI1 5E1RA 2ZMKA 2CGNA 1W2UA 2JDAA 1UKRA 3WF1A 4Z2WA 2XBO3 4WVZA 5A6YA 1QEXA 1TZOA 1QJFA 1CIWA 3PIGA 3TAYA 3ZYPA 5FZ4A 1MZEA 1NA1A 4I3GA 2VMEA 1JOBA 1LKNA 2ARCA 5CFCC 1RMU1 2R073 3W5NA 4GD4A 3B02A 5J48A 4AQ6A 2WN3A 4YNIA 3Q8BA 5CU1A 1PVC2 4LO6B 2DTWA 4YZ3A 2ARXA 1WWYA 3GJAA 3SMHA 4QKFA 3NW4A 4GJYA 1DP0A 2H6BA 1GNZA 3M3QA 4DIQA 1UW8A 5FUIA 2EIGA 3KVBA 3WQ0A 5A3NA 3LEKA 5LRSA 4E2SA 1DG6A 3LEIA 4HN1A 1AL21 2D5HA 3C7FA 1OOPA 4UWDA 5APAA 1KDKA 1OA4A 2VR4A 3LFIA 4LBKA 5FYZA 5FP7A 3ZR5A 3AZWA 5DDJ2 1GQPA 2UU8A 3U0ZA 1UIJA 1XE8A 5L7OB 1SACA 1GOHA 5F3GA 4LA2A 5DAPA 2ZGLA 4XZUG 1NY71 1ODMA 4RGAA 3C7OA 1TE1B 4PIXA 2QQUA 1ASJ3 1ENXA 2Y34A 4XUOA 3I2IA 3BUCA 2A3WA 3ELNA 4OUSA 3HNYM 4Q0QA 4Q4Y1 3RMXA 1BMV2 1XYNA 1DLCA 2J1RA 2W95A 4ATEA 4K20A 3RZJA 1F5FA 1CX4A 5I8TA 2JG9C 5IVEA 2DVAA 1XSQA 5D21A 5EPAA 4ZY9A 3VDAA 5FBZA 2KR2A 5FR3A 3GJBA 3VL8A 2AENA 2Z79A 5A7OA 1JZ4A 3PVBB 1YJKA 5HCAA 3RYKA 5KHIA 4YZ4A 3KT1A 4LKEA 1F4HA 1XNAA 4E4HA 2V73A 4CCEA 5A1LA 1IG3A 3A0KA 5F3EA 1J58A 1VE0A 2AUYA 3AP9A 2DCKA 4HT1T 5DABA 4ZU4A 5BYNA 4OHXA 4Y4YA 3MLLA 1XNBA 4QQOA 2KA3A 4FPGA 5FZ8A 2P37A 1KJLA 1QJZA 1WD4A 2GH2A 2XG3A 3VZMA 4GWMA 3U11A 1RUD3 1QH7A 2PHTA 2VMIA 3JD72 3V56A 2UURA 3WDXA 3FZ3A 4AG4A 3NO8A 4B7KA 2FZ1A 1MZFA 3VL9A 4MO3M 3NKGA 2VU9A 3CDZB 3KV6A 2WL1A 3NNJA 3QCWA 1MS9A 1JXNA 4CU7A 4IDZA 5GKAC 2XJPA 4PF1A 3WNNA 3CZJA 3LEMA 5IK7A 1SFPA 2G9ZA 3M1HA 3JD71 1OA2A 4DQAA 1VBC2 2JDYA 2XJUA 3KHBA 3NKTA 4Y1ZA 1OD5A 2IWGB 4DNYA 3KM5A 1ZRIA 2VMHA 1RXGA 2XVLA 1XE7A 4LIVA 4OUMA 1EYBA 4PCRA 4XJ9A 2KM2A 4Q29A 2Y6GA 1UY0A 1AR83 2WR9A 1RGSA 3AVRA 2AREA 2WKKA 4NWWA 1UCXA 3L9JT 4PI2A 5JR7B 2A6XA 4COVA 1UU6A 1ZYBA 1H8VA 2CY6A 2WS93 4RL7A 1OUXA 4DUWA 1UY1A 4RA0A 5T5LA 4UT5A 5J7MA 2VZ3A 4JRAA 1FAYA 2BNNA 2WFPA 2WN2A 3GDBA 4Q4X1 3LKJA 2WWJA 4IQPA 2ES3A 3VBUB 4CUBA 5K0UB 1PO22 2WIIB 1VRH1 3D6EA 4O7XA 5DAWA 3NNMA 1NG0A 2OZJA 5EJ3A 1WBFA 2NM1A 1OURA 5C5TA 1W8UA 1VMHA 3FBMA 2XPJA 3ILNA 2ZZJA 3OUIA 3MDPA 3NNGA 3WP4A 1O3TA 2ZGPA 2R0HA 2VNOA 2XLGA 4QAWA 1QJU3 1HRV1 4NAOA 4GWNA 3AYDA 3UJOA 1NZCA 3ZN6B 3PLQA 4K1YA 2YUEA 2EXJA 3WG2A 3HQXA 3G6JB 4QGNA 5DPNA 1AR63 1DZQA 1JZ2A 3OEBA 1Q43A 1W6PA 4CXWA 2E32A 3DECA 4GA9A 5FPZA 1WMXA 5I0RA 3MYXA 2J22A 4OI0A 1OLQA 1G9FA 4G3YC 4IGQA 1JN2P 3RMYA 5FZBA 4IW3A 5I0UA 4EV0A 2ZACA 4C0HA 1JMUB 1D4M1 5BUVA 1OSGA 4C1WA 2B4KA 1U5ZA 2CYFA 3G7DA 3AM2A 3CBNA 1IS5A 5C8CA 5JR2A 1JYNA 1D2SA 3EJKA 1YC61 1GUIA 2R16A 4P14A 3E5UA 2DCJA 3OGSA 1V9U3 4QKNA 1W06A 4TN7A 4YW4A 1SLCA 4BQ5A 5JIUA 3R05A 5GJ6A 4E9KA 4DPNA 3QOPA 4HPKB 3GNEA 3ZXFA 1H9PA 4OI4A 2DYCA 2KD7A 1Y43B 1W2AX 5A7SA 3ZN5A 5A32B 1ZZ9A 4DEVA 3ZYFA 4MLOA 2XUMA 1DBNA 1JYTA 1ONAA 4XUNA 3JZVA 3D5OA 1CPMA 1VMJA 1RB8G 1NA1C 3FFZA 5KXEA 3GZTB 2WAAA 3R0RA 2Z4FA 1S0GA 2C9AA 1UOGA 4IEPA 4AWDA 3OGVA 4FBFA 3MIFA 1GSLA 5GALA 2WFF3 3WG3A 4LKFA 3FX3A 2ZA9A 1X8EA 3H3ZA 3VDDC 4JV4A 1QDOA 5K9YA 2R1BA 3OD0A 5C3OA 1C8M2 5KC5A 1TMF1 4BM8A 3MIGA 1JHJA 4JHTA 1VBA3 5ACA3 1FNZA 1C4RA 1ZZ7A 1W90A 2CV6A 1RUJ2 2QUOA 3OD4A 2NZ9A 3OSDA 2WZEA 4XDQA 3AYAA 5FKCA 4CP0A 4O65A 1W2OA 1NCQB 4Y1YA 3DKQA 3ZMOA 4HN0A 1K5MC 1F5JA 2G9FA 3VHOA 4Z07A 1FPN1 3JXSA 1VBB1 1PM4A 2YC2A 4UOJA 4F7ZA 4MG2A 3WNMA 1NA1B 2W0XA 5DDJ1 4ZZ5A 2OIIA 1XSRA 1W8FA 4A44A 3BIEA 2BFUL 2I2SA 3ZM8A 2PYTA 1AJOA 4P9XA 3RSJA 4I0WB 1VBD1 1V6KA 5L7OA 4RHV1 3ZXKA 2XB6C 2HWC1 3E97A 3MV11 4QDRA 2EXHA 1AYM3 3DUIA 1QMJA 2PHXA 3H8XA 2RS33 1UO9A 2JXAA 2W91A 2ZX3A 4INDA 4M01A 1HB3A 4HFSA 2ORZA 1VBB3 4HK8A 4NHXA 1FPN3 5AVAA 5FYYA 5JVVA 4QQPA 4A4AA 1W8NA 2E53A 3UETA 1H2MA 4OULA 3B94A 1Z7S2 4MHRA 3LOBA 3J9SA 4C90A 3KF5A 2WFF2 3ALQA 5CZKA 2PELA 5T55A 2FD8A 2Q1ZB 2AC1A 2YROA 1QNWA 4DINB 1G9CA 1WMEA 2ZABA 3AXEA 1J1LA 3IDAA 4KGQA 4P00B 4Q4V1 1X82A 1YLLA 3PDQA 1FMD2 4M3CE 4ZS3A 3UESA 4COUA 3V0BA 4CEWB 3T2PA 3P1IA 1AR73 5LB6A 4AQTA 5AVPA 2CDOA 3M2MA 4C1XA 1QJEA 5F3CA 1I1EA 1GMMA 4AYUA 4LORA 1YXWA 2XLFA 1JH5A 1MEC3 2YGMA 4LBQA 4P9IA 1DGRN 2WFF1 2A5ZA 4R9CA 2JG9B 4DOUA 1XQNA 3U37A 3IZOA 5IVBA 1O3RA 1R092 1O8SA 1AXKA 2BWCA 3ZIXA 2ADDA 5BNOA 5FZKA 2E7QA 3LZZA 3RQ0A 1FOD2 4ITCA 3ZX7A 2FDFA 3R4UA 3ZN4A 2V4VA 5LK5A 5JWPA 2ZHLA 1SPPB 5I0DA 4XAEA 4BOWA 3OY8B 3M70A 5FP4A 1SBDA 2UWCA 3UKTA 3WXPA 5F1RA 1UOFA 4XOGA 1W28A 1U5XA 3U4XA 3ES1A 1NCQC 5HXMA 4Y33A 5SV8A 4AI1A 3HN3A 1W2NA 1R1A2 2ZGRA 3H42B 3WNKA 4CP9B 1PO23 4NR1A 1H1MA 1ND3A 4HLTA 1HRV2 2E51A 1CZSA 5FLIA 1TME2 1UMZA 4AFBA 3AKSA 5CEHA 1QJY2 1B09A 1BXHA 3GZUC 4YW6A 1VRBA 4YG3A 2Q8CA 5JXGA 3LA3A 3SCFA 1OKOA 1SDDB 2ATFA 4QD2A 3MIDA 1DGWX 4A6SA 4AHXA 1POV1 4HANA 1FT9A 3Q8EA 1AR61 1NX9A 4M0HA 4A7YA 3ZFFC 1X36A 4XDPA 3A0NA 3Q8FA 3VBOC 2ORXA 5EZWA 4KU8A 3UKVA 1YHFA 4EN6B 1VP6A 4L99A 4LEJA 1HRV3 2YY1A 1HN1A 4LMFA 4P02B 4B4PA 4MGQA 5FTTC 4FP3A 5A3OA 3WY6A 4Q27A 5BNNC 1UZZA 2RJLA 4GALA 2B39A 1S55A 4BXFA 4FXGB 2RR11 4JGYA 5DQ0A 2A73B 1SLIA 2D6PA 3KQ4B 2W5FA 3ACLA 5JDBA 1ZX5A 1JZ7A 1PGW1 4GZ9A 1W9FA 1HJFA 4BCUA 1LENA 4JX0A 4LHKA 2WNUA 3W20A 4XFFA 1MS8A 5C9AA 4QX8A 1JUHA 3DYMA 3K4AA 4UW6A 1BBT1 3OUJA 2DDUA 3LA2A 5DUVA 5KHJA 1W6OA 1VBE1 4D0QA 2HH9A 2EICA 2HWF2 2CL2A 1CAVA 3WQ1A 3D4KA 4BE3A 3T09A 2GN3A 1H8TC 2Y6KA 3JCIA 1JU4A 4RQPB 5C9AC 1AXZA 4SLIA 2WZR1 3E5QA 1WD3A 4LA3A 1W9TA 2I74A 4A41A 1YQ5A 2UY9A 3BOPA 2GP5A 2VTFA 1NKGA 1RUG3 3E6DA 3POWA 5LRRA 4GB32 1YWKA 4Y1XA 3W59A 1ENQA 1UYYA 1Y9GA 3WVJA 1FOD3 3BOWA 4LLFA 3D3AA 1Q8VA 3NV4A 4Q1PA 3FLTA 1HLCA 3JBG2 3PUSA 4NAMA 5EHDA 5FLJA 4Z8BA 3B3QE 5CIRA 1R1A1 3ZVXA 4UYBA 2OUJA 4A3XA 2QZ2A 3ZKUA 3AYEA 2WZR3 2MHFA 2XOMA 3T3YA 3THCA 3N7KA 2DCTA 1UY4A 1Q5OA 3EMRA 4HZFA 4ZPIA 4GB31 4AI8A 1PZ8A 1G7YA 1DGLA 2N7GA 3B93A 3CIHA 2GNDA 3PHMA 1AR91 4FOWA 3SNMA 3I3DA 2BGOA 4B1LA 1TMF2 2WRAA 3W5MA 1WLWA 1X9TA 2CDPA 3WW4A 5FOBB 1I5ZA 2ZEZA 3J7LA 1ZBE2 4ZU5A 2YDEA 4PIZA 1BEV1 3DGTA 5EJ1B 1G86A 3CHXA 2PHUA 5BNNB 1IQDC 3N9MA 2YC0A 2ZPXA 3KQRA 4LO7A 1J3PA 4Q4W2 2WINB 3ZN6A 2RM22 3MLKA 4QXBA 4FOYA 5GLWA 1CJDA 2PHDA 2HWB1 4WV8A 2SLIA 5E8AA 4MXWA 5DAQA 4YWAA 2DVGA 1NCRA 1WBLA 4NVPA 4YW2A 4AZZA 1OPMA 2DUPA 3I2KA 5F8PA 5L7OC 1LESA 3FBYA 3H3UA 4ARYA 5A70A 5JAXA 5DZFA 1FMD1 1UN1A 4HVOA 1SHWB 2J1TA 3KT7A 4AHYA 1SEFA 1XPWA 3WG4A 2QKDA 3LE0A 4XILA 1Q8SA 3HT1A 3O5SA 1S0BA 4A7ZA 2OVUA 1PGL2 3AMMA 4ASLA 2RR12 2F6BA 5H9SA 3IIAA 4B1MA 4K40A 1EAH1 2DCZA 1QXJA 3T30A 1Y9MA 3JUUA 4P9WA 3N9QA 2BZDA 2VO5A 1W05A 3NV1A 3WZ1A 1AR72 3J8F3 3MV01 3AZZA 2PAMA 4XXPA 4AVAA 4GAZA 4NHLA 1YFWA 3L2HA 3RZKA 2VCMA 4IEVA 2Z5WA 3E1F1 1YIFA 1POV3 3LB9A 3B9CA 1FX5A 5H9PA 1QGLA 2VOWA 1HB4A 2K9ZA 5IW0A 2MPFA 3IDEA 1FPN2 3USSA 2VQAA 1OFSA 1QJX2 2J1SA 2BPA2 2A75A 2XH6A 1UPSA 1UPIA 1BYHA 1AX0A 1VIWB 3N9PA 1SCRA 4TYSA 3WDYA 4AF9A 2LRPA 4TLFA 3BN6A 4AW7A 2YBPA 4KWJA 5GLUA 5B4XA 1ZZCA 3IKWA 3NJXA 4LQRA 5EJZB 4LITA 4PLOA 5GZCA 4BMEA 1Y9QA 1ST8A 3SQOA 2CWSA 1I6XA 2BBAA 4QXHA 4Y1VA 3WF2A 1H2KA 3ZXJA 4KL1A 4ASMB 3D0SA 1IG0A 2FCUA 2Q5TA 1H9WA 3BVCA 2H0VA 3OOXA 4PLMA 4XXAA 5IVJA 4ISQA 5JZGA 1UMHA 4ZHNA 5C3PA 3IAQA 1RUJ3 5DZGA 1N1SA 1LHUA 4BPZA 4FAGA 5C3QA 3N36A 3T08A 3RRDA 2XKOA 4BQ4A 3NRUA 3URFA 2NQYA 4MGIE 2YMZA 3JBG3 1UQXA 3RNSA 4M00A 2L9LA 1XOYA 2WA3A 4E2QA 4XZPA 2UY8A 1T2XA 2QQWA 4N53B 2RS11 3A7QA 2W1WA 3CNAA 1RUD1 4IGOA 4IE4A 3FE5A 4ZXKA 3H7JA 5CFDA 2EF6A 3NAPC 3GGLA 1W9WA 2JECA 5FYHA 2JB4A 3FL7A 2XJTA 4GKXA 4UXAA 5LA0A 1L7RA 4BA6A 4DY3A 3W58A 5FY0A 4K9SA 5FJHA 5FO8B 1MS0A 1JUIA 2D6NA 2QQLA 4AE2A 3KGLA 4XUPA 4EN9B 1YQ8A 2R32A 1NE6A 3T2TA 4N43B 3W21A 4IV3B 1DQ4A 1QXPA 5FZEA 3EBRA 4BZ4A 4KU7A 5FY4A 1OH4A 3AMPA 3OF1A 1H30A 3LQCA 1C8NA 1RUOA 2IFWA 2QQIA 2W08A 4BK5A 3UK9A 3PURA 3GM8A 3K3OA 2VOTA 1CN1A 2D6MA 3HPNA 3WP6A 2A3XA 2BNMA 3O12A 3NAPB 3ZFEC 5DDJ3 1KRIA 2AR6A 4JDMA 4DRRA 3SXWA 3ZMNA 1OKQA 1RVF3 3M7AA 2ZEYA 3N9OA 3POGA 1I3HA 4IGPA 4EJRA 4B3NA 4RFT0 1SZBA 4XFIA 1XU2A 1ULCA 2WYFA 4Y4RA 1S0DA 2DF7A 3RZGA 5HXVA 2Y6HA 2YFZA 3ZFEA 4NRMA 2KXLA 3ES4A 4XF4A 3HR9A 2YGLA 4FPOB 4X8PA 1W6QA 2OKXA 1H1AA 4ASKA 1AL23 1RC6A 5FZ9A 4H3WA 1CQ9A 2P6HA 5FZLA 5JXIA 2ZGKA 2PHRA 3WUDA 1LRHA 2CAUA 3AMQA 4N9HA 3KMHA 3WDVA 1GOFA 2XL7A 2W92A 3FHQA 1JS9A 3QLQA 3VBHA 2ZS6B 1XBFA 3OG2A 3PUIA 4XEZA 5IAVA 2QQPA 2AZ5A 3MZHA 1BCXA 2RDSA 5F7UA 3BIWE 2ZGTA 5A3PA 5C9AB 4Y26A 1E5HA 4QB6A 4R4ZA 1H8TB 2B5HA 3KF3A 3GBWA 3I3BA 1PK6A 3V0AB 1PO12 4XBNA 2ZGQA 3TEZA 1CX1A 3POEA 4NPMA 1RUE1 1GU3A 3C7HA 1UZ0A 1AL22 1DU3D 4RR3A 5G04L 3SLIA 3C2UA 3SKJE 1JZ3A 5LATA 2IFRA 3W9AA 3NL1A 2BNOA 1QQP2 1XU1A 4WM8A 1N1TA 2J1VA 4GWIA 2UWAA 4GWJA 1CJPA 1GNYA 3TN93 5I91A 2TUNA 2BOJA 1S4CA 5IWFA 2VG9A 4J1WA 1G9BA 1V9U1 2ID4A 2AEZA 3T1LA 2VZSA 4Q0VA 4WM8B 2VBPA 3USUA 5I8YA 1LHNA 2RVAA 4MOAA 4X6QB 1LHVA 3H8UA 1UX6A 3H50A 3N35A 3O1VA 2VZQA 3ZR6A 2ARAA 2WNOA 4LULA 3K51A 4O9EA 4FPLA 1B35C 4FPEA 3VZJA 1IS4A 3NWKA 2VOVA 4W6XA 4MGZE 4DS0A 3ZYRA 1CGPA 2OW4A 1CAXA 2WZ8A 2V09A 1EAH3 4B29A 3VBOA 1AYN1 1RJ7A 2W87A 4KNCA 3ZFGA 2XXZA 1Z7S1 4JGZA 5HI0A 1UX7A 5KXDA 1PIV1 3VKMA 4GKYA 4URTA 2XBO2 1AR93 2YBKA 3OYWA 3BI3A 1CAXB 4YFZA 3WP5A 2DV9A 3WINE 3ON7A 1GP6A 4HL0A 2LROA 1W3XA 4MSVA 4QXKA 3M4FA 1HV0A 4WZFA 2JDUA 3V64A 4AEKA 1CR7A 3VBSA 1OLRA 2JG8B 3RGBA 2IXIA 3WOGA 3FHAA 2GMEA 3JB8A 3AKPA 5LWBA 4TWTA 4Q4X3 1JYXA 4QX1A 4PJYA 5C8CC 4M4RA 4Q8LA 2D97A 4P9JA 4QGLA 3VD9A 5JCTA 4KMQA 4XJ8A 1ULFA 2JE8A 4FTSA 1O6UA 3OGRA 2HWC2 2QDRA 4UF0A 4NPRA 3AX4A 3RG0A 1H0BA 2V4AA 3DN7A 4QX0A 1VBD2 1OMIA 2RS53 3AFGA 3RZHA 3MPPG 1ENSA 2VNRA 3GXUA 4AXOA 1RUC3 3I2FA 4FOQA 4GULA 3ACFA 1RUJ1 2W1SA 3H9AA 5FJKA 5IT6A 4Z92B 2EIEA 2D6LX 4D6RA 4IEWA 4XUTA 2XKPA 2R063 3I59A 4QB1A 4XQDA 1HXS2 4DEQA 4KQ7A 4CUAA 1DYOA 1R081 1OC1A 4Y3OA 3HIFA 4XCAA 5I8SA 2QE3A 4AEDA 4L2NA 3FWEA 2W68A 4BXSV 5CKMA 5H9QA 2DBNA 2RG4A 2EXIA 5TSWA 2CGOA 2JDZA 3ROUA 1MPXA 3AZXA 1R091 2Y60A 4S2FA 4QMAA 1KDMA 4LBJA 2XMLA 4Y5Z0 4I0AA 3VUOA 2Y8KA 4AEDC 2YZ4A 4H14A 5DUXA 3ZPOA 1YQ2A 1QDCA 1DZTA 5DAVA 2A3YA 5C6CA 3O1PA 4I01A 3TNPB 1Y3TA 2DCYA 1PO13 4YZ5A 4FXKB 4NO4A 1RUH1 2BVVA 1L3JA 1IQAA 1TNFA 1AVBA 2HEVF 4JDNA 4PIYA 4W50A 4Q26A 3NJZA 4MH0E 1N47A 1EV13 2VOXA 5FZOA 2LS6A 5JZGC 4XF9A 3VDBA 3DXUA 4LUKA 4AFDA 2VVFA 2YU2A 2MEV3 1W8TA 1S0FA 4IV1A 4XJWA 4FTEA 4COYA 4QPIB 5FPBA 5A3LA 4Q4Y2 4CCLA 3P3PA 5DAXA 1DLLA 1K5MB 2P4EA 5FAXA 1XNTA 1SMVA 2O0OA 2YV8A 4DZGA 5ABJA 4Y1UA 3T2OA 2ZX2A 1IS6A 2OA2A 2W39A 3LEGA 1D7PM 1LU2A 4JCKA 5FY9A 1JOJA 3B5LB 1U0AA 3EQEA 1GFF2 5L36A 3HWJA 5CG8A 4MUVA 3WG1A 3HAGA 5F6LB 1ZBA1 3V0BB 5BV6A 1S0JA 2VZRA 2P5BA 5B2GB 4QHBA 1W04A 5GZFA 3VB9A 4W6WA 1GKBA 5FZOB 4J1XA 2VUJA 4X8NA 5JLVA 3POSA 3AJYA 1N1VA 4ONUA 5ANNA 1UOBA 1W8ZA 2X09A 3SITA 2SBAA 3KGZA 4UFKA 4MGYE 5T5JA 3QH7A 3THTA 3ORJA 1NYWA 5FZMA 5A3UA 3OBTA 5IK8A 1S0CA 3FC0A 5EV7A 4CZSA 3IIIA 1E5IA 1K5MA 4CU9A 3ZFEB 1F31A 1RUH2 1PO21 2XBO1 4N53C 1MEC2 2ADEA 2DUQA 1LNSA 2JWPA 5IJRA 3BB6A 2ARBA 4FCAA 5FYIA 4NUBA 2GZWA 3HNBM 5FMOS 5IK5A 4UW4A 1VBE2 1UMIA 3I2GA 2ZEXA 1X8MA 4I02A 4PDWB 5EYYA 3P3NA 4P5YA 2H0BA 1CD3G 4AVBA 1KITA 1NAEA 2IXKA 3MHZA 3RYPA 4YM3A 4IERA 4BQ1A 1GZWB 2Y64A 4UFMA 3E6CC 5CVRA 3O0XA 5CB7A 2XHKA 3LSDA 1UIKA 1TVGA 1V6JA 5A3WA 4BIOA 1POQA 5FBJA 4CXXA 2XR4A 3ZYIB 4QX7A 1NZIA 4WM7A 1E5SA 2RMU3 2VW2A 3IB3A 4LPLA 3CU7A 4CCCA 2RDRA 5FPUA 5IFPA 3OUHA 4JQRA 3CEWA 1H6YA 3GHMA 3DYOA 1IS3A 2P3KA 3ABZA 2EAKA 3BPZA 2R0FA 1ALYA 2K46A 2WWUA 1FXZA 4OI2A 3ZSEA 3ZSLA 4TXWA 5AFEA 4ET7A 4E8CA 5ERLA 4XF3A 1H4GA 4DO0A 4EWDA 1RUI2 5F32A 3J7HA 3TRSB 5JSRA 3MGUA 3T2QA 4BQ3A 1GOGA 4UFJA 2HJIA 1OI6A 4QQHA 1JHNA 1QIQA 2Y0OA 4FPJA 3RS6A 5FK7A 2ZZQA 3NNLA 2AGSA 4YVWA 1LECA 3TYJA 1W0OA 2VCBA 1E5RA 2VC9A 4J6GA 2A70A 2PLV2 1NLRA 4JRLA 1X9PA 1VBD3 3VBOB 1MS5A 3VBFC 2JDHA 3BU0A 3IWZA 4Q2FA 4R52A 3N7JA 5T5PA 3UV9A 1BMV1 1QJU2 5FZCA 3X29B 3FFQA 3ILFA 1A8DA 1B35B 2GNMA 4FTBA 1U12A 2RE9A 3J7MA 4Q4X2 1U5YA 2VMDA 1YCIA 2OX0A 2WUHA 3WW2A 1RUC1 3LCPA 3RWKX 5FYBA 3WW3A 2BVBA 1JTZX 5K7PA 3GZAA 3PMEA 3RZMA 5DZEA 1BBT2 3FLPA 1N3OA 3THDA 1MVEA 2QCSB 4Y24A 5DG1A 4AEJA 5BNNA 1WW7A 2CTVA 4HKLA 4KGGA 1W6PB 1V6OA 4Q0SA 1KXGA 4AOCA 1GP5A 2WQZC 4UF0B 4Q4V2 3WDTA 5DXDA 1AX1A 1GR3A 2HKXA 4XHBA 5FYTA 3A22A 1A3KA 4TLGA 5EYXA 3CJXA 3V65A 5LA2A 3BYWA 1Q8OA 2G4IA 3B00A 3A21A 1PVC1 4AAPA 4EN0A 2I45A 2BV4A 1OH3A 5A33B 5K0UA 3ASIA 3MFAA 4AGVA 4E8DA 2E9QA 4RGGA 3KV4A 2MNGA 2E31A 1OD3A 1PIV3 2C5DA 3PVEA 2E63A 3GZEA 4TTGA 2VUDA 2HBTA 1CAWA 1LOCA 2HEWF 2CSGA 1HN0A 1EP0A 1MS4A 4LOSA 1GICA 3B7MA 1OT5A 3CJIC 4XIOA 1QJU1 4Y20A 3VDDB 5FLHA 1YQ6A 2JG8A 5DN2A 2ZCWA 5JI7A 5JSOA 3MI8A 3S5AA 5CBLA 3ETPA 2VZUA 1V0AA 2BRTA 4YLZA 5A7QA 2J7MA 2UYAA 3FUQA 5T52A 3ZYHA 3M3EA 3ZSJA 1WUVA 3OBZA 4FT8A 4XFCA 4RD7A 3VDDA 5C7GA 1QJY3 2ZX0A 3H1MA 5JMCA 1VLNA 5A33A 4XJZA 4W8JA 4QDSA 3S7IA 2PXJA 5HCBA 3LIHA 2ZJCA 2BERA 3PJYA 4U36A 1LHOA 3B9IA 3VBFB 2X5IC 1AL0G 2YC4A 4M3CF 5F5QA 2BGPA 3H1WA 4EN8B 1REEA 3PVOA 2VM9A 4FI9A 2IXHA 3K4ZA 1EV11 4IETA 3VBUC 2R7EB 3INAA 4NJ4A 1F8VA 4WBBA 1C3HA 3VKNA 3CMGA 1QOSA 3DYPA 5FZ1A 4CPBA 1MZ6A 1S1AA 1IGOA 1OVSA 1HRI2 3WDWA 2WNEA 3J26N 5B4NA 4V1PA 4QPIA 1P8JA 4A7KA 2J42A 3ZFGC 4LBOA 3U78A 4ZU7A 1UYZA 2FHRA 1VB4A 1PM7A 5DUUA 2JX9A 2VVEA 1H6XA 2WYSA 1VMFA 4DB5A 4BQXA 1CPNA 3LDRA 2X5IB 1O5UA 5D8AA 4CDXA 3CLPA 5FPVA 1RUG1 5LASA 1UOJA 2ILMA 3PMSA 2F4LA 5FPXA 4CCJA 2DVFA 5FO9B 1GWLA 3N9NA 4AEDB 1F2NA 2W2IA 5JMOA 2OXBA 1BKZA 1OFNA 1SFNA 4LKDA 4P5HA 4YZ1A 3VKFC 4L11A 3OBAA 1M4WA 4IEOA 1RL3A 3GALA 1OOPC 1JODA 4LBMA 1UY2A 4M3CB 4ZXEA 3AZVA 1CWPA 1DQ0A 1OUSA 4UFHA 4ZONA 5FIXA 2GAUA 1HKDA 3ZSKA 3C7EA 4QPGA 2RS12 2ZHNA 2WQ4A 4Q5OA 4OHVA 1Q8PA 1OVPA 3C8XA 3TEWA 1SPPA 4CP2A 1YEWA 2GU9A 5A6XA 2HWE2 4K8RB 1JZ5A 1SG3A 2NMNA 4CUCA 5EP9A 3WNLA 2JD9A 5I0TA 1OXCA 4XMAA 5A3MA 2DFBA 1SQ4A 4PQ9A 3LF7A 3I49A 4EWAA 4Q4W1 4WVVA 4R8HA 1KFXL 2PTMA 3B69A 2A6VA 3I97A 2QQKA 5KC6A 3AK0A 4CEYC 3TEYA 1R64A 1VRH2 4OFGA 4BQ2A 3J8F2 4AVCA 4CPBD 4EWEA 4PDWC 1RXFA 3BU7A 2WSVA 4X6RB 2ZXQA 4PBOA 1YFUA 2LM3A 4UAPA 1ASJ2 5JUVA 2G9GA 5CNAA 3O1RA 2X05A 2D93A 5FQ0A 4OCTA 4YPJA 3VBRC 3EHKA 5J09A 5LW9A 2K0GA 3QD6A 1N1YA 2ZEWA 4PDWA 2QZ3A 2RDQA 2ZGOA 3J8F1 4XIKA 3VBHC 1Z7S3 2XUEA 4CEWA 3L2YA 4K6BA 1QKQA 3KCYA 3UT0A 3RFRA 3I54A 5HV4A 1VBB2 5FXWA 5GLTA 4HSJA 3VHPA 1W39A 5FO7B 4LT5A 2Y6LA 2JE9A 4N53A 3PUQA 1ZREA 2JG9A 2VBBA 4Q4Y3 1YFYA 1YO8A 1XC6A 3KD4A 4MGSA 2VCAA 3WF3A 1ZM1A 1PVC3 4D3WA 2VTXA 4LK7A 1HB2A 1O7FA 1MACA 3F95A 2R062 2WNUB 1VRH3 5FZHA 4W6YA 1XJAA 2VGDA 1OQ1A 1ULDA 1LGBA 1YUDA 3O0WA 1POV0 4IESA 5C3RA 4Y5SA 3ECQA 2EALA 4IV3C 3AL5A 4AHZA 3HBKA 4K1ZA 4CP1A 2RMU2 2E26A 2O8OA 2YG0A 2HWF1 1PGL1 3VBHB 2QQVA 4YGEA 3N7LA 5J1XA 4R9BA 1GBGA 2IZWA 5JOYA 3SKVA 1QY4A 1RUNA 2ZGSA 5FP3A 5SV5A 2HWE3 3Q8CA 2VY0A 4LBLA 2XJQA 3RJRA 4EE2A 5HCHA 2R1DA 1RUE2 3E5XA 4MHUA 2W1QA 4CSWA 1PMJX 3EB7A 3H8OA 2VMFA 1PK6C 1SLTA 3JU9A 2A1XA 2C0ZA 4JHZA 1VJ2A 3D8CA 4BQYA 1GNHA 3QH6A 3I2OA 1C57A 5FY7A 5GZGA 2VOKA 5T50A 4BDVB 4I2OA 4V2VA 3OPWA 4RN5A 5JOXA 2WABA 4IEZA 5FYSA 2BFUS 4YW5A 1APNA 4XFGA 1QU0A 5FYVA 3M8LA 1BK1A 5CISA 4RFRB 1RINA 2WJSA 1W2TA 1IKPA 2FDIA 1F35A 4AEMA 4YVWB 2D98A 2QBXA 4WM7B 5FMOL 3TN92 1Z0HA 3LA7A 1R1ZA 4M0NA 3ZIWA 3ZXDA 3UJQA 1JYVA 4OQ8A 3MIEA 3SEPA 1US3A 4QM9A 4HETA 5IATA 4QQ2A 3ZFFA 4WVWA 1NY72 3BTZA 1ZBE1 2ET1A 4P9LA 3VKOA 1V70A 4E4SA 1XYPA 2ERFA 1ACCA 2GC3A 3O1MA 1AYM1 2R042 1CAVB 4EQVA 1HDKA 4Y5TA 4A6OA 1LCLA 5FPLA 1ZNPA 2YFUA 4LNVA 3WSOA 5JPMB 1CAWB 2A71A 4CXYA 5L9RA 3SHRA 2BOIA 4URAA 1IPSA 2AACA 2D3PA 3OCPA 2O8QA 4Y20B 3USUB 4AK3A 4Q1RA 4QB2A 5F5IA 2F17A 1BEV3 4GXLA 4WVMA 2R30A 4KWUA 4YM1A 5FREA 5C4WC 2PFWA 1NCRB 3OB8A 1CZTA 3CJIB 1KFUL 3TEXA 3BTXA 4MGTA 4YVSA 3APBA 2VCCA 4UFLA 5EWSA 3VBSB 2E6VA 2RM23 2WNUC 4LXLA 2W46A 1GV9A 4Z82A 3VD4A 4NWVA 4GB33 4RQPA 1ZRFA 5GZEA 4IEYA 1COV2 2FCTA 5I0SA 5EQUA 2R072 3BALA 1F9KA 3HOBA 1Y4WA 1ZBE3 4LO5B 4XMIA 4BISA 4DMIA 1R083 2IVIB 5E88A 3IM0A 1WA4A 1EAH2 2PAEA 3WNOA 2Q30A 4XVHA 4CDQA 4CRQA 1L7QA 2R061 3NMBA 4W4ZA 1GP4A 2C9KA 4YGCA 5LBBA 4NMIA 3KCCA 4Q0UA 2IXLA 1W8WA 1N3QA 1QXRA 1OLME 4D6QA 2VAUA 2RJKA 5FYCA 2HBUA 2VUCA 1EUTA 1NXD1 2NMOA 2XVKA 1UZVA 4MXVA 4QT6A 3I2DA 4DY5A 5C5UA 4P08A 3VZKA 3SC7X 3I3QA 5CFCA 4LHNA 1TNRA 3SH3A 4BQWA 2E33A 1IPJA 3K2OA 1RUF3 2HLEA 5F5AA 3RWNA 1EPWA 1A6CA 1UXZA 1WW5A 3SCGA 1VBE3 1WLTA 5FFOC 1IZ3A 1RMU3 1UYXA 2VMCA 5FYUA 3TWIA 1OBNA 3POIA 3ZLIA 3HEIA 3I59B 2WAOA 1D4M3 3HJRA 3GBGA 4BK4A 2ZGUA 3VDCA 1CAUA 4HPKA 2JENA 1TME1 4IL7A 5LY1A 5A1FA 1DQ2A 5FZDA 1M06G 2ZHKA 1DHKB 5FDBA 1HXS1 4LO4B 1RUI3 1FV2A 2WS92 2HEYF 5FZGA 4E4ZA 5KBFA 4PI0A 4QDQA 4AHWA 2BW8A 2QVSB 1Y7BA 2MEV1 2JIJA 3K75B 5A7NA 2WT1A 4TSVA 5IVFA 1OOPB 5IUQA 1LOGA 2VZVA 3ATGA 1COV3 4DXRA 3FMGA 4XFHA 1ZBA3 1QOOA 4YGBA 2ZKNA 3AKTA 4I30A 2B9UA 5LK7B 3O1OA 1PHMA 5FWEA 4CDWB 1DIWA 1DYKA 1SDWA 5FXVA 4F3JA 3MIHA 1AR71 5F2SA 1G9AA 4LE3A 5FZ3A 1V00A 4J25A 5LBFA 2PHWA 3VD7A 2AH2A 2YBSA 2GALA 4Z1VA 4HVQA 4IEQA 2VZTA 2ZGNA 2PAKA 2YYOA 3I4IA 1RUF2 2B9VA 3TN91 1ND2B 2QFEA 3UGGA 4CEYB 4NPLA 3M3CA 4JC1A 4CA9A 2OZ6A 1MS3A 5FZFA 3AMHA 3AVSA 5C33A 1XE0A 4N43C 3N3HA 3NV2A 5LA1A 4AR2A 1W99A 4OHWA 4SBVA 2HWB3 1LHWA 4CEYA 2E7TA 1ZVFA 2X5IA 5FUNA 1RUH3 4A3ZA 2A6YA 5CG9A 3K48A 4QX2A 1RUF1 4XJUA 5L9VA 2Y6JA 4CDWC 2A6ZA 5FKBA 5T3NA 4GH4B 3P5BA 5LBEA 2EAAA 3F2ZA 3VBUA 4ZS2A 2WDBA 1RIRA 4N43A 2BDRA 4XF0A 1CONA 4F83A 5IVVA 1GZWA 1NQDA 3ZSMA 4D7SA 2JEMA 2DTYA 3HMYA 5IVCA 2VZ1A 1RMU2 4YW7A 2Q0AA 5C70A 4N9IA 2OUHA 4QX3A 4HMZA 4QPIC 5BXXA 3U14A 1ZA4A 3PJQA 1N3PA 1K5JA 2C6SA 1DGWA 1ULEA 4KG8A 1UF2C 1WMDA 2BWAA 3LDKA 4H55A 3TBDA 1D0GA 4A45A 4CCDA 1UXXX 3OPZA 1XRUA 5C3SA 2V72A 2D6OX 2R043 1BLZA 1K3IA 4N90A 3VHRA 1X33A 3P6BA 1GANA 4FO9A 3SCHA 4QX5A 2GC0A 1RVF1 2QTWB 2VE1A 4K21A 2NYYA 2CAVA 3WV6A 5IVYA 5LZ6A 4XAAA 2B42B 1O4YA 2WO3A 5FMDA 2VQ0A 4I0BA 2AYHA 1PX4A 4GJZA 2NLRA 4MGKE 3PIJA 3HQRA 3I7DA 2RS51 4AVVA 1EV12 4META 5FQ0B 1S0IA 3WP3A 1JI6A 3IPVA 3NAPA 2HWC3 3ST7A 2JDMA 3AC0A 4XFBA 5F5CA 1J83A 3NVCA 4OVEA 2B8MA 4B4QA 2CU5A 1F4AA 3H3LA 4OLLA 3RZZA 1VBA2 4B7EA 5ACA2 1G9DA 3MFCA 1NLSA 3T0BA 1ZRCA 5CKQA 3BODA 1MQTA 2C24A 2W9XA 2JDNA 4WM7C 2W52A 1RYYA 3DKWA 1YI7A 1QNYA 3POYA 4Y22B 2XWJB 2PA7A 2ZHMA 5FRAA 2VZPA 3A4UA 4YVWC 3WT3A 2WNVC 4RS5A 5C4WA 1MQTB 1D4VB 4WM8C 5FMBA 3U1XA 2WA4A 2ZBJA 2VNGA 3KS7A 3LIGA 3HBZA 1TMF3 1O4TA 1WCQA 1HX6A 4R4XA 3AXDA 1DGRA 3DV8A 4RS5C 1BZWA 1BHGA 2HWD1 5FP8A 1G8WA 1PK6B 3V0AA 1US2A 4XQWA 4GMP3 3WHTA 1VAKA 4LE4A 5FXXA 3VKLA 1PMHX 4M4PA 2BTVC 3K46A 1WMFA 3CO2A 4XDOA 1H1IA 3VLBB 4EZHA 4OHZA 3WX5A 4AFMA 3O7OA 1PZ7A 1V9U2 5L73A 4EYUA 5ISLA 2WT0A 3WHUA 1JZ8A 2R071 2JD4A 5FP9A 4MADA 4XACA 3J7NA 1S2EA 2WNVB 4KG0A 1MR5A 4QHZA 5LA9A 3WCSA 1RUG2 4PHZA 4XQ4A 2BU9A 3WEZA 1HV1A 1QWRA 1L7LA 4HSLA 3ZFGB 5FV3A 4YM2A 2W1UA 3ZOIA 2CGPA 1XNDA 4HVRA 3KZ4C 2YPJA 4XJAA 3PTRB 1URXA 2QNKA 2DUOA 4COZA 1QHDA 2NN8A 1BJQA 3WW1A 4CCKA 2LALA 4CE8A 1RUE3 2P2KA 2WQ8A 1QJX3 5DUWA 5D1IA 2JDPA 4A2UA 1ODNA 4N7IA 4NOTA 2D3SA 2FCVA 3VZLA 1OHFA 3N7MA 5CYYA 4LO8A 2VULA 1NQJA 4C0BA 2UWBA 5F2WA 3QACA 2OPWA 3IDCB 1YIPA 4YZ2A 2VXRA 4QPYA 3VBFA 4BLJA 2OQ7A 5J96B 4AQSA 5JXHA 3VV1A 2BBVA 4CDXC 1AR82 2Z69A 2G19A 2IVJA 2NP0A 3FUOA 3LOIA 1NCRC 3LDBA 4HBNA 1W6MA 2YPDA 4OMCA 4YRDA 5EXOA 4NIIA 5BNPA 3PUAA 1JZ6A 4HONA 4NHYA 3VBSC 1UAIA 2VJXA 4KWKA 5KR7A 1YNAA 5A6ZA 3ZXLA 1OQEA 4BMBA 3ETQA 1DQ1A 2EA7A 5FY8A 1J59A 4QPGC 5BNPB 3CJIA 2ENRA 1WCDJ 5FUPA 1LR5A 4KBZA 4OMDA 3FLRA 4JTOA 1W6NB 2BEOA 2OYZA 3VN4A 3VZNA 4AI2A 3WDUA 5CKNA 1HJGA 2JKXA 5KHHA 2RDNA 1SBFA 2RMU1 3HNMA 5A80A 1J3QA 2RS13 3AKQA 3IAPA 3MW4A 4Q4W3 3MW3A 4B4RA 5CADA 5F9TA 1MVQA 1FV3A 1NT0A 2DVBA 1CAUB 4YG6A 1WW6A 5FY1A 5GLZA 3WLUA 4BLIA 1JYIA 5G05L 3VD5A 1LGNA 5IHRA 1FI2A 3ZO0B 3OJBA 5M0TA 1U5IA 5CFCB 2CWMA 2YU1A 1PMIA 1YI9A 1OF4A 4FFHA 4RHV3 1PGSA 4I3PA 1UU5A 3HVDA 5E6HA 1UYPA 3K4DA 1VAVA 3U4SA 2FDHA 5JZGB 3OTFA 1ND2A 2TEPA 1RUD2 3JD73 1RHI3 5AC93 1VAMA 1W6NA 3VGIA 3DF0A 2WWSA 5A1AA 4EROA 4QU2A 4CCNA 1AXYA 2XGXA 2Y6FA 3POBA 4CCMA 2X53S 1YRZA 1FNYA 3R4SA 4JAAA 4D8MA 4OHYA 1NOVA 2LTNA 3MO4A 4IV1C 4BU2A 4LBQB 2BQPA 4M3CA 2Y26A 1IKQA 3N9LA 3H8RA 1A78A 3AP4A 4XBQA 1AYM2 2R041 4JZRA 1C8M1 1G6NA 1SFYA 2WSUA 2XJSA 1JU3A 2E7AA 3KCXA 3PU8A 2GP3A 3LSEA 4LOTA 4LR4A 3FJSA 5EIYB 5DMYA 1Z78A 1VR3A 2ET7A 3AFKA 4JKKA 4FAHA 5ABJC 1EUUA 3C7GA 4GH4C 4E4DX 2DVDA 1PNFA 4CUGA 3SISA 1NCQA 4YG0A 4P9YA 3CKHA 3THPA 3FN9A 2D7FA 2ZX4A 5LEJA 4YW1A 2K2SA 3LWCA 4DXZA 3ACHA 1BBT3 4NHMA 1HQNA 3POJA 3S0MA 4XURA 3O1UA 4CDUA 3DPRA 3LFMA 1VALA 2FMYA 2BYVE 4XPVA 2CHHA 2ZAAA 2J1EA 2IC1A 4N8MA 1PIV2 4P9GA 5A3TA 2Y33A 3MLJA 4EN7B 1GWKA 3ACGA 3LAGA 4BIFA 4XBLA 1VPHA 3RPQA 1DF0A 2G1MA 4FSJA 1WGPA 4YFWA 3O1SA 4PLNA 3WCRA 4H7LA 2DWRA 4FPFA 2BP6A 4PT6A 3BCWA 5CAZA 1NE4A 3ZXEA 2PMWB 2PQQA 2D44A 1UU4A 2PN5A 5IYYA 4FPYA 4FPKA 1QOTA 2QJVA 3SEEA 3AJZA 1ND3B 2VECA 1PX3A 1QQP3 1S2KA 2VQTA 5FZ0A 1BK0A 1LTEA 1PO11 4S2GA 4DUXA 4AFAA 1LEDA 3S57A 4AI9A 1QQP1 4DXSA 4LIUA 2JB8A 2ZMNA 1Q8QA 2XWBB 1HW5A 1YJLA 2WLQA 4QU1A 3UGFA 1NXMA 3DCQA 5FCCA 4BYYA 2D43A 3Q8AA 4RYDA 1HRI1 2YXSA 2VXJA 4JVAA 1DDLA 3AB0A 5LEKA 1TME3 4JDOA 5FMCA 5C4WB 1O8PA 3PUHA 2B7YA 1I9RA 3RI8A 1H2LA 4CTEA 1V6MA 4IE5A 1OF3A 2Q8OA 2R49A 4MVTA 2B45X 4MX3A 3U10A 4R9DA 4QPWA 3WR0A 5BY5A 4XW3A 1K45A 1GQHA 1AHSA 3LPGA 4DXTA 2W47A 1MQTC 2P3JA 4Y22A 3HT2A 3OEAA 1KS5A 3OY8A 2GH8A 4FOVA 3R6SA 4OZOA 1JYWA 3IBMA 3RDIA 4H2AA 5A7PA 1KS4A 3AKRA 1CIYA 5K0UC 1T6GC 3WUCA 5FPAA 1LB2A 1YQCA 4ZZ8A 1OA3A 3D0JA 4CVUA 4YSFA 1QF3A 2BJSA 5JIAA 2XQXA 3NV3A 4HXCA 4JTNA 1T6BX 2XL9A 2H6CA 4XE9A 3PL0A 1XNCA 1AYN2 2VL4A 3DL3A 3AZYA 4UBGA 2FMDA
chains in the Genus database with same CATH topology
4AQ2A 1Q3EA 4YARA 2VH9A 2DU0A 1LJ7A 1WCSA 4F8AA 1D2QA 3IT8A 3MICA 1DQ6A 4KH9A 1R1A3 4D69A 3Q9OA 4XTPA 5BPXA 1C5HA 3ZDSA 4Q8KA 5T54A 1FOD1 2JJ6A 5KXBA 3H7YA 1WLCA 2WZPP 1WLDA 4PF5A 2O1QA 3OYWB 1UL9A 2X29A 2ZMLA 1O3QA 2WLPA 2RS31 4ORFA 1AX2A 4K7JA 3LGRA 3PVNA 2JE7A 4RS5B 2XVGA 4G4FA 1SLLA 1GZ9A 2YHJA 4R9AA 4E2GA 3S7EA 2VUAA 2HWB2 1PGW2 2P17A 1OPOA 1VB2A 2ZKLA 3ILRA 2PHFA 2ZAHA 3GF6A 4LLOA 3ZXGA 2TNFA 3MEPA 1UKGA 4RQPC 4YYOA 1B35A 1HIXA 2GMPA 4ATFA 2C1FA 4WZCA 3SH5A 5JOZA 4YVSC 3AYCA 3WQ7A 1VBA1 1WCKA 4D7TA 5ACA1 4G9SB 5BNQA 4JGZB 4QQLA 4YM0A 3ENRA 1ASJ1 3KB5A 3GHNA 2IXCA 4GQ7A 3RJ2X 2GC1A 3AP6A 4OZXA 1VBC3 4O9GA 4AGRA 4L9BA 1ZBA2 1CESA 5KXCA 1W6MB 1JYCA 4XF1A 2ZOEB 4CDQB 2FBEA 2TBVA 1C1FA 2D40A 4ES8A 2HWE1 1C28A 3E6BA 1JBCA 2XJRA 1LOAA 1YYNA 1ZZBA 4GIQA 4MXWB 4OI1A 2V5YA 5A32A 2HWF3 1VBC1 2NPIA 2BGCA 2WZR2 1RJ8A 2EXKA 2HWD3 1UZYA 3ZYGA 3CL1A 1GZCA 2WC2A 1KD7A 3HD8B 1C1LA 1V6LA 4L92A 1C8M3 2A7AA 1MZ5A 1Q56A 3JB4C 1V6NA 3WD5A 4IV1B 3DPRC 3KSCA 5E89A 4CDQC 5J36A 1XYOA 1RHI2 3AP5A 5AC92 1FATA 2DU1A 1REDA 1ZZ8A 3MW2A 1LOEA 5ABJB 4CEWC 3JQXA 4YW3A 4B8EA 1HQWA 2B46X 1ZRRA 3H0OA 4GMP1 4XFAA 1D0HA 4BPZA 2ETEA 1MEC1 4W65A 4UW3A 5KWRA 1J3RA 1IPKA 2GN7A 5E16A 1BQPA 5F6KA 1J1TA 4FQZA 2XJVA 4U2AA 3ME2A 1RUC2 4AI0A 1OQDA 5FOJB 5D8AC 2X8KA 1AJKA 1MS1A 4S2HA 3O0VA 4Q4V3 3SH4A 1JW6A 3RI9A 1C5IA 4QM8A 1DQ5A 5JPNB 4CDUC 3PTYA 3D82A 5JOWA 4IV3A 1D4M2 3JBG1 4ISRA 3IDBB 3OGJA 3VBRB 2GDFA 2DURA 1X7NA 3TOJA 4GH4A 2Q4SA 4RSUA 3U07A 4BHPA 2XLAA 2R6QA 4MZUA 4XYXA 3QBQA 1IOAA 1ZRDA 3VBRA 2CNAA 5I93A 4JGYC 3NSTA 3O14A 4NN0A 4D94A 3B01A 2WT2A 3H1YA 2HYKA 3N4MA 1REFA 3MPBA 3PNAA 5KHGA 4DRVA 4KWLA 4FQ4A 4BWOA 1ZZ6A 2LUWA 4YGDA 4PBPA 3DPRB 1W6QB 4XETA 5AFBA 2VMGA 3HN1A 1QJX1 4L8QA 4D7YA 1SLAA 4I09A 4LUMA 2D6KA 2RHPA 5KHKA 5L19A 1LU1A 4HK9A 1CVNA 3EXUA 4FPHA 4RR3C 5CFDB 4JGYB 4IEXA 4BH9A 5HBAA 4LBQD 1QH6A 1IHMA 1LEMA 1ND3C 1GYKA 5BNOB 3OGGA 1LOBA 1RITA 3M3IA 5DG2A 1DZRA 3ZXAC 3OBRA 3S30A 1DFQA 1BEV2 1S0EA 3EO6A 5T5OA 4AVTA 1H4HA 2DFCA 3AP7A 4CYDA 2P34A 5J3UA 5J37A 1COV1 3FHIB 2PLV1 4RHV2 1QJY1 1R082 1O3SA 1FMD3 2ZGMA 4MV2A 2I07B 2UYBA 4UW5A 2ZTNA 4AI3A 4IEUA 3C3VA 3VHNA 1YFXA 1W0PA 5CFDC 1TEIA 5GM0A 2Q1MA 5JSPA 2BUKA 5BNOC 2Z42A 3KT4A 2WS91 3UL2A 2GNBA 2PHLA 3IPVB 4WVMB 2PLV3 1UD1A 1LODA 1AR81 1H8TA 1RVF2 1RTVA 1A8MA 4COWA 1LULA 4L97A 2GC2A 3IN9A 4UBHA 1WW4A 4KBBA 1AZDA 3MF6A 5J98B 2EVXA 1H2NA 3UKNA 4NHKA 1FYUA 1W6OB 4TZDA 3KLSA 1HXS3 1R093 5JI9A 2HWD2 4E27A 3RYRA 4AFCA 1GLHA 2GNTA 1O5LA 2ZX1A 4YVSB 4LBNA 4N7UA 4JGZC 4LHLA 4RR3B 1BVP1 5HCFA 5C8WA 4MYEA 1S2BA 1V6IA 4HKOA 3MIBA 1RHI1 2QDNA 4XTMA 1SCSA 5AC91 2Y0IA 1O4ZA 1EPZA 4XHXA 4QGMA 1SBEA 3ZPYA 2GMMA 2VPVA 3ZFFB 4Q0PA 3MF9A 1O91A 1XXNA 1GQGA 1EY2A 2FZ2A 2P3IA 3CF6E 2RS32 4DFSA 2D5FA 2WNVA 5GLVA 3I8TA 2VW1A 3BTAA 5H9RA 5EFUA 2JKBA 1SLBA 1AUYA 1PZ9A 3IMNA 3S6PA 2A6WA 2MEV2 4H7MA 4LTAA 3ZYJB 2FQPA 4AVSA 1KJRA 3J4UH 2D3RA 3R4DB 5K8SA 3VZOA 1LOFA 4FP2A 2GSYA 1ULGA 2JICA 3TB0A 5IK4A 4GMP0 2F4PA 2Z2SB 2JG8C 2RM21 4K3UA 1HRI3 1DYPA 4K8FA 1ENRA 1TQ5A 2RR13 4S2DA 1LOFC 5C8CB 2VVDA 4ES9A 1LGCA 1AYN3 1PNGA 4CDXB 3GBFA 1PVXA 4ZKTB 1AF9A 5CA6A 4IXLA 5GZDA 4FVVA 1AR62 4CDWA 2RS52 3GYDA 3WNXA 3T1MA 1E57A 1X50A 1AR92 2Y38A 2IXJA 1KQRA 2OPKA 3JQWA 4HKWA 4FPCA 4QPGB 5BNPC 3AMNA 1BVVA 2VW0A 5D8AB 3TNQA 1HQLA 1XNKA 4CDUB 4AGGA 3M3OA 1ND2C 4C91A 1RUI1 5E1RA 2ZMKA 2CGNA 1W2UA 1UKRA 4Z2WA 2XBO3 4WVZA 1CIWA 3TAYA 3ZYPA 1MZEA 1NA1A 4I3GA 1LKNA 5CFCC 1RMU1 2R073 3B02A 5J48A 4AQ6A 4YNIA 5CU1A 1PVC2 4LO6B 2DTWA 4YZ3A 2ARXA 3SMHA 3NW4A 2H6BA 1GNZA 3M3QA 1UW8A 2EIGA 3WQ0A 5LRSA 4E2SA 1DG6A 4HN1A 1AL21 2D5HA 1OOPA 1KDKA 1OA4A 4LBKA 3AZWA 5DDJ2 2UU8A 3U0ZA 1UIJA 1XE8A 5L7OB 1SACA 4LA2A 2ZGLA 1NY71 4RGAA 1TE1B 4PIXA 1ASJ3 1ENXA 2A3WA 3ELNA 4OUSA 4Q0QA 4Q4Y1 3RMXA 1BMV2 1XYNA 4ATEA 4K20A 1F5FA 1CX4A 5I8TA 2JG9C 2DVAA 5FBZA 3VL8A 2AENA 2Z79A 3PVBB 1YJKA 5HCAA 3RYKA 5KHIA 4YZ4A 3KT1A 2V73A 3A0KA 1J58A 2AUYA 3AP9A 2DCKA 4HT1T 4ZU4A 5BYNA 4OHXA 4Y4YA 3MLLA 1XNBA 4QQOA 2KA3A 4FPGA 2XG3A 2P37A 1KJLA 1QJZA 1WD4A 2GH2A 3VZMA 4GWMA 3U11A 1RUD3 2VMIA 1QH7A 2PHTA 3JD72 3V56A 2UURA 3WDXA 3FZ3A 4AG4A 3NO8A 4B7KA 2FZ1A 1MZFA 3VL9A 3NKGA 2VU9A 2WL1A 3QCWA 1MS9A 1JXNA 5GKAC 2XJPA 5IK7A 3M1HA 3JD71 1OA2A 4DQAA 1VBC2 2XJUA 3NKTA 4Y1ZA 1OD5A 2IWGB 4DNYA 3KM5A 2XVLA 2VMHA 4OUMA 1XE7A 1EYBA 4PCRA 4XJ9A 2KM2A 4Q29A 1AR83 1RGSA 2AREA 2WKKA 4NWWA 1UCXA 3L9JT 5JR7B 2A6XA 4COVA 1UU6A 1ZYBA 1H8VA 2CY6A 2WS93 4RL7A 4RA0A 5T5LA 5J7MA 4Q4X1 4JRAA 1FAYA 2BNNA 2WFPA 3LKJA 4IQPA 2ES3A 5K0UB 1PO22 2WIIB 1VRH1 3D6EA 5EJ3A 1NG0A 2OZJA 1WBFA 2NM1A 3FBMA 2XPJA 3ILNA 2ZZJA 3MDPA 3WP4A 1O3TA 2ZGPA 2R0HA 2VNOA 2XLGA 1QJU3 1HRV1 4GWNA 3AYDA 3UJOA 1NZCA 3ZN6B 3PLQA 4K1YA 2YUEA 2EXJA 3WG2A 3HQXA 3G6JB 4QGNA 1AR63 1DZQA 1Q43A 1W6PA 4GA9A 5FPZA 5I0RA 3MYXA 4OI0A 1OLQA 1G9FA 4G3YC 1JN2P 3RMYA 4EV0A 2ZACA 4C0HA 1D4M1 5BUVA 1OSGA 4C1WA 1U5ZA 2CYFA 3G7DA 3AM2A 1IS5A 5C8CA 1D2SA 3EJKA 2R16A 4P14A 3E5UA 2DCJA 1V9U3 4YW4A 1SLCA 5JIUA 3R05A 5GJ6A 4E9KA 4DPNA 3QOPA 4HPKB 3GNEA 3ZXFA 1H9PA 4OI4A 2DYCA 1Y43B 3ZN5A 5A32B 1ZZ9A 4MLOA 2XUMA 1DBNA 1ONAA 3JZVA 3D5OA 1CPMA 1RB8G 1NA1C 3FFZA 5KXEA 3GZTB 3R0RA 1S0GA 2C9AA 4IEPA 4AWDA 4FBFA 3MIFA 1GSLA 5GALA 2WFF3 3WG3A 3FX3A 2ZA9A 1X8EA 3H3ZA 3VDDC 4JV4A 1QDOA 5K9YA 2R1BA 3OD0A 1C8M2 5KC5A 1TMF1 4BM8A 3MIGA 1VBA3 5ACA3 1FNZA 1C4RA 1ZZ7A 2CV6A 2QUOA 1RUJ2 3OD4A 2NZ9A 4XDQA 3AYAA 4CP0A 1NCQB 4Y1YA 3ZMOA 4HN0A 1K5MC 1F5JA 2G9FA 3VHOA 4Z07A 1FPN1 4F7ZA 1VBB1 1NA1B 2W0XA 5DDJ1 2OIIA 2BFUL 2I2SA 2PYTA 1AJOA 4P9XA 3RSJA 4I0WB 1VBD1 1V6KA 5L7OA 4RHV1 3ZXKA 2XB6C 2HWC1 3E97A 2EXHA 1AYM3 3DUIA 1QMJA 2PHXA 2RS33 2JXAA 2ZX3A 4INDA 4M01A 5I0UA 4HFSA 4HK8A 1VBB3 5AVAA 1FPN3 5JVVA 4QQPA 2E53A 1H2MA 4OULA 3B94A 1Z7S2 3LOBA 3J9SA 4C90A 2WFF2 3ALQA 5T55A 2PELA 2Q1ZB 2YROA 1QNWA 4DINB 1G9CA 1WMEA 2ZABA 3AXEA 1J1LA 4Q4V1 4KGQA 1X82A 1YLLA 4M3CE 1FMD2 3V0BA 4COUA 4CEWB 1AR73 4AQTA 5AVPA 3M2MA 4C1XA 1I1EA 4AYUA 1YXWA 2XLFA 1JH5A 1MEC3 2YGMA 4LBQA 4P9IA 1DGRN 2WFF1 2A5ZA 4R9CA 2JG9B 4DOUA 1XQNA 1O3RA 1R092 1AXKA 2BWCA 3ZIXA 5BNOA 2E7QA 3LZZA 3RQ0A 1FOD2 4ITCA 3ZX7A 3R4UA 3ZN4A 5LK5A 5JWPA 2ZHLA 4BOWA 3OY8B 3M70A 3WXPA 1SBDA 2UWCA 3UKTA 5F1RA 4XOGA 1U5XA 3U4XA 3ES1A 1NCQC 4AI1A 5SV8A 1R1A2 2ZGRA 1PO23 4NR1A 1H1MA 1ND3A 4HLTA 1HRV2 2E51A 5FLIA 1TME2 1UMZA 4AFBA 3AKSA 1QJY2 1B09A 1BXHA 3GZUC 4YG3A 3LA3A 3SCFA 2ATFA 4QD2A 3MIDA 1DGWX 4AHXA 1POV1 4HANA 1FT9A 1AR61 4M0HA 4A7YA 3ZFFC 1X36A 3A0NA 3VBOC 5EZWA 4KU8A 1YHFA 4EN6B 1VP6A 4L99A 4LEJA 1HRV3 2YY1A 4B4PA 5FTTC 4FP3A 3WY6A 4Q27A 5BNNC 1UZZA 2RJLA 4GALA 2B39A 1S55A 4FXGB 2RR11 4JGYA 2A73B 1SLIA 2D6PA 3ACLA 5JDBA 1ZX5A 1PGW1 4BCUA 1LENA 4LHKA 2WNUA 4XFFA 1MS8A 5C9AA 1JUHA 4UW6A 1BBT1 3LA2A 5DUVA 5KHJA 1W6OA 1VBE1 2HWF2 2CL2A 1CAVA 3WQ1A 3D4KA 4BE3A 2GN3A 1H8TC 3JCIA 5C9AC 4RQPB 1AXZA 4SLIA 2WZR1 3E5QA 1WD3A 4LA3A 2I74A 2UY9A 3BOPA 3E6DA 1RUG3 3POWA 5LRRA 4GB32 1YWKA 4Y1XA 3W59A 1ENQA 3WVJA 1FOD3 3BOWA 4LLFA 1Q8VA 3NV4A 4Q1PA 3FLTA 1HLCA 3JBG2 5FLJA 4Z8BA 3B3QE 5CIRA 1R1A1 3ZVXA 2OUJA 4A3XA 2QZ2A 3AYEA 2WZR3 2MHFA 3N7KA 2DCTA 1Q5OA 4AI8A 4HZFA 4GB31 1PZ8A 1G7YA 1DGLA 2N7GA 3B93A 2GNDA 3PHMA 1AR91 4FOWA 3SNMA 1TMF2 1WLWA 3WW4A 5FOBB 1I5ZA 1ZBE2 4ZU5A 2YDEA 4PIZA 1BEV1 3DGTA 1G86A 2PHUA 5BNNB 2YC0A 2ZPXA 3KQRA 4LO7A 1J3PA 4Q4W2 2WINB 3ZN6A 2RM22 3MLKA 5GLWA 4FOYA 1CJDA 2PHDA 2HWB1 4WV8A 2SLIA 5E8AA 4MXWA 2DVGA 1NCRA 1WBLA 4NVPA 4YW2A 1OPMA 2DUPA 5L7OC 1LESA 3FBYA 3H3UA 5JAXA 5DZFA 1FMD1 1UN1A 4HVOA 3KT7A 4AHYA 1SEFA 3WG4A 2QKDA 4XILA 1Q8SA 3HT1A 3O5SA 1S0BA 4A7ZA 2OVUA 1PGL2 3AMMA 4ASLA 2RR12 2F6BA 5H9SA 3IIAA 4K40A 1EAH1 2DCZA 1QXJA 3JUUA 4P9WA 3NV1A 3WZ1A 1AR72 3J8F3 3AZZA 2PAMA 4XXPA 4AVAA 4NHLA 1YFWA 3L2HA 4IEVA 2Z5WA 1YIFA 1POV3 3LB9A 3B9CA 1FX5A 5H9PA 1QGLA 2VOWA 2K9ZA 2MPFA 3IDEA 1FPN2 3USSA 2VQAA 1OFSA 1QJX2 2BPA2 2A75A 2XH6A 1UPSA 1UPIA 1BYHA 1AX0A 1VIWB 1SCRA 4TYSA 3WDYA 4AF9A 4TLFA 4AW7A 4KWJA 5GLUA 1ZZCA 3IKWA 5GZCA 4PLOA 4BMEA 1Y9QA 2CWSA 1I6XA 4Y1VA 3ZXJA 1H2KA 4KL1A 4ASMB 3D0SA 2Q5TA 1H9WA 2H0VA 4PLMA 4XXAA 4ISQA 5JZGA 1RUJ3 5DZGA 1N1SA 1LHUA 4FAGA 3N36A 3RRDA 2XKOA 3URFA 2NQYA 4MGIE 2YMZA 3JBG3 3RNSA 4M00A 2WA3A 4E2QA 4XZPA 2UY8A 4N53B 2RS11 3CNAA 1RUD1 4ZXKA 3FE5A 3H7JA 5CFDA 2EF6A 3NAPC 2JECA 4GKXA 4UXAA 2XJTA 4DY3A 4BA6A 3W58A 4K9SA 5FO8B 1MS0A 1JUIA 2D6NA 4AE2A 3KGLA 4EN9B 2R32A 1NE6A 3T2TA 4N43B 4IV3B 1DQ4A 1QXPA 3EBRA 4BZ4A 4KU7A 3AMPA 3OF1A 1H30A 1C8NA 1RUOA 2IFWA 2W08A 3UK9A 1CN1A 2D6MA 3WP6A 2A3XA 2BNMA 3O12A 3NAPB 3ZFEC 5DDJ3 1KRIA 2AR6A 4JDMA 4DRRA 3SXWA 3ZMNA 1OKQA 1RVF3 3M7AA 1I3HA 4EJRA 4B3NA 4RFT0 4XFIA 1XU2A 1ULCA 1S0DA 2DF7A 5HXVA 3ZFEA 2KXLA 3ES4A 4XF4A 3HR9A 2YGLA 4FPOB 4X8PA 1W6QA 1H1AA 1AL23 1RC6A 4H3WA 1CQ9A 2ZGKA 2PHRA 3WUDA 1LRHA 2CAUA 3AMQA 4N9HA 3KMHA 3WDVA 2XL7A 3QLQA 3VBHA 2ZS6B 4XEZA 3MZHA 2QQPA 2AZ5A 1BCXA 3BIWE 2ZGTA 5C9AB 4Y26A 4R4ZA 1H8TB 2B5HA 3GBWA 1PK6A 3V0AB 1PO12 4XBNA 2ZGQA 1RUE1 4RR3A 1AL22 1DU3D 3SLIA 3C2UA 2IFRA 3W9AA 3NL1A 2BNOA 1QQP2 1XU1A 4WM8A 1N1TA 2UWAA 1CJPA 3TN93 5I91A 2TUNA 2VG9A 4J1WA 1G9BA 1V9U1 3T1LA 4Q0VA 4WM8B 3USUA 5I8YA 1LHNA 4X6QB 1LHVA 3H8UA 1UX6A 3H50A 3N35A 4LULA 3K51A 4O9EA 4FPLA 1B35C 4FPEA 3VZJA 1IS4A 3NWKA 2VOVA 4W6XA 4MGZE 4DS0A 3ZYRA 1CGPA 2OW4A 1CAXA 2V09A 1EAH3 4B29A 3VBOA 1AYN1 1RJ7A 4KNCA 3ZFGA 5HI0A 1Z7S1 4JGZA 5KXDA 1PIV1 3VKMA 4GKYA 4URTA 2XBO2 1AR93 3OYWA 1CAXB 4YFZA 3WP5A 2DV9A 3WINE 4HL0A 4MSVA 4QXKA 3M4FA 1HV0A 4WZFA 3V64A 4AEKA 1CR7A 3VBSA 1OLRA 2JG8B 3WOGA 2IXIA 2GMEA 3JB8A 3AKPA 4TWTA 4Q4X3 4PJYA 5C8CC 4Q8LA 2D97A 4P9JA 4QGLA 5JCTA 4XJ8A 1ULFA 4FTSA 2HWC2 2QDRA 4NPRA 3AX4A 3RG0A 1H0BA 3DN7A 1VBD2 1OMIA 2RS53 3AFGA 3MPPG 1ENSA 2VNRA 4AXOA 1RUC3 4FOQA 4GULA 1RUJ1 3H9AA 5IT6A 4Z92B 2D6LX 4IEWA 2XKPA 2R063 3I59A 4XQDA 1HXS2 4KQ7A 1R081 3HIFA 5I8SA 2QE3A 4AEDA 4L2NA 3FWEA 2W68A 5H9QA 2EXIA 5TSWA 2CGOA 2JDZA 3ROUA 3AZXA 1R091 4S2FA 4QMAA 1KDMA 4LBJA 4Y5Z0 4I0AA 3VUOA 4AEDC 2YZ4A 4H14A 5DUXA 1QDCA 1DZTA 5C6CA 2A3YA 4I01A 3TNPB 1Y3TA 2DCYA 1PO13 4YZ5A 4FXKB 4NO4A 1RUH1 2BVVA 1L3JA 1IQAA 1TNFA 1AVBA 2HEVF 4JDNA 4PIYA 4Q26A 3NJZA 4MH0E 1N47A 1EV13 2VOXA