4AY6A

Human o-glcnac transferase (ogt) in complex with udp-5sglcnac and substrate peptide
Total Genus 257
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
257
sequence length
717
structure length
698
Chain Sequence
b'SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYLTRANS F
publication title O-Glcnac Transferase Invokes Nucleotide Sugar Pyrophosphate Participation in Catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 257
structure length 698
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ay6A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ay6A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4ay6A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4ay6A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ay6A03
3TG4A 1SXQA 2GW1A 3URZA 4AY6A 3MRTA 4O6FA 1RZUA 3U3WA 4UQZA 4U04A 2AMVA 3SYMA 3MTBA 2AVPA 3UQ3A 2PZIA 1A17A 5LCWC 3MT9A 3TG5A 5EKQD 4BT8A 4X7MA 4CTOA 2DBAA 4G2TA 2UY1B 3E3OA 3T3GA 3O48A 2OOEA 3RJVA 4NEQA 3S7DA 3T3HA 3ZN3A 2VCHA 3ZGQA 3EDTB 4RIFA 2QFCA 2GM9A 3MA5A 3QHPA 5HXAA 3CX4A 2KCKA 1P2DA 1QM5A 1NA3A 3S0JA 4ABNA 2VGXA 2IV7A 5EX3A 4M83A 1Y8ZA 3LY8A 1C8LA 3KS2A 1Y6GA 2LSUA 5ENZA 2V5FA 4GZ5A 2FI7A 5C1DA 1KT0A 3FROA 3ZCRA 2QLNA 3RT1A 1FU4A 4KQ2A 1UQUA 2HYZA 3Q49B 2ATIA 3S7JA 3DZCA 2GPNA 2JJMA 3ZCVA 2YQ8A 2FETA 4LDPA 2QN2A 4WACA 3DD1A 3CK7A 2IYAA 5I45A 1FA9A 2BGTA 1FS4A 2VG8A 1HXIA 2GT1A 3O3CA 3BCRA 3HBMA 3KAEA 1E1YA 1P4HA 4A1SA 3CEMA 3LY9A 3GPBA 3LPZA 1AHPA 3VUFA 1B89A 4UI9J 3Q47B 1XKXA 4N2QA 1GPYA 1FTQA 2UY1A 1C3JA 2FF4A 1JIVA 2PL2A 1UZUA 4M60A 4WNFA 4N39A 2IEIA 2KS6A 1PN3A 5FZSA 4N2SA 2SKDA 2ACVA 5HQ8A 4I2ZA 4MI6A 4UI9K 5KJKA 3NC4A 2JLBA 3IA7A 1JG7A 1XNFA 2H1HA 4AY5A 1GPBA 5BNWA 5DU2A 4GZ6A 4EJ2A 2QZSA 3FFLA 5HI7A 4MI3A 4G1TA 1NLMA 2KATA 4UQYA 4YNDA 3HBFA 5ARFA 2Q7FA 3NCHA 4KXKB 1BX3A 3ASFA 5DXFA 2QRMA 4X7RA 1P2BA 3LKUA 4EQFA 3SYRA 4I9EA 5BT1A 8GPBA 1WM5A 1HZ4A 3UPVA 1Z8DA 5JJ7A 5JJTA 2QN9A 2LSVA 1SXPA 1FU7A 2WPVA 2R66A 3BEEA 1WUYA 1YA6A 1KTIA 4WNGA 1EM6A 2X6RA 2KCLA 2MHKA 4GZ3A 5D0OD 3SZ7A 4Z5XA 4G26A 1Y6FA 4KQMA 4KYOB 4WUYA 4I2WA 1PYGA 3RO2A 1JIUA 2QNBA 6GPBA 4UI9C 5A6CA 1ZBPA 3MTAA 1K06A 2PRJA 3ASGA 2XGSA 3E3LA 3GUHA 3NB0A 1P5QA 3ZCPA 3OTIA 3MTDA 3H4TA 3CVLA 3HYMB 4ME2A 1FC0A 3KD7A 3S7FA 2VSNA 2SKCA 2Y4UA 1OUVA 5FZRA 3OXGA 1NZFA 4B94A 4BWRA 4REMA 4WHMA 1IXYA 5DIZA 4G23A 2C0MA 4RBNA 3K9IA 1HH8A 4HOQA 1JIXA 2AW3A 7GPBA 5FTPA 2AZDA 4AMBA 2IV3A 4CGWA 1ELWA 3TAXA 4EKYA 1LWNA 3BD7A 3VDNB 3WADA 4CTMA 3ASDA 4GPBA 1XC7A 1QZ2A 3AS5A 3CUVA 3RSZA 3RU0A 4XIFA 3QWWA 3VTYA 2GJ4A 3E4BA 3ULQA 2BISA 2HO1A 4KBQA 4YI3A 1WAO1 5D01A 2G9VA 4MICA 2XCBA 4UQXA 2Y4TA 2G9UA 1M5RA 2GEJA 3H4IA 4U0UA 2XCCA 1WW2A 3G2LA 3ZCUA 3UYKA 1NZNA 3VUEA 3AMVA 3MV2B 3MEKA 4GA0A 4F3VA 2QRQA 4HLNA 1VGVA 5DBKA 3G2KA 3NP7A 4WNEA 1Y8MA 2NC9A 1QKJA 2XA9A 5DLDA 3ZCTA 5IKPA 3EBPA 3OKPA 4X6LA 1PC2A 1WV0A 3CKBA 3C4VA 4F97A 5KJLA 3CUYA 3WC4A 2VQ2A 4BQFA 3VDMA 2G9QA 5FJYA 4GA2A 3CVQA 3MQFA 4EKEA 1NOIA 1NOKA 1FU8A 5JTTA 2XCIA 2R4UA 3Q3IA 1FCHA 5FZQA 3TOVA 4L22A 1XL0A 3QDNA 3S2UA 3ZHEB 4FKZA 3CK9A 2F3PA 4Y6WA 3D0RA 3QKYA 1IYGA 2G9RA 2F9FA 3L7AA 4GCOA 3CK8A 5TMDA 2FBNA 4GCNA 2QRGA 4EL5A 1B4DA 2VGYA 3RSCA 1UQTA 4F96A 9GPBA 3CVPA 3JYSA 3Q3HA 3MT8A 3MKRA 1FTYA 3AS4A 3PE4A 3U4TA 4N3AA 4YVOA 3DDWA 3NP9A 3AS8A 3CEQA 3ZPJA 2ASVA 5D0QD 1L5WA 2XGOA 2YJNA 2IW1A 3QKWA 3PE3A 3T3EA 3QWPA 1LWOA 5TMBA 2X0FA 1L5RA 2PYIA 5KJNA 4HOUA 4YI5A 2QRHA 2VCEA 2PQRA 1GGNA 4U07A 4HWGA 2HR2A 1QQEA 5BW8C 2R4TA 3Q15A 4M7PA 1PSWA 4GYOA 3R9AB 1V4VA 3T3DA 2R60A 4FZRA 4XI9A 3MS7A 3OKAA 2H1FA 4WADA 3LYAA 1A8IA 2ONDA 5G05J 3D0QA 3OTGA 2QRPA 4BTBA 4LEUA 3C4QA 3ZHEA 2F3QA 3RHZA 4CGVA 2IFUA 4U0SA 1WUTA 3D1JA 3OTHA 2C2LA 4CTNA 1KT1A 2VYIA 4HOTA 2KCVA 1L7XA 2GEKA 3BD8A 3BCUA 2UWJG 4HOSA 2F3UA 2L6JA 3OKCA 3G2HA 1XL1A 3VTXA 3L01A 2XPIA 3MBOA 2O6LA 1E4OA 2E2EA 4BT9A 2LNIA 3QWVA 2GPAA 3NPAA 5CCMA 1L5QA 4KQ1A 2C4MA 1H5UA 4XI0A 3IEGA 3OT5A 4NC9A 1FTWA 2FO7A 3GW4A 3BCSA 3G2NA 2P6PA 5D00A 4N9WA 1NA0A 1NZDA 4N5CA 2X6QA 5JJ6A 2PQ6A 3MRVA 1O6CA 3TGOA 2C9ZA 3OXLA 2PYDA 4NESA 3MT7A 4H7XA 1W3BA 5G05C 1YA0A 3E3NA 3Q3EA 3G2JA 3Q5MA 3OY7A 4HORA 3T7DA 4RG9A 5FT9A 3ZFWA 2KC7A 3BD6A 3L7DA 1GFZA 3CEJA 2QN8A 5A7DB 2C1ZA 1C8KA 2Q6VA 4J8EA 2F3SA 4N3BA 1JG6A 4GA1A 2IEGA 2JZCA 5JTUA 2BUGA 1NVKA 4J8DA 3GZ2A 3FWVA 3SF4A 5IKOA 4G2VA 1IIRA 2WQHA 1EXVA 2SKEA 1GPAA 2QN3A 4MI9A 3MSCA 3MS4A 5ARGA 2ZB2A 4PQGA 4GYYA 2C1XA 2IYFA 4N3CA 1P4GA 3WAGA 2IF4A 5AYWD 3S7BA 3CVNA 2R68A 5LQDA 3S28A 1J39A 2BFWA 5EX0A 3CEHA 5CCLA 3C48A 3UYLA 1GZ5A 1P4JA 2VSYA 3GYZA 3NAZA 5TVGA 4RIGA 3CV0A 3S29A 4MHSA 3PDNA 3RIBA 2BGUA 2FEZA 3QOUA 1HLFA 2FFRA 2IUYA 2XCUA 4G25A 4IN3B 1L6IA 2X0DA 1JEJA 1L5SA 1XV5A 5M72A 3ZCQA 4RELA 3ESKA 1ABBA 4MRAA 2R5SA 5CHEE 2AV6A 2J9QA 4APOA 2YHCA 3NF1A 4NRHB 4EL0A 2C0LA 4I1AA 1WV1A 4U0ZA 2ACWA 3BEOA 4J8FA 4MHOA 3N71A 2XA1A 3T3IA 4H7YA 2QLLA 4W9RA 3WXXA 3CUTA 2QLMA 2I6HA 2FF5A 1KLXA 4BFCA 4WNDA 4JA7A 4JL0A 1Z6QA 4QLBA 3CV3A 3ZCSA 4NQ0A 2GPBA 1GG8A 3LY7A 3MV3B 1WW3A 4YVQC 3HBJA 2PRIA 3FP3A 4I17A 1TJCA 1XOIA 1Z62A 3CKCA 3Q4AB 3T5TA 2QN1A 5G04J 4AIFA 1L5VA 4F9FA 2PQNA 4RIIA 2XGMA 4LEIA 3G2IA 4RIEA 3MRXA 4AMGA 1RZVA 2P58C 3L79A 1F6DA 1P2GA 1P29A 3OY2A 1IHGA 1C50A 4JA9A 2WTXA 4BQIA 1ZU2A 3L7CA 1NOJA 3BDAA 4W6QA 5LCWJ 4I9CA 4J0UA 4GPKA 1Z6PA 4JHRA 1F0KA 2XA2A 4RG6A 4AN4A 5KJMA 3TSAA 1E96B 3RO3A 3COPA 4BQEA 3UUXA 3DDSA 1RRVA 3RKVA 3CUUA 4YUAA 3GZ1A 3LCAA 1K08A 2ECPA 2XMPA 4RENA 4G24A 3HBNA 2X0EA 3S27A 1ELRA 1PNVA 4X7PA 4GYWA 3ASHA 3EBOA 2VGXB 5GPBA 2HY7A 2XEVA 2QN7A 4CDRA 3IAAA 3L7BA 1YGPA 4RIHA 3CUWA 5TMEA 2OFFA 1AXRA 4AM9A 3MS2A 4BTAA 3OXFA 5G04C 4Y6CA
chains in the Genus database with same CATH superfamily
5ALTA 4LGCA 4ZYXA 1X80A 4TYYA 2NSDA 3VTAA 1MOQA 3MA0A 2NACA 3PNLB 4DXDA 2I7DA 1GG9A 4YH1A 3IEXA 4E08A 4LMPA 4GC9A 4GUDA 1PJCA 1NT2A 4GTOA 3NTXA 4JI7B 1KHTA 2PXXA 3LX4A 4JGGA 5I48A 3DE3X 4DT1B 3F4LA 4IEFB 5FOQA 5KBYA 4LYHA 2FOLA 1K8ZB 3TH5A 4O2AF 1WAMA 1LI5A 3KEAA 3UANA 1E1RA 3K0HA 4CT5A 4S3MA 1P33A 3DFZA 5EHQA 4Q7KA 1Z29A 4EHLA 1S3FA 2B6CA 3TKYA 4B76A 2WHQA 3VO2A 1GRNA 3MLBA 4X6YA 4N2SA 4EUNA 1LV8A 3AUJB 1Y9AA 3IMCA 4X66B 1Q1QA 3QEOA 5HTKA 4KVOA 4WZBB 4XB1A 5GV7A 2QY9A 2WSSA 3GYBA 4F5ZA 3AHDA 4RNCA 4E30A 1KTIA 4MWDA 2O57A 2HMSA 5A7HA 2OCLA 4U6SA 4IX9A 4TS3A 4X1YA 1A4IA 3WLSA 1X3SA 1GLGA 4F38A 4NBUA 5JHHB 5A4FS 3DSUA 1HO8A 4O4HA 2BIFA 2Z56A 5E9WA 2PNJA 2IV3A 4C6TA 3PEUB 2JFPA 2JZNA 4A15A 3QE3A 4XWYA 3GUVA 3EMDA 1MIHA 4FLHA 1VGQA 4AZ3A 1Z5UA 2I55A 2C2ZA 4ANUA 2BISA 4KYVA 3U49A 2IIVA 3H9BA 4QSHA 3HM2A 3VUEA 5BMOA 3O92A 4CKYA 2Y1WA 3I61A 4U2KA 5B1SA 4CMGA 2BFBB 4R8KA 1TI7A 5D87A 4PF1A 3P2IA 3B5EA 4AYWA 3OIFA 1E77A 2B20A 1ZOSA 3GX1A 1FNDA 1WY7A 1Z5OA 4MCJA 1DZIA 2GXQA 4GE3A 4YDQA 4YGXB 1P9NA 3W2HA 3KR9A 3U9SA 4PC2A 1WOYA 5EUCA 2P9CA 4Q3DA 4LSMA 2Y3AA 1EP9A 1ZBDA 3NYRA 3D9NA 3GMIA 4BFRA 3L7OA 3SO8A 3KTFA 5EL0A 2W2NA 2XZTA 4PN3A 1QRDA 1YS7A 5C1IA 2A0XA 4RJTA 5PNTA 2VZ8A 1KR2A 2G7MC 3EQ8A 3QX8A 2X42A 5DN6D 1YRYE 3HJNA 3ZDCA 4YT8A 3IUYA 2IDMA 3STYA 4F7DA 3C3CA 4MH0R 4BUJA 3L43A 2OP0A 2CE2X 3PPWA 4W8HA 3VOBA 1TM2A 1ZG3A 1RXVA 2UXDB 1SRQA 1ZJJA 2QZJA 2PLNA 4EFNA 2XMSA 4Q6WA 2H9AA 2C31A 1OLXA 4LWZA 3HYRA 1SWVA 4TSFD 4FHFA 1KA9H 3CVXA 1GT6A 4OHCA 3FVRA 4EHJA 2X9QA 1UP7A 4J0QA 3OZXA 5EYPA 4IFEA 1O5MA 3SZRA 1SBQA 2ZVJA 1KVUA 3PEYA 3CMMA 1YE5A 1VL6A 2P9NG 5CU7A 3ISTA 3UKRG 4MKGA 4GR5A 2H11A 2YHIA 3TZCA 3BU8A 3E35A 4A03A 3D9MA 2XB9A 2FUG6 3UKOA 1GRRA 1Y8RA 2PGDA 2VYND 3G1TA 2YV5A 2IYEA 3DLAA 1FQKA 1NM5A 3AESA 3MGCA 4FFPA 4MHTA 4WXRA 3FPJA 2YJ4A 2QXTA 1QYIA 1VOTA 4HYEA 5DXJA 4KX5A 4HBGA 4YDHB 2MDTA 3U4QB 2O0MA 2QTVB 2ORYA 3FRJA 3RYCA 4ILKA 2FFHA 2ZRGA 3LCAA 4MQ4A 3FPGA 3IB3A 3F49S 3GCWA 1PT6A 2A14A 4MQEA 4LOHA 2Y66A 2PUHA 1DV2A 2WHXA 4Z86A 5ALJA 3Q8XB 4CMEA 4RM3A 3EDRA 2ZI6A 2Q0QA 3HABA 3I09A 1JB9A 4BO7A 2FJEB 1YZLA 3P2OA 3LOQA 3AP1A 4NSNA 2C2BA 3HKDB 5DBGA 3V8MA 2OOEA 2L17A 3DE7X 5EOVA 2B4TO 2CL5A 2GM9A 4HYYA 3CZ9A 3B7BA 1ZB1A 3GBPA 3Q6IA 1LBEA 2WIKA 1CY8A 3DONA 5AUNB 2FZGA 4UBOA 1JQDA 4G11A 4HRLA 4MWBA 3DOOA 5I45A 4DM4A 2QYOA 1UDXA 1ZK2A 1EG2A 3M6WA 3EUAA 3KEMA 4J7AA 1ULHA 3DVAA 2FSVA 2PR7A 2Z3ZA 2X6KA 1GGVA 4L0MA 4CW7A 4DLPA 2PT5A 5HI7A 3VHLB 3IBFA 3OPYI 2LAHA 3QVOA 3Q3GE 2Y1LA 1XRQA 1W1IA 5JCPA 1LVUA 4JYPA 3ZV6A 2NXEA 1GTG1 4NE9A 1VXOA 3DHWC 3GUHA 2ZI4A 1PR5A 3M49A 3BL5A 4M1ZA 5THKA 2QJTA 3UATA 5HWSA 4P2BA 2BKUA 1W76A 2TSYB 3FCEA 3LUCA 3NHRA 4CYMD 2H4FA 3LOUA 3OX4A 3CF2A 3C6ZA 4BRUA 3O5AA 5G4KA 1QP0A 4L4XA 1TLLA 4GA0A 5K4GA 2BGIA 2E21A 1YSCA 2HJSA 1E5QA 3SQDA 4DB4A 3HJUA 1DFGA 3RBAA 4ZZ2A 2Q6TA 2ZFUA 3PCRB 1CUXA 2I1VB 1S64A 1VHJA 2EARA 1C3XA 4MWZA 2XWPA 3AFNA 3KPUA 5ENDA 2PQ0A 3VO8A 3ZEAA 1RAIA 3Q2KA 1C3VA 2VAWA 3PC8A 4Q9LA 2VJQA 2PLWA 4EZEA 3TSZA 4JFAA 2ZI7A 2XD9A 1V54E 4R1QA 3LPAA 1I5EA 3UUWA 5GIPE 3IBEA 4EAQA 4GWGA 4NMXB 3CW9A 2AMYA 3R7NA 2GESA 4LRZA 2VTKA 5K0ZA 4FK8A 4ZVPA 4FP9A 1WE2A 2IFUA 3UPTA 1CUUA 3HS3A 3ZD7A 3SN6A 1M10A 2VSXE 2DECA 1G5RA 5H5JA 2VTVA 1U7DA 1UZMA 4XWTA 3IXEA 3UK1A 2CLHB 2W9JA 4M46A 4H7PA 5E9AA 1WZCA 1GTRA 3PTAA 2O7SA 4MDHA 5DYYA 2WYVA 3F5MA 3TRFA 1R16A 1NJ5A 1UC9A 1PFWA 2C1ZA 1EUDA 4N3BA 1I9GA 4TV9A 1XG5A 2SKEA 3PUYA 2C83A 4COKA 2GPSA 3VJMA 1B15A 5IBQA 1G41A 1H8HA 3EGDB 1R00A 2VPIA 5A4DA 3H5OA 2IUYA 4CETA 5KYXA 3KKNA 4WXEA 4TTVA 1NXXA 2PK3A 2CDBA 1LZLA 2FCAA 1WS6A 1EYHA 4KVGA 1G6HA 3KEFA 1OREA 2WA1A 2ETAA 2B83A 2R1VB 1Z2OX 1H6BA 1N9ZA 1OXXK 4ONEA 4DX7D 3EG9B 2QN1A 2QR2A 5JO0A 1KERA 4TUMA 2MSNA 1N6OA 1ZCZA 4Y1RB 1H6PA 3D7NA 3COVA 4MRNA 3ANSA 2F17A 1I3MA 2XT9A 3TNFA 3NT4A 3I6BA 5C8YF 3K6RA 1UF9A 4KE6A 5EHNA 5B2ZA 3IXQA 2W93A 3HLYA 4JJ7A 3HXBA 3D7SA 3HN2A 5IH3A 1E3WA 1U7WA 4X97A 2YHAA 3LPLA 1J1ZA 3NHSA 4ND4A 2X0RA 4OVVA 4K88A 2CHUA 1V8BA 1A17A 3J5PA 3E3OA 5EESA 3BK2A 3S7DA 4TLMB 3EDTB 3GFQA 2HRDA 2JAPA 1P2DA 5IAAA 3L07A 1SZJG 1AM4D 4D97A 5DM1A 2O8FB 4TQGA 3TQQA 2HZBA 2HF8A 2O2EA 2BFOA 3RK6A 1LLUA 2JJMA 3S2IA 4A4DA 3DGFC 4KSBA 5DJ5A 2A4ZA 3AKYA 3PNMA 4HB5A 5ED0A 1T2AA 2ERXA 3N2ZB 3H2BA 3KYIB 1OZAA 4J3JA 4M1YA 2FFJA 4WFKA 1OD6A 2HN9A 3V1NA 3U5ZB 3K0SA 2ZIVB 3BXEA 5GVSA 4MI6A 4I6JA 1OIWA 1Z3CA 4QPPA 1BW9B 4G1TA 3HBFA 4D9KA 1SKAA 3O21A 3EFOA 4RFSB 2Z58A 4GMKA 2CUTA 3MGKA 1RNLA 5J5CA 3GIDA 1RKVA 3L8CA 1ORWA 2AG5A 1RYZA 2XLBA 1MV5A 1X1QA 4IIHA 1GUFA 4YROA 1TQ2A 5EWLB 3FDHA 3M81A 4P3NA 1X70A 3HRHA 3DOIA 3GFGA 2ZXWE 1VQ1A 4KO8A 2NP6A 1NBWB 2BM9A 4HVBA 1XJWA 1XZKA 2HIHA 1XMPA 3G82C 3TAHA 5K7SA 4XPIB 3EU5A 2YRFA 2CSXA 4BFVA 1VPWA 1W87A 4XUCA 4FQ5A 1JHQA 4JMPA 5BWOA 3H8SA 1AQYA 3ZY4A 5ALFA 2ADMA 2XXAB 2KJQA 1ESZA 2O7RA 4G1FA 4KMOA 4XQ0A 3FAKA 2R7LA 4KOAA 3DHVA 2LDXA 4KDEA 3P20A 2IL1A 3MF4A 3OMLA 4ZYZA 1C1DA 3SBEA 2J4BA 5MGNA 5EE5B 1FTYA 1STOA 1D8DA 3R6LA 5KYTA 5C5DA 2IW1A 3ZE0B 3FLEA 5JBIA 3FWHA 4GI3A 1J09A 4GICA 4KFSA 3E5HA 4RD6A 3HXEA 5AARA 5EXSA 3U0BA 2FSPA 4EA7A 4V1CI 5KVSA 2MTBA 1QVRA 5ES3A 2FWAA 2WJVA 3L41A 5INTA 2QVBA 5LD2C 2ZROA 5CMLA 1YU6A 3JALA 3RHTA 3ZCXA 3LLCA 3ESBA 4II2A 1Z0UA 4MZXA 1GKLA 1AB5A 4B2PA 1E92A 3PVCA 2FKAA 4KDFA 3MMSA 1U7OA 2W6ZA 2X1LA 1FRFS 2JGIA 5DT9A 1NZDA 3N2GA 1TO2E 5AOXA 3UTCA 2AFHA 1CRPA 2VJNA 4RC9A 4OEHA 1N5MA 1X39A 4L0QA 5AW9A 1TYQG 1S8NA 3E3AA 4YIHA 4UAVA 4D3YA 5CEFA 3G02A 4CDMA 3JXEA 1ZYUA 2VWGA 1E90A 5C3UA 2NV0A 1GLNA 2BL4A 4FEGA 3DXFA 1O97D 2XUQA 1KSFX 2YIDA 5GWXA 3QJGA 3PV0A 2Y8EA 1Y8AA 1CQZA 1E3IA 1Z83A 3ES9A 1PY1A 2QR3A 1CUDA 2O52A 1N2CE 3QJYA 1YMUA 4KSCA 1N9GB 4DYDA 3HC7A 3PD0A 4UE6A 1E94E 1W88A 4U0ZA 2MSLA 4A5SA 5FFNA 3UKUG 4W5NA 4OSPA 5B4VA 3I2HA 3FMGA 4UVGA 2JFWA 2FI1A 2AQHA 1ZLYA 1U1DA 4KRYA 2E89A 2NU9B 2QD5A 4GWKA 1LD7A 1YZHA 1Z0AA 1BCSA 3VH4A 3JD4A 3OLZA 1IBLB 2OGWA 3V8VA 2W37A 4KBYA 1A82A 3FJOA 1NOJA 2WKSA 4XX1A 4YC7A 1IPHA 5CXUA 5DISB 4WT7A 3DDOA 3GYXB 2ZRIA 2HDOA 1XN4A 4MVWA 1U8UA 1I8TA 4DI4A 4NZYA 4B6SA 2P67A 4DMGA 1D4AA 5FQ8A 2FKNA 3K9WA 1X0XA 3BF8A 1U4SA 1E7UA 1SBHA 4C01A 1HURA 3AF5A 3CCCA 4Q9HA 4DC9A 3IQEA 4YMTA 3RW9A 3GUUA 4AF8A 3WXBA 4R3UC 5JCJA 1D1QA 2P5YA 2AFIE 1MB4A 1Y5RA 1SOVA 1P9LA 4OV6B 3BGWA 5E0KB 3KJGA 3TMAA 3KS2A 2GK3A 4EJSB 1DCQA 2GK6A 5CK5A 2B99A 4CLXA 1YZUA 4DV2B 3WAKA 1BGVA 3MJEA 2PL3A 3VDQA 4AN0A 2QV0A 4HQRA 3NFYA 2C3PA 4EUSA 3CHPA 3C8UA 1XTTA 4FMDB 4O59O 1FNSA 2J4CA 4BPRA 1DSSG 4AJNA 4AOFA 5EE0A 2VHWA 2FP4A 3UV6A 2DB3A 3DB1A 5CW2A 3C5RA 2QYUA 5HQ3A 5HQ8A 4C78A 6LDHA 4AB1A 2FVXA 5AUPB 4BESA 2G40A 1U63A 4ZT6A 2PSHA 5F1PA 3UJHA 5C31A 2CYAA 2PV7A 3S2EA 4INAA 3DOUA 5B1HA 3RT9A 1HDIA 3K6KA 5U4QA 3NOXA 3PQ8A 1JKXA 2D0OB 4WUYA 1YKFA 3TLKA 5EJMA 1FRZA 2R00A 5A71A 2WMOA 2I67A 3TJMA 1VSUA 1EHIA 1D0IA 2CNWD 4L4SA 3NOCD 2VSNA 2JJ1A 4RYLA 1L0BA 4JVSB 3K9IA 1O5OA 4Y6OA 4YAOA 5BQ5A 1WUIS 2YXLA 3TTWA 1DV1A 3O2NA 1IQ0A 1A9RA 1JR2A 4EB3A 5ANRA 3EWSA 2AE2A 4G6ZA 3CINA 3T7JA 2WWTA 3JQEA 3LDUA 1QGUA 3UXMA 2O8DA 1JLLB 3PFCA 1DRJA 4CQLB 3L6CA 2NO9A 1UC8A 3G2KA 4LVUA 2IOLA 3A2MA 5JD3A 5T3YA 4MLPA 2L42A 4W5OA 1KZ4A 1PT7A 4GPZA 2B92A 2V4LA 3QU2A 1OFVA 3SZOA 4O4LB 5ALUA 2GEBA 4BBJA 1F2DA 3RYHA 3BT3A 1WU7A 3C3XA 3N0VA 1YQ9A 4FE7A 2AL7A 1QHFA 3QLEA 1PL8A 3G2QA 4BEJA 4J07A 2ZE7A 4BWGA 3AS8A 4JEUA 1MU0A 3H2IA 4MROA 2X7JA 2IITA 2FSFA 1NBAA 4RTNA 3H8JA 4S12A 1THMA 4C2BA 4F4UA 2HT6A 4ITVA 2ZJ8A 1H2AS 2Z6VA 1TEXA 1PGJA 3B1KA 1C1XA 4NNJA 1EZ1A 3FDZB 3JWIA 1YQUA 2FWMX 3LRPA 2Y2UA 1F2VA 5ANLA 5GOZA 3B53X 1N5LA 1Y4ZA 4X61A 5HIAA 1RWNA 3V80A 3ZDDA 5JJKA 1X86B 3W2EA 2GK4A 3O8LA 3GF4A 3E2IA 4RA6A 3HCBA 2XSZA 3RVJA 1QFZA 1GL6A 2VHYA 4LJ6A 7MDHA 2GRNB 3L8DA 5IKOA 1H23A 2I7CA 1WMAA 5LLSA 1S2GA 1BLXB 2IJGX 2QQFA 2ET6A 3ZVVA 4YIKA 4R54A 1R18A 1P4JA 4C6RA 2N47A 3R3HA 4UUNA 2C96A 2HAEA 1T9DA 3QH4A 5BQFA 4AUEA 1ZESA 5D7BA 3O8BA 4JVLA 3CRZA 1W7AA 1U6KA 3ASZA 4D3ZA 1DCKA 2SICE 5J1SB 3UA3A 3PR2B 4ND8A 1XQXA 2QUBA 1D3AA 2W58A 1OILA 1N0WA 2BHNA 4CGYA 2YFHA 4GI2A 4LRTB 4WBSA 4PFSA 1ZIYA 5CMWA 1TQHA 3CIAA 1Y3AA 4ZAXA 2IW3A 2Q8PA 3IT3A 4JBNA 1HKHA 2UZ0A 2Y1FA 3HCDA 1L7AA 1T4CA 1BGWA 2D4AA 1YZQA 3AERA 1POXA 1XVVA 4C07A 5AW8A 1M0EA 3WLTA 2DG2A 1NR5A 1LD8A 3UAGA 2D62A 3M33A 4CMIA 1OXMA 1ZVKA 3LLUA 2XTMA 1NXSA 1MOSA 1GZVA 3CSSA 4E3WA 4OH1A 4RMHA 3O8OA 3AM1A 4I50B 4ZDWA 1WMEA 1J9ZA 4WLUA 1BS2A 1YC2A 2A5DA 1RKQA 2LRHA 4WK0B 2VJ8A 4J0KA 1MD9A 5HVNA 1RC8A 4EJ6A 5D3ZA 2PTGA 1D7OA 5E1DA 3HU5A 2HKIA 4GLJA 4JD5A 3ELWA 5JS7A 1NAHA 4MV8A 4YBRA 2RG7A 3WNCA 1R4ZA 1O4WA 2G82A 3ZTYA 2FZLA 2JL1A 3DAFA 5JCOC 2YIVX 2OHFA 4L3OA 4UI9K 5T4YA 4TTJA 1KFKB 3ANLA 3WHPA 3PKZA 2QZSA 4HDCA 3IUEA 3W4JA 3NCHA 4YP0A 2GAAA 2W2MA 5TEVA 5BN3A 2LCIA 4CL2A 4B3XA 2PT7A 1JCRA 1WSBA 3EVGA 1MEEA 1QVZA 1T4BA 1G2OA 1ZXBA 3IIKA 5CB6A 2IXBA 2GGSA 4EHIA 1FT2A 4HUQB 4RK6A 1JYEA 2HI0A 4B80A 1DQNA 2RC6A 1UBOS 4KQKA 4XR9A 2B5WA 2MYTA 4DNPA 3ZEIA 3NYQA 4KKVA 3RG8A 1YC5A 1AKRA 2AB0A 4ZGWA 4IWYA 2FPRA 4FBLA 1ITZA 2CHFA 3Q11A 3RSFA 1S63A 4FFDA 1RHKA 1BHJA 1CDEA 4P83A 3MPUA 5EHIA 3Q8MA 4IZHA 4RPKA 3GFBA 2QVYX 4G5HA 4ESHA 3KOUA 5DNVA 5JUWA 4ZEVA 4TN1A 3OZBA 2XUFA 1VBNA 3DOJA 3TWXA 4GA2A 2A2ZA 2GARA 1UBSB 1VG9B 4EHNA 6Q21A 1FCHA 4BN0A 4P0PB 5B58C 2WT9A 4JFRA 4WPGA 3BRWA 3R23A 3P45A 3RUIA 5BPPA 1R9MA 3DV9A 3WYGA 1XF9A 1JEYB 3IH5A 3NGLA 4M99A 3BERA 5EZSA 3RNOA 3PRZA 4HBDA 2LPMA 4ACKA 3ILVA 3BWEA 1EFVB 1E2IA 2G5PA 1U02A 4GMHA 1I24A 3FOEC 3RADC 3GDHA 2ODTX 1FJ2A 3E7WA 4GOJA 1XLTA 1NV8A 4TRNA 1M8PA 3ESLA 4I6EA 1YOVA 1PS9A 4WCFA 3FUFA 2NZJA 1BROA 4DNXA 2HREA 4HQLA 1V11A 1RIIA 5G2OA 1QTRA 2PL9A 1QYVA 2EDCA 1E4OA 1CK4A 5EIFA 5H81A 3GLSA 3A36A 1IL0A 1CUHA 1FTWA 3T0GA 5JIBA 3WA6A 4DJFC 1N2BA 2CDRA 3QB2A 3FXAA 1IYZA 5JD6A 4YRDA 3N86A 5G05C 4BV2A 3OY7A 4LBZA 3PREA 2V55B 3NEYA 1QH1A 4UE2A 5DGIA 1ONOA 3IKLA 4KRFA 1QSGA 1H0RA 3WOHA 4UWFA 5C51B 2I34A 2DFNA 1VP9A 3P4YA 3D7LA 3ABRB 4KPYA 4XGQA 4Q3KA 4GRDA 4JJ6A 3COSA 5AIJA 1Q0PA 1GQQA 5K8IA 5FA6A 2Y9PB 4RVHA 3QFHA 2Q6IA 4HNRA 4ZI7F 3G2UA 1G3RA 3TFWA 1DBSA 3CB2A 4B6EA 2JANA 3RSOA 2OXFA 3S81A 2OQVA 4A82A 1GILA 3LQKA 2G5TA 3JYNA 3MRXA 1INZA 4I2NA 1U31A 3F6RA 3KQPA 1SNYA 3GUZA 4U8GA 1AKTA 4M0EA 4U9HS 2EJUA 3KB8A 2VUSA 1N33B 2XEVA 2C4UA 2A9OA 3IAAA 5EQJB 2COKA 5K8TA 1SZCA 3OZUA 2LKCA 2XOEA 4OXQA 2ZT7A 5CYOA 3IFSA 2CMHA 3ZNNA 3QEKA 1NXTA 1U7TA 5EWMB 3BL6A 1AS3A 4QOEA 3VPBA 3DZKA 4NEQA 5FQ7A 4EW2A 1CZOA 1ULZA 1AQIA 2GZ3A 2DC1A 4PYNA 4AP2A 2YASA 4W1RA 3S0JA 1GV1A 5IARA 5JQGF 3U9WA 1W4BA 5CDFA 5JDCA 3NJ8A 2BFCA 3LYLA 2B37A 1I32A 1SQ5A 4XW2A 2WXOA 1ORTA 2QPAA 2DPMA 2YOHA 3ASVA 4UMVA 4FHJA 2GBCA 5AH0A 3JZDA 2R6GA 2IIQA 2QXUA 2QW1A 5FOWA 3V1YA 4MJXA 3U4MA 3L8EA 5D3MB 3RRMB 1TNOA 3GELA 5AJXA 1MEOA 3P0RA 2O4CA 3DYVA 4WJKB 1TKAA 4UHCA 1V5IA 2W6MA 1HG0A 2J3DA 2QVCA 4RHTA 3GJ3A 5L3QA 4NOLA 1Z4KA 3H17A 3T41A 4RZIA 1CT9A 4HK4A 5DCLA 4NPHA 2B4YA 3ZDAA 2IC5A 2I33A 3P96A 1CPYA 1E3JA 9MHTA 1D0SA 4OG2A 4PY2A 4BO0A 3QLTA 4Q3OA 1RQGA 3D1VA 2UZ3A 4EI9A 5IAJA 1NDUA 3IKOB 2OMKA 2OCYC 1LJ8A 5CW1A 1SZPA 2HHLA 2MMGA 3Q5DA 1YASA 4AMZA 4ESOA 3CVWA 4G4JA 2IH5A 4OIFA 4QYIB 3U26A 1UM9A 4JT8A 4QU9A 2CNLA 3PZ4A 4F3VA 3BH0A 1KC1A 5HDQA 2JD0A 3HY3A 3PSHA 2W6NA 1QIMA 1F17A 1XU9A 3R7SA 1PDVA 4I43A 1NVEA 1FLDA 1MVOA 5DW3A 4HX5A 1OX4B 1HDOA 5AVQA 4F71A 1P7ZA 3EZ9A 1L8LA 2VTDA 2Q3FA 3MKRA 4N5NA 1UBCA 1HG2A 3R3SA 4BMXA 1H2EA 1E2HA 3HVUA 5MDHA 1TT5B 3I8SA 2CE7A 1YIOA 4FJZA 1SXJC 3GP5A 4EEZA 4NFSA 3A3KA 1GA4A 4LTNA 1DDIA 4KZKA 5IH7A 3U3XA 1GPMA 3M5WA 3PDWA 4WIAA 2IZOA 3FB4A 3KP1A 1N1DA 1WCV1 2ZRLA 1VL1A 4W9NC 3F5FA 4GXRA 4P34A 1WDYA 5JAQA 5K3SA 2W7TA 1CY4A 2WM8A 1BAPA 3CUKA 4UATA 3JTEA 3OXLA 5AW6A 2YZMA 1WO8A 4ZIRA 5C81A 4AECA 4BKQA 4P92A 1WNFA 1KKUA 4RD4A 2VRCD 1NDQA 1V48A 4ARZA 1BOOA 4JQOA 4GH5A 2RG8A 3GNTA 1AHIA 3TOZA 2J3EA 1OLUA 5ESWA 4BJHB 4PZCA 1HLPA 3OJCA 1ZD1A 4C21A 4L9AA 3GH1A 4MPRA 2X9NA 2PQMA 2O1WA 3SOZA 1XNJA 4AAYA 3H3JA 2CK3A 2I1QA 3EIHA 2AOUB 2P2NA 3ZDZB 4B74A 2PJZA 1U8AA 4MVCA 4X44A 3TM4A 5CHEE 3GJXC 1DC5A 2P91A 3C5HA 3WL4A 3QX3A 3FTEA 4RKWA 3GNLA 1WMFA 3ZY6A 2G67A 2ORIA 1ZICA 4UYKA 3OZ7A 3Q9UA 5H3LA 1Q91A 5DBEX 4Q9DA 1VKOA 5I7SA 2WWRA 2DBVO 1L4KA 3B82A 3IIIA 5DEOA 2NQ2C 3MFQA 4LRQA 4Y2PA 2YYZA 4MS1B 4QREA 3GDOA 1G4UR 3GLTA 2EFJA 1V1RA 5HM6A 4ZFNA 4ECEA 2W6JD 3RKSA 4CQMD 3NBYC 5TMEA 2DLNA 3F71A 1GNTA 1SUCA 2C99A 2GW1A 3SEFA 2R5WA 3PPVA 1ZD4A 2R86A 5IWAB 4GMJA 3KXIA 4YCJA 5A4MS 2G0NA 1SUEA 4N5IX 3EZ2A 2EBFX 1E89A 4FS8A 3FH7A 3WLPA 4LXQA 5ELXA 4ALJA 1DTSA 1A4XA 3RRZA 3DEPA 2J3JA 3UAOA 4DWVA 2XBUA 3FGPA 1QK3A 1TXGA 3DULA 3ONNA 4S0XA 3I5XA 1E2KA 4DA9A 1SU6A 1CRQA 4WACA 1PZXA 3CK7A 1QG0A 1Z15A 4TTTS 3PGXA 3BCRA 1WDKA 2J3MA 1A96A 3ANYB 2P2CA 3AYZB 3HZOA 1VCHA 5FOXA 3FHCB 3GUCA 1ISIA 1CY7A 1PIWA 2WJPA 5EPOA 2IOHA 3HL4A 3L6BA 5AHOA 1L7VC 4UOZA 3NWBA 4MKFA 1I3CA 3P5SA 4MB2A 3RVPA 3HYTA 4XSVA 2LSVA 3KXLA 2Q27A 1SUAA 1YA6A 5JMTA 2CBXA 3NVKI 3DDCA 1SKQA 1VYUA 1G4HA 5SY9A 3MTAA 4NECA 2ZRHA 1UMDA 3SQVA 4Y2UA 2C5GA 1JEEA 5FBKA 5K6TA 3F7MA 3K20A 3HDHA 4W7SA 3TD9A 1DJPA 2G36A 5TMPA 4DV3B 1GHTA 2IIPA 3FUNA 3GT4A 4IDCA 4QOGA 3IPCA 1PS0A 3GOQA 3NAGA 2IVZA 2WDPA 4NOJA 3MERA 4I8XA 4F84A 3TFQA 1QVVA 4YHBA 4LBWA 4MCHA 1V5FA 2V9PA 1AHNA 3CVJA 2G9UA 3VVBA 1Z5GA 3OIVA 3EPKA 4N5HX 4H60A 4LE1A 1K6EA 2EQAA 5EUBA 4ZK6A 1Y89A 1XALA 1DC4A 3TNJA 5E1BA 4NG5A 1PJZA 4ZVRA 1U0TA 3WNDA 1NOKA 4DMRA 4J16A 3KWJA 5JNSA 2EKBA 4I5IA 1CY0A 5FUWA 2HSDA 1AMNA 1EJ2A 3I34X 1UXHA 2VNJA 3DE6X 2EBUA 3U4TA 1K7XB 2B25A 2YICA 3AQ4A 1AO0A 1QQ5A 4MUNA 1AP7A 2C42A 1V4VA 4F91B 5DN9A 3ESYA 3B6EA 3DSXA 1L5MA 2G1JA 3CO5A 1UDCA 4I4TB 2R7AA 2C4KA 4X20A 3IRUA 3FGOA 3RLIA 2FQYA 2O3TA 4WSOA 3GLIB 3ICEA 3L7LA 1FNBA 3TGOA 1GRCA 3DZJA 3GFSA 4AT1A 5EMKA 1USIA 4XRGA 3OZVA 3KOXA 4RG9A 2EYUA 5CURA 3DBIA 5AKHA 3CZRA 3CRW1 5BV1A 3EB9A 3MSCA 4ZCRA 1L5HA 1P4GA 2ZTSA 2IU1A 2XT6A 2Q07A 1CZKA 3U7QA 3GVXA 3TBFA 2ZJZA 5B6PA 1OY3D 1MA3A 4KGDA 3AV3A 1N2EA 3TJZA 4YRMA 4JD2G 3GT7A 4FLBA 2GCOB 2PBRA 5KOJA 2PO7A 3BREA 4JL0A 3V8QA 1FYFA 2CXTA 4NLLA 1W4AA 1J97A 5AHRA 3DEOA 4EG6A 5CMYA 2IGTA 3A11A 3WIUA 4F9FA 2ID7A 3A4NA 3MRSA 2W9XA 1SUDA 2B8WA 1F2TB 5AHKA 4DA0A 3DL0A 2E9SA 2ZR0A 3I73A 4N3NA 3GEMA 4RENA 2YZ7A 1ELRA 4NYIQ 3MNFA 4OUKX 3RUHA 2VDLB 2RD0A 4J1TC 5HZGA 1ZX1A 2X5HA 1NYRA 5IUJC 1YVPA 1O5TA 2X0IA 3EMKA 4GLLA 2ZYTX 4BV8A 3RJTA 5EQDA 3GD7A 1L9KA 1GZ4A 3BMOB 1XIVA 3TG5A 5LP6A 4K9LA 4B81A 3L7YA 3DPSA 2EINE 3GZ4A 2VNHA 3V1KA 4O29A 3MJWA 2WVGA 1EFTA 4PPNA 1AUPA 2VBGA 2ODBA 4ND3A 6REQB 3C16C 1ICEA 3I2FA 1R0ZA 4L75A 1QR6A 4NV1A 4NATA 4DA8A 2WJ3A 2R8PA 5TQ0A 2XBMA 1E2LA 2IUSA 4U2EA 1ODFA 1VMIA 4L1BA 2ONYA 1N36B 3D8HA 2C00A 3RC2A 3UGKA 3CWQA 4KVZA 2NTVA 2F67A 2Y1OA 1GZ7A 3IBGA 3ZE7A 4LHZA 2GOYA 3RFCA 1MPTA 3DEJA 4HB4A 3E4DA 5KBAA 1NW5A 2XJ4A 3CE6A 1SAYA 3KT3A 3VR6D 1A3CA 4DJ5X 3K5WA 2XD4A 4R16A 3PHJA 5CEJA 4I5EA 3E0XA 1JFFB 2G1PA 5AXDA 2ZJ7A 1YZYA 1FC0A 4FHKA 4MUFA 1S8FA 2QY6A 2SKCA 4DMMA 4HTAA 4FOTA 1JIXA 5H0IA 1TQ6A 3NZSA 2WWYA 2BGLA 1BDJA 5K0LA 5AK5A 4U96D 2VRWA 4BU1A 3HVHA 3PXUA 2PX3A 5JD5A 4U0UA 3WYAA 4AJ4A 1MORA 1HDCA 1U7XA 3NP7A 4WH0A 4NK5A 3IQHX 4CL0A 3EBPA 1TMYA 1P2FA 2GM5A 4M7WA 1G8AA 4F3NA 2HMUA 4FGUA 5E6UB 4ENPA 1J56A 4G89A 1FSPA 4LUNU 4LWQA 4WKOA 5B1EA 9GPBA 5AYVA 5JAHA 3ESXA 1D6JA 3DEHA 5AI8A 4NENB 2OEPA 5JH7B 2ZYDA 1L4UA 2BTDA 2R4TA 1UBUS 1KPSB 1K4YA 2FWJA 4F04A 5JOQA 3O4IA 1OSNA 4GSYA 4PYKA 2AKYA 1JFRA 1IQUA 4TVOA 1WXIA 2UYQA 3CZAA 3TE7A 4I1OB 2F1KA 4JK3A 4Z1MD 4AKXB 5FTMA 4AVXA 3LD9A 4X54A 5LUBA 1EIZA 2IYRA 4ATZD 3DXXA 4FYPA 5JAMA 1ZJ4A 1NG1A 5EI5A 2WXRA 3GGOA 5JRZA 3H6GA 3G2NA 1D9SA 3VISA 4DARA 4BBAA 3OQBA 1YQTA 3LDAA 2QP4A 2Z1NA 1K5PA 4ZQCB 1M8KA 1P17A 3AJ9A 3VYVA 1U1EA 1E96A 4AKTA 4G2VA 3ZWOA 1YQQA 3TL3A 1VFPA 3PQFA 4DK5A 1G7CA 5I9BA 3W9FA 1BD3A 4WNIA 2RH4A 4HNAA 1V26A 3OQ6A 4R2KA 1NUUA 1FVXA 5IAEA 3N71A 5DW0A 1A04A 2GCPA 4JB8P 1NNEA 3DAPA 2XW6A 3H18A 4ZDIA 2PGAA 4H77A 3Q79A 3QVSA 1EHYA 2H6EA 3T9AA 1N9KA 2REOA 5GJCA 4AMGA 3H0KA 4V0NA 4YJFA 4CGZA 3OQ1A 4I9CA 2RAFA 4MV9A 2WKPA 2EFDB 2R2GA 4G24A 4A23A 3S27A 4GAAA 5IM4F 3CN7A 4OJKA 3FTNA 5SYNA 4K3UA 4NMLA 3UTDA 2YV2A 1RI1A 3QA9A 3OXFA 4O2BB 1OXSC 4EMSA 3OZSA 5BMVF 1ZD5A 3U44B 2EFEB 3HBAA 4I5FA 5H7PA 4MRMA 1B8UA 3TB6A 3PS9A 3BDIA 1PG2A 1GKUB 4AZ0B 3LUGA 5FR1A 5M2QA 2HEGA 1L8QA 2H07A 3H9QA 2NV2B 4U8HA 1QTQA 2VDJA 1X9GA 4WK2B 1S89A 4TYWA 5BN5B 1OFIA 3O3CA 3D9PA 1YRWA 2HZ7A 5G0TA 1O87A 3KPYA 2CD9A 2QIPA 1R3DA 2RAUA 3VX3A 3ZJYA 2XEDA 3PYXA 4I8DA 4ZPJA 4WOCA 1K68A 3UKJA 1WU8A 5I5EA 1GQOA 1NLMA 1Z4PX 3TR6A 3LKUA 1UBFA 5BT1A 4I9GA 3RI3A 3UK6A 3KWMA 4YK7A 3DKPA 3IAS1 1SH7A 3DA8A 3HADA 4QUBA 4A16A 5HS4A 4URXR 3O1HB 5F76A 2HR1A 4F06A 1KH1A 3JQ7A 3PWKA 2Q6KA 5ALDA 1E7RA 2C84A 4HBZA 2QL6A 1JR3A 3MIZA 2WXHA 4PV7A 1FLAA 1RCUA 1P2UA 5K5EA 1U2DC 3OAAD 2HU2A 4BB6A 3HFJA 3O3MB 1ZONA 2FPGB 4PR0A 5MN4A 1ISMA 3WLKX 2FXIA 4AJIA 2XYVA 4HGOA 3K94A 1FQJA 3KKLA 4GM0A 1QYCA 2YQ4A 1EAMA 4EGSA 1UBLS 1C9MA 4YP5A 4CMKA 1ZI6A 2PANA 1BH6A 3BPSA 3ZY2A 4Z4QA 4LOJA 1PGQA 2QTNA 5FADA 4DLOA 1VE7A 5CAEB 1K8KG 3UT8A 1EJ6A 4PZAA 2ZYHA 5COBA 2RKKA 5MFZA 1LK7A 3FWZA 3MJDA 2H1CA 4JBIA 3WSVA 2NX2A 3M4ZA 3OBIA 3VVMA 4L7QA 2B2CA 4HH4A 1YFJA 4UCWA 1QDLB 2NU6A 2CVQA 3AF3A 3R24A 3D6NB 1F8GA 3RF6A 1ZC3A 2YHUA 4RS4A 3ZPJA 2QAGC 1RJ9B 3CPSA 2O48X 3RG2A 5AM4A 5JJ5A 1Z0FA 2W8ZA 3TZBA 1JUDA 3UJPA 2IPNA 4B9EA 4CF6A 4QX6A 2PGNA 3IO5A 1YDGA 5C80A 3FPEA 4ETNA 1LRLA 4CGVA 1ZVVA 3WGHA 2QRVB 3CTPA 2YWGA 3EGVA 3FD8A 1AY0A 4DDKA 2QLFA 4YRPA 5DLEA 2FE1A 4H1VA 2X2PA 4E22A 3OPQA 4M1SA 4G97A 1G20E 1DLJA 4PSVA 2BP7A 4FGKA 3IOCA 4EVQA 3IALA 1LK0A 5K2MA 2QQGA 1JIJA 1P7YA 4JI4B 3N74A 1NBOA 4OK6A 3GAMA 1R0YA 4DQUA 1U7UA 4TUYA 2GFHA 3CX8A 2JIZA 4L08A 3I2GA 4D10C 4TV8A 3F6BX 1RJEA 2O8EB 3L49A 4LNUD 1U0JA 1UIMA 1V9CA 2ZBFA 2CMFA 5GM2A 3T06B 3VR4D 4Z0NA 2Y6UA 2QJFA 3LCCA 2FRDA 3CMCO 1T6XA 4MS4A 4XDGA 5T5QA 3QF4B 3NTUA 3B2QA 1ZPDA 3F8WA 3FGZA 1GZUA 3O1LA 1BD8A 1TNZA 4NTZA 1OAOC 1YOBA 2OBBA 2NVUA 1X7DA 3PJFA 3BAFA 3F7NA 1U6JA 3K0CC 4IDQA 4OP1A 4Q7QA 2A1TR 4P4LA 4FCTA 3H5NA 3MWDB 3WJ2A 4W1SA 5LNK1 1E2MA 2VF2A 3A6PC 2YVUA 1GXSA 4PX2A 4DJTA 4P3KA 1I1QB 5JVDA 3WMFA 5ICGA 1T3TA 3I5MA 3AHCA 1KJJA 1JQ3A 2LWIA 1ZA2A 3GEBA 4FEYA 4EG5A 3CUWA 3I4FA 3LW7A 3ZLJA 2R62A 3LKVA 3GNQA 5CDTA 2EWMA 4MSUA 1RTKA 4XYBA 4NXNB 1U3WA 3ICQB 2BEWB 1Q92A 1P61B 1JHZA 3JATB 4ZVQA 2CDAA 3P9YA 2CLFB 3EW9A 3QVWA 1Y6JA 4J9VA 3SK1A 3Q9NC 3ZIMA 4RIFA 4A6EA 5J2UB 1MFZA 3LL7A 1OROA 5AOVA 2VNIA 1Z7EA 2Q5EA 4UUMA 3BULA 3LXXA 1XYGA 2P6MA 2V5FA 4M8KA 1ACLA 3D6TB 5KREA 3C39A 4LJ8A 1CUIA 4RCZA 3THOA 2JKZA 1XXHA 3PNLA 3L7JA 3ND6A 3AYXB 3L8MA 1PFKA 3BUAA 3CUSA 3M6UA 5HF9A 5TT1A 1GO2A 2R6DA 5BPHA 1I6WA 4CL8A 3A6ZA 4B3GA 4EFMA 3NC4A 4DT1A 2J9FA 4V2IA 1N6IA 3DQPA 2EVWX 2CNDA 2RIPA 4I0WB 3L1HA 3JAKA 2OQIA 4MCAA 3W3AD 4JIGA 4YA6A 4AJ9A 4DIBA 1OY1A 2V7UA 1O95A 3MYYA 1YJBA 3V1UA 4I2WA 3SQOA 3L7IA 5CEAA 4ILIA 4K6KA 1OWOA 1K86A 4JUBA 5IBPA 2OCKA 3HA2A 1SUPA 1F0PA 4W5WA 3KSDO 3U80A 1QGED 1E8MA 2XKAA 4ILGA 2R751 1ENYA 1RFLA 1BYUA 1XP5A 2B8NA 2OWEA 1Z33A 4B0ZA 4BQQA 4B6JA 1MO3A 3KVVA 1IXZA 1Y6ZA 3QV2A 5GV8A 3CH4B 4DLZA 1FSSA 2O5CA 2CFIA 4OI1A 2X6IA 2I6UA 4N0PA 1G5TA 4NBTA 3ANNA 3AWIA 4F9EA 1Z73A 1VGVA 3TVTA 3SWWA 4QO8A 3WK5A 5CG2A 3C5CA 4ZICA 1V3UA 2BR3A 4BQFA 1DQSA 3DLCA 4DWWA 3HSYA 1COWA 2IRWA 4HKTA 4C30A 1TZJA 1NVAA 2NYUA 4F5YA 4BZPA 4HNGA 5AQ1A 3G2PA 3VOSA 4BAUA 1HG1A 3QVVA 1O6BA 4O2RA 1P1IA 4F9GA 4NHOA 5BRNA 4N3AA 3RS5A 5IYZF 4F8EA 1RHMA 3LA8A 3PDHA 2ZAGA 2PQRA 2BFBA 3VNQA 2AR0A 1PQPA 1Z07A 3IHLA 1I4EB 1H4SA 4UJ3A 2NPOA 3VMMA 4UAUA 3INTA 3N8DA 5CVVA 1N0IA 5JLJA 3LECA 1J2TA 5A1JA 5DO9A 3BDVA 3QVGB 1LFDB 3VTXA 2L9BA 3MJVA 4FYVA 3ZOZA 5THXA 4EYQA 3O73A 2FPSA 5K8JB 2O14A 4OMFG 1B6RA 4IQ0A 1ATZA 5JYEA 4GRAA 1ZK4A 4HZGA 1Z36A 1RAGA 1RPZA 3EAQA 5EIXA 1TM5E 7ADHA 5FUMA 2YFQA 1XQ6A 4Z6KA 1X8XA 3ZH9B 2ZI3A 1J21A 1ADCA 3UA4A 5IW8A 3VMFA 5DWVA 2H0QA 3NBUA 3W2GA 3P9QA 5ARGA 5KSPA 3JR3A 2QRKA 1BNCA 1J39A 4HB2A 3FSEA 5A5FA 1R12A 4ENWA 1SRRA 1VJTA 1UXIA 3ZG6A 5JARA 1KSJA 2HRRA 4YJ2F 5KYGA 1P72A 4Y2RA 3TZEA 4DB2A 1QF7A 3S70A 3FPAA 3P1UA 3HG0D 2EFHB 1KGSA 1F4PA 1J0BA 1U3DA 3CKLA 4C03A 2DLCX 4NE7A 1W8DA 3R09A 2IQ5A 3E15A 2QN6A 2HK8A 5HR5A 3EEBA 1RD4A 5JDIA 2VGEA 4CMBA 1TZMA 4NONA 3ZBPA 2FWBA 3IOMA 4C2AA 3EUEA 5JMOA 4JODA 2ZZNA 1M76A 3EZLA 3OUTA 3FUMA 4QJ5A 5JMPA 5T6BA 3RRUA 4R1OA 3W6UA 2IZ5A 4B3HA 3FZGA 1SKYB 2WT8A 1JHXA 4DDUA 3DSVA 2UXCB 3C8HA 2ZSFA 3A1TA 3UOAB 3FNFA 2PSSA 1N4PA 2WMYA 4C0XA 2R79A 3VPGA 4UHBA 2PS9A 2RK4A 4NVRA 3L0IB 3CLRC 2Q46A 3TWWA 2VQDA 4RE6A 1NA5A 1N32B 4F46A 2WHPA 5ICEA 4G9GA 1P9WA 3N7UA 4Q39A 3C2QA 3MQ4A 4LNGA 1KI1A 1B43A 1ECBA 3SS8A 4DR3B 1OV4A 5L3SA 5A3QA 3HKDA 1HPLA 3BKWA 4LK2A 5LU8A 2OPHA 1M2VA 1ECCA 2DJIA 3FX2A 4N40A 4DGQA 5LVAA 2RGDA 4DJAA 5DX0A 3E9RA 4LRWA 4KXKB 4AWXA 3CQCB 3GVPA 5JY6A 5JJ7A 3P0JA 4RJJA 3PPYA 4IHQA 3OJEA 5IAKA 2VXOA 4J03A 2POCA 3VSBA 4YXWA 2JATA 3W4KA 5CBPB 2R8XA 1CUSA 1T6NA 3TIIA 4EB6B 1BE1A 5K51A 4UHHA 3QUBA 3LVQE 3TWTA 1R27A 4KLAA 4YJ3F 3MX3A 3ESAA 5BXOA 1CRZA 4N48A 2RBKA 1R2QA 4IJUA 4PGAA 4JROA 2FPPA 1JF8A 2X76A 1XP8A 1E0DA 1IUPA 2G9VA 1GGMA 2CXRA 5T8KC 3A1FA 4OVKA 2XF2A 1G5QA 2E4ZA 4B6FA 2HA2A 4BMZA 1TC2A 2NSLA 3FTFA 3MQFA 4WI1A 3PQEA 1Q0RA 1CCWA 3Q8KA 1SMKA 3UJNA 3ON5A 5ENRD 2OCCE 1ZUIA 4LRYA 1HRKA 1Q95A 5H02A 5ILOA 2FBNA 1APBA 3LZCA 1K3UB 4TYQA 3I39X 3K6SA 3T5VA 3ZHUA 3UJ7A 1B1CA 4DLNA 4UWGA 4Y67A 5AI4A 1FXWF 4LHXA 2GZRA 5FL3A 3F4KA 4KXLA 2PYIA 4CV2A 4APFA 3M5PA 1FRNA 3PDCA 3OCUA 5CPFA 4XI9A 2FQQA 4O08A 5K0SA 4X8QA 1NW8A 3N76A 2NT4A 5BPFA 2QSJA 2NIPA 1SVUA 3TQOA 4Z99A 3TGWA 3L77A 3EISA 3F46A 3S68A 1RS0A 3TLYA 2DCPA 2Z09A 1EDDA 2VEDA 5EZYA 2HV9A 1FMLA 4A10A 5L3ZA 2HLDA 5DK6A 4V02A 8ABPA 3E32A 1ZITA 1JAYA 5DBHX 2PKCA 3FZEA 1W3BA 2HIGA 3K1AA 5DP2A 3HGQA 3RABA 2ZJ6A 3T7DA 3DEAA 3VYRB 1QZ3A 3ED1A 1GRVA 4LJ7A 4KVFA 5JTUA 1QE0A 3TLAA 3HDJA 4XPZA 5I9LA 1HYQA 5DI3B 1DQRA 3TLXA 1T5SA 3FF1A 1CUCA 3KR0A 2FUCA 4ZARA 2IXAA 1Q7BA 4C1BA 4QOJA 4KLCA 5JZOA 5B4UA 1DCFA 1IBKB 3LUBA 4I55F 3PUJA 4O33A 2BBWA 5TPZD 5TSDA 1OB2A 3LLMA 1OI2A 3D6MA 4D81A 2JLXA 4AJ1A 2FUEA 1J0DA 1CJKC 1BWSA 2H18A 3B38A 3B3JA 3L5KA 2HPVA 1RFGE 3I92A 3QM1A 4HLUC 5B1IA 3EHNA 1FZQA 3EGDA 2IDKA 2YZGA 1OA0A 4NBVA 3WV5A 2FMXA 5LCWJ 1EGVB 3I28A 4LCTA 3JQGB 5DPMA 2ZAOA 4U2GA 3WB2A 4JLOA 3OSUA 1VDMA 5CIYA 4RHXA 1MX2A 5SZKB 3H2YA 4G8LA 5BSTA 4GX1A 3RAGA 4LC1A 2E82A 3CYFA 2CNNA 3L18A 1JJ7A 4AM9A 2EF1A 1SPXA 3ITEA 3Q7IA 3A9WA 3EG9A 5FBLB 5JR3A 5L51A 3EPPA 4DUGA 1HBJA 5A4IS 3NQPA 4MUBA 5LMNB 4Y1RA 1MW9X 1JAIA 4NZMA 3P52A 3QK7A 5FRDA 2DH5A 1J8DA 4DWJA 3GMTA 4YRCA 3DZHA 3IQXA 4G9EA 4BNHA 3R8CA 1SC4A 2Z2JA 3EGXA 4JBWA 2C1EA 2HO4A 4BTVA 1FU4A 2O3SA 2V7BA 4YRGA 2NO5A 2NQTA 1G9XA 1CNEA 3ZI7A 1U80A 3IDSA 4C22A 1IULA 1N3LA 5JEDA 3X43A 1T2CA 4M0UA 3VH1A 2H59A 1BE0A 3VV3A 4QYSA 1A95A 5FINA 4F3YA 2WZDA 3KEZA 2MMCA 4JR2A 1GA6A 1EK1A 2QVLA 3AUFA 2RHWA 4BNDB 1HV8A 4IZOA 1T29A 1L8XA 1B16A 5MN5A 2JJ8A 2P6RA 1LX7A 1VKZA 2AD1A 2XYRA 4JHJA 2OHGA 1U2SA 3OJXA 2OXCA 3VXKA 2CLDX 5A6VA 5DIZA 4BLVA 4TTIA 3CS3A 1DVPA 1G9SA 3GLKA 4HRAA 1NVBA 1Q1BA 3LCMA 1UKZA 3S7ZA 3KSAC 2DHDA 1AGYA 4EECA 1TCAA 4RANA 5SY4A 2JGDB 4V0OA 2ALJA 4CTJA 1KI6B 5T4FA 4KBQA 2PIDA 3CG4A 1Z5ZA 5FWXB 4H6PA 5KVAA 1QZXA 2EJBA 2HGZA 2X4LA 3LL4A 3FVWA 4ZP1A 2P9EA 1ZD8A 3GJTA 5IULC 3IUMA 4MLDA 5JNLA 2KSQA 1UM8A 1NOIA 5EYLA 1D1SA 1XDWA 3DMHA 3H2GA 4TYNA 2VP9A 1ACJA 2BLNA 2G76A 3WO1A 1NPDA 3DF7A 2CCKA 2C3OA 4UAGA 2VYQA 1F0YA 1SQMA 3AFIA 1A71A 2J8ZA 3WYBA 3UKDA 5EN5D 5EPEA 4HDQB 5LDGA 5ESRA 1L7BA 3E82A 3RRXA 5LA6F 2PH1A 3OJLA 1KGDA 4UMDA 1MGPA 3ASUA 4RA9B 3GLHB 2V5AA 2QZZA 4F6RD 1L7XA 1VPEA 1FUKA 3KYCB 1AE1A 4IJ5A 2XT0A 1OH7A 2VP5A 5LB4A 2QP9X 3JAWB 1NN3A 1L5QA 4GP7A 5HFJA 1ZKMA 4X1KB 3S2AA 2FO7A 3M9LA 2ZUSA 3QSGA 2B6NA 3E9ZA 421PA 2IU4A 3PNVA 2M6KA 2OHXA 3ZBQA 2HRQA 1TCCA 2AYYA 1GRQA 3OU2A 5TRTA 4GQAA 2G7ZA 2G3YA 5HUJA 4LSWA 2CG2A 2JFOA 5HJEA 1N7HA 1DJLA 3PVZA 3EVAA 1OI4A 3DT9A 4KH1A 4HLEA 5J4YA 3OPYB 2VN8A 3K1TA 2HFKA 1V6SA 4E0BA 4NZ9A 4GKBA 2X2FA 1U0HC 3R7WB 4F5EA 3ZJUA 3T5XA 4NJEA 2PN1A 3BXXA 3Q15C 5E8RA 1E3EA 2ETBA 3WGNA 3A1UA 2W43A 2Q4DA 3DG9A 1J22A 4ENTA 4W8GA 1KS9A 3S3TA 3KALA 1N5KA 5KS2A 3MV3B 2WAXA 4BE4A 5CVUA 4XVRA 1QNLA 4NYMR 1AMOA 3QU4A 1I6KA 4GF5A 5K09A 1M2WA 4JNKA 3UMYA 2IYUA 3AJAA 1XEXA 3DTYA 3LMKA 4DQKA 1L5FA 1N9GA 4KR7A 5GAJA 3NC1C 1K27A 3EVCA 3W8RA 1GCUA 3KKQA 3DR3A 4G84A 3IP6A 1ACMA 2DBRA 4G0VA 2Z1DA 4BP9A 4Z53A 1P2SA 2ODWA 3C3AA 1N0HA 2X4GA 1NHWA 1GGKA 1ZEMA 3R0QA 4BO9A 2PZLA 1L1FA 4WWNA 2QUJA 4OX9Y 1PFQA 2MSKA 1SQGA 1UPXA 1H2BA 3ME5A 4GAEA 1P5JA 4LHVA 3FNEA 5AK3A 2WY2D 1GCIA 2CEAA 1ODCA 2PJUA 2F8LA 2X5TA 2I2OA 2ZAYA 3Q6MA 3BM5A 4LXIA 5K6AA 1TFUA 5FIUA 3ZCVA 4IRXA 5B3KA 1KMCA 3G3EA 2B61A 3ZD9A 2VOEA 5DHPA 4C4OA 5HA5A 3N8HA 3S44A 3B3QA 4EG7A 3R40A 3GPBA 2GD0A 2O0HA 1WZUA 5FI0B 1K66A 4PRYA 1U7ZA 3PG5A 3ENQA 4MZDA 2OKCA 2FMKA 3MMZA 1TNYA 4QRDA 3C5WP 4ZAGA 2YINC 4CI0B 4EJSA 3GBSA 4ZYWA 1ZMRA 3SF8B 1G6Q1 4S1WA 3U61B 1KVTA 3C3RA 3HDQA 4D9EA 4AXXA 1AUQA 3KJEA 1KXZA 4HFGA 5HP4A 4EBAA 1XN1A 4LF9B 3SZ7A 4QA9A 3NH9A 3B7UX 3QIVA 3WRXA 1E9CA 1KTVA 5DB4A 2J48A 3QU7A 3SJAA 1L4BA 3BG1B 1NY6A 1M8JA 2Q9AA 4HFJA 4I3HA 1N5JA 3M89A 4QBKA 4QUIA 4G81A 4KYUA 3GLRA 4JGBA 1XZIA 2B0JA 2ZRCA 4MGYR 3B6KA 4OUDA 2I6QA 5K8CA 2QRNA 3E27A 3ORYA 3P2MA 4HDMB 4FXOA 4UUQA 1VKJA 5H80A 2M2IA 2ATVA 3NVDA 4WJZA 4W1PA 1QQBA 3VPXA 4HLNA 1QOZA 2O05A 3UAZA 2C4TA 4HUTA 4EA9A 5ICCA 4HG2A 4JVSA 4BFUA 2YVAA 4KBFA 1F14A 1I2MA 4A5OA 1WCYA 4TKVB 3K0AA 2C5HA 2OVBA 4TMFA 4RFLA 2G9RA 2G83A 4U9UA 1XRMA 3KG2A 1G5HA 4MAMA 2F1HA 5KO2A 4DHWA 3UAWA 4NMHA 5NULA 2D1SA 5JV5A 3DXYA 4U7FA 1W19A 4YVOA 3Q78A 5JXIA 3UXGA 1CR2A 4NMMA 5A9TA 2D5CA 2OHVA 2PEYA 4PWZA 2VCEA 4KG7A 1Y1SA 1C3OB 4RZ2A 3NWJA 3V55A 4U9IS 3AG2E 1ODTC 2W6OA 1S96A 3A1VA 1GUAA 1VKNA 3FSGA 2AEJA 2GEKA 1P7CA 5BWNA 3V2GA 1LJUA 2W11A 4XM2A 4NCIA 1XL1A 1OT8A 3AF1A 3AI7A 1LDEA 2PKXA 3PHCA 3LY5A 2FNAA 3AOEA 1GGJA 1JQEA 4M4SA 3AVWA 1DXQA 3SSOA 3KSRA 2AFRA 2CXQA 3DBOB 1LI4A 3JZAA 3QE0A 4MITA 3G2JA 4CQJA 2AC2A 3QLVC 3RUAA 1Z7WA 1DTWB 1FDIA 1E1QD 2JFYA 4X65B 3Q72A 3M2PA 2FPIB 1NW3A 4PAGA 2Q1WA 1PZEA 2REXB 3H19A 2WNHA 4WOJA 5DEIA 1VM6A 1U3TA 3PU6A 2NSHA 5KTOA 4TS4A 2VK1A 2OZLB 2BYTA 3IXLA 4YMIA 1QQ6A 2L82A 4YCCA 2DPYA 1IUKA 4KQCA 1BKSB 1G16A 1VBKA 3HB4X 1WW3A 1K5HA 1YDFA 3FTDA 1RE1A 1A9XB 2YVLA 5JT1A 3OIUA 5KWJA 1G5PA 2Q9BA 3GRRA 3FFAA 1G3MA 1T9HA 4EKDA 5CA1A 1Q6YA 2LGJA 3P19A 2TYSB 3OY2A 3X1KA 3ZGZA 5LOZA 3IV0A 1L4NA 1KOGA 3E5NA 5F1YA 5EJFA 3S5UA 1IBCA 3PFBA 4P86A 1N11A 1A7UA 3NOQA 1H65A 3JY6A 4NZPA 5ISMA 3QLJA 1XQYA 4DCGA 4I9FA 2NVBA 3ZW7A 3ZWDA 1T2FA 2CB9A 4I1MA 1H2YA 4LSGA 2JDID 1GPKA 4E46A 1Q2XA 4RDXA 4QDTA 1QH9A 3X1YA 1RQPA 1U8ZA 2HCJB 2L2QA 2CV0A 4JJEA 1W4RA 3EOAI 1BDMA 4KIWA 1C5KA 1DZ3A 2XCLA 5FNZA 2ZETA 4IIGA 3FH5A 3BE6A 4KYTA 3LC0A 5C7YA 1UN9A 1WEKA 5AJWA 2YZNA 5GONB 2XQFA 2A0UA 1HFKA 2G28A 3VSAA 2ZM5A 4NULA 3CZCA 2C5FA 2GRAA 4UTRA 1GITA 2BM0A 2VS1A 5IX8A 1HL3A 1NVWQ 5BWLA 1QVAA 4QAJA 2Q3JA 4AXBA 4LERA 2IEIA 4ID9A 4I50A 2HO5A 4P9NA 8LDHA 2Y1LE 4EUEA 4RZSA 5K8VA 2Q7FA 1JSZA 3TSOA 4EQFA 4WXMA 1Z28A 2HJWA 4DV0B 4L9WA 5IDXA 2NU7B 3I5AA 3HN6A 4KZ0A 3OTQA 4Z5XA 1L5KA 1YR8A 2HU8A 4AS2A 4EI7A 4QBTA 3OTIA 4S2UA 5CLFA 3MCUA 4E85A 4HT3B 3MLEA 4LF6B 3ZZ1A 3HWSA 5DHRA 4TXMA 2Q5HA 5H70A 2ZSAA 4AMBA 1K1AA 2AJ8A 1CVLA 1HQDA 4IHAA 3QWWA 1SK9A 2WE7A 1E2PA 2YXEA 4WMLA 1QXSA 4M0KA 4AF6A 1PTJC 3FW1A 1E1RD 4E5MA 1G8MA 1NIPA 4YYZA 3AHGA 4HUQA 3L0OA 2YR0A 5AOAA 1EK5A 3UJ9A 1ZGHA 1FFBA 5E7QA 3RYFB 3ZHYA 2HWKA 3B1XA 3VO1A 3SZ3A 4U5QA 5BNIA 3ML8A 1LTQA 3AILA 1EFHA 3ZQJA 2UDPA 3CSUA 5K45A 5JS1A 3GEEA 3M0EA 3I37X 2JI9A 1UZLA 1J0XO 4RKEA 3K92A 2DHRA 1C7IA 2O06A 4R9VA 4D8TA 3D9OA 5AUOB 2Z83A 3I5YA 2PDAA 3QKIA 2CJYA 2HK6A 4YMUA 4HFMA 2Z30A 3EE6A 1KT1A 2VYIA 2HPHA 3K5PA 1JWAB 4HY3A 3HNRA 1FMCA 1QIGA 1RM5A 2AZTA 3HSKA 2E2EA 2FPLA 4ZTZB 1JEYA 3KWFA 1XTBA 1E3QA 2PD3A 4ALNA 5A5VA 3QUSA 3WTCA 2LNDA 3T1VA 3TDNA 1WJGA 3EXAA 3Q5MA 3E30A 1NW9B 4CCWA 5LYJF 4WVLA 4HEJA 2V45A 1FFDA 2F3SA 4Q0MA 4J8DA 4WINA 3C6KA 4DMHA 1GPAA 4GXNA 2N1MA 3MS4A 3QVLA 4BMSA 2ESRA 2ZJ0A 1N2SA 3PLAE 3QE4A 5EX0A 1G1MA 1JXQA 3HKEB 3VKHA 2P3QA 2ES4A 4U39A 1ZHOA 8OHMA 5M72A 3NCTA 3ZQ4A 4QJBA 3WK9A 2QBYB 1GCAA 3C1AA 3CUEF 3VNRA 4A8PA 2AX4A 3VYWA 3WKDA 3LU1A 3ACBA 1XRRA 4DQXA 5C35A 4KN6A 2QHXA 1RR6A 3P9ZA 3FTUA 2ZUWA 2EP8A 1KOLA 3E34A 4BCDA 2C58A 3JQCA 4AIFA 3SY8A 3O4GA 1T4DA 4MQUA 3RTAA 1F0KA 4RG6A 2ZREA 4K9RA 2C8JA 2DULA 3HXDA 3AR2A 1X1RA 1LNSA 1YS1X 3EHMA 2EEPA 1THGA 1GPNA 4AU1A 3OKFA 3M6XA 1SOMA 5EIDA 3AP2A 1IUOA 2R97A 2E37A 3DZDA 3M82A 2EIKE 5J2TB 5EHXA 4UQZA 1EDZA 2PWBA 4OMUA 4G85A 3ITWA 1SIUA 5JNTA 2Q2QA 2I1LA 4CMCA 4E5NA 5DX8A 4RK7A 2YRWA 2E3JA 2DU8A 1BO6A 4NIMA 3KK0A 2H4HA 4AP5A 2GBIA 3A1WA 2Y0DA 3B70A 1SB9A 3REOA 1FW6A 5ALIA 3TD2A 3M8KA 3F3YA 4NCAA 2J59A 3HXPA 4I99A 4PBTA 4QLOA 2XVMA 5GGXA 3TL2A 3ZV7A 3IQDB 1SC1A 4F1PA 5KX5B 1ODJA 4OLJA 4ERNA 3D9JA 4O8CA 3R6TA 1XKXA 2F4VB 4FN5A 3RJ9A 5EXDA 4RSRA 2PL2A 1HQKA 3I0ZA 2OENG 1FP1D 5KKAA 1VHDA 1ZSNA 3BSWA 3LUKA 4DBLE 3LFUA 5DGHA 9LDBA 3IO3A 4CT4B 3C6MA 1ECLA 5AJLA 5FNVF 3P9CA 4EYEA 1IBRA 4ATNA 2AI2A 1N52A 1CR0A 4GM4A 1GQYA 2ZUDA 4IIJA 3GHYA 3I32A 1T3ZA 1Y6FA 3AVUA 3IJPA 3QVMA 4FDAA 3RO2A 1ILWA 3VR1A 1IY8A 4OYSA 4HDNA 5D3MA 4P4SB 2XDAA 3RRMA 1CR6A 3F74A 1CRWG 2VHTA 4Y7DA 3LE8A 2Q1XA 1O77A 2FFBA 4R1MA 5L45A 3OF3A 4BVLA 4G0YA 3VR2A 4F92B 1MP0A 1ELWA 3K4HA 1HY3A 2GXSA 1UPFA 2EZ9A 3S1AB 3KAPA 1V9LA 1R6TA 3C5EA 1JA9A 2AFVA 1EWYA 5F3DA 2UXBB 3KOOA 4OOFA 5LFAA 2UZIR 4RPJA 1RYBA 5CB4B 3NHPA 3HXOA 3ZU3A 1D04A 4UNNA 3H5AA 3BQ9A 4R41A 2XODA 2PMEA 2IHBA 4KFCA 4DRXB 4UHEA 2EW1A 1AUOA 3B9PA 5FL7A 3B5JA 2GTIA 3QF7A 3LT1A 3L1JA 3FSJX 4Y3UA 2IHYA 1SO8A 1GQ2A 1YT5A 3N8KA 3CVPA 4QYIA 1PLKA 4KGZA 3QOXA 5I7EA 3PE3A 3PZRA 2IY9A 5FXMA 5KCZA 4YI5A 1YR6A 3AU9A 4HWGA 2HR2A 3RBVA 3IUBA 1GN8A 2OHIA 5KJ6A 1O0SA 5H9WA 2WG2A 3IOBA 3QPCA 1RZ4A 4YRTA 3UUFA 1XTRA 4QDUA 4HLCA 1RYYA 4CR6A 4NV0A 3ULKA 4JVMA 4JSYA 4GC5A 3W4IA 1NVDA 1EFUA 4JW1A 4D46A 3BK1A 4HOYA 3WKCA 2FX3A 2AFHE 4JLWA 4GBMA 4MUJA 4E2ZA 1TT5A 4GMRA 1UEIA 3HIZA 1Q0SA 2P75A 4AKSA 3QPVA 5HKLA 4J0EA 4CJXA 3OURA 5HHTA 4PFKA 4PAOA 4WQMA 3FU3A 3GZ2A 3NBNB 1JHYA 4MWSA 3DL4A 2ZAIA 3DUFB 4PQGA 4Y9RA 5A2GA 3ZW3A 4ZA2A 1QOQB 1Z56C 3CEHA 4Q9NA 1UMKA 2BGUA 3VU9B 3Q7TA 3A14A 2XXJA 1PJ4A 1BFUA 4JLSA 2ZSJA 2QNRA 3GZNB 2IZ6A 1Q0TA 2CLKB 3D7MA 1WIWA 3Q7RA 3L0SA 1L5OA 1ZNWA 1HQCA 1W34A 3NHKA 5DYIA 5ENSD 4XDHA 1RMYA 1AKMA 2ZDGA 2BRUC 3GLFB 2IYYA 1J9GA 1D5CA 3HPRA 1SUFA 3U4IA 3H1BA 2G25A 5DRYA 5A3SA 2AOUA 3HG7A 3R4CA 2UZ1B 3KNZA 4OX9B 2Z8YA 4UTZA 3TPCA 4D2IA 3AVPA 1Y80A 1NYQA 4LZAA 2E6UX 3UH1A 3G2MA 1DRVA 2WJIA 1WQ4A 4D6XA 3SNHA 3H1FA 3S1SA 1S2NA 3HMQA 3HNOA 5I9IA 1P1CA 4WEOA 5JZMA 1CF4A 3BG0B 2X8LA 1T0BA 4PG7A 3IR7A 4KXFB 4YR7A 5J4VA 2DFKB 1CJTC 3WGTA 1Y4DE 1J2RA 3FU6A 3IAS6 2C2WA 2HMWA 1EG7A 4MS1A 3VR3A 3IULA 2DZOA 3A9VA 2Z6UA 3OWHA 2EIJE 1HE8B 5LOVF 1H8HD 2QMQA 1ZCBA 2GJ9A 1ZQ9A 1TRKA 4XWAA 4G01B 3C3WA 5EEHA 4EDHA 1O94A 1JEQB 4MVXA 5M34A 4O3MA 4R9UC 1O0BA 2W2LA 1TB4A 4OHOA 4MR8B 1EA7A 3K2QA 4I4IA 3D1LA 1GPLA 4F2DA 1OVGA 1HFAA 2WUEA 2QMEA 3KTAB 1CQIA 2A9RA 4Q1EA 1PO7A 4XE0A 4KIJA 5LQNA 1G64A 2J45A 4Q05A 4INOA 4WY8A 4PLTA 2BFMA 2HYDA 4MDEA 2C3MA 1OASA 4BQRA 3P2YA 4C0QC 1RC0A 1C4OA 1J8QA 1XTIA 2X6RA 4B4DA 1FFEA 4RUKA 5HOEA 5LXTB 2VUUA 4H1HA 4TS1A 3ETCA 1XROA 3E1SA 2M1ZA 2CB0A 2H57A 2ZPTX 3G0GA 4B89A 1PNTA 2VAXA 5LM3A 4II3A 4JOCA 4DSOA 3A31A 2ZU6A 4BWRA 4K05A 4ALKA 3MCAA 5IM5A 3W5HA 1M9NA 3IQGX 3E37A 3LDZA 5LB2A 1K97A 1OPRA 4RTPA 1SQ0A 3RIHA 5HEKA 1H8EA 1W52X 1UKVY 3NVAA 3QX9A 3I6YA 5FTJA 4PX3A 5REQB 4G63A 1S5PA 1U81A 1POWA 4XLTA 1PJ8A 4PLWA 3PHLA 1BDBA 5IT5A 2H6HA 4JYCA 1O1SA 4L6AA 4ZQHA 4KXVA 3PICA 1W36C 5FLYA 4GCNA 2AJLI 1DL5A 1IDN1 1IBSA 3INYA 1FTSA 3D0KA 1X4RA 3HHEA 1EI9A 5BV2P 3I4GA 3B48A 1T13A 3QKWA 1KKLA 3I9MA 4BLTA 1C3LA 3DCYA 2B69A 5JNUA 4JKOA 4MPDA 2CNKA 5LD2B 3HDVA 1ZM9A 2XUPA 1T25A 2B2NA 3GVCA 2QGNA 4J43A 4L9SA 3PL1A 2LDBA 4O2LA 3LT4A 2RFMA 5LCXA 1MNQA 1ZCJA 3ZQ6A 2WIJA 4OJNA 4BLQA 1M2GA 5UKDA 3Q87B 4I1YA 1JJAA 2C97A 4IRMA 2YNMA 3CLHA 1H5UA 2C2OA 3L0BA 3OT5A 2A9FA 3SKYA 4PO8A 4OJQA 3T6KA 2R9VA 1R9NA 1NBIA 1U2ZA 1G21B 5GZ1A 5LNK6 2ZSKA 2W6QA 3KJFA 3E5MA 4ECAA 5KTYA 1O3YA 5T41A 1KZYC 3PZ1A 1GP2A 4GPD1 2WA2A 2EATA 3BJMA 5AVVA 4GNRA 1VIVA 4WLOA 2O7VA 4P2GA 2IXFA 4QTTB 4Y2TA 4PYJA 1HWYA 3GLIA 3TUIC 1KO5A 3OQVA 1NP7A 4ZCSA 1PEKE 3RAJA 2F43B 1SHJA 3ZXXA 4PTLA 3LP5A 3WLEA 3AIKA 5C2YA 2ADFA 2FF5A 3AI2A 2GCGA 4BFCA 5KKCA 4BE7B 3RQSA 1AV7A 1RLTA 3UO8B 4L6CA 1QGDA 2H9IA 3VU0A 3ZHZA 2IQCA 3D8TA 3RB8A 5D5QA 2GB4A 4IZ6A 4H1UA 2XIJA 4L57A 4BQEA 4RETA 5F7JA 3HP1A 1RVV1 3ODGA 3APCA 1YQEA 2HSZA 2CFTA 2IOQA 2GCOA 1NDHA 3PUHA 5D8DA 4L23A 2Q5QA 2I54A 1XQVA 4UBMA 5LBIA 3E18A 2AW5A 3HU3A 1PHPA 4WZBA 1DRKA 4V3CA 5DM0A 2ODEA 1NKVA 3P9KA 1CLEA 3IHKA 4BOYA 4RACA 3LWBA 5IJXA 2UY1B 3VR0A 4R40A 2HA6A 3DNFA 4N54A 1F7VA 3EW7A 3FDIA 3TPFA 2OC4A 4ABNA 2FK8A 1H66A 4CR8A 3TWUA 1AC5A 1U9IC 2VNSA 2ZYWX 5CDYA 3I42A 4IG9A 1QAOA 4A73A 4YUXA 2IYAA 4MMXB 1QHGA 1T8YA 3Q7AA 3TO5A 3I5UA 1SG6A 3IELA 5HKPA 3PEUA 4D1YA 4D43A 5JC8A 4J4TA 3SJBA 3R6DA 3SC2B 2QAJA 5CNKA 4QXAA 5IXSA 2X8BA 5CT6A 2QT1A 1OOEA 4C3UA 2XX3A 4HWRA 4OH7A 6REQA 2YZKA 1U2RA 4RESA 4KNYA 1MX3A 2I66A 1E6LA 1QZTA 4WESB 2BGGA 2W2XA 3T95A 1ZN9A 3R5TA 5IJ0B 1AN9A 2LP4Y 2Z4SA 2N1BA 1SBZA 1OWPA 4KQFA 1MZVA 5EIOA 1NPTO 1YRBA 3BFKA 1OLSB 1JWLA 2DPGA 4OAPA 4S1OA 5JAIA 5JCJD 1K7YA 3V8EA 5KHLB 4ZANA 2IHZA 5BSMA 2PTHA 3GRVA 5DBOA 1M5TA 1XTSA 1ECGA 4ZZ3A 5D1HA 4A2PA 1Y8MA 5CB8A 4H18A 3QLUA 2GBPA 2XCIA 5C5IA 1NNLA 4H31A 1GL9B 3I01A 3VX4A 4BAZA 3WWCA 1P45A 2WJJA 2DTDA 1CQJB 3B20A 5HGXA 3PE4A 1ZS9A 1ONSA 3UINC 2D54A 1A2OA 4CI9A 2FHPA 1WXDA 3TMYA 2BKLA 2QRHA 3IHWA 1GJRA 3ZZ0A 2ZI9A 3M83A 4F3TA 2QMUA 4HAXA 3TFOA 3OOSA 1G5IA 4Q19A 3DKKA 4I66A 3K6JA 3DWGA 5BSWA 2Q1TA 4C08A 4WBXC 1O58A 1OBFO 4AP9A 4EVSA 2JJ1D 2WKRA 1CQWA 2ABWA 4BWYA 3ZE8A 3KPVA 2VPWA 2PH5A 2DXIA 2G8LA 3U6KA 1JEAA 2E4WA 4AI6A 3TGLA 2ZIAA 2IZ1A 3UM0A 3RV4A 2CXSA 1DXOA 3E7PA 3A8TA 4M22A 4BZXA 4Q37A 5GQSA 2AKAB 1NR1A 2WSBA 3U4QA 3EXHC 2QTVA 4FC6A 3T0IA 1CFZA 3SBDA 5JD4A 1QB7A 3J7AC 5DSTA 2FV8A 5KWEA 1G3IA 2GZHA 1JDJA 4LYGA 5TX7A 4A2CA 4LISA 1HE5A 1Z6GA 1DUIA 4ZRMA 3S28A 1JE0A 2O5EA 4HZUB 2Q4TA 1B1AA 2VP0A 5IASA 1CNMA 3PF9A 5GOTA 2FN4A 4KO2S 4IN3B 2G71A 3PD1A 4CUKA 1U8EA 2HA7A 4NNPA 2QNIA 3AJDA 1T1RA 5H82A 2E87A 1MJGA 4JQYA 4EP1A 4X1IB 4FYHA 3PT9A 4FT4A 3U6BA 3WBFA 4LBVA 2BZ1A 3PEEA 2JJ2A 4Q1DA 2WHRA 2QOEA 2QR5A 2PMBA 1H0SA 2PM7A 3NIBA 1O96B 2W83A 3UMSA 4IUDS 4QKQA 1C0KA 4UTNA 2WMNB 2LKDA 4GPKA 1KJZA 4PYMA 3QUAA 5EJ9A 1AGPA 1NFIE 1FQOA 1VYVA 3TIVA 3M6VA 4GYWA 4RVGA 4OCZA 4MGZR 3OZEA 2ILRA 3X0DA 5LP1A 1QMGA 3U4CA 3W5BA 2Z9BA 4FGLA 3GN1A 4JWTA 2XUZA 4HN2A 4TXNA 3MRTA 2YV4A 2XSZD 3QBDA 1GWNA 2ZS8A 5CDFE 2DMRA 1D6MA 1IDOA 4CTOA 4PHTA 3OOHA 1RDFA 4GTTA 2ORED 4MRSA 4A36A 1Y33E 3CLTC 1HMPA 1M83A 3FYDA 4OD0A 4POAA 2HMVA 4DXAA 5EX3A 2QMYA 3MXOA 3SKXA 5AD1A 2VDNB 3GRUA 2RBEA 1FW8A 3P94A 4K9KA 3TTUA 4F85A 3QY9A 4RW0A 1E3TA 4TLLB 4OM7A 3OD1A 1NBEA 3NTLA 3AKCA 4JQSA 3ZD8A 3WMEA 3GZJA 1W49A 2I80A 1UZUA