4AY6A

Human o-glcnac transferase (ogt) in complex with udp-5sglcnac and substrate peptide
Total Genus 257
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
257
sequence length
717
structure length
698
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title O-Glcnac Transferase Invokes Nucleotide Sugar Pyrophosphate Participation in Catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYLTRANS F
total genus 257
structure length 698
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ay6A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ay6A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4ay6A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4ay6A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ay6A03
3RKVA 1QQEA 2R4TA 5DIZA 5LQDA 3O3CA 3C48A 3G2LA 4U04A 3BEEA 1GPAA 4WNDA 1Y8MA 3NC4A 3HBFA 4EQFA 1Z8DA 1QZ2A 1GGNA 5TMEA 3SF4A 1C8KA 3NPAA 2QN9A 4NESA 4N3CA 3CV0A 1FTWA 4WACA 4NEQA 2VGXB 5HQ8A 1KT0A 4GZ3A 2SKDA 3ZCQA 2FI7A 3CK8A 2JLBA 2VSNA 1JIUA 3VUFA 5I45A 3N71A 1GPBA 4AM9A 4YUAA 6GPBA 4N9WA 2L6JA 3TG5A 1RZVA 3Q49B 1OUVA 2UWJG 3CUYA 4GZ6A 4BQIA 3H4IA 2GPNA 2XCUA 3JYSA 5D0OD 2QFCA 2VCHA 3RO3A 3S2UA 3OXFA 4XI0A 2XCIA 3S7FA 5D0QD 4MRAA 2QN1A 2HR2A 3T5TA 1FU7A 4J8EA 3U4TA 2XGSA 1K08A 5GPBA 4F3VA 3PE3A 3RJVA 4RIEA 2PZIA 2NC9A 3CKCA 4I2ZA 4PQGA 4HOUA 1NZDA 1P4HA 5TVGA 3TOVA 3S0JA 3NB0A 3CVLA 3OTGA 5TMDA 5CHEE 4G25A 1L5RA 3MRXA 3BEOA 2HO1A 1FS4A 2AW3A 3NP9A 3ZFWA 3D1JA 2G9UA 2I6HA 3HYMB 2PRJA 3T3DA 5A6CA 1P29A 2LNIA 2WQHA 4ME2A 4X6LA 5KJMA 3R9AB 3DD1A 2V5FA 2GJ4A 3C4VA 3FP3A 2X0EA 2C9ZA 3KAEA 2DBAA 5G05C 2ACVA 4O6FA 2QN8A 5CCMA 3CUWA 3RU0A 1JEJA 4G26A 2UY1A 3MT7A 1B89A 2BISA 2XA9A 4N2SA 3OTHA 1WW2A 1UQTA 5ENZA 4BWRA 4KQ1A 4BFCA 4JL0A 2GW1A 1FU4A 1Y6GA 5DLDA 4BT9A 3OXLA 4UQYA 2AVPA 8GPBA 4MI3A 3RO2A 4BQEA 3CEQA 3ZCTA 3ZGQA 1XV5A 3BCRA 2C0MA 2SKCA 2VSYA 4LEUA 1XL0A 2IFUA 3CVNA 2FFRA 2PYIA 3ZPJA 2ATIA 3UYLA 3S7DA 2XA2A 3SZ7A 4EKEA 5FJYA 2R5SA 2IW1A 4RG6A 2QLMA 3QKYA 2JJMA 5JJ6A 2C0LA 2VGYA 1B4DA 2QZSA 4IN3B 3MTAA 4GPBA 2G9VA 4RIFA 4H7YA 1KLXA 2Y4UA 4NQ0A 3OKPA 2XEVA 2HY7A 1ZBPA 2GT1A 4N3AA 2KCLA 4X7MA 3OXGA 1UQUA 2F9FA 4HLNA 4CTOA 1IYGA 4KBQA 4BTBA 2BFWA 3T3GA 3WXXA 2VQ2A 4MI9A 1WM5A 1Y6FA 2JZCA 2AZDA 3IA7A 3T3IA 4EKYA 1GG8A 1Y8ZA 1M5RA 5D01A 3URZA 1HXIA 1NLMA 4GA0A 4J8FA 2FF5A 1YA6A 2VCEA 3ASFA 4UI9J 3Q3EA 3CVQA 3ZCSA 4G2TA 2ECPA 3OY7A 2FBNA 3FWVA 4GYOA 1W3BA 4Y6CA 3EDTB 3NAZA 4BT8A 3C4QA 4RENA 3G2KA 1HZ4A 2QN7A 4EL5A 1PC2A 4WUYA 3VDMA 3QWVA 3Q5MA 4KQMA 4AN4A 3T3EA 5KJKA 3LYAA 3DDWA 3LY8A 1PN3A 4UI9C 2QRPA 4YI3A 2WTXA 3QHPA 2Y4TA 2PYDA 3VUEA 1IXYA 2BGTA 2PQRA 3ASDA 3BD8A 3FFLA 4N2QA 1KTIA 4MICA 1O6CA 3MS4A 3PE4A 3GUHA 1SXPA 4U0UA 3LCAA 3MT9A 2XGMA 1EXVA 4JA9A 1FA9A 1K06A 1E4OA 2VG8A 3RIBA 1AXRA 3G2HA 4M83A 4AY6A 3MS2A 5EX0A 2F3PA 3ESKA 3S7JA 1L5WA 4XI9A 3ASGA 1RZUA 3OKAA 3SYMA 4RIHA 1WV0A 2UY1B 5TMBA 2GEKA 3BCSA 1RRVA 3KD7A 4GCNA 2Q6VA 3CUTA 3H4TA 4NRHB 2IV7A 1NOIA 2XGOA 4YNDA 3COPA 3RT1A 1L6IA 2QNBA 3ZHEA 2XCCA 3CUVA 2P58C 4I17A 1GPYA 3CUUA 4GA2A 1C3JA 1Z62A 3UPVA 2ZB2A 9GPBA 3OKCA 1XL1A 3MRTA 1SXQA 2QRQA 2C2LA 2YQ8A 3MT8A 3HBMA 2IF4A 2XA1A 2VYIA 3MV2B 4WHMA 3LY9A 4QLBA 3CEHA 3CV3A 3TGOA 3FROA 1IIRA 3AS5A 2GPBA 3MTDA 3MSCA 2IYFA 4I9EA 4I1AA 2XCBA 3E3OA 3MS7A 2VGXA 5BT1A 2C1XA 3IAAA 1ABBA 2PQ6A 5BNWA 4FZRA 4MI6A 1JIVA 2KCKA 4HWGA 3Q47B 1YA0A 3VTYA 4Y6WA 5JTUA 3KS2A 1JG6A 3Q15A 2X0FA 2FEZA 2IUYA 5JJTA 2X0DA 4NC9A 3ZCRA 2KCVA 3MRVA 3IEGA 3QWWA 1NOJA 3NP7A 1Z6PA 5LCWJ 3BCUA 1QM5A 5HI7A 4CTNA 4X7RA 4AMBA 3MV3B 4N5CA 4G23A 4GPKA 1WAO1 3Q3HA 4A1SA 2R60A 4RIGA 3UUXA 3AMVA 4B94A 5DXFA 3D0QA 4CGVA 4L22A 3BDAA 4RELA 1V4VA 2PL2A 3LY7A 3L7BA 4EJ2A 4AIFA 2LSVA 1GZ5A 5ARFA 3G2JA 4G1TA 4KXKB 3EBPA 1WUTA 3DDSA 3ZCUA 1A8IA 2KATA 5IKOA 4U0SA 3U3WA 2IEIA 4U0ZA 3QDNA 3GW4A 3RHZA 2P6PA 2FO7A 4G24A 4RBNA 4YI5A 1NA0A 3Q4AB 1NZNA 1L5QA 4WADA 4I9CA 4GYWA 1QKJA 3EBOA 3ZCPA 4F9FA 3CVPA 4UQZA 3GZ2A 2AV6A 5A7DB 3BD7A 2O6LA 3L7CA 4H7XA 1HLFA 3E3NA 1YGPA 2R4UA 2ONDA 3MKRA 5EKQD 1J39A 4W6QA 4RG9A 1NOKA 2X6QA 2WPVA 1PNVA 3AS8A 3QOUA 4AMGA 2BUGA 2OOEA 1FCHA 1C50A 5FZSA 3RSZA 1PSWA 3BD6A 3WADA 1BX3A 3MQFA 1L5VA 4J8DA 2F3SA 3RSCA 5EX3A 2QLLA 3S7BA 1XKXA 5HXAA 3ZCVA 3OT5A 2FETA 1P2BA 3ASHA 3OTIA 1ELRA 3CEJA 3QKWA 5BW8C 1Z6QA 4LDPA 1NZFA 1UZUA 1LWNA 4F97A 5CCLA 3NF1A 3VTXA 5DBKA 3TG4A 2GM9A 2YHCA 2C4MA 2XPIA 3MEKA 4ABNA 1NVKA 2ASVA 1LWOA 3CX4A 5FTPA 4Z5XA 3MA5A 4HOQA 1GFZA 3VDNB 5C1DA 1WW3A 4MHSA 5FZQA 1HH8A 3Q3IA 5ARGA 5AYWD 4I2WA 2IEGA 3S29A 1P2DA 4U07A 1F6DA 3L7AA 4GYYA 4HORA 4GZ5A 3ZN3A 5KJNA 3LKUA 2QRMA 4UI9K 1WUYA 3OY2A 4XIFA 3NCHA 3LPZA 4GCOA 5FZRA 1FTQA 1PYGA 4UQXA 1P4JA 5G04J 1ZU2A 5LCWC 3D0RA 4REMA 2XMPA 1FC0A 3L79A 3MTBA 4WNEA 3T7DA 3O48A 4MHOA 1AHPA 1EM6A 3HBNA 1XNFA 2IV3A 4APOA 2QRHA 3UYKA 3ZHEB 1FTYA 2ACWA 2GEJA 4X7PA 3S27A 3TSAA 2QLNA 1L7XA 2X6RA 2E2EA 1FU8A 1P5QA 2FF4A 1ELWA 3CK7A 2BGUA 1JG7A 4LEIA 7GPBA 2F3QA 2R66A 4RIIA 1E96B 2J9QA 4CTMA 4F96A 4KYOB 3T3HA 3WC4A 5KJLA 3G2IA 1NA3A 3CKBA 2H1HA 3L01A 3GPBA 5DU2A 3CK9A 4HOTA 2SKEA 4M60A 1KT1A 4YVQC 4CDRA 1IHGA 3K9IA 2YJNA 1E1YA 2QN3A 3CEMA 3WAGA 5JTTA 1JIXA 2QRGA 3L7DA 3S28A 2KS6A 3G2NA 2QN2A 3HBJA 1VGVA 3PDNA 1C8LA 2HYZA 4J0UA 1A17A 2C1ZA 2GPAA 4JA7A 4G2VA 3E4BA 4BTAA 3GZ1A 4WNGA 5G04C 1WV1A 4N3BA 3UQ3A 1H5UA 1XOIA 2H1FA 4HOSA 3GYZA 5FT9A 4EL0A 5M72A 4KQ2A 2LSUA 4YVOA 2PRIA 2AMVA 4N39A 2OFFA 3QWPA 2IYAA 4CGWA 1L5SA 2KC7A 5JJ7A 2Q7FA 1P2GA 3AS4A 4W9RA 4JHRA 4M7PA 2G9QA 3MBOA 2PQNA 2F3UA 4BQFA 3ULQA 4AY5A 3SYRA 5IKPA 3DZCA 1XC7A 4FKZA 1F0KA 3TAXA 2MHKA 2G9RA 4WNFA 5D00A 4GA1A 3E3LA 2R68A 1P4GA 1TJCA 5G05J
chains in the Genus database with same CATH superfamily
4B6GA 1YC5A 4O4HB 3ZW8A 2BGLA 3VKWA 1DO2A 3NJRA 1F17A 3KT8A 3EAQA 4ZTZB 4OO3A 4B3CA 4ZYTA 1NMXA 1VA4A 4U04A 1DG9A 3GQBA 3ICWA 4EHDA 3OHSX 2F43B 4D0RA 4WY8A 1Y8MA 3L84A 4OLAA 5EWMB 3T1OA 1ZGJA 3IAS6 3ZU4A 3JQ9C 2R0QC 3EVBA 5F9FA 3G1TA 2IS2A 4PZZA 3LL4A 3UM3A 5AQBA 1EFPA 5TMEA 4YDWA 1GCIA 1CIJA 3THYA 5K3FB 1FX1A 2GUGA 2GYVA 5LZ5A 5BPHA 4GTMA 5MGBA 3OPVA 1NVVR 3L40A 1TKCA 4XEUA 5H8WA 2XIQA 2IS6A 4LJ8A 1TNDA 3HB1A 3LBAA 6GPBA 3P9XA 1ONPA 4IIHA 4ND6A 1JT9A 1Q7GA 1ISRA 1E8DA 1IXSB 2ZQ5A 5FXMA 4JX8A 4U2EA 1G21E 2IIVA 3DZIA 4C0QC 2O8BB 1EUDA 4P2BA 5HVNA 2ZSJA 2PKQP 4GGPA 3I9KA 2R00A 5D6NA 2ZAGA 4EFKA 5AW9A 1JIJA 2QT0A 2X0RA 4AKXB 1EHCA 3DO5A 4NCBA 4NECA 4C4ZA 3QM1A 3F74A 3L92A 3L7YA 2ILVA 3NRCA 1E9EA 1LXCA 3PEUA 3RKRA 4BFSA 1TLLA 3IMEA 4F8EA 1H6KA 2HK8A 1GNSA 5K6AC 1X0VA 3HJFA 4I6JA 1BROA 1KTVA 1NA5A 4C0SA 1EMDA 2P67A 4NJEB 5COAA 1R6AA 5FV4A 4LV5B 2D0OB 4JV5B 4LTDA 3E82A 1LH0A 1ZI8A 4MPTA 3SX0A 1V4NA 3T7TA 2DETA 3ZLVA 2WXJA 4IZIA 1H85A 1OBOA 1ZEJA 1W76A 2WJIA 4WL0A 4J6IA 3SSMA 1GPUA 3HB9A 4BAZA 4FOTA 3FY4A 2P91A 3LBYA 1F8XA 3C72A 4KVGA 4MAAA 4BTLA 3QSYA 4P7GA 3QYFA 1V37A 3NFYA 2QY7A 4D4LA 5KHOC 4MVJF 2IEDA 4B79A 4L8LA 2G8NA 4DA9A 2N42A 3C98A 4ZOLA 2QSZA 4TUYB 1OH6A 1YI8A 2HO1A 4C6TB 4QREA 2YHIB 3ZJTA 4GYKA 3VSCA 2MSKA 2H4FA 2PLWA 1P77A 1WSAA 3LC2O 2IH5A 2F4VB 4WA8A 3IYLW 4FFBB 4PLGA 1Y3IA 2GBPA 4W1QA 4TVSA 3GLIA 4I1PA 3F6PA 5CPFA 1U8AA 4CKEB 5IJ9B 1IY8A 1HDRA 1XP8A 4H08A 2ZULA 3FP3A 2QV0A 4WAUA 1L7QA 3L8HA 3LY5A 1H22A 1Z74A 1TJFA 4I36A 1TEHA 5FLKA 3WLHA 2WIKA 1F48A 3ZWYA 2PL5A 2H1SA 5DNAA 4Q34A 1E1NA 3FHJA 5DMHA 3NDJA 4KQCA 2UY1A 2ZJFA 2XSZD 1C3XA 3RYFA 4BC0A 5A3QA 1Z37A 1XRNA 4G9GA 3FMFA 4XIGS 3UM9A 4IHQA 2EYUA 1ZK3A 5K6AA 5CCXA 1A4XA 1L4NA 2I33A 3L54A 3K9LA 4BWRA 1Q0QA 4KMSA 5KTNA 3FOEC 4AS1A 1KZ6A 4ZCTA 1SRQA 2YDXA 4LSGA 3VKGA 3L49A 4IUYA 4OQNA 3ZIDA 3I3OA 1FU4A 3AJIA 2P41A 3I9V1 1VZ2A 2GK7A 2NQ8A 4HX5A 1UM9A 3EG9B 4WUTA 1H8HD 5BNFA 2FPIB 3QE2A 5BN4A 1X80B 4BVKA 5AW3A 1YRHA 4MI3A 1BU9A 3SE7A 3BMQB 5JH7A 2ZGGA 4WASA 5HGJA 2PZFA 3CWCA 1WLSA 4JVOA 4Z8XA 4JEMA 1JU4A 4Q3OA 1E2JA 5BT9A 4RPCA 4V3CA 3G5TA 1B8PA 4I5GA 2NTNA 1YVPA 2ILTA 1ZHHA 4B35A 4CM7A 3F73A 5EJFA 3DAHA 4RTNA 3SIXA 3FDZA 1I3MA 1BH6A 1DAKA 1V8DA 4UNIA 3LP5A 2VGYA 3MYRA 4G0QA 4WIAA 3AB7A 5K0JA 3RT7A 3A05A 3WISA 4YMTA 3UBTA 1QBGA 2OCDA 1OCZE 4NQ0A 1FK8A 2HY7A 3D8TA 1HGXA 2A5YB 2BFCA 4QL3A 2QZ4A 5AIJA 3FD8A 2RC6A 3NDRA 5THXA 5T8KA 5FQNA 3TEMA 5KMGB 3ZHBA 1VOTA 1YBMA 2ECQA 3GFBA 3MTIA 4FEEA 2Q07A 2WJHA 4JBGA 2ZIGA 3T4UA 3VDQA 1N6KA 2IGTA 2JLXA 3R4VA 4M3NA 1TRKA 1FPQA 2AMLA 3T3IA 3V7YA 4LOIA 2VZ8A 1E5DA 2QW0X 5DSXA 5AKXA 2MJLA 4XR9A 1ZD4A 3MUNA 2IH4A 2BP7A 2HUNA 1KEUA 3VR2A 4YTEA 1GU7A 1Z2AA 4DSNA 1KQGA 4WFQA 1SG9A 1B8VA 3VU8A 5CTJA 5BSRA 3OA2A 1N4PA 4UWKA 1VCOA 3IEKA 1MUUA 3FTUA 2PBZA 3GX1A 5LBUA 3LK7A 5EXPA 1CNFA 1T6NA 1TU0A 1NE7A 4R9RA 1ZN2A 5EUBA 5LQKA 3PP8A 1NXOA 4P54A 3NXSA 4MRMA 2OD7A 1JWLA 4EO7A 3JQ0A 3HR8A 3HM9A 1YDFA 1D0SA 2Q4BA 1Z15A 3NAZA 5ERGB 3OSUA 3CB2A 1YH3A 1BJKA 2FXIA 2COUA 1Y4DE 1O9BA 3N86A 4HK4A 1O6GA 4IIJB 1PLJA 5G0WA 2PH7A 3WDMA 2PUDA 5BV8A 5EZSA 5A5DA 5CEEA 1CZNA 1CUJA 3EJ6A 5K4GA 1EGVB 4PIVA 3BH7A 1T91A 4TUYA 5JLJA 1DJMA 1FMFA 3QHPA 4C2TA 4C05A 1R74A 1RXUA 2ZYSA 2CG3A 2HMUA 2R9VA 1UOOA 2EBWA 2QNIA 2QMUA 2V98A 1F2TB 3G82C 1ONBA 2IXFA 4H1UA 4LK3A 5K3BA 4DG8A 4LQ4A 4OVUA 5IPFA 2HDWA 4R1QA 2E5LB 1HDCA 2DBQA 3KYDB 3W2IA 1O54A 3GUHA 5BWCA 2A1UA 5IDXA 3LCAA 1Q1EA 1KJ9A 1RSZA 3EXG1 3TEFA 3ONWA 1CJSA 5JXGA 2YRFA 3GWZA 2NQTA 1F4PA 4PS0A 1UDXA 4HWKA 1YHZA 4EB3A 2W6CX 1YBFA 4ADSG 3UF0A 1KHHA 4GPD1 1DS6A 1IHPA 2ZE6A 3HGTA 3ZOKA 4B0OA 2UY1B 1C2TA 1FXSA 1RQGA 1T0PA 4IY1A 2X7HA 1DBRA 2MINA 4AP5A 5CDGA 1KIFA 5HG0A 3HKEA 1D5CA 1M2NA 2WTAA 1S3SA 1X77A 2FEAA 5DBFA 3V9PA 2YBDA 3GDFA 4L73A 1DC4A 2QUKA 4QYMA 2HIHA 2K7ZA 5FWXB 1WDYA 2YWJA 4GA2A 1GPNA 5TQVA 1HYGA 5DRTA 3ZY3A 4EA9A 1K9SA 1QTQA 2YHAA 3COSA 4XYBA 4OXNA 1P7YA 4NLLA 1T36B 1MZCA 3H05A 3HADA 2FX3A 4YAEA 4YA6A 1UBLS 3MWEA 2YUIA 3LRPA 2FUG1 4QLBA 3CV3A 3DOJA 1NQUA 4FYPA 2ZWPA 2J67A 4B3MB 1RI5A 2REQB 1U5CA 1QVWA 3B36A 3FH8A 4MNTA 4OK5A 4DYHA 2FPGA 3VSEA 3HU2A 3TKAA 4F2WA 3E7PA 5K0GA 4JI6B 3HA3A 1IDN1 3DZGA 4WEOA 3TQHA 4MI6A 4QT0A 2O0HA 4NSNA 4G5OA 4Q4HA 3TTSA 4JLOA 2KCKA 2DX7A 3Q47B 2Y1DA 3AR9A 1N2IA 5IAEA 4RK4A 2ZYAA 1Q0ZA 2H06A 2Q2QA 3E9EA 2RHGB 3AX6A 4GC9A 1J56A 2Q2OA 3RIYA 4KNYA 3TUIC 1TW3A 2ORIA 1XF1A 1VHQA 3NWBA 1FRZA 3MX3A 3Q15A 3HP4A 1NN3A 1DXQA 2EX4A 5E6RB 4EY4A 5CFQA 1MJGM 4FT2A 3UIOC 4HVBA 1EVLA 3OJFA 5ESRA 4UEQA 2DYRE 3JQFA 1PWEA 5HF5A 4BNWA 2JIZA 4L76A 4DR7B 4YT2A 1NMZA 1UT6A 3DZ8A 4N5MA 3TKYA 5M34A 5ELXA 1W47A 1GV0A 4RVGA 2R6R1 2HSGA 2A5EA 3QNUA 4LZZA 1J22A 3N5CA 4H4EA 3MV3B 4XX5A 4WCFA 3CTMA 5AYVA 4YS6A 4G23A 2BL4A 4RH0A 3QHQA 3W0LB 1ZH8A 4TTIA 2Z1NA 1TI7A 1XO1A 3UUXA 2EZ9A 3DAGA 3EHDA 4QGGA 4ZMSA 3R5FA 2W6JA 4X54A 4C03A 2JDIA 3FDFA 1YQTA 3N28A 4LXXA 4V39A 2AJ8A 2XOEA 4RMJA 1JFFA 2PL2A 3MLAA 3P9IA 1LRJA 1UCFA 4JVMA 4UHCA 1Z18A 3USZA 5LJLA 3WKCA 2IA5A 3PS6A 3A10A 3S7ZA 3I8SA 4Q00A 4IW3B 5C4IA 2H7CA 2AC7A 4GX2A 4MCIA 3VMFA 3EPLA 3GBSA 4R2LA 1B8OA 5EJEA 3KOWA 1SVNA 1HNXB 2O8DA 1M2WA 3VU3A 4ES6A 3HYSA 1RIFA 4DLQA 3FTWA 1K7YA 2PXCA 2UYGA 1DJQA 1KEKA 5DTEA 4E07A 3IDFA 4I9CA 3I4FA 4GYWA 4Q01A 1UL1X 3LDAA 2X42A 3GLFA 4WNIA 1QRRA 4AUKA 2KI5A 2C8LA 1G21B 2C98A 2Z9BA 3QEKA 3GFQA 5LQMA 4Y2HA 5C3MA 2E4UA 2QIOA 2F62A 1E0DA 5ICMA 1I01A 1KMMA 3EVEA 4MUJA 5J43A 1XKTA 2J30A 4WLVA 1WO8A 1FE8A 3G5UA 3LUAA 4CM8B 2XKAA 1HEIA 3AZPA 3QWAA 3RK4A 4EYKA 3R9WA 1UW4B 4TROA 1A4UA 1CS4C 1X92A 2VA8A 2WPVA 2PQ2A 3COYA 4J8YA 1NW4A 4X62B 3MFQA 4QUAA 3U19A 4B34A 1GRVA 4B3DA 4JGGA 1NNUA 2EYQA 4Q3BA 5TY0A 2J46A 3VRHA 4WV3A 4P3NA 3UW1A 2G1AA 3FFAA 4E1VA 5ALJA 2O1XA 4QU9A 3D2CA 2EF1A 3P9SA 2R97A 1L5VA 4TTQA 2OA0A 2AF4C 5FWAA 4C4PA 2HWXA 2BEJA 3ESBA 4W8OA 5DGDA 5FEUA 3ROQA 1CZUA 1LFAA 4W5NA 2BBTA 3HG0D 1T9CA 2IYEA 2WFLB 3AINA 4UEOA 1Z7BA 2O7NA 5L3SA 4CEJB 1AS3A 2EF0A 3S2GA 1P5RA 1N8SA 5ETJA 3ZWAA 1A9RA 5B30A 2VF4X 4GUAA 4N48A 4NOMA 3WZLA 4AC9A 4AULA 2RGNC 4DMGA 4J7WA 1QHIA 1RLTA 3GPIA 1J2EA 3MWDB 3FTDA 4R3NA 2AEEA 4JBIA 2C2MA 1UJNA 3RTGA 5LNK6 5EKXA 2NP6A 1YQEA 1IM8A 2N3ZA 3CTPA 2CFCA 4CLOA 1FXUA 5BN3A 3V2GA 2HFKA 3CLSC 5IN4A 1G5IA 2P3LA 3BICA 3VH4A 4EJMA 4Y9UA 4RAOA 1CXZA 3JYPA 1N5JA 1Z33A 1O87A 1U9CA 1PLLA 3L0BA 4RU1A 3SU8A 2B6NA 4DRZA 1E6MA 4R54A 5BT8A 3H9GA 4LBVA 5JV5A 3D43A 3L0OA 1E1LA 1LVUA 1PD1A 2A4MA 2D0PB 2POQX 4TYQA 2NACA 1ZY2A 3OX4A 3Q73A 1UXGA 3HS3A 4CNBA 2I7DA 2F1HA 3IQIX 1KKMA 3LKUA 2YINC 4ZHQB 1PD0A 3TVDA 2OZLB 4V3IA 4GCOA 5FZRA 4DLOA 3T9AA 5F1OA 3HDHA 4N3GA 4KXFB 5CITA 3W6PA 1W48A 3WMWA 4CMHA 5LZ4A 1KO1A 3LWZA 4REMA 2IQCA 4ONEA 4CQJA 2EFCB 5TIIA 2C7GA 1LW6E 3L79A 1RJ9B 4ESHA 4WKNA 5JMWA 2AFIA 3D9IA 2V5AA 1PK9A 4KV9A 3LUBA 2QRHA 5ALQA 5E1OA 3AP1A 1T35A 2ACWA 3SC4A 3TSAA 3U3RA 3VYSB 1H1LA 1DAOA 3EWAA 2HA6A 4GBMA 2GETA 3HMKA 2Y68A 1TAUA 3T7SA 2ILRA 2MSWA 3AETA 1U3VA 3OBIA 3RNOA 3W5CA 5IVHA 1WXEA 5CFZA 3SJ7A 2CLHB 3COWA 1U2QA 2XNCA 3EZYA 1DPGA 1J0DA 2ZPUA 4NAUA 4R16A 1ZIYA 5H9VA 4JR2A 3RJTA 4L2IA 3DMDA 2P30A 4DLNA 4B45A 3VHQA 3LUPA 5IF3A 1QU2A 2CNNA 2VAWA 3M3DA 3NDIA 1MG5A 4BV3A 2MDTA 2G4VA 4CIDA 2V6FA 2MYNA 2QP9X 5IWCA 3STTA 4CFYA 3HXQA 1IHGA 3A9CA 1ONSA 1EQAA 1SG0A 2CJPA 4M89A 4TMWA 4ZJUA 3NHSA 5C80A 3Q9NC 4B7UA 4N4AA 1Q0LA 4QFBA 2E21A 2DYKA 2W8BA 4YDSA 3TM4A 2BKEA 2HNBA 3HKBB 1RYFA 4QXRA 1C1YA 3B7GA 2YWEA 4J0UA 2A92A 1INZA 1TOAA 2MHCA 2P8JA 1LPPA 1RI4A 5EQDA 3T7EA 1A4IA 3M33A 3R3ZA 3IIKA 2VDWA 3ONEA 4WECA 1NWCA 1BCRA 2ZCUA 2WXQA 4LNGA 2ZYWX 3REQA 4CKCB 4ARIA 2FPPB 3GZ1A 1KQ3A 5G04C 4RPHA 4TYPA 5DT2A 4BV2A 1LBIA 3UUFA 4CMKA 4KX3A 1STOA 3HGMA 3GYZA 5B55A 3ZE2B 2ZB8A 3EFOA 1XTQA 2OORA 2Y1CA 1SVMA 1OIWA 1CYDA 3WRVA 1WA5A 4ZEVA 3ANMA 3NHFA 3NM5A 4J0CA 4LZNA 5IJXA 3F3SA 3BL5A 2AEMA 1H2FA 1SXGA 1ES9A 1H3FA 2H6EA 1LFDB 3G2SA 3FBGA 3GLRA 1VL1A 3TWRA 2IE0A 2LWIA 2A0KA 1JA1A 3FVQA 1B2RA 3MGKA 3NBKA 3PRKE 2VCYA 3O5AA 4L50A 4Z9FA 1W35A 4E5SA 4E6EA 3VZBA 4Z4EA 4I1RA 4XPIB 1TNBA 4RD2A 1AK2A 1U8CB 4LYEA 3OEWA 4CKBB 3PVZA 4WXYB 1DT5A 2CWWA 2J1LA 2ZB7A 3HABA 3IPRA 5D00A 4YAJA 3GRPA 4V0OA 4UNQA 4B6PA 4ZCSA 1DWOA 4MX8A 1UC4B 5FUVA 1EEHA 2NW6A 4MPRA 3D9OA 3IQHX 3SCZA 3VO2A 1T5SA 1QQEA 4AP9A 4G8BA 4GKBA 3R5SA 4MGHA 4ZAVA 4YONB 5LQDA 5T6BA 4UC0A 4DRYA 4EF4A 1ZUIA 2ONZA 4V0LA 1R8JA 4TUYF 3YASA 1W0KA 5LWQA 4V38A 1LB1B 2VK2A 1GPAA 2XDAA 4R2WA 1NJSA 1VLJA 5CJ2A 4GX5A 4EB6A 2ZJOA 3NC4A 5ALXA 4OY3A 1IZ9A 1OXJA 1TZKA 1VBFA 2WHRA 2IYQA 3CX8A 1FP2A 1TT5B 2YFKA 2EFYA 4HQ6A 2JD0A 3QKIA 1KSGA 4ZYXA 3CX7A 4MIYA 5C5IA 4HBDA 1ZXXA 3LI2A 3OFVA 3DEPA 2SCUB 5ILOA 5L9AA 2XENA 3FTCA 4PYJA 1XMPA 3CNOA 3C6KA 3CNBA 3GJQA 1A7KA 1WXDA 1USIA 4Q21A 3ULYA 3SZGA 4YV2A 4UUAA 5KYGA 1E7SA 5GVSA 1I3LA 3KPYA 1B2LA 4N9WA 3ZI4A 4F1WA 4G84A 2HZ7A 1AQUA 1JLHA 1ZJ6A 5AH0A 2ZBRA 4N5QA 4X1YB 1D4AA 5F78A 4BQIA 1ZAKA 2PEYA 3NM4A 2JVJA 3PQEA 3QEAZ 4EHMA 1GCGA 1KS9A 2NPIA 3JQ7B 3V48A 2P9QA 3KQSA 3O94A 3SFVA 3VTZA 2J09A 3KOXA 3RRYA 4A0RA 4HNSA 1XEXA 1V1RA 5DWQA 5JRJA 4XWKA 2GWRA 2PT7A 4ALJA 2AFIB 4NIMA 2BKKB 3BXFA 2BFDB 2JCGA 3HCFA 5F73A 5HOEA 2HR2A 1PQPA 2BF4A 3JTMA 4LX0A 5BMVF 4PS8A 4HB5A 1CUFA 5BWMA 2VF5X 4JROA 4UZSA 1QVVA 5TX7A 2APJA 4EMSA 1GQOA 5LFAA 4PC7A 4UZFA 4V0KA 5LN1A 1BDMA 4W99A 3T9CA 2WB4A 5AKYA 4F3VA 3BMCA 3Q2IA 3N8IA 1RHMA 521PA 1UINA 1C80A 3R24A 3B85A 2UUPA 3LNTA 2ZI5A 5E2BA 3S1AB 3NV7A 5KWDA 2IDKA 4A63B 2WU8A 4UD6A 3RAEC 5KX5A 3KT6A 3BWEA 4AVYA 1XCMA 1XTZA 1ENPA 3ZU2A 3U64A 1DAIA 5H4GA 3T4PA 3CR3C 3WNCA 2DR3A 2WVIA 2AKEA 1KJJA 1VRVA 3GDOA 3QVKA 4R9SA 1I7SB 3E37A 1JQ5A 1X3SA 2GNPA 2VTKA 3Q40A 4KV7A 2C07A 3IQFA 4LJ6A 3H5IA 3GA5A 4TRMA 4E7PA 2D2VA 1GITA 4ZN6A 2PRJA 1TPZA 3K9FC 3AG5A 2E18A 5EZYF 3QE4A 3A4VA 1X81A 5KJMA 1XTKA 4MQBA 2AWOA 2XUDA 1A9XA 4MQEB 3AUXA 2XRMA 4RF3A 2O5RA 3RBXA 5BW8A 3C4VA 4UMFA 4KXQA 5IAKA 5IEJA 3AVYA 3KAEA 1KI1A 5E38A 2DBAA 2AX3A 4YUWA 1OLXA 1ECFA 2PRSA 4XYEA 1IK4A 2XMQA 4FW8A 5CH5A 3GFVA 3NONA 1YOBA 2GM4A 4HDMA 3VCXA 1SQ6A 2XSZA 4DY4A 5HCIA 3EC2A 3DPSA 4G26A 4XFJA 4EPVA 3DF7A 1FLNA 4YT4A 2WKWA 4NCJA 1KMIY 4EHKA 3WLRA 4BVFA 3P71T 2LIVA 5C8YF 4CWAA 2Z6UA 4IXNA 5DK4A 4MMZB 5BN1A 4FZ3A 1I6WA 5EZYB 1GZDA 2VN8A 4OX9B 3Q75A 3D2LA 1A2OA 4Z4CA 2DHRA 3SZOA 3LPLA 1FDWA 3H2IA 3ZE9A 3DEHA 1WQ1R 2Z98A 3ONVA 1H6CA 4MIEA 3E81A 5KNGA 3ET5A 2GW1A 1BX1A 1S2GA 3GG9A 3PNBA 2BV3A 5J2UA 1OA1A 1FFDA 2D5AA 3H5NA 1E2UA 2AVPA 1FFXA 1UMBA 4RVDA 1AU9A 4YCCA 1DZIA 4DJEC 2X9QA 4X6XA 2TMYA 3K1ZA 4I8XA 2EIME 1Z6YA 2C5FA 2O2CA 3LDGA 1WCWA 1II8A 1XV5A 1TMYA 1UBEA 2G7MC 2P9ZA 1FFBA 2ZJ1A 3F3KA 4W5JA 1U4SA 4XM0A 5LPNA 2O3SA 4PFQA 2VSYA 1ULBA 5I7HA 1E3LA 1J4AA 2JLCA 5FI3A 3DL2A 3F6RA 3FLAA 3GK3A 3OOYA 2DY1A 3V2HA 3R7NA 2FJEB 1HDOA 4J29A 4XCQA 3KKZA 4DMUB 4EB6B 3FVWA 3FUIA 3ML1A 3VBEA 1P8AA 2A5FA 4WFIA 5EMMA 3ENEA 4LHWA 7AT1A 5IHXA 5CFNA 4Y0AA 4G4JA 3ZIUA 1M8GA 5CA0F 3TLCA 5JJBA 4JLAA 2Z8YA 3L7LA 1ZN8A 1I80A 1DU4A 2NO5A 2OUKA 4HNQA 1FVHA 4LJ9A 5M5BA 2BM8A 4C0WA 4EARA 4X8MA 3LKDA 1EVQA 4JFAA 4RQAA 1ADCA 1PJRA 4YMHA 4B3IA 4KBQA 2BFWA 2QTVA 3G9ZA 2I2CA 3AEKB 1FYWA 3NHKA 3QF4A 4LZJA 3UAZA 2D1YA 1SIOA 4GTSA 3I09A 5AK4A 1R64A 2W2VA 5TPWB 3ROMA 5EIWA 3NWPA 4I5EA 3H4MA 5D85A 3QLVC 5JADA 3GD7A 4PGHA 1PJAA 1W4ZA 3W5HA 3WIOA 5LOVA 3UWSA 1S0UA 2R05A 3EZXA 4G9BA 5CX4A 3REGA 2NZVG 2Y3IA 5B3AA 1PDWA 4UU1A 4P29A 4N47A 5KU7A 4LECA 2FMKA 2PE5A 1NXPA 3T3MB 5I47A 5EKTA 3FH0A 3K0HA 3Q3EA 2WMNB 3BGOS 4HTAA 4KGZA 4H1HA 4RGBA 2CJWA 3LHIA 1F1JA 1NSFA 2HWYA 2B4AA 2ZWVA 4ETMA 4MZDA 3LFHA 3B1VA 5TEVA 1E6UA 5TARA 4QQ8A 4I2NA 1P72A 5ISMA 3RPEA 2QW8A 2QN7A 3VMMA 4AY2A 3FCAA 2ZT6A 3FU3A 2WKQA 3GNQA 2VJKA 4C43A 3D9MA 5H80A 4WOCA 2Z2XA 1ADFA 4BX9A 3DEAA 4HEHA 4AG5A 2B3TA 3PI6A 1AOXA 1CUVA 4RSMA 1PNRA 1KYVA 1US8A 1KQPA 4AX8A 4EGQA 2O07A 2ZTVA 3RWOA 4D3YA 1P2FA 4KQXA 3PTAA 4XOIA 3EBLA 3UUGA 3ITNA 3BUSA 3L02A 4LZOA 4HTFB 5H70A 1QO7A 3HPQA 3RHFA 2H3HA 1Q57A 1BEEA 1OFUA 2A0YA 2PR7A 2PQMA 5CHYA 3A3YA 4BERA 2I71A 2Y2VA 5J63A 1QANA 3W3AH 2ZYIA 3NHLA 4ZPXA 5KYKA 3BZWA 3T6KA 2J4FA 3WGQA 3ZCSA 3LCJA 3ESKA 1L5WA 4XI9A 1D9XA 5HZMA 4PLCA 5TMBA 1NVTA 5EPUA 3SVTA 4DJDC 2CFIA 1OW3B 3CUTA 2AJLI 1K2WA 2ZITA 4A3TA 4Q3DA 5AJYA 1YL7A 1SM4A 2IV7A 1SIUA 3GLVA 1HY3A 3AHHA 4PQFA 1ESDA 2E6KA 2E37A 1NW3A 2FTKE 4OF4A 3FHTA 4KPUB 1LV8A 4G65A 2OCCE 4OPMA 3VNRA 7REQA 2ZB2A 1WCIB 1EBBA 1L0BA 1P6QA 3DWGA 2VP2A 1NUTA 2QRQA 3MT8A 3BFVA 2K87A 5GONA 2XA1A 3GLGB 1M7GA 2GSWA 2QI9C 2Y76A 2DRIA 2A0UA 4RD1A 4LHZA 3T35A 1HYHA 3D02A 3ZE0B 5EJ9A 1OX6A 2GROB 1RKQA 3DFUA 4FGSA 3WMGA 1UMDA 4LMAA 4ZAYA 3TAHA 1P7PA 2C82A 1IG0A 1ZMXA 3Q2KA 2GR9A 3BXZA 3R0JA 2H17A 4DXAA 5A4DA 3IAAA 3CKYA 4RH3A 1JV2B 1O1SA 4K6OA 3GO4A 2W93A 1KZYC 3CLUD 2VTBB 4OBEA 4RVOA 3OQHA 3SXUB 3N0RA 4EBAG 4M4SA 2CNOA 1Y4ZA 4I81A 4JUFA 4Q82A 1NVAA 1RPNA 3NJ4A 2Z4RA 1KIAA 3ELWA 4Q0MA 1M1YB 5BSGA 5LQJA 2AJBA 4UNSA 1N2EA 5M7EA 3K70C 2CXQA 3HXDA 1AO3A 1HKHA 1LPBB 5JJTA 2ZIRA 2H54A 2J7KA 1AB6A 2HUPA 1U81A 3SYKA 3W3ZB 1GAEO 1K6JA 4HLQB 1O8CA 4M88A 4MVJM 4NCKA 2WFMA 1XQ9A 3QWWA 1L1FA 3TSYA 3UT5A 3MJVA 5FYQA 2BI7A 4D9MA 1G4AE 4F5WA 3ZYLA 3M4JA 1YMVA 1JA9A 2GRLA 4R3UC 3C3CA 4CMEC 2OCYC 3PJGA 3H2ZA 4OX9Y 3NMUF 1SY7A 1N95A 1H2XA 1Z12A 3DBRB 3FPBA 3JAKB 4D9NA 1RXIA 1YI1A 1HT2E 3EF0A 1U7DA 4TM8A 1Y6ZA 4Q9LA 3ZV6A 5NLLA 3LDZA 2VDLB 3R7LA 5JAOA 4HNTA 5K0CA 4RHEA 3VTAA 2F6RA 3FTYA 2QQFA 3JATA 2CKDA 1P1BA 3C87A 2D6FA 1U8YA 2C04A 2YXNA 4RVNA 2OD2A 5FQOA 4ZK6A 1Z16A 3LKVA 2FFGA 3PNLA 1JA0A 1H69A 4I5DA 5K0TA 3DLHA 4BJ3A 2CJWB 4F11A 4Q6BA 3JUIA 3NYWA 3ZXXA 1KC3A 4ENPA 1G7RA 4RH1A 2WJ3A 5LA6A 3DL0A 3TVYA 2J0QA 3P2KA 2IONA 2ATEA 2EOAA 5DX8A 4JKYA 4HWOA 3FUMA 5EHQA 3EPKA 2PUEA 1UANA 1CDEA 3KKQA 4C3VA 4E21A 1CFJA 1JNZB 1C7JA 3JALA 4ZQFA 2FSGA 1LPOA 3ZNNA 1E0JA 3GZ2A 2VK8A 5AHWA 2G1KA 3UJ6A 2IXTA 2FOIA 3BMQA 3DKKA 4ZXPA 2C2OA 1B8UA 3UFXA 4BKPA 5I7SA 3PZ2A 1KJWA 1G8GA 2NUTB 3OLCX 3TZ6A 2JLZA 2DCUA 2OR3A 1XJWA 3I0NA 3I64A 1XXHB 4QM6A 1JDBB 3TE6A 2BHNA 1QZTA 1XRMA 1XDUA 3AF5A 4IGEA 4K87A 1L4LA 1ZD1A 5GM1A 5JOQA 3DZHA 4FD3A 3N87A 1M1ZA 4GGOA 3GAAA 2FWJA 3H42B 5ALOA 4KTTE 2GEFA 1XDBA 3RVQA 1I5RA 2FX2A 3MYVA 2OLEA 3HCEA 4FDUA 5D6OA 4LJ5A 4ANFA 1PJBA 4RE6A 2IH2A 4JLJA 4OYLA 3FUEA 1XD2B 5JIBA 2RH5A 3DTVA 3ED5A 3GHHA 1H1TA 5HW0A 3IC5A 3SVLA 2QM8A 2VBGA 1KJNA 5BSUA 3P32A 4JGIA 3VV2A 1DE0A 1VKHA 4Q1EA 4LSZA 4YACA 1D8DA 3LDFA 1XCLA 5JAIA 4OAQA 1HDZA 3OKFA 3KVYA 1E6WA 1P6UA 2V7WA 2VTDA 1LUAA 3F5FA 3I04A 5EGSA 3EGCA 4WTOA 3UOAB 4W1PA 3VZQA 5CNMA 3BT7A 2JAQA 2ZE5A 3LW7A 2W6ID 2ODTX 1NF9A 1NRWA 3DKRA 4YP1A 1CS0A 5IC6A 5IF9A 1CUSA 1Y8QA 4Z9YA 1Z35A 2Z09A 4KN6A 1UK6A 2BP7B 2DECA 2NTJA 3IEPA 2CF5A 5DM60 2GCGA 4DF3A 5IT9A 4C0MA 1EA5A 1PL0A 1QYRA 4GR5A 2AZMA 3GBVA 5MN4A 4ZVSA 3F6SA 3VDNB 2XXAB 2V5UA 3R23A 1N5RA 3K1TA 4BZXA 1H2TC 1OYVA 3C6YA 2X4DA 1E3QA 1A82A 4O2BF 5ARGA 1DOAA 1KU0A 1NMEA 3W04A 2CCKA 4H6WA 3PXBA 3VHXA 1CJTC 4D4IA 2R8BA 2CCGA 3LE8A 3VO8A 5BW4A 4MRMB 3UMMA 1UK8A 3EIJA 4HXIA 1EH5A 1NSYA 4JD5A 4FXOA 4UUBA 4TS1A 5BYAA 3QVOA 4AJHA 2Y3AA 3Q12A 2PUHA 4JVNA 3BULA 4ZFNA 4FQ8A 2OO5A 3ORSA 1UZLA 3CSDA 2BFMA 1JKFA 4TMFA 4G8JA 5BOVA 4WNEA 1DDOA 2HL6A 4XGQA 1NW9B 5A06A 4GNKA 3JSXA 1JQKA 3TMKA 1AHPA 5CNJA 2DCPA 2I3BA 3FNEA 4TXLA 1GU0A 1T9ZA 3RG8A 1NVVQ 2V74B 1JSCA 2Q6KA 4M1KA 4JLMA 4K1LA 4G2NA 3WGOA 1RPZA 2AG0A 2VDNB 4YROA 4JYAB 5AW1A 5IT5A 5CMLA 1TNOA 1TJNA 2BGUA 3CNLA 4WCFC 3NXKA 5L40A 2F4NA 5CB8A 3NHMA 1EFKA 5SYNA 2IOYA 4RVUA 4DA6A 2Q1YA 4CTMA 4YECA 4F96A 3SGLA 1ID1A 2XUIA 3GDWA 3OE5A 5E7MA 4D92A 4EKNB 3ICEA 3QJ5A 1IJEA 3SBOA 1H0AA 1Y7LA 5G1OA 5HZGA 3EX7C 4L9SA 4FM9A 4AD8A 3N3BC 4K0KB 3JATB 1USVA 3L4EA 3LS2A 5AJHA 3TR5A 1JEAA 3OCVA 4GRDA 3ESCA 5CXUA 4UTVA 5TGTA 4CDRA 4LNBA 1OCRE 1COWA 1C9EA 1J99A 2P2YA 2VP3A 2WXMA 4HADA 2R11A 2GPYA 3ZHRA 3RUAA 4D0NA 3WAGA 4H60A 1ZVVA 4PFJA 2H85A 3AW8A 3M4ZA 4LTMA 3V46A 4WOBA 1L5HB 5JNSA 3TU3B 1PFQA 3AP3A 3PHCA 3VZSA 3ZVRA 4N0EA 4TQUS 4R1MA 3UV3A 4IUCS 3E4BA 4YXFA 5P21A 2WWIA 2R96A 1KI2A 1JBQA 3WG9A 2ZRJA 4R83A 4DB2A 2IEJA 2ZROA 3EYAA 1XTTA 3GYBA 4HO1X 2BJVA 1XOIA 2DOKA 4UYKA 1OFGA 4WKCA 4DX1A 5FT9A 5AW4A 3IHKA 2F55A 4GMKA 2LSUA 1KO8A 3L4BC 2WLTA 3QPBA 3HXFA 2I2DA 4KO3S 3Q4GA 4RMGA 4BMDA 4PBTA 4ZQBA 3TN7A 2MSDB 1XCOA 2JEKA 6REQA 1MJHA 2C83A 1HL7A 2J6BA 2QWXA 1TEZA 2Q49A 5F5XA 5DNYB 1JDTA 3ISVA 4RX1A 1TN6A 4MV0A 1Z8FA 3T5PA 3NHZA 2HHLA 3HCWA 4HDRB 4L5IA 4X5OA 3WNQA 5EXSA 1WMFA 4O4IF 4D6PA 2VIIA 1UODA 2BFEA 1L9KA 5ALSA 3RVNA 4DUZB 1XRRA 4NYIQ 3PWTA 4ISBA 4AZWA 2XIJA 1J20A 2O3JA 5CECB 1SC9A 3K72B 1FUUA 4MWDA 4G5GA 4QBHA 1C0PA 4RJTA 3KLMX 2G9NA 4ZZ1A 2OY0A 4IILA 5DI9A 5BPPA 5FA6A 1CEEA 2ZPAA 1O08A 1YBAA 1HNNA 1R8YA 2JLRA 3GDHA 1TZBA 1L4HA 2ZJBA 3W5SA 4QUEA 1F2UA 1VSBA 1XGKA 2ZS8A 4GXTA 1VSVA 2HRDA 3PS9A 4G56A 4N6OA 2VXYA 1W36B 4Y9RA 3B6JA 3FPAA 3HJBA 4N3CA 3G2WA 5CX1B 4Y2GA 5L4LA 1H4SA 4FLMA 1VMEA 1DLJA 1K7XB 4EJ6A 4Q1VA 4F9EA 2HMTA 4K26A 5EIBD 1E5QA 2CUKA 4Q93A 3DZJA 1FQKA 3VUFA 3ZCQA 1QFZA 2MYPA 1Z22A 1M2EA 2ZUBA 4MCAA 4V0RA 4WNYA 4H27A 4JT9A 1KMHB 2YWHA 3PB3A 3RUIA 1KEEA 1OGIA 1XYVA 1X1AA 4NOLA 2BFOA 4PZ0A 4QHSA 3SO8A 3ITEA 2GD0A 2D2EA 1IG3A 2AOUB 5ER9A 4G09A 4HGPA 4PPFA 1X7YB 2AQIA 1SFRA 3PZ3A 1ODIA 2HLPA 3TQRA 3S2UA 2V7QD 3A1EA 4DXHA 1OTXA 5D8DA 4MPJA 3LVBA 1N2OA 3KTFA 4JGBA 1D7OA 4BCDA 4KN9S 2WJJA 2RKWA 5BN5B 2QN1A 2I8AA 2IQIA 4IZHA 4B8ZA 4CM8A 2ZSUA 4P3PA 3MT0A 5JSHA 1CJCA 2PUGA 3I01A 3AJRA 3TQCA 3E30A 1M0EA 1EX9A 1YZTA 2VJOA 2JRLA 1D1TA 2YYZA 3AHEA 3HCCA 1TA4A 1Z4NA 1O6BA 1D4FA 4YRGA 5CERB 1L3IA 1CBUA 3IQWA 4D4KA 4U5XA 3KPWA 2NC9A 1E6EA 2IXEA 5AIAA 3U3MA 5A7FA 1PEAA 1J2YA 2J07A 2ZIFA 4GWGA 4L0MA 3HEAA 3SHQA 4I4IA 2J3LA 2FUG6 3E7XA 1P7CA 2WJAA 4TKMA 3A9WA 1HO8A 1TQ8A 4PYQA 1R6DA 5JSFA 2UU9B 3IFSA 3NHJA 1U0SY 3FSRA 2VNHA 3ME5A 5EEHA 4MLDA 4XRGA 3LQ4A 3VYTB 4L5YA 1QVZA 4DV1B 5A6CA 4G0OA 1HTWA 1RLUA 3E61A 4OSEA 3KUDA 2A1TR 1EM8B 2PTGA 4B4WA 1MJNA 2YCLA 3HXBA 1NKVA 1YDWA 2IGBA 3JXEA 5DT9A 3ASVA 1ZDMA 2J5BA 10MHA 2OSBA 4HWSA 1IJKA 5GMOA 1L6RA 4MLCA 4F60A 2JIZD 4FS3A 3RG2A 4PO1A 3TLZA 2NVUB 3E03A 5JXJA 2QL6A 3IKTA 1A2QA 1RVDA 2SHKA 1E0KA 3TX2A 1TX4B 2QPLA 1QQ7A 4WZAE 1B15A 1SQ0A 2PSDA 2QQ0A 3ENZA 1A7UA 3K9GA 5ENQD 3DCJA 4CLRB 4REQA 3M1IA 4ECEA 2BSXA 3IUEA 2VBCA 2OFXA 4ZOEA 3F71A 4RMHA 3LLMA 2YVAA 4KB5A 2GK3A 4FN4A 4AYWA 1YRAA 5EMLA 5GOZA 1ISIA 2GQ0A 4YHHB 4R05A 1CJBA 2J08A 1JE0A 5JDIC 2YXDA 4LRYA 1SIWA 3RFUA 1K8YB 4A10A 5JBIA 2PRZA 4KQIA 4P6VF 1LSSA 2OPBA 4KFTA 4QYTA 4ZDWA 3WDKA 4CEIA 5JJKA 1CQIB 1M72A 1XN1A 5P8WA 3ICQB 3ZHTA 5DHRA 4ZJYA 1LF5A 1OMOA 3QKUA 4GC5A 2OQ2A 2PZJA 4GMFA 4D6YA 3G2OA 4HGOA 4TL6A 5FLYA 2GBGA 1JDZA 3FE2A 4MV6A 1YS6A 3QOYA 3T52A 2C0MA 2KMLA 3BTUA 3TWXA 2CXRA 2RC5A 2XH8A 3CINA 4IFIA 4MVJG 3IVGA 4NBNA 5KDDA 4Z49A 4QGBA 4F38A 1FSSA 3DRAA 1SMKA 3CN7A 2XA2A 1W36D 3USCS 5KOHB 3H6GA 3R77A 4NZZA 4KZCA 3VVMA 1DO8A 1O4WA 3E1SA 3GJZA 1U7ZA 2JHAA 1DDIA 4BFZA 4H6VA 4CE6A 5D2MC 1B4DA 1N2CE 1O1YA 2HHCA 3HFSA 1GZ4A 2VPTA 4MUFA 1BIFA 4WN9A 4H7YA 1YMUA 2F3TA 2IU6A 4MUIA 3WWYA 3OKPA 4DZTA 3B13A 3HSSA 3TNLA 4L7VA 2GMWA 3ELUA 5A6SA 1B0PA 3E6AA 2XXJA 4YDYA 4Y9TA 6ADHA 4HWRA 2TMDA 3D5QA 3R9KA 1VG0B 5AFSA 1F14A 2UZ1A 2YQZA 1J70A 2NXNA 4IBOA 2FEWB 4MWOA 1I2BA 3HCOA 3NAGA 3I3SR 3KQVA 1D2EA 2VDWB 4JA2A 5FBKA 4R81A 3W1WA 4DHEA 3BTVA 2V7BA 4EKYA 1DTEA 4BLVA 1ELOA 1GP2A 1KJQA 2CKMA 3LTEA 4XX0B 3ASZA 2NU9A 2QTWB 2HF2A 4GA0A 5JR3A 1NM5A 2A14A 2UVPA 3QE0A 3NIBA 2FOLA 4DIOA 3GVHA 2P5SA 4QAJA 1KWKA 4BNIA 4AK9A 4IDOA 5FL3A 3OZFA 5IC5A 3PXEA 3ISTA 4B3RB 1GIAA 3DWIA 3OLWA 4G4SP 1Z2EA 4QA9A 3DLAA 4XPIA 1ADJA 4HAIA 1MT3A 1S2OA 2EQAA 3V1LA 3QTBA 2YWGA 3LUDA 3UMYA 1OKKA 4QO7A 4QJ3A 1RWQA 1G19A 4PS3A 2PWPA 4NRDA 1S8FA 3L3BA 3T7CA 2NGRA 3GLHA 1N9KA 1QNLA 2BMAA 1GKIA 1G6HA 2XGJA 4ZFHA 1A2KC 3U1VA 5KJ1A 4YI3A 1EK6A 5DI3B 5AKKA 3RVLA 4AJPA 5EERA 4MDHA 5BP7A 5TF0A 1HZJA 2WFAA 5E6UB 1KZOA 3NB2A 3BREA 2REXB 1OJLA 4ROTA 1PG0A 4F7WA 3HB5X 3PVSA 4K2HA 3IESA 4R01A 4CUKA 4R8KA 4CQNA 4N8EA 1KBQA 4Y2QA 4BMSA 1N5MA 4BVEA 3E23A 1NVDA 3GZJA 2GDJA 2VG8A 4C3OB 4MRUA 3AEYA 2QJWA 3IO5A 2DBVO 5LYYA 1XVLA 2JC3A 3HVIA 3A6DA 4LKRA 1XLWA 2ZUVA 2SCUA 1ATZA 3DOOA 1FL9A 1M5UA 2V8BA 3FNHA 4TUUA 4N8SA 3SE0A 4WWOA 1G8HA 2A90A 1TGVA 1UWCA 4CLRA 3V4RA 2GEKA 3BCSA 3C6BA 1RRVA 1IHXA 1Z08A 3GHYA 2H07A 1NNEA 2ZREA 2RHOA 1V8PA 2WAXA 5F3WB 5IN5A 4TT8A 1K7EB 1KGDA 1QZUA 2G72A 3FOBA 1W85A 3R3VA 2RSFA 4CM3A 3TEJA 2B21A 3MBKA 3WTBA 3FR8A 3HVEA 4PIMA 2Q9CA 3AONB 1PJZA 1TGYA 2QDKA 2RGBA 4MV7A 1XL1A 2G82A 4QQNA 2B94A 2NZWA 2ZI7A 5AR1A 4M1SA 1QONA 4LY9A 5EMNA 1P9NA 3GW8A 4F6RA 4B3FX 5L95A 3NTVA 4ZQEA 2WZDA 4DIUA 4MHTA 1IIRA 1CHNA 2DHCA 3SX2A 1XCGB 2LP4Y 4I9EA 4DC9A 1J5XA 2BM0A 4PPYA 1W1IA 3PHLA 3ZJVA 2XCBA 3E3OA 5CVCA 3ES9A 2OBXA 3NBAA 3JXIA 3R3SA 3B82A 4ZV9A 4NDNE 5EHNA 5D3KA 5KOHA 4P4SA 4J7UA 5JS7A 3U3JA 4NXNB 3LUGA 4HWGA 2ZJZA 5TLSA 1R15A 5JSZA 3T34A 3PRZA 3DLTA 3CF4A 2WV9A 1DUSA 1P7ZA 4HQFA 3TSOA 3TIGA 4EUHA 4FULA 1Q91A 3PA6A 3I2HA 1MV8A 1P8JA 1W25A 1N2CB 3B13B 2IUYA 3EVFA 2ZRIA 2F8LA 3OJXA 4TRJA 5EJ2A 4K9SA 3UKRG 4R9VA 3ADCA 1XK7A 3SM9A 4N41A 4NULA 1SU4A 2CD9A 4RV9A 1UXOA 1ZD8A 6LDHA 1EA7A 2WWFA 5BMOA 1ZKMA 4H3VA 4JB8P 3ZJUA 3PLAE 4HLDA 5TR9A 1VIAA 4BN4A 4JDUA 2GRRB 3KTDA 5BURA 5C1BA 4FGZA 1N3LA 3LXUX 1P75A 1QDUA 4QHTA 4JYMA 1A5BB 4N5DA 3VZDA 3TTUA 4D9JA 2ZDQA 4RHUA 5C52B 3MGBA 3AMVA 3E4CA 3I9MA 2H6HA 3L8YA 1ZL0A 3GCGA 3ZY4A 4CGVA 1T3GA 1E3WB 1Z5OA 2VPWA 4UKDA 2ETAA 4EVSA 2LAIA 2R7NA 1N7HA 5K0FA 4M46A 4DUPA 4XEIG 2YOGA 4C22A 1FP1D 2QL5A 4CV1A 5AUNB 4GHWA 3KJXA 5D3ZA 1VP9A 3G9XA 5ES4B 3L9TA 2PMDA 3INYA 3S70A 2J45A 4F1KA 3GRAA 3OLYA 1NI4A 3EIQA 1ECGA 2H51A 1J09A 3EEBA 5KHAA 1CUYA 5ARCA 1T0HB 3EIOA 4HB2A 4WADA 5ALTA 1MA0A 3KPVA 5D7BA 4DG9A 5C8VA 3OIFA 4RF2A 1XA4A 3E8SA 3QP9A 5IKMA 5KSYA 1W2HA 1DIRA 2AK3A 4Z1MD 1HI9A 4WA7A 1E69A 4PUCA 2P2SA 3PUVA 1NX9A 2IYSA 2G6TA 4XARA 1V0JA 4EX6A 1QO9A 2XDQB 1HLFA 3P1UA 2H2FA 3V7FA 2FN4A 3PEVA 3HBLA 5DGCA 3ZNGA 1N9ZA 3C0KA 5E6UA 2OB2A 1ATIA 4NX2A 4XKBA 4Q37A 5CA0A 1Q0HA 3A6EA 4F93B 1U2VG 4PVDA 1QP7A 3NVMB 2F17A 5LU8A 3B1YA 1VJ0A 1T1SA 2VPZA 4MITA 4URYR 3KB2A 1FFHA 4IJQA 4R2IA 2RE8A 2OV3A 1B3BA 3NVDA 2PGIA 1XQ1A 5FZSA 5JPDA 1WE2A 2VI5A 3WLEA 4KE6A 4D97A 1K1BA 3P4YA 1KGSA 3OZXA 4JT4A 3T95A 1RHRA 1M6EX 3F6YA 4MTCA 2XNDD 4MROA 1KVUA 4M1MA 4ZRNA 4YRIA 1POWA 4R1TA 3HXPA 3KG2A 2H9YA 5CLIA 4UAUA 1SO8A 1V95A 2AVNA 2ZRMA 4LZLA 3RLFA 3S68A 1YR2A 3R0ZA 2EX0A 3A6ZA 3KAKA 2YWBA 1KYXA 5JFGA 5FHQA 1A9QA 4B3TB 1YV9A 2P62A 2X5HA 3NF1A 4P32A 2IU0A 3HVEB 5DBKA 1FP7A 1GPWB 2QC9A 2HADA 3QPCA 3Q15C 4NHEA 3R8CA 4LWOA 4OFBA 2XUKA 4XLLA 2IEAA 2KB0A 1I33A 2ZI4A 3NORA 1Z5PA 1XKQA 1Y8RA 1XZEA 4LMRA 3ZGVA 4DBZA 4M1EA 2BZ1A 2BC9A 1YVDA 1Y9DA 3LOPA 5C1DA 5EI5A 4BX0A 3BHIA 3MTGA 2RHRA 3TF5A 1DG1G 3KWFA 4QXPA 1GUFA 4FI3F 5FWNA 1Q0UA 3I2IA 9MHTA 4KN5A 3CKMA 2AW5A 5H0IA 2PD4A 1PR2A 2WPDD 3QQ5A 4J1QA 4AO8A 4ZI7F 3PUKA 1T34A 2QRMA 1TO6A 4A36A 5KTKA 2WDPA 2GZDA 1CY7A 2DTDA 2WUDA 4E7OA 2FQ1A 2OXTA 3M3HA 3FMGA 3VYUB 3ZWKA 2F64A 5EIDA 2JIBA 2VO1A 4RJ2A 4YPFA 3RNLA 2BH2A 3MTBA 2X1LA 5DGTA 4HXGA 1AP7A 1HRKA 4C89A 5B1EA 4JSYA 3IV0A 5BOSB 2IT1A 3PQ3A 3Q3VA 2HYIC 2IHNA 1PVDA 3RO7A 4DA0A 5FF9A 2NSYA 3W78A 2GRNB 3V5NA 3TG2A 2QXTA 4LGYA 4J3NA 4JT8A 4N6GA 2WYHA 1ELWA 1CZHA 2ZFUA 1CLUA 4GLJA 5AKJA 5HE9A 1O96A 3V2UA 3EWNA 4RIIA 4RXUA 5FNVA 3F78A 4W9MC 3OA0A 1V7PC 1YOVB 3EOBI 4D1YA 5JO0A 1S8AA 1JWFA 2BUBA 1JTFA 1F0YA 1WHSA 2MSEB 1HT0A 2FCRA 1CJKC 1YS1X 5FINA 2AR0A 4MUKA 1EK1A 3R20A 4FEGA 4QO8A 2WTNA 3NGMA 2CT8A 2HA0A 1T6XA 1T8PA 2GB4A 2EJBA 2WM3A 3HSYA 2I03A 1UP6A 3IE2A 1DIHA 4BLUA 2QIPA 4CM4A 4F72A 4BHTA 4MQMA 3R5JA 2QRGA 2D8AA 3MOIA 5T57A 3S5JA 4BO2A 1JJIA 1M2HA 5CT4A 3B3FA 4EGSA 2L6BA 4UBJA 1PHPA 4QEKA 2HYZA 3OQJA 1UBKS 2HTFA 3SGHA 2GN8A 4KXYA 4V0NA 4POAA 4G2VA 2UAGA 1O94D 1Q3KA 2M6RA 2L0XA 3LFUA 3Q0EA 3ZLTA 3NNSA 4A8JC 1SKUA 1LW7A 4B89A 4HUQA 1YJ8A 4N3BA 3UQ3A 2PJUA 4E13A 4F6LA 3NEYA 2UYQA 3C2QA 3HE3A 1J1IA 4P3KA 1BHQ1 4QOJA 2UYOA 5CEDB 5CTAA 3U9LA 4DKXA 4EL0A 4TLEA 3BPSA 3PFBA 2YV5A 2G71A 4IXDA 2DSNA 2P9SG 2BKXA 1TYQG 4PPGA 3RVSA 4EEKA 1OB5A 1Z38A 4JI0B 1QU3A 5JJ7A 1U2PA 2BM1A 3LF1A 3G9TA 1NFQA 2IPOA 2FUEA 3GJ7A 1P2GA 3UZUA 4EITA 1HQCA 4DMLA 1BFUA 1VPDA 1W2WB 3VVLA 2G08A 1ZA1A 2WHPB 1AUOA 3FGPA 4KQKA 5AOVA 1WPRA 4IICA 1JHYA 4RLSA 5K0LA 1EDEA 3DUFB 2IDJA 4U9UA 3WBKA 3NOXA 1FFGA 1QFXA 1TCCA 4TV8A 1EE1A 5F1YA 3K15A 3EJNA 4R41A 4IG4A 3S55A 2BBWA 4ENTA 3ZNOA 1NN5A 3SNXA 1WJGA 1D9SA 1MIHA 1T0IA 5JU6A 2I0FA 2YOHA 3OI7A 5IM4A 5EQFA 1IXKA 1M34A 3RVDA 3L16A 4LPSA 1GSAA 4PLZA 3BK1A 4OHBA 2CYCA 4TGLA 3J81k 1I9GA 4YV1A 3R0IA 3LZ6A 4OHWA 5I6DA 3WLQA 3KFVA 3D64A 3OQOA 2EP7A 4RCZA 1MF7A 4TMTA 3T0IA 3JYLA 2A84A 1WR8A 1WQ4A 2GCNA 1HYQA 5JHBA 2WM9B 1JPUA 4MGKR 4CL0A 2O7SA 1Y6QA 1TD9A 4RQUA 2DQ4A 2EDCA 2JFFA 1V3QE 1AUQA 4WACA 5C46F 4L3WA 4RADA 4NCNA 5TGZA 2XUQA 4CDMA 1UXHA 1DAMA 4N0MA 3SC2B 4JB2A 1Y63A 4A2QA 1H0KA 1RPJA 3IMFA 2CV1A 4KVMA 5KNDA 4BQNA 4GOMD 3HH8A 1GFWA 3SQMA 4HXEB 1OLOA 3FJOA 2OHIA 3DAYA 4H4DA 4KLRA 2YZ7A 2DUWA 4OV6B 4TT3D 3CWQA 3L0DA 3DP7A 2J48A 1V47A 5TQ0A 3FJYA 4HGYA 1NONA 1OBVA 3R09A 5A4MS 1ZH0A 2BGNA 2OBYA 5D0OD 1N0IA 2AN5A 1X7WB 3SICE 4AUEA 2FSHA 3RO3A 5I9BA 4E15A 5A3JA 2LAHA 1NXSA 3Q7FA 1DQPA 1T3TA 3VLDA 2P0YA 5AVSA 2LD4A 1ECJA 3LRXA 5DB4A 1WZ2A 2Q6IA 4CYMA 4WAFA 3M89A 3VTKA 1HLPA 5CMWA 1M2GA 1UBNA 1JAYA 2BR4A 2ZRHA 2R5FA 3B3GA 1T6YA 1N7IA 2PHZA 3GXOA 4UCQA 3A2KA 3BS4A 1TTQB 1JVBA 4O29A 1W4LA 2XGSA 1J0CA 1JEEA 2FEPA 2A33A 5ENRD 2ONJA 2WUFA 2WW8A 1JLSA 3DOCA 4QICA 1XN4A 4W8GA 4EENA 3ZXSA 1DAEA 1UEJA 1RLIA 3ASOE 1TU4A 3SBEA 3WOVA 3I2KA 3AESB 1WD7A 3UKJA 5IBPA 4BVHA 3OTGA 1GDDA 3C1OA 3TLXA 1LLDA 3Q0IA 4XEHA 1UJ2A 2AJDA 3IRUA 4AZTA 1XNJA 1WKBA 2Y1KA 4O4HF 4ER6A 4S04A 3VJLA 2ODPA 4JUCA 1JP7A 1FT1A 3PXUA 3ORYA 1PR0A 5BW6B 4KAJA 2IC5A 3DYVA 3HP7A 1CS0B 2AYXA 4G89A 4LXHA 2C9DA 3K73O 4UNRA 4JEIA 4I1OA 4WRRA 2OC4A 2GJ4A 4PG8A 2C9ZA 5LBIA 4CF3A 4B1FA 4YJ3F 3F9IA 1GNQA 2F2TA 3GGPA 2NZYA 3O93A 2PG3A 3ZWQA 3MJEA 5KDOA 1Q7RA 2O0JA 2P9JA 3BCHA 5HQJA 5LZ7A 4EG3A 3NVAA 1N6OA 1ZWLA 3O0TA 1BPOA 2Q3MA 1YI0A 4GVLA 4F5EA 4YMGA 2A5JA 3Q11A 5C9ZA 2RAFA 2R02A 4QPPA 2NUAB 4ENVA 3TGWA 3K3PA 4URKA 5F7ZA 3TX6A 1UJJA 2YV3A 2DHQA 1V1JA 1YFZA 5CLHA 3PDIB 2ISSD 2BYTA 4LFAB 4BXOB 2O2XA 3QKSB 3G9UA 2VKTA 4WBXC 5KVQA 3O4IA 1GGEA 3KL4A 4DL9A 1YCGA 1LI4A 4CGZA 4DDVA 2KM4A 3D3NA 2AXUA 3GLKA 1SVWA 4LTNA 4ZCRA 1WZNA 1YMPA 1H23A 1IEQA 4UVDA 1V54E 2ZYTX 5U9CA 1F20A 3FG9A 5B1SA 3OZCA 2OQRA 3ESYA 3M81A 3PLRA 2X6JA 2V7EA 3X43A 3R7FA 2NYRA 2HT6A 2BE7A 4RKRA 5CAEB 5LXTB 2XNSA 1XL0A 2PYIA 3CVNA 1D2NA 3Q6MA 2C97A 3NTQA 1WMDA 3TTTA 4OATA 1HE4A 1HT1E 3CVWA 1PUIA 2IW1A 4M53A 2WM9A 2OV4A 3F5DA 2XQ0A 1EU1A 1QQ6A 3LX8A 4TX1A 4KKVA 3ZDBA 2QZSA 3BWMA 4KH1A 3OZAA 3ORHA 1U94A 1DIGA 3EDMA 2VT6A 2SBTA 1KLXA 2ZPTX 5TPZD 3UWDA 1DNPA 16PKA 1NI5A 1ZRMA 3ZV7A 3LBHA 2DCMA 5KAPA 2XRFA 2KCLA 2H08A 5KDLA 4EB0A 1SBQA 1XT6A 3U44A 4OOEA 1HSZA 3GN1A 4ND3A 4KRYA 4CI0B 2LPMA 3I37X 1O3YA 2QLTA 3C8UA 4QBKA 3IOBA 1KMCA 4I3HA 3VYVA 2OQVA 5KBAA 2OAEA 5FUWA 4DSTA 4ZD6A 4D3ZA 5JALA 4BB6A 3PD7A 4LDQA 3IH5A 2J9GA 3L05A 4L6IA 1YR8A 2GLXA 2HA7A 2NV6A 4K5AB 1X1RA 3C45A 3LWNA 2O9JA 4E2ZA 3N7UA 3VH2A 1VJ1A 1THZA 3CXUA 1BD4A 1ODKA 1XHLA 2DZDA 1HXIA 1P7VA 1PP4A 4JP8A 2HXSA 5EESA 3RH0A 2XWBF 3OQBA 4EYGA 2B1JA 3G2PA 4DI4A 2JGDA 4ZALA 2PJRA 2C84A 3KQLA 4XR4A 1FMCA 1OU0A 2LUHA 4X20B 3IL2A 3CVQA 4TLCA 4UM9D 1ZLYA 2D4HA 4CT0A 3SDZA 1LQ2A 3LO8A 3TSWA 4AG3A 3CZQA 4QUDA 3HRKA 2FBNA 4LUCA 4PFKA 4UTOA 3VZCA 3DD5A 1X7XB 4NBUA 1YK1A 2E3JA 4P5EA 4FC6A 4A0FA 1B3RA 5JDCC 4N7JA 4EL5A 4EHAA 5KBYA 1Z28A 3RYIA 3PYXA 3FI9A 1UBSB 5BSMA 1USUA 1JG2A 3IHYA 2GRPB 2NPFA 2MSLA 2JBAB 4JJGA 4HMPA 1UJKA 4NS4A 4RF5A 3PR1A 4X9XA 2X6HA 1NVMB 1D0IA 5AQ9A 2W4IA 1PEKE 2Y69E 2IIPA 4BVJA 4K5CA 5K3EA 2KYRA 3MWYW 4Q94A 2ZT7A 2PKEA 3NQ41 4XJXA 2FHSA 5GOTA 1IXYA 1M74A 4G8KA 4BJ6A 5H9WA 1ADGA 1XFDA 1W49A 3JXJA 1E5LA 1P1IA 2JJYA 2ZSFA 1SXPA 2FMTA 2IU3A 1LNQA 3HNRA 4I1OB 4KHPB 3VC3A 4J16A 1IM2A 3RBZA 4PCLA 1JNXX 1K06A 2YZNA 2CHVA 3P4XA 3BBPA 1E58A 3TW6A 5J4HA 1WUKS 3T12A 4ETIA 1SZDA 2QGFA 1MXFA 2JATA 1QIEA 5LLTA 2VXCA 3L7NA 4DCMA 5EWLB 1B1AA 2ZGVA 2ZIEA 3HEMA 2GBLC 4FKMA 2NUAA 3SF0A 4I43A 3AUSA 1DC3A 1IJBA 1PDVA 3DAOA 1KMNA 2XYHA 1AS0A 2JLSA 3OF5A 4MKGA 4RLQA 1IM5A 4UU7A 5IBRA 2EEZA 3ZDXB 3O3MB 2YS7A 3KZCA 2CEKA 3SFYA 2HCTA 4I7EA 4UOZA 4IZ6A 2IF2A 1E98A 2I54A 1EWQA 1D6SA 3WMEA 1R9NA 2CE2X 2J3MA 2ZRNA 1U0RA 5JSUA 1YZKA 3MRTA 3ICPA 2YQ8A 1MAVA 1QIFA 3HBMA 1IH8A 2A67A 4GOOD 3IJPA 4L4YA 3WLOA 3OH8A 4PN3A 5DNUA 3G68A 3MV2B 3TIXB 3FTSA 4UXJA 3JQBC 5H3HA 1DEHA 1DQRA 1RFLA 2P4HX 2O7QA 2Q4DA 4URHA 3RV4A 2ZKLA 1XVTA 4F04A 1L7PA 4A6XA 5DNVA 2I87A 1CFZA 3W2FA 2PS3A 2C1XA 1KQFA 2W2LD 3NT2A 2BBOA 4HQRA 4COKA 3FW1A 1T5TA 1ZVMA 4EI7A 3NI2A 4FWBA 1VJCA 4YGYA 1PV1A 3N2KA 2XQGA 4FQ5A 4PLTA 3TZHA 1VMAA 2QTRA 4UQLA 2XHEA 2BUCA 1XPOA 3W2GA 1OILA 4DR3B 3HG7A 4OGLA 4WKBA 3W6OA 5HE8A 4FSHA 2O2YA 3STUA 3B70A 3KKKA 4C0KA 2VNKA 2QAIA 3DH0A 4L8WB 5MFZA 1N9GB 3DEFA 1JHZA 4K6MA 4OQPA 1O89A 2J8SD 2H2DA 3LUJA 3L9XA 1G3MA 3KJIA 1VCNA 3NHAA 4XPZA 5BUQA 5KJFA 1WBDA 1ZMRA 2ZE8A 4KL8S 4J1TA 4I4CA 4HB0A 4NNPA 1GV1A 3RVKA 3AERB 3F6BX 3OQ1A 1PQWA 1V2HE 5LDHA 1WCV1 4JWTA 4UTNA 2NZUG 1N7JA 2DUUA 5CRUA 4JC5A 1OXTA 3H0EA 3GRCA 4Z99A 4D9IA 5ALDA 4A1SA 3RRNA 3IAM6 2Q0SA 2XWSA 4GF5A 4O4JB 4BGIA 1PR5A 1G98A 1TO1E 1GLNA 2OV1A 1TK2A 5J08A 3WRXC 1XRQA 1YZ3A 4B5LA 1SVIA 4S12A 4B5KA 3OECA 5G53C 3IAXA 3KWMA 1FT2A 3U1TA 2PA0A 5IW8A 2EQ5A 3EW7A 3EHRA 4E4TA 3UFBA 3MHPA 3AILA 1GQFA 2PKXA 4PNPA 4EW3A 2CV0A 3EXHA 4KDFA 3TBKA 1QX3A 4B3XA 3H1FA 1S7CA 3AUTA 4URWR 3N5KA 3TRKA 2HDNB 3D6NB 4ARBA 4E5MA 3GP5A 1IZ7A 3KOUA 2HWUA 3L8MA 2ZDGA 4U0ZA 4ZT3A 5ILGA 3D6FA 4WOPA 1R8XA 2FO7A 2RG7A 4M1OA 5LP6B 4P82A 3DXYA 4I0WB 3EDCA 4N5HX 4TKUB 1U7OA 3S7TA 4ALKA 4EG4A 1WXWA 2F1KA 4I55A 1UZAA 4F9FA 5KNBD 4GPAA 2PBLA 2VQFB 3ESZA 4I4TF 4Z0HO 4YRQA 5A7DB 2O50A 4TTPA 4DARA 1H1DA 5BVGB 3TG8A 3WNBA 5E9AA 5GIPE 3L08A 4DE5A 1BMFD 3ECCA 3SK0A 4EO9A 5AW8A 2J9XB 2OCPA 2Q2VA 2ZE7A 1XYYA 1LD7A 1W4RA 2GVNA 3EZ6A 3IIIA 4DWOA 2HPVA 3A9RA 1Z88A 4FYXA 4RA6A 1EVJA 4PY2A 4BNLA 4FNOA 4CW7A 3BG5A 2B1QA 3D4NA 4HGZA 2PGXA 1D0VA 1M1YE 2WJ6A 2AQHA 3P2YA 4IIYA 4KE9A 3BG0B 1XCBA 2BUGA 2QE7A 3EODA 4L6CA 4W9NA 2VH1A 2C2GA 1T6BY 4DEYA 1FCHA 4B46A 3DBVO 4B17A 5F52A 4Q02A 4WFJA 1U1DA 3OT1B 4J8DA 2QGNA 4BLRA 5G1PA 1NJ6A 4HI8A 1VE5A 1JL3A 5CVUA 5FIUA 3ZCVA 4LVCA 1V5EA 1ZITA 5JH7F 1P3Y1 5EP1A 3O1JC 2Q5HA 3GGCA 3Q9SA 3QKWA 4GOXA 5I9LA 1SW6A 5JCPA 4OGFA 5JZOA 1V5WA 4OYYA 4LN1A 1ZM7A 1DIBA 4L74A 4EHFA 2YBEA 4GGMX 1T2DA 1QHHA 1U0FA 4URUR 3EPHA 2EX1A 1E9BA 1JPNA 3CVUA 1GNPA 3L6EA 1YB5A 3B3AA 1RP1A 1R0CA 2ASVA 2AWIA 4YDHB 3K30A 3UUEA 4NYIR 3HFRA 4RPIA 4Z5XA 3FLBA 4UBLA 3JWPA 3RARA 1ZH4A 4XQ9A 3W8NA 3WWZA 4K9KA 4DILA 5M29A 4GQIA 2I8CA 4RKEA 1DAPA 4ZGBA 1M6NA 5G4LA 1S96A 1RW4A 4JJZA 1GUDA 4J43A 4GI1A 2DZNA 1MAHA 4B8YA 2R7MA 1QTIA 4X41A 5COBA 2B37A 3U3ZA 1PNTA 2YHBA 1G55A 3DEKA 5KMGA 2AN3A 4D57A 1GLVA 2D1QA 1C0KA 1YQ9A 2GD1O 1KI7A 3UN1A 3UXMA 4CODB 2IX3A 1Q7BA 3UKOA 1I10A 2HEIA 3D8RA 3UJBA 4ZOAA 3ZK8A 5LCWC 4BC1A 1BDHA 3FU5A 5KWVA 2XV1A 1OCOE 1FZTA 1SHLA 1FW8A 1EM6A 2XMBA 5I4IA 3C7DB 1XNFA 3QU4A 4URZR 4HF7A 3UC9A 2I9KA 3ZHEB 1CWUA 1HZZA 3T5MA 3WGMA 1ZJWA 1DKUA 4Z1OA 2R48A 2JB9A 3TLBA 3AKZA 2Q0QA 2Q50A 4YRTA 5I9SA 4DR4B 3C3DA 3LQRA 1GAWA 4BSXA 4D26A 2HMVA 1Z4MA 2WHEA 3B7PA 3PX3A 3QVVA 1P9WA 1QIDA 4UBKA 4DLLA 3C6QA 1LTHR 1WMSA 1UXJA 5JCOA 4QOIA 2H1HA 1U5BA 2E0IA 1DB3A 1W5TA 2QENA 3OG9A 4J2HA 2VJYA 4UASA 4A16A 4BUCA 1U04A 3DTYA 3JVDA 3LA6A 5CT6A 1RNLA 4EGJA 1P17A 2O19A 4MWSA 1ARZA 1ORWA 3QBVA 4TV8F 3MCTA 5B4TA 2BUAA 2GTPA 3GGJA 3PSHA 4XCXA 3L07A 1U3DA 3CHOA 2AH5A 4G5SA 1T4MA 3S2YA 4CRWB 3HKDA 1NWHA 2XVYA 3EK2A 2PMWB 4H1WA 1KFEB 2X8LA 3AEZA 3S28A 2EFEB 4IEIA 1G8FA 1J8MF 1M76A 2O3QA 2WEKA 1D4ZA 2CGEA 2OECA 4KAAA 4KFUA 4QPZA 3TAUA 3WGLA 5B64A 1CZKA 3MRVA 2GPAA 4CG0A 1YACA 1E9VA 2HHHB 5JEDA 4JHJA 4L02A 2QYSA 1IZ8A 4TT3A 5AVJA 3V33A 1SD2A 3SLRA 2R59A 1HO3A 4TWBA 2A1UB 4TWIA 3HR4A 1GDHA 4UREA 4YO7A 3AG4E 1EZ4A 2FRDC 2YZGA 2YJTD 5DN6A 1OOEA 4O2AF 5FL7A 4GM0A 2HGZA 1MOPA 1SUPA 1Y3DE 1C7QA 2QE6A 4Q4DA 4LNUA 2JFXA 3T9EA 4NPCA 2HQ1A 4A2WA 1NMYA 1SC3A 4QGHA 4EHHA 3FHEA 1UKEA 2O2SA 3MCUA 3OQVA 4M8KA 1T26A 4ZDIA 4P4SB 2I6SA 2MINB 5KWEA 4XQCA 1SGWA 3SKYA 1EFVB 4U7DA 3UFXB 4II2A 2I2AA 3SYRA 1R00A 1XC7A 3IILA 1EX7A 3W5IA 1GZVA 3AYZB 3CW2A 5K0NA 1OVGA 3GCXA 1ZD5A 1ZGHA 1ZN9A 1ZRNA 1BAPA 2I65A 4FZVA 4ZA2A 4B6SA 2W0MA 5IMSA 3D3WA 1TJCA 4IKEA 4PICA 1T36A 2WG0A 3A2LA 3ZIAD 1P0IA 2YS6A 4MRVA 5WRFA 1KDRA 2ICAA 5DXJA 3R9IA 1TADA 1R2QA 1JR3D 4HGRA 3EHQA 3THXB 1TM3E 3DWLG 2DPGA 1C7IA 2WT4A 1OGYA 1MP0A 4FEYA 2XQJA 1MVOA 1HG1A 1X9GA 2QMZA 5F7JA 1XJ0A 1EFCA 1M7HA 2QRNA 3AZOA 1E3WA 3T06B 3VU9A 4A1FA 1ZLXA 3THWB 1CVIA 3RFVA 3NPAA 4JP3A 4B75A 4M0PA 4NESA 4UDOA 4B0PA 4B4KA 3PR3A 1EPUA 1NTOA 4KK3A 4OEHA 5F64A 3T3PB 1VI6A 2QL9A 1HXHA 2ZU6B 1E61A 1HSOA 2Z58A 4DPRA 3RS5A 5LSAA 3CPEA 2AI3A 3CK8A 3CRZA 3EGDB 3RS7A 4AN1A 2Q0HA 3N71A 3K1AB 1N0QA 1CE8A 5E6RA 2L6JA 3ILVA 1NNSA 3U13A 1R6VA 2I6QA 2KHZA 1M2VB 4KCGA 4EP1A 5LQNA 5ICGA 1BQEA 1M6VA 4C0XA 4DGQA 1VIDA 3U2QA 1I7QB 4YRSA 4WWNA 1CZRA 1HORA 2WZCA 3H87A 3P20A 4E2YA 4FGUA 1OYYA 4JLKA 3LKBA 1E8OA 4IF4A 1BOOA 4NBTA 4MVCA 4RPLA 1CQJB 5K4AA 1GPLA 3LQ1A 3GRFA 3E3AA 4OAUC 2BLNA 3KV3O 4D8XA 5DPMA 2N47A 2HO4A 1XZGA 3A31A 1MC1A 1PGJA 1TM2A 1V6AA 3K5PA 3AOGA 3SEQA 2IYXA 2ZWOA 3OZDA 4B81A 3PUYA 4DC0A 3K09A 4XH9B 3EPPA 4EKGA 3VNAA 3PEVB 1IOZA 5JBNA 1FU7A 3I72A 4QRIA 3U9TA 2EG9A 2Z2YA 3RK6A 3K8ZA 3LUKA 3F46A 1KQNA 4B31A 5AW7A 1NGSA 4LCBA 4UE2A 5FBZA 4AMYA 3T99A 1JHDA 3U7QA 4CFZA 1IEWA 2CBGA 2X23A 1XG5A 3GCDA 3IJ5A 4R0NA 2H6FA 4A9AA 4CMIB 4QSMA 1ZM9A 1UM8A 3CRW1 5KVVA 4MP8A 5J2TB 4ITVA 2CB9A 3EAFA 5JROA 1Y1LA 1G59A 1CYEA 5CFOA 3S0JA 1K3TA 3BA6A 4CKWA 2WWGA 2BJWA 4RCVA 5JMPA 3R3UA 1G21A 4MKHA 1NT4A 1YVRA 1E62A 1ZC4A 1X19A 2I76A 3HYMB 2OO5C 5E7IA 4ZHQF 1P29A 3A6PC 2I4NA 4X6LA 3DBOB 1PX0A 2ZVPX 3FCUB 3J5PA 3P9CA 1E8WA 2NXWA 2VHYA 4H7PA 4HRYA 4L4UA 1N78A 4OHVA 1NYQA 5KU1A 2X7XA 1BJRE 4X93A 2C4VA 1I0ZA 3BIOA 4QXMA 4B93B 4XD7A 1E6CA 1YFLA 3AI1A 3P9ZA 1A8HA 3HVKA 4QPCA 4R2JA 4KQWA 1GYRA 3D9KA 2JGJA 1FXWA 3V8QA 5G4KB 3VR3D 2VSOE 2G06A 4TRRA 2KJZA 2Y27A 1OY3D 4OXRA 3E9QA 4M1YA 1ZISA 1V41E 3WLAA 1A8SA 2Z30A 9ATCA 3WJ1A 4ZXFA 5DX1A 4XVUA 1V8ZA 1JZSA 2NO9A 4WK0B 1SN7A 2ZAIA 4E3WA 2Q3DA 1UPFA 4QNNA 1TJ4A 2PU5A 4RYDA 3EMDA 1BVUA 3H7IA 2WSYB 4NICA 1QH0A 5ECGC 3U4GA 1HLDA 4CR7A 5B6IA 8GPBA 5IXSA 1T2UA 1ISFA 1Q1QA 4IIXA 3SMQA 4ERXA 1S89A 4IDNA 3IEMA 3CEQA 2DY0A 1PU2A 5A4IS 1Q12A 3WGKA 4EW2A 1T4CB 3O47A 3KXIA 1YS2X 4DMFA 1PJSA 1LKZA 2ATIA 3R9MA 3EHNA 3KDPA 2OBMA 4CDGA 3CZPA 8ADHA 1SR8A 4KOEC 2QMQA 5LZ9A 4ZI7A 3ML8A 5KNBA 2ZRPA 3F8TA 4HDAA 3N2EA 4I3FA 3PEYA 3VU9B 1YJCA 3DTNA 3T1HB 4RSYA 2PUFA 2JIRA 1YQXA 5ED0A 4E2FA 2IJGX 2PH3A 4A1GA 1X8LA 5FTLA 1GY8A 1C3LA 2Y4UA 4GYJA 2YINA 1E2KA 3FI0A 4HAYA 4H1TA 1BYIA 4QVGA 4A0GA 5JY6A 1D2AA 5G0VA 1VE7A 2HW8A 2JA1A 3ZYKA 1HG0A 4X7MA 1G8JA 4UEJA 4XW2A 1J33A 5A4KA 2DKOA 1CE8B 3GRUA 1CUWA 2FFHA 1KYTA 2OP0A 1S1MA 4E5NA 2VPIA 3T3GA 3FUVA 1QO0A 5KSZA 2VQ2A 1XWWA 1C29B 3B1XA 4QQKA 2JZCA 2IVFA 3KUUA 4O2BB