4AY6A

Human o-glcnac transferase (ogt) in complex with udp-5sglcnac and substrate peptide
Total Genus 257
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
257
sequence length
717
structure length
698
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYLTRANS F
publication title O-Glcnac Transferase Invokes Nucleotide Sugar Pyrophosphate Participation in Catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 257
structure length 698
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ay6A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ay6A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4ay6A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4ay6A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ay6A03
2FF5A 4AMBA 5HI7A 2F9FA 1XL0A 5KJKA 1JIXA 3T5TA 5BNWA 1IYGA 3FWVA 4G23A 1QKJA 2XCCA 2LNIA 2JJMA 1KT1A 5G04J 3BCRA 2VSYA 3MS7A 2GW1A 2XCUA 4Y6WA 1P2GA 3OKCA 4G2VA 2F3UA 5GPBA 3O3CA 3CVPA 3ZN3A 1IIRA 2QRPA 3GZ2A 3ASGA 4BT9A 2QN8A 1SXQA 3SZ7A 2QLNA 2J9QA 3S7FA 1FU4A 4M7PA 3MBOA 4GYOA 1LWOA 2WPVA 2HO1A 2XA9A 3ASFA 3ZCQA 2C4MA 1P5QA 2JLBA 4KBQA 3UQ3A 1B4DA 1JEJA 1FU7A 3LYAA 4GYWA 1WV0A 3HBNA 1GG8A 3U4TA 4PQGA 2G9VA 4J8DA 3HBJA 3MRTA 2QFCA 4BQIA 3BD6A 1HH8A 3OY2A 2FI7A 4W9RA 2GEJA 4U04A 1RZVA 5JJ6A 2PQ6A 1JG6A 2X6RA 3G2IA 3L7CA 1AHPA 2YJNA 4NRHB 4EQFA 2ACWA 1WUTA 3CUYA 2OFFA 3NB0A 4KYOB 3MT9A 3QWPA 1K08A 3C4VA 3S29A 3S28A 1B89A 2KC7A 1P2DA 4NESA 2GPAA 3NPAA 1WAO1 5I45A 3AS5A 4MRAA 1TJCA 1HXIA 3ZCRA 3KS2A 4BTAA 1L5WA 2VYIA 3SF4A 1PN3A 1NA3A 3MS2A 1GZ5A 1LWNA 3OT5A 1QM5A 1ELRA 3RHZA 2SKEA 2PQRA 2FBNA 3E4BA 5ARFA 2KCLA 2F3QA 4XI9A 4YVQC 2ONDA 3MQFA 3S7DA 2UY1B 4F9FA 1Y6GA 3L7BA 3CKBA 3CVNA 3RO2A 1UZUA 1BX3A 3DDWA 5LCWC 3N71A 3HBMA 2KS6A 3K9IA 3BCSA 5TMBA 2XGOA 5DXFA 3NCHA 3E3NA 2FF4A 1Y8ZA 2GPNA 3T3DA 3T7DA 4MHOA 2GEKA 3T3GA 1FTYA 3Q3EA 4LEIA 4NEQA 4F96A 4HOTA 4BTBA 3QWVA 2KCVA 3T3IA 4WNFA 1E1YA 3ZFWA 4A1SA 3LY7A 5DU2A 1WV1A 4GYYA 3GZ1A 1NZFA 1C8LA 3L01A 3EBOA 5DIZA 4J8FA 2PL2A 3BCUA 3S0JA 5A6CA 3HYMB 2PZIA 3FFLA 4N5CA 3IAAA 3ZCTA 1K06A 4H7YA 2HY7A 2QRQA 3MV3B 4YI3A 3S27A 4CTMA 5HQ8A 2QRMA 4RIGA 4UI9C 3CK9A 2C2LA 3MRXA 6GPBA 4GCOA 1Y8MA 2BFWA 3COPA 3MRVA 3UYKA 2FFRA 3ASHA 2F3PA 2UY1A 4N3CA 5FZSA 3OTGA 4WUYA 3ZHEB 4RIEA 3RSCA 5FZRA 1XL1A 4EL0A 1NVKA 3UYLA 2G9QA 4GCNA 2IYFA 2QLMA 1NOKA 2YQ8A 3DDSA 2E2EA 5IKPA 4O6FA 1QZ2A 3VTYA 1P4GA 2XEVA 3LY9A 3GPBA 4J8EA 4UI9J 5AYWD 2XA1A 4UQZA 2QRGA 3G2KA 2X0FA 4KQ1A 1A17A 2MHKA 3ZCPA 4EJ2A 3VUEA 3ZCUA 2ZB2A 3CEMA 1L5VA 4BWRA 4KQMA 5DBKA 2XGMA 5HXAA 1JG7A 2XCIA 2XA2A 4N3AA 3Q5MA 2IF4A 2X0DA 3CVQA 4EKYA 1NOIA 2HR2A 1J39A 2R68A 1XKXA 4N9WA 3WADA 3AS4A 3WC4A 3CVLA 2QN1A 3U3WA 2FEZA 2VGYA 4ME2A 4NQ0A 3L7AA 3Q3HA 2ACVA 3ESKA 3VDMA 3MTDA 4RG6A 2R4TA 2C9ZA 1RRVA 5M72A 3ZHEA 3T3HA 3LCAA 2FO7A 3MTBA 4GZ3A 1FS4A 4WHMA 4U0ZA 3G2JA 2R60A 1WUYA 1NZNA 1E4OA 4G25A 4NC9A 2PQNA 2PYDA 4MI6A 3PE4A 5TMDA 8GPBA 1WW2A 9GPBA 4HOQA 4QLBA 3O48A 4G24A 2GPBA 2VSNA 4J0UA 4GZ5A 2IW1A 1C8KA 2SKDA 3AMVA 3RT1A 1Z8DA 4HORA 1RZUA 3OKAA 4H7XA 3MT8A 3KD7A 3C4QA 5EX0A 1C50A 4HLNA 3E3OA 5DLDA 3DD1A 2R4UA 1GPAA 3NP9A 3S7JA 4JL0A 5D01A 4WNEA 2Y4TA 4CDRA 1JIVA 3CEHA 4YVOA 4REMA 3NC4A 2H1FA 4WNDA 2XPIA 4I2WA 3BDAA 3MTAA 2OOEA 2V5FA 1FU8A 3UPVA 2ATIA 4RENA 1ZU2A 5FZQA 1FC0A 3BD7A 3HBFA 1V4VA 3TAXA 4RBNA 3ZCVA 1YA6A 4UQYA 4F97A 3ZPJA 3AS8A 2AV6A 2Y4UA 4I9CA 5EKQD 2C0MA 3ASDA 5ENZA 4YI5A 1KLXA 1EM6A 4WADA 4XIFA 4L22A 1IHGA 3BD8A 3OXGA 4HWGA 1VGVA 1Z6QA 2BGTA 3DZCA 3G2HA 4JHRA 3MS4A 5LCWJ 2PRIA 3IEGA 4AMGA 2QRHA 3Q3IA 4MICA 3RKVA 4AM9A 2NC9A 4BQFA 1L5QA 4FZRA 4XI0A 1QQEA 4U0SA 2G9RA 2R66A 2QN3A 5IKOA 3BEOA 2X0EA 4W6QA 3VTXA 1P4JA 4EKEA 1ABBA 5G05C 1GFZA 1M5RA 3LKUA 4JA9A 4MI9A 3G2NA 2SKCA 3SYMA 2C1XA 3OXFA 2JZCA 5KJMA 1P2BA 3FP3A 2BISA 4GPBA 1P4HA 2QLLA 4HOSA 4KXKB 4N2SA 2IYAA 3OXLA 1L5SA 3GW4A 3OY7A 3CEQA 4LDPA 4ABNA 3KAEA 4YUAA 3PE3A 1L7XA 2Q6VA 3RO3A 3Q4AB 1AXRA 4M83A 4Z5XA 5JTUA 4RIIA 4G1TA 4APOA 4CGVA 3LY8A 3VDNB 3QOUA 4AIFA 1GPYA 3D0RA 2R5SA 1XV5A 4AN4A 3CV3A 5G04C 3WAGA 3EBPA 1PYGA 5CHEE 4MI3A 4X7PA 3H4TA 4X6LA 3RSZA 5D0OD 3VUFA 3NP7A 4CTOA 2GJ4A 1JIUA 4LEUA 2ECPA 3CUUA 5LQDA 2Q7FA 3JYSA 1NZDA 2H1HA 1HZ4A 2C0LA 4GA0A 1NOJA 2G9UA 4GZ6A 2VCHA 3GUHA 4G26A 4X7RA 4BQEA 2IV3A 2QN2A 1L6IA 2XCBA 1XNFA 2VQ2A 5FJYA 5JTTA 3QKYA 3CX4A 2LSVA 4I1AA 4F3VA 3H4IA 3WXXA 2QNBA 2HYZA 3BEEA 5D0QD 1YA0A 2WQHA 3TG5A 3QHPA 3FROA 3TGOA 2BGUA 3R9AB 1UQTA 4X7MA 3G2LA 3NF1A 2BUGA 4KQ2A 3RIBA 5KJLA 3QKWA 4B94A 1ZBPA 1Z62A 4IN3B 1F6DA 1HLFA 3CK7A 5CCLA 1XOIA 5D00A 3OTIA 1UQUA 4UI9K 2LSUA 3SYRA 5FT9A 3CUWA 1WM5A 5KJNA 1NA0A 2KATA 2XMPA 7GPBA 2GM9A 1XC7A 1FCHA 2DBAA 2UWJG 2IFUA 4JA7A 3URZA 3D1JA 2X6QA 4M60A 3GYZA 3OKPA 1KT0A 4MHSA 2AZDA 1EXVA 3CKCA 3QDNA 1C3JA 2C1ZA 2AW3A 2FETA 3L7DA 4WNGA 4EL5A 3UUXA 2QZSA 1PSWA 2IUYA 3CUVA 4U07A 2XGSA 4AY6A 1WW3A 4RIHA 3Q47B 4GPKA 2QN9A 5A7DB 1Y6FA 3ULQA 2WTXA 3ZGQA 5C1DA 4N39A 3CK8A 4U0UA 1GGNA 2P6PA 3E3LA 3L79A 3NAZA 1PNVA 1F0KA 3Q15A 3S2UA 3CUTA 1KTIA 4WACA 3TSAA 5EX3A 2P58C 2VGXB 1FTWA 5TMEA 5TVGA 3S7BA 4CTNA 3MSCA 1H5UA 3TG4A 2I6HA 5JJ7A 4BFCA 1O6CA 2VG8A 2IV7A 2KCKA 3IA7A 4GA1A 4YNDA 2QN7A 4RELA 1OUVA 3MEKA 2PRJA 4G2TA 4Y6CA 1SXPA 3ZCSA 3D0QA 5CCMA 2YHCA 2F3SA 4I9EA 4RIFA 5BT1A 1ELWA 4RG9A 3MV2B 4CGWA 3T3EA 1IXYA 1W3BA 4UQXA 4I17A 4HOUA 1Z6PA 1FA9A 3MT7A 5ARGA 2O6LA 4N3BA 3LPZA 1PC2A 2IEGA 4BT8A 5G05J 2GT1A 1A8IA 3MKRA 1GPBA 1P29A 3C48A 1NLMA 1E96B 4I2ZA 3PDNA 2VCEA 2IEIA 3QWWA 2L6JA 5FTPA 2AMVA 5JJTA 3Q49B 4GA2A 2ASVA 5BW8C 3OTHA 3CEJA 3CV0A 3RU0A 2PYIA 2VGXA 1L5RA 3MA5A 3EDTB 4AY5A 1FTQA 4FKZA 4N2QA 2AVPA 3TOVA 1YGPA 3RJVA
chains in the Genus database with same CATH superfamily
2QB5A 2VQEB 2FEKA 4UOZA 5F4BA 1D8TA 4BE9A 3ZTYA 2CXHA 4FDLA 3IOYA 4HAOA 7MDHA 5BSVA 2VJBA 1E79D 3C6XA 3H86A 1G5TA 1VCIA 3F2IA 1WM1A 5E1MA 4AIIA 1UBEA 5L7WA 3W5SA 2B21A 4ZI2A 4WBSA 2WM8A 3LLUA 2K4MA 4LI3X 4BFRA 2COEA 1UKVY 4GM1A 2ZBPA 3QG1A 2P5SA 4PSUA 1U3CA 2JJ2D 2VQ6A 1YZNA 4IR7A 4J4BA 3EMVA 4NCKA 5BN5B 3V5NA 3HK2A 2NO1A 5H82A 4HSGA 5BUCA 4DGQA 3KTAA 3DLPX 3F0TA 3ZD9A 1WA5A 3RWOA 1K0FA 2I2FA 3D9OA 1CF4A 3SXJA 4EY6A 3PFNA 3IAHA 3NB2A 1VZ3A 1ZOIA 1UP6A 5EJ6A 2LGJA 3A4TA 3H2HA 3PQ2A 4R2HA 1TIKA 4LHVA 4O1HA 4QBTA 3ZXSA 2E1PA 3U3MA 4C30A 4HPJB 4V0SA 2B5WA 4F6RB 1SUBA 2C57A 4BWRA 2IOHA 4IHKA 5AJTA 3A3PA 4PGAA 5J2TA 2IH2A 2FLWA 3WA7A 1Z2EA 4QQ8A 1OT5A 4O1IA 3O21A 3LQRA 5CG2A 3QEMA 3VDMA 5DNDA 3IDQA 1LD7A 1XXLA 4YPOA 4H77A 4JDUA 4DA7A 1HYGA 2C2BA 3CNHA 3U6BA 2R60A 5DBFA 2B1QA 2WJ4A 2A78A 3H83A 2ZPUA 2UZ4A 1GUDA 1O5OA 3DZ8A 2B5VA 1MD9A 3OA2A 3K32A 6YASA 1DO2A 4C0AC 4GMHA 2PTHA 4LOKA 3LKBA 3O93A 3ZWVA 5BT9A 4X1IA 1SG6A 3USES 3TR5A 2NIPA 1YA6A 2R25B 4H4CA 4LSZE 5EKQD 1EM6A 1P0CA 2H2FA 2OGUA 2YVUA 3FPJA 3IB3A 3EGXA 2Q0XA 4IDDA 1Y33E 2VA9A 4ND8B 4YJGB 3OX3A 3F78A 3GCZA 1X87A 1P2TA 4HFGA 2G70A 3D81A 4MI9A 5LZ7A 3SZOA 4OQFA 1C0EA 3FP3A 3EF0A 3EPLA 2Q6LA 4XKCA 9LDTA 2ZGGA 3TR0A 4IRUA 3SBDA 4PYIA 4ZZ3A 1U6IA 1OV6A 1JVSA 4FHCA 1MAAA 4DABA 3FDZA 1ENYA 2WDPA 4MRPA 3ESLA 3U64A 6ADHA 1CHNA 3PX3A 2ZYDA 4JL6A 3K8YA 3QKYA 2GBIA 1IHOA 4G9GA 3B1ZA 3WYBA 4XEHA 1X7WA 2QAJA 2QTZA 4E4TA 3L0CA 2L18A 2ZSJA 4A5OA 2WHEA 2ETCA 3FZEA 2FW1A 1NGSA 4F12A 3ASOE 3FGOA 3D5TA 2RH8A 1N0HA 2X42A 1N2GA 3NZSA 4B0OA 4AP9A 3GLGE 2FEPA 3EYAA 2AD5A 2ZI5A 3JQ6A 1W85B 3JVUA 4S04A 4JLUA 3D8UA 1YR1A 1QP4A 5EN5D 4X9XA 4MIEA 2R6DA 1TECE 1JU9A 4EVQA 3MSCA 5FLKA 1JLKA 1KEKA 2QK4A 1HI9A 3LA8A 3RYFA 3DM9B 1ISGA 4JX9A 2EJVA 1YU6A 3VSAA 3IE0A 4QYIA 2A0UA 4AKTA 3I8OA 1M2VA 3IHWA 5BXOA 4B8WA 2ETBA 4JEMA 2WVGA 5D5PA 3J80A 2J1LA 1NQUA 5CJJA 2B8WA 4HFRA 5BNWA 1ZZEA 5AVTA 3BCRA 1NVWQ 1RLUA 1U9YA 1QBQA 2IE8A 1FFHA 2GPTA 4AKIA 4YAGA 2HJSA 2SHKA 5B2FA 4C3ZA 1PJQA 4OHXA 3U4QA 1B42A 5FKJA 3RASA 2PS3A 1H0RA 1E1RA 4YRCA 2FQYA 3RU9A 4R1QA 2YBEA 1B8OA 3GEGA 3MT9A 2EEPA 4QLOA 5F73A 2VJCA 2OBMA 2HK7A 1EWYA 2C8JA 5G3ZA 4BP1A 4INJA 4WXHA 3PGMA 1CEXA 1SXJB 3LL4A 1LTHR 3CF4A 3OF2A 3WLTA 3I5AA 5E2BA 3NBZC 1L6RA 4M38A 1XTZA 2FMTA 4C7OA 1E3WA 1KEVA 1O9GA 4X91A 4WH0A 2YRWA 5LP6F 5MFZA 3FCOA 2QE6A 4QDZA 3K9GA 3U3KA 1N5RA 3T3NA 4RZQA 1N32B 5ALNA 2AG8A 1GAXA 1QDUA 1YTUA 3FVQA 1RJ9A 1DRUA 2PS0A 3HU3A 2DBVO 3KQMA 3PWTA 4LHYA 4IH9A 2OBBA 4YRMA 1DFIA 4HNSA 4KT6B 3TW8A 4R40A 3RC7A 2A58A 3S0JA 4BMSA 3NM5A 3S27A 2QRMA 1K88A 4DG5A 1Y8MA 3I5MA 4NX2A 4LNUD 2NVUA 1FYXA 1EA5A 2LAIA 1QZ2A 2E87A 4YCBA 4J49A 1Q1BA 4WERA 3BRCA 4RPIA 2BF7A 4PG4A 1JAXA 5H16A 1V2HE 4I14A 4TSFD 1MJ5A 2BC9A 8ATCA 2G09A 5IARA 3ZD7A 4X1KA 1NVVQ 3EXEB 1NLYA 4K40A 4D44A 4XA8A 5JY6A 1RWKA 1XEXA 2V96A 1Z39A 4RJKA 2X3FA 4GMJA 3WS7A 3H5NA 3P45A 4M7WA 4LHZA 4U3JA 4E13A 3E61A 5EMJA 1O94A 3SBEA 2IY7A 2OAQ1 4CZ2A 1QO7A 3Q72A 1T6YA 2V58A 4NBSA 4PG5A 2JJ8A 2X9LA 3QB2A 2R62A 1TC2A 2HJVA 1YJBA 1X8KA 1QZ3A 3GUCA 2YXEA 1AK2A 3PRJA 4CKYA 1SKYB 3PGJA 1CT9A 3QX8A 4Q9DA 5EI5A 2I9CA 1VGVA 4BGIA 2Y77A 3S2GA 3ZJTA 3QVJA 1NU8A 1KZPA 2WUFA 3C8HA 3M4JA 4IJVA 5SZIA 4WNIA 1X9HA 3BEOA 3KNZA 3G2NA 3RVBA 1VYHA 1IN4A 4PWZA 1EVLA 5EXDA 4TSRA 2BISA 1R10A 1R16A 3H5OA 2XWSA 5ILQA 5B1HA 4Z5XA 4PN7A 2B4YA 2VBCA 2ZBUA 1UPCA 4LJ5A 2O8BA 4GLLA 4U95D 3GBPA 4HY3A 3KTOA 2I66A 3VO8A 4OH7A 2TS1A 2F9MA 1JCQA 4MKFA 1G8YA 3MFQA 4DJ5X 3MJWA 2H5EA 4YCNA 2WAAA 3N6XA 1INZA 2GTIA 1AF7A 5KOHB 1XTQA 4YJFB 2PLFA 4DLQA 1XVIA 3IDOA 3R3HA 1PX0A 4GIBA 4L1KA 1UQUA 2PVSA 4NCHA 3F4BA 2LXNA 2G0TA 4G1UC 5C1BA 1ODTC 1V6AA 3QVKA 2AFIA 1Y7TA 2I1JA 1CUXA 5CFPA 4N48A 1BROA 3E37A 2I4MA 3I9MA 3RRMA 4L8FA 2D13A 2C29D 3BZUA 3UKUG 3UUWA 5A0VA 1C4WA 5JNWA 4IVRA 3NONA 2OESA 1P1JA 3BRQA 4G09A 3BVPA 1I2AA 2VG8A 3KHSA 1EFVB 1AO3A 4JLKA 4CKWA 3SHOA 4K6OA 8LDHA 3D7SA 4B75A 3BIFA 1TDJA 5TNXA 1YOVA 2VRCA 4Y0NA 1AA6A 3NX4A 3BMXA 2OVBA 1O97D 1KO5A 3GMIA 4DJFC 1HEIA 5JPCA 3OTQA 3WTBA 2NXWA 3SF8A 1WMBA 3ER9A 3L46A 1RE1A 3PZ2A 2FQWA 4W8GA 4PAGA 4MV1A 3TD2A 5LQNA 3CN9A 3DB1A 1BN6A 1F8XA 3DUFA 3JQQA 5F1KA 2YC2C 4QE3A 1K4MA 3M9XA 1IIRA 1Z2AA 4XX0A 2CD7A 5FORA 5KB3A 4FILA 5SZHB 3VYUB 4B3MB 4ZVVA 3VR5H 2FMXA 2VP9A 4NFLA 2A8YA 4LBYA 3DOOA 1VI2A 3C6YA 5AVWA 4QGFA 3EQ6A 5K8CA 1ZQ9A 1QCCA 2GVZC 3KT8A 4XQ9A 1OI3A 1GCGA 4ZT5A 4J7AA 3OH8A 3CA8A 2GHIA 3WRXC 3U1TA 5CT5A 1PFQA 3THRA 4HSEA 3AJDA 1RNLA 2I5PO 1JTEA 5TE9A 3AFNA 3UA4A 4A2CA 2YW2A 4QBFA 3OZ7A 3U37A 5IHXA 4NE9A 1F2TA 2RAUA 2REXB 2EHDA 3SHQA 2YH2A 3V1NA 5EIEA 3TLYA 1NZFA 4OL0A 4CTMA 4J6IA 3MOGA 5KYUA 4WEOA 3NYIA 4GOND 2XE6A 4KBYA 1XGKA 3DMDA 4MPJA 3D3WA 3PSAA 2P9CA 3ZUVB 3VH1A 1YH3A 1YB7A 4ESHA 4NARA 5BQXA 5FV4A 2WT4A 4DM7A 5DI3B 1JSZA 3HV0A 4AQYB 1GZHB 1SUWA 4ZOLB 4UMFA 3S8YA 1ODFA 2CKMA 1XKXA 4FZJA 3C3QA 4FTWA 4NQ0A 1HQKA 1KEEA 1Z8NA 4HHEA 4DYVA 4IV5A 2V6JA 1T1RA 4O4HB 4AT1A 2XV1A 5A7HA 2OBNA 3A2LA 5EHNA 2O3RA 4X1YB 2A9JA 1BRTA 4Q9AA 1TW2A 3EYWA 1M6VB 1QE5A 5BV8A 3OKAA 1DDOA 3L82B 4PLFA 4XQCA 5AOVA 1AT1A 4RD2A 2ZZMA 4KSBA 4BEBA 4MO9A 2F1KA 1RE0A 4JL0A 1O1TA 4EB6B 3HYNA 3WIEA 3HZOA 4URZR 2GARA 3V2OA 5K6AA 3CY6A 3DBLB 5CERB 2JAUA 2OEVA 1QHEA 4GGPA 3Q7RA 4EIWA 1QG0A 4Q4DA 2JEKA 1NBOA 1NYLA 1BMFA 3DF9A 4M0PA 2ZSHA 3GARA 4W7HA 4JP8A 4MNTA 5HIAA 3TW6A 4JOSA 3DKVA 3UK6A 4KNYA 3V4RA 3DEPA 2I6UA 1ZJ4A 1SU6A 2ZJ6A 4G5SA 4IJWA 3RGWS 3QNKA 4LQLA 4LNHA 3DGEC 1IWBB 4D4IA 1K8ZB 4FT2A 2G36A 3PLRA 5HBRA 3TG5A 1UT8A 1G9SA 3FTFA 2GZAA 4FHGA 2DCUA 2CK3D 4IZOA 2E49A 4A4DA 3D9JA 2FGKA 3NTQA 5EZSA 1U8ZA 4EHNA 2FJDB 1K6MA 2IU0A 1FSZA 5BV7A 1AKMA 4CL2A 3L17A 4EZLA 3APCA 1V3VA 2DQ4A 2H0RA 4BX9A 1SH7A 4YV0A 4TWAA 1KK2A 2B1GA 3EUVA 2DBQA 2Q3HA 5EXEA 4KZCA 3W8DA 3K8QA 4DCVA 3QX3A 4OO3A 2IYTA 3OQIB 5K51A 4BRUA 4A55A 3AEXA 3I73A 5I9IA 1EHIA 1SC4A 2QU7A 3HJBA 4U7TB 2I65A 3QLVC 3R9XA 5AHWA 1L5NA 4CFYA 4V2IA 3VC1A 2O54A 4LDRA 3B85A 1A9XA 1S3FA 3HXMA 3GVHA 2F3SA 1ZOSA 1ELWA 3EUEA 3TTSA 3FYCA 1C3XA 4NY1A 3D5EA 3V3TA 1Q0RA 2KMLA 4MUKA 3LCJA 3MKRA 4DUPA 3WGOA 3TIGA 4NMMA 2IYVA 2AN4A 1JN0A 4LRXA 5IK2A 1BVYF 3LC2O 4RVGA 3QGMA 1PQ4A 2YHSA 5DXJA 3V8EA 2EKBA 2OXFA 1GT91 1X9IA 4NCAA 6PFKA 1HEUA 1T0HB 4IGKA 4JWKA 5KJKA 3NMUF 1Y6IA 2F90A 5G04J 3C6KA 2NQ8A 3FWNA 4HQFA 4IIHA 1T34A 4B0PA 3UWOA 4JUDX 4FWBA 2FKAA 4TWZA 3DV2A 4HH3C 4B32A 2PX4A 4KN6A 5DTEA 3VPGA 2Q1TA 5F1YA 4IV0A 1WZUA 1W34A 1QOZA 1UJKA 2KE5A 4QT4A 3S8MA 1YR6A 3MZLB 2GN0A 5I45A 3FEYA 3SEQA 1YQDA 4OQNA 3T8MA 1POXA 3VOAA 4DM3A 4G4SO 2EFDB 1A9QA 2Y27A 1CQPA 2FBNA 2ZS8A 5AI8A 4AYXA 1KPHA 1RKUA 2ZBRA 1J20A 1O03A 2OFWA 2RHWA 3DZKA 4C08A 2H6HA 2AMJA 1MO5A 1YTLA 3ORRA 4CL3A 5CXSA 2PRSA 3RG8A 4A8HA 3WGTA 3I5XA 1WB4A 4D45A 3CLVA 5DU2A 4NMLA 4G0XA 1R0SA 1BWRA 4N8EA 4M9SA 4NJEA 5HMMA 4AZ3A 1MMFB 3TTYA 4O25A 2J08A 4KPGA 2X9VA 1U8XX 3PXEA 3QU7A 1C8BA 2XUQA 2X0FA 5IAJA 4GMLA 4UHKA 2IS6A 2X0DA 2HA6A 2HCJB 2I3ZA 4ZHSA 2V54A 2B3TA 4ME2A 2C4TA 4X61A 2RGGA 3LVQE 4BGDA 2QD2A 1LI5A 5JXHA 4XE0A 1QO0D 3KJXA 1HLGA 4BO6A 3D8BA 5LLDA 2CDAA 4JLPA 3F6CA 4E5VA 4H60A 3N7TA 9GPBA 1E2QA 4G0PA 1CB7A 3IQHX 1PW7A 4A9AA 4HXFB 3T12A 1QTRA 5EE9A 2FY8A 3U61B 3DMHA 5JS2A 2XUAA 5FI5A 3K6JA 3MZ0A 1GFIA 4A2WA 4PLCA 1KLXA 3PXUA 4YQYA 4A8JA 1Y7PA 3IYLW 4FSHA 5I7SA 4ND3A 1A9OA 4RNDB 1ZCZA 1QFJA 2VPIA 1GPJA 3EHEA 5AQ1A 4Q82A 1D7AA 4UDNA 1QCYA 5EP3A 4IDHA 1I3MA 1SHUX 1LH0A 5L3SA 1EVKA 4ZXPA 4EPRA 3N8IA 4JL5A 4YR7A 2CJPA 1GJRA 2VPWA 2QV0A 5IJWA 3DBHB 1WS6A 2VSOA 5EZYF 2CNBA 2VJMA 2I8AA 3GJRA 2ARKA 1USVA 1GW6A 4UDOA 3U7QA 3PVSA 2CLFB 5IJZA 4G01B 2CFTA 5HPYB 2FSFA 3Q79A 3ZDCA 2X2FA 1DC6A 2B30A 3C24A 5F7ZA 4N5IX 4DIFA 2BGUA 4ZODA 1KTVA 4CWAA 3G0CA 5C9ZA 2QNRA 1N5MA 2C5BA 4YRSA 5AVQA 1BE0A 4A03A 4D0SA 5IN5A 4UI9K 4Y9TA 1T8YA 3MYYA 3TL2A 2C54A 1I6LA 4X8MA 4ZALA 1DJPA 3SYLA 3CWZA 3VVCA 1IN7A 1DDGA 1GZ7A 1U0OC 4BFXA 5ITVA 2H4XA 3U81A 4A0QA 3STUA 5EZYA 3H1GA 2IV7A 3TM5A 4DAOA 4Z4IA 1O1YA 4LDQA 1P80A 2OGZA 5EUQB 3QBVA 2O7QA 3IUYA 1YB4A 3T7SA 2P9JA 2ZAOA 5AN8A 1XDWA 2XHEA 1UK9A 4AJ4A 3PXCX 1XQYA 3GQVA 1UF9A 2ZWAA 3TVTA 4EHHA 1VLQA 3TZHA 3BWCA 2ZSKA 5FPTA 3RFFA 1DIOB 1XL0A 3T5TA 4LCJA 3F8WA 3PT5A 4R3WA 4D9JA 1Y0BA 1EFLA 1ZISA 1C30A 2H2AA 2F3UA 2I2OA 2ZB4A 1X1BA 1G6HA 3S7FA 1UMDA 3CX6A 1RKQA 3QVTA 1YE5A 3L1JA 1MIOB 1JEJA 2X5XA 3KALA 1QB8A 5GTDA 4L7QA 4C22A 3NFYA 4QARA 2BFMA 1V16A 5E1DA 1Q7EA 4EMBA 4M4SA 2AJBA 4U4AA 3P2OA 3SS9X 2B94A 4RDIA 1AO0A 1G3MA 1Z5GA 4B3XA 2PL9A 5KNCH 5JCPA 1R8SA 3F90A 2CFUA 1M33A 5A7FA 3DEIA 1JPNA 1Y6GA 4G8KA 1G2OA 4B3DA 2XYVA 3Q3VA 5FI0B 2HCTA 5HE8A 1ZIYA 3ZTTA 1WBBA 2AH5A 5CYPA 3EULA 2WJJA 2QE7D 2EFCB 1KIAA 3IGFA 2XGGA 4OLJA 1NSFA 3BL6A 3DP7A 4WNFA 4X44A 2JFXA 4OAOA 4B85A 5CYGA 1XJ0A 4N47A 2DUUA 3LWBA 3D9MA 3GNLA 1MCZA 4J0QA 4AN0A 3LRPA 2EG9A 3LP8A 5DBOA 4XEIG 2CL7X 2MRIA 1SOAA 2A5JA 4AJ9A 3OJ0A 5JOQA 1JDZA 4PXYA 2WXIA 2XXBA 3QUQA 5HS0A 4HI0E 4KMRA 1J70A 4HX9A 2WD7A 1UBJS 1XWWA 4F71A 5EDSA 1R6AA 3K1YA 4R2MA 1CF2O 4ENTA 4KRYA 4EPZA 4IJ5A 2XE8A 5F35A 4IS2A 2Q2VA 3RC2A 1EQUA 4ATZD 2CHVA 2X5NA 3KHKA 1YFZA 2YQ4A 1ORTA 2AYYA 5I8ZA 5L3QB 3CO0S 1T8SA 5REQA 5LD2B 3ANYB 3HJFA 1OPRA 4R9RA 2WSIA 4AJIA 4OMFG 2YJ5A 5IMBA 1TJ4A 2ZAGA 4MUXA 4ZCIA 4URFA 4O2AF 5TLSA 1X7ZA 2KYRA 5JO9A 3DQPA 1K3UB 1WCYA 3EQ9A 2AG1A 4YNBA 3ZXYA 2C5FA 3KCQA 5KU1A 5BQPA 4J9UE 1R50A 3KC2A 4U5XA 3RSGA 1U0JA 1CUHA 1NWHA 2VS1A 2X8BA 4MVJM 5DF1A 5CB6A 1M0EA 3BXGA 3NHSA 3N0VA 5CDFE 4J0EA 2R2GA 1FRQA 1FP4B 5BNFA 1IBMB 2C61A 1PJTA 1N1MA 4UCWA 1GU1A 3T1VA 3I30X 3HKCA 1QF7A 1XNFA 4JXKA 2W4IA 3P9NA 4D3SA 3V8QA 4FFRA 5DK6A 2FMKA 3SY2A 1KYVA 3R8CA 3RF6A 4PO9A 3AVTA 2VQDA 4DK5A 5G3YA 3DPIA 5EJIA 2F3RA 3W3AD 3KAJA 4RV9A 2CNWD 3CUWA 4R0NA 2WT9A 3S70A 1ZMOA 4M8KA 4HGNA 3M5DA 1V7PC 3HL4A 2NAFA 3QH4A 2RGBA 1VKJA 2QTGA 1TLLA 3TKLA 3WL7A 1FMJA 3IRUA 1E2PA 4L7TA 2V5QC 2Q5JA 4CMIB 1AN0A 4M9ZA 2P78A 4R1UA 1OVMA 2JABA 4J0IA 4DVGA 2IPNA 1V1MA 3E7DA 1TKBA 1HURA 3DPUA 1PGPA 3DTVB 2VAWA 2QZAA 4Y6CA 5EUMA 5LWQA 3BX1A 3ZQKA 3FUIA 4JXZA 2P2YA 1P4SA 3CZAA 2WG1A 1IHYA 2ECQA 4UVHA 1G4UR 3QKRB 2J0UB 4B81A 1H2VC 3VBEA 1KKUA 2L17A 2DHQA 1I6MA 3RKUA 4DZTA 3FSEA 1EE2A 2WD8A 4S1NA 1EWRA 5CPFA 3HZHA 4UTXA 1HQCA 1XU9A 3C5VA 3COSA 1D1TA 4GYKA 2JIOA 1EFTA 1IVYA 1PZGA 4TN5A 1LDGA 6AT1A 2MR6A 5HS4A 2Z4SA 2FSUA 2II6A 4ODIA 5JFTA 2L0TB 3K0BA 5AVOA 3I01A 4HXGA 5EHXA 3MWEB 5LSAA 4FHFA 4DNOA 4X20A 3BICA 4H4DA 1E2BA 4IQGA 1T3SA 3KSRA 1ZO8A 2GQ0A 1ECGA 2YXDA 1TNYA 2H8GA 3TZBA 3HVEA 4OGWA 1XZPA 3AB3A 2O3SA 1KP9A 4FOPA 2GD2A 2H5IA 1VBKA 4XZ3A 3WYGA 1XLTC 3ZV5A 5J43A 2HU7A 1YK0A 4JC8A 5LMCA 3T3DA 4RNCA 2XS8A 4JLJA 3HEBA 4R1OA 4ZC8A 4L2LA 1H66A 3ADDA 2FP4B 4G6ZA 1J1IA 2H9AA 3AKYA 4F4FA 1ORIA 1OOEA 3WK9A 1FB5A 3ND9A 5C7LO 3VO2A 3WLSA 4UI9C 4FHZA 1HUQA 3WMXA 1KVRA 4LRYA 1COWD 1EINA 3RS2A 3HFRA 2DUWA 3HFGA 4WKOA 1P4GA 3SQWA 4RYLA 3DWIA 4BJ1A 4IY1A 1JFLA 4DDWA 3DSUA 2R5FA 3M34A 1Q19A 5HXAA 2RB5A 5KI6A 5L45A 4NJMB 1CYEA 2X6KA 4X1OA 4BU0A 2NO5A 5K0FA 1LBSA 2ONYA 1HSOA 2ANCA 1ZXXA 1YS4A 1ZESA 4PZ0A 4R05A 4XQ0A 4GPIB 1EDBA 3C41J 2XE4A 2RGWA 3LAWA 2QRKA 1F4PA 1KRHA 3AHJA 1SOWA 3PEEA 4DTCA 2WXQA 1WW2A 4LBWA 1MX4A 4OJKA 2DR3A 1C3LA 4B0ZA 3A05A 1GPAA 4FLEA 4MV8A 2PA0A 1M2JA 2W4MA 1A76A 4RQTA 2PSEA 3TL5A 4N5NA 3FNQA 4HDOB 5JCOA 2WAMA 1OUMA 3LLVA 2I2CA 1J2JA 5BR1A 5KYKA 1BE8A 3ETJA 1THMA 4HR7A 5EXTA 4YYZA 5JZVA 3EA4A 5AKKA 5DM1A 3L8FA 4AMGA 4XJVA 4CIBA 3ZVKA 3FZQA 1T3LA 3CLUC 5CLGA 2X0EA 1LBHA 2XBLA 5F64A 5IDWA 1B8NA 4HMQA 2GGFA 1NXSA 4XW2A 5LXTA 1CJVC 3NAMA 4LFBB 4HS9A 4YUAA 4CEHB 3EW7A 3TL3A 1B6GA 5E1BA 4D8XA 3K70C 3DEKA 3HHPA 1TW3A 3M82A 4ZIRB 2AC7A 2KWIA 2C0LA 2ZZKA 1B3BA 3D6JA 1J24A 4F4DA 2BUAA 3DW3X 4DR7B 3OOEA 5EE0A 3E9ZA 3HB1A 2CXNA 4QATA 4B1FA 4O4IA 1SVIA 1MENA 2C94A 1E1QA 5H68A 1L8QA 1N4DA 3K0EA 4NCJA 2BSXA 3M89A 3DCIA 3C6BA 4MEJA 1DXYA 1Z5WA 1WDMA 3K4PA 1OASA 3VZRA 2QQEA 4S2EA 3CLHA 5EGNA 2QLFA 4JJ7A 5J47A 4MHSA 5ARDA 2R1VA 5JAOA 4I1PA 3GLTA 4QC2A 5FBWB 1YFKA 2E37A 4IDQA 4BECA 3ZY6A 2B0OE 5KWDA 4X71A 2P6MA 3THYA 2R3SA 2JCXA 1XD2A 4BMPB 1KY4A 2VUHB 4X94A 3U7RA 1Q1GA 3QSGA 4APFA 1JQDA 1X38A 4B71A 3DSXA 2ZUWA 2I6XA 1U4NA 3QRWA 1EZ4A 3MV2B 1SIBE 2D7JA 3LF1A 1R3UA 3MWLA 4PS1A 4L6AA 2IFTA 3G6WA 4FULA 2WJGA 1OKKD 4WCDA 1KXJA 3IIJA 1JEQB 2LKCA 3F9IA 4MW2A 1A2OA 3G13A 1YYHA 4DDVA 5HIMA 1JKMA 1G8SA 4G37A 2DE0X 1YAHA 5ILOA 2F1OA 3Q8MA 4FK8A 1TT5A 1P5QA 3JQAA 5CIYA 3HXBA 4GYWA 4KE6A 1GGHA 2B82A 3ZCXA 4CM1A 1GLVA 5M04A 4QTTB 3WSTA 1TRKA 4B7AA 4LSMA 5KSWB 1CSEE 2B25A 3AJAA 4F6CA 4Z49A 4QOJA 1CE8B 3EUAA 3RVPA 2L42A 1DAHA 4Q3CA 4X97A 3WZMA 1Y3IA 5CNJA 5BN4B 3C3BA 2R03A 1Q21A 2NN3C 1ZNXA 3A0RB 3DEYX 4NCBA 1FSSA 4V03A 3THWB 1MPXA 3E58A 2PJUA 2NTVA 2H48A 1I5EA 4QREA 2EERA 4QG7A 4D9FA 2H92A 4HK4A 2FMHA 4HOTA 2J4DA 2ES4A 3B6ZA 2YINA 4JXJA 5F23A 4D9EA 2OUIA 3T1YB 4JEIA 4BQPA 3TGWA 3IPAA 2C2LA 1NF9A 3RUDA 1S2OA 1PHPA 3VPAA 1WMEA 2YQZA 1BIFA 4HI9A 1C0IA 3VR3A 4MX8A 5JYCA 1XZIA 5DLQC 5AK4A 3LVFO 4FXOA 3BFKA 1ENOA 4H1WA 1IXRC 1BLXB 1J9EA 1UJCA 1HGXA 4GVPA 3WYAA 1P5RA 1E94E 1GTMA 4P3OA 4CQMB 1CUVA 1ULHA 2ISCA 1L9KA 2HA3A 3C5HA 4DCNA 3U4GA 2HMVA 3PSHA 5DXAA 1YMUA 3E2PA 4U2GA 4WK4B 4U8YD 2O8EA 5TS2A 1CYDA 5K3BA 2FPWA 1MZPA 1JIKA 4MP8A 4DMMA 3EOAI 2X5GA 2QD3A 5GOTA 2GPBA 4J0UA 4BVGA 4B3RB 4I5FA 3A1VA 2GFQA 1SQ0A 3FKQA 4DMKA 4GNKA 2VQSA 2FPPA 1XI2A 3LQYA 4DIBA 2CZGA 1KK0A 1NWCA 3OLXA 4DX5D 4KH0A 4Z86A 3BH6A 1JT9A 2D74A 3ASYA 2DFLA 3IURA 4EJMA 1FXSA 4GE0A 3B6KA 5P21A 5HGJA 5HF5A 2IY9A 5LQMA 1IHGA 2A4KA 2A9FA 2UDPA 3Q9UA 2G25A 3ZXIA 3D4PA 2N42A 3UXHA 1LDYA 2C3UA 2L82A 3JCKC 3FI9A 4MV4A 3RVKA 4KPYA 1LZLA 4J94A 2OR3A 2AFHB 1Z56C 3CHRA 1U5CA 3QMMA 5K09A 2QX6A 2E2WA 1L1QA 4JHJA 3PEUA 4LRWA 1B1CA 2XD4A 5L3VA 2QTVA 4WFKA 4QFVA 4UCFA 5B3KA 2YXLA 2JF0A 3EZXA 3TLEA 1CQWA 1W29A 4QHYA 3UT4A 4HXYA 3LOQA 1ULZA 5KDDA 3L08A 2P65A 3O73A 1K8QA 2HSWA 4LW8A 5EN4A 3HC7A 2YWDA 2CMGA 3BH7A 2HSGA 5ESXA 3KEOA 1ZCBA 1E7YA 2HPHA 4HD8A 5AKYA 4DBZA 1ONPA 2DEUA 2OPBA 4HB0A 2BBOA 1DUSA 3TJPA 5AM5A 4KLZA 4ZRMA 2Q1UA 4XRGA 2CG3A 4BNXA 3LM8A 3WJ1A 1F1JA 3TZ6A 5BR8B 2KCKA 4YRDA 2OHGA 3F1KA 5HKPA 1XAHA 3ICWA 4F0JA 1IXYA 2XF2A 2PGLA 3V30A 4D97A 4QVIA 3RTCA 3ZGOA 4Z4CA 5TMPA 4MR9B 3TUZC 1KHTA 3WL5A 3SNHA 4UU7A 1IONA 1L5MA 4B73A 1XCJA 3FSGD 3V42A 4J0HA 1I5RA 1NQVA 1SWVA 5IAGA 4Q66C 4V3BA 1T1GA 3BD9A 1EE1A 2C7PA 3IKJA 1NYQA 1V41E 4DLXA 3GRFA 1GQ2A 4UU8A 1KDVA 2QYJA 3QPWA 5E2AA 2GJSA 3IXLA 3GZ2A 1TYBE 1Z2NX 1Z3IX 4HZUB 2JAQA 4HF7A 1L9XA 2YZMA 3LO5A 4LQCA 5A6SA 4JVNA 4FI3F 4QUKA 3VTKA 1AX9A 3BQMB 3EBLA 2BUCA 4Z4EA 2GEBA 4EG3A 2KC7A 2VTKA 4I2VA 4LRUA 3LPNA 4F1WA 4GDMA 3SF4A 1PN3A 4MGYR 3DEOA 2RH5A 5KTTA 4ZVUA 1FZQA 3OT5A 4S0XA 2PNJA 1W1UA 2YV1A 3MQFA 2C2OA 1QC5B 2WKWA 2KS6A 4JYCA 3K6KA 1N7HA 1UPUA 1WQ1R 2AOVA 2QW0X 3LNCA 4PNHA 5B53A 2G40A 2QX7A 4JR2A 3U66A 3V8RA 4H31A 2VAMA 4MZXA 4UU1A 4MUNA 1DLJA 2D06A 2GBFA 4JB8A 2OBLA 2FFRA 5CEAA 3MWKA 1YRQA 4NHEA 2FOLA 2DPGA 4RORA 5JLAA 4UI9J 1I51A 1YZUA 3Q2OA 4G89A 2QX9A 4QT0A 3REGA 5JAZA 1RZRD 1TO6A 2C58A 2GA9A 3WC4A 2GTPA 2A5LA 4PYJA 1W4CA 1M6HA 4WSOA 4WDQA 4TUMA 4L57A 4J8PA 1ZS9A 5IJ9A 1XLUA 3TWQA 1BXRB 2CXSA 4C87A 1BCSA 4YROA 1PEDA 4IQ4A 2Z5LA 5AQ7A 1NF3A 2QG6A 2PMCA 1SG0A 4JJEA 4A8TA 3BJRA 3PENA 4MVWA 2HRZA 4ITRC 3TJZA 4CKEB 4KXXA 3ER8A 1DBSA 4FFNA 2GTHA 3VR1A 2QRVB 1RHKA 3ER6A 1OI4A 3DYBA 2V3VA 4OXQA 1KVUA 3CUKA 5AJXA 1FYVA 1QGOA 5EESA 1D4ZA 2ZB8A 3TRJA 3F8TA 4IGFA 4GKVA 4AL4A 3H65A 3CCFA 2QPAA 3UMMA 1I2DA 2GZ3A 2PL3A 1YCSB 1M8PA 3UB4A 2FRDA 4Q7JB 1KJJA 3KSZO 3UAXA 1ABFA 1BXGA 4OKNA 2H51A 5LMNB 5KINB 2YXNA 3R3UA 2VPZA 3AINA 1K9SA 2C1XA 3MAAC 4BB0A 3JQ7A 2E5LB 2YICA 3CR8A 1XWIA 2X9NA 2MYTA 1P3JA 1KNQA 4GKKB 3A1SA 4QQRA 2O8FB 1C7EA 5G04C 2CNOA 1WBJB 1YRAA 2AL7A 3CUUA 2XZPA 3AUSA 3CLKA 4ZEWA 5HCNA 1KMMA 2A59A 2A9PA 4YQEA 3IE2A 4CFSA 3KOMA 1DRKA 2PBRA 1ZH0A 3KSLA 3AR4A 4M8IA 5J5CA 2V7PA 2C0QA 2FN4A 4UASA 4I55F 4P4GA 3O3OB 3T5DA 3KXPA 1NW6A 4OYSA 3O31A 1VSUA 3N70A 4KIGA 4Y1RB 2JH3A 3JQBA 2IU1A 1M8KA 1EA7A 3Q11A 1QV9A 3N8NA 2RHBA 3UMJA 1IN6A 5LLTA 3FRJA 1DOZA 1CPYA 1AN9A 4QGHA 3QZUA 3DO8A 1J4AA 5GVSA 2FK7A 1U5BB 3RAJA 2NXNA 5AJYA 1MB2A 2PX3A 3T3EA 1U5AA 1MABB 2ZRPA 3R4CA 4JBIA 2W8BA 3FHJA 2WQZA 2NSZA 2WSSD 1S7GA 5FAXA 3EIEA 5BSWA 3IPCA 1TT7A 4MUHA 4DMCA 2V4ZA 2GHRA 5CK4A 4KVZA 1VC2A 4GUAA 2PZMA 3PIRA 1EVJA 3JASA 3V7YA 1FXWF 3U44B 3COWA 3P52A 3CEJA 5BVHB 3V3LA 5B36A 1IK4A 4YCAA 2MHCA 2Q5FA 5IDQA 5CW1A 1G41A 3WFZA 4NCXA 2FFBA 2VP6A 3NHAA 3ZU6A 3KOYA 4RXTA 2MIIA 1EAYA 1V7QA 3RVNA 3Q9SA 2YASA 3ASGA 1OLUA 3QTBA 5K8VA 1LWOA 1TU3A 4GP9A 3VNUA 4WOKA 2JLBA 4Q24A 4UWHA 1CCWA 4U6SA 3RV3A 4WEQA 2DTEA 2QORA 5LP6A 2QL5A 1ISJA 3A1EA 3VAZA 3P20A 3QE9Y 4N40A 1NXTA 3U62A 4CN8A 2G0NA 1H93A 1SU8A 4WN9A 1HV8A 1X70A 3WA6A 1U3WA 2LXLA 4BX0A 4P4SB 3HMQA 4KYUA 1I7NA 2BYTA 3B12A 2AB0A 4UBLA 1EE9A 4ATNA 3HCNA 3TIIA 4PHCA 4CCYA 5H3HA 3GLUA 3EGDB 2CLDX 1YV9A 4X65B 4UVEA 4DV2B 1WF6A 4FD3A 2P1DA 1KETA 5G55A 1Y9DA 4PN3A 5C8YB 3CK9A 4Q01A 4LX8A 3JXJA 4YBZA 3RTEA 1R6TA 2E2EA 1JDBB 3W1EA 4LZAA 4OBXA 1IDOA 1BC5A 3CMMA 4LZWA 5FWNA 4V3CA 4X8LA 5K0NA 3DLBA 5C8DA 5DX8A 4HGRA 5CTAA 1ZN2A 2QVZX 2IGBA 1QF9A 3LS8A 3MWJA 2W5UA 4R8RA 1W19A 1GZVA 3KXLA 2RJNA 3EA5A 4G5OA 3FDJA 2ZJ7A 2DIWA 5JSKA 2I3DA 1DKUA 4RH3A 3KYIB 1D5CA 2BHLA 2BR5A 5FUQA 2D00A 3LWDA 2WMNA 3CJQA 5AM3A 5BNTA 1BHQ1 3GP8A 1ZBDA 4CM4A 5KTKA 3ZV7A 5ENZA 3PNKA 2NT4A 2WWYA 4RTJA 2FWNA 3EXIB 2PRIA 3DNPA 2QUJA 4LCTA 1L5HB 2Z4RA 3HR4A 2MINB 1P75A 5LA6B 3MB8A 1GGKA 1NBEA 5GJWC 2AE2A 4IIBA 4WJZA 3K30A 5C81A 3RSZA 1JXAA 4A10A 3DDHA 3IQIX 2P6NA 4J7UA 2BT4A 1W76A 5I7AA 1BXZA 4NIMA 2ZYHA 3K0CC 3KKEA 4IJUA 2FOXA 3WG9A 4DWWA 1YA0A 1NF8A 2OHHA 2D1TA 4Y2GA 1CUDA 2Q5IA 2IODA 4IN3B 4JI5B 2HO5A 3GJ3A 3KJGA 5EHIA 5FT9A 3IULA 4CQLB 3Q8LA 3CT6A 2DBAA 3SLKA 4MKIA 4TT3D 3ZU4A 3LLMA 4L73A 4OKIA 1D4FA 3QYJA 1RYZA 4BNGA 2ZSDA 4TQUS 5JSFA 3A9CA 4XLTA 1ELOA 2BMAA 2UXDB 4JI3B 2FULA 3LCUA 4BQOA 3JWHA 4EZBA 2G17A 1A5SB 1XZLA 1PEAA 2N9UA 4WESA 1SEPA 3F73A 4RIFA 3OF3A 3RIGA 1Z6TA 4IZIA 2A94A 3MT7A 3QVSA 1DEXA 3P0JA 5FQ8A 5K3DA 4W8HA 2RHRA 4QPDA 3DOHA 3NUGA 3ZWYA 4OCZA 5A6VA 2XS1A 5LNK6 4P6VF 3KZKA 2QY7A 2IHJA 4M8NE 4EDFA 4XJTA 3KYCB 3LHKA 1ATIA 4R51A 1H0KA 1NVMB 1TJ5A 2UUCB 4OF4A 4OL9A 4NV0A 3NIGB 2VDPB 1P3DA 4Q7MB 4WCFC 3U1VA 1GZUA 5F5LA 1G1MA 1DQZA 4UD2A 4MUGA 4Q3BA 4W7IA 5CG1A 3EF1A 1JFFA 2PU7A 1PIWA 5D7BA 2B4KA 4YJ2F 3UM2A 1NI4A 2AN9A 4YN3A 1QIGA 2EZ8A 3IKVA 4P5PA 3WXBA 1WU7A 3MB5A 4WNAA 3B95A 4W5WA 5FOWA 1KZGB 3OWOA 2QLJA 2KSQA 3VKHA 2E21A 4ER0A 1QM5A 5F7JA 1N0RA 1KI7A 5LDGA 2EW1A 1JH8A 1NI1A 2QVBA 2BJWA 1T5BA 1MF7A 5HJ7A 4DA9A 1UZUA 1L8LA 4JUIA 3LUHA 3W2IA 4D43A 1E6KA 1SBNE 4GE3A 4YJ3B 3QJGA 4N4AA 3UBTA 2D2IA 5FL7D 4M9CA 2AXNA 4UVGA 1YNSA 1P7ZA 5EWMB 5HJEA 3BCUA 3HRIA 2BRUA 4LV8B 1R0BA 2RKWA 2AMYA 4OX9Y 1V11B 3PRHA 4GL4A 4YJ2A 4PANA 1E9VA 5ALRA 2GZ1A 1PG5A 5E9AA 2D5BA 3R2JA 1E2LA 4G4GA 3DE7X 3H8SA 4EUNA 4PS3A 1N6NA 2XGMA 4G81A 4GM0A 2XTMA 3RVQA 1XB2A 1ZU4A 4LC1A 3RK1A 1QZUA 3J7AC 5JSHA 1U2DC 3L7AA 2ACVA 4TXJA 4IQ0A 2DTXA 4ETNA 5IT0A 1EWTA 4B74A 4GB9A 3Q15C 3LK7A 2FZEA 3GRCA 4QLBA 3OKFA 1QOQB 3WQSB 2YN2A 4YRNA 3L84A 1TF7A 3V4LA 4FMDB 3W9FA 1FFAA 3UXGA 1B8UA 5ICMA 4B2PA 5LBTA 3OFSA 4OBWA 2ZRNA 2DBZA 4UQYA 3D4IA 4OVKA 3OFKA 3VR4D 2HQSA 3KWLA 1VE9A 4L22A 1LLQA 5KNDH 1TQ2A 1L5LA 2VH2A 1ZMRA 4NI5A 1WLSA 4X3PA 2EJUA 1ZUD1 1MZVA 3HJGA 2QAIA 4XIJA 3B7TA 4ZYUA 4D3YA 3RWMB 4EW6A 2WWRA 4TYQA 3ETNA 2QR5A 2EJWA 4UUNA 1E4EB 2PBFA 3ISTA 4RLFA 2RFMA 4IJQA 1T9GS 4Y7DA 1NDHA 4TOIA 1SCAA 2IYRA 1LK5A 1P1HA 4ANFA 1ZK2A 3WL4A 2E4UA 4HN4B 3QBJA 2WYWA 4PO1A 4OM7A 4EUHA 3KYDA 2XE7A 1T9AA 3FKJA 2I4LA 3G3EA 2JI8A 4DCSA 4UZEA 4GTTA 2KBXA 4WBXC 4TLBA 2C7RA 4QUBA 2H3EA 1OX6A 2XUJA 1W73A 4HATA 3VOBA 3DE0X 5ESWA 3ZI7A 2FW9A 5B4UA 5KAPA 2DRIA 3MCUA 2VEOA 3ZG6A 3QWBA 4M60A 1A9TA 1QFMA 3IVRA 1V71A 4K9SA 5FR1A 1XXHA 2OHOA 2IUYA 2O14A 4HAWA 4HDRB 1T1SA 4INAA 5KJFA 1EG2A 2AJLI 4X0EA 1G1AA 1RWMA 3T3MB 4IIXA 5ENTD 1CXZA 2JHAA 5KJ6A 3DAOA 5AH0A 2NTYC 4LG6A 4W7SA 3JX9A 3WP1B 5CNIA 4LCBA 3TTXA 4PZDA 2RGEA 3T5PA 2I2BA 4HV4A 4PZ9A 2ZZNA 1LGYA 2AI3A 3H3XA 2FEMA 2ZR0A 2PM7A 2P4SA 4DV6B 4DUZB 1NLMA 3D4OA 2WAYA 2X8WA 2ZWVA 4G1FA 3TDMA 1WZEA 4PS0A 1W25A 4HNAA 1ZN7A 3H11A 3SK1A 4YB8A 1QQ7A 4FKZA 3GLGB 1YGPA 4GOOD 2BFCB 4GOXA 2JBAB 1WMAA 4G23A 1ZVVA 4Y6WA 1X92A 2YY6A 3L1HA 1UFKA 5B1YA 4BSZB 1EGAA 4AJNA 4G97A 3FCXA 5J2UF 4QDOA 3GK3A 4TVKA 1X7DA 3PNMA 4PTYA 5A4DA 1SKUA 2ZYSA 3AFGA 1VE1A 3K20A 5B3JC 3FOBA 1LNQA 2EBWA 4F6LA 3TIVA 4PX2A 4YCMA 2WUGA 1DAFA 4MW5A 2NXEA 2H1VA 3NGMA 3DPSA 3PFKA 3H1PA 5K0ZA 1JLSA 4GMXA 2SBTA 4L95C 2VRWA 2CLKB 2IHUA 4F2DA 2H63A 1AZLA 3K05A 1WUKS 2V6FA 2DWZA 1NFQA 5U1PA 1XNJA 2C5GA 3B1XA 2YWGA 1J1ZA 4Q0MA 2LRHA 3O8LA 5CIQA 5IY5E 4JP1A 1VL0A 3HFSA 5B7QA 1MC8A 1K75A 2HQBA 1ZCJA 2QMZA 3KR2A 4WCVA 2XTZA 1PR5A 1OBFO 5BV2P 5ENDA 3OUTA 4JJAA 4Y9SA 4WWPA 3A6KA 2ZJ8A 4ZQGA 3ZU5A 4L51A 3LP6A 1D6SA 3O38A 2ZE8A 2CWWA 1KYIA 5EG5A 4CV0A 3EDCA 1E79A 1Y37A 4ED9A 2QUHA 1AK1A 2NXJA 5DEIA 3DKRA 3MX3A 3UTDA 3ZVRA 2PGJA 3TZQA 1H22A 2W2MA 4XIGS 4PZLA 2X58A 5C4MA 1JI0A 1KI2A 1V7ZA 1JALA 4UD6A 3STTA 3R8FA 5AM4A 5BN3A 2CGEA 4AB1A 5FNVF 3PZ3A 3G5AA 1MG5A 1EBUA 5IH7A 2NV6A 3ABLE 3T1TA 3C2QA 4AW9A 3KZOA 3TQTA 2Y4TA 3DZDA 1HOXA 1TMGE 1B8VA 5IF3A 4IICA 4KG7A 3YASA 5KTSA 2GAJA 1XRNA 3BD7A 1SD1A 1YUMA 3ZZUA 3P1UA 3UJ8A 3MOSA 1FFYA 3LC1O 3V8PA 2JGNA 1MA0A 1Q7BA 3ZY5A 2RGUA 3AIIA 1NBMD 3FZNA 2QM8A 5IP5A 4MQ5A 5KJEA 2G06A 2CLEB 3ODGA 4RVBA 3ZR4B 3EVTA 2OV6A 1JAIA 4YV7A 1T1EA 4KXNA 1FDWA 2FR1A 1N1DA 2AQHA 3UJ6A 3KPVA 3H99A 2IYAA 5FQ7A 3RABA 2ZS7A 5TQ2B 1JAHA 3LOPA 2QU8A 1M6NA 3W9SA 4YEDA 2ZIRA 3G2OA 4O0LA 2YYAA 5CYFA 3TSCA 4OXNA 1A95A 3DEJA 3FCYA 3D8NA 1MX6A 2QYOA 5FNVA 4EY4A 2OBXA 1E1CB 4KQ9A 4XGKA 3GUHA 2LCFA 2XHZA 3I1IA 3OQ1A 3RIYA 1OXMA 3GEHA 3HO6A 4P1ZA 1GU7A 4R81A 4JROA 4RDCA 4ZCLA 2ERXA 5MN4A 1NP7A 4XWAA 5B4VA 3ZZTA 3R4VA 1UJ2A 3P0HA 1VKZA 3QVXA 5JEEA 3KD3A 3AL3A 4EKNB 3A28A 4J0CA 4TM8A 4Z6KA 1YXMA 2J9FA 2O59A 3BN3A 1WW3A 4CF6A 3HQ4O 1VCHA 1YRHA 3WBFA 2DJIA 2FHSA 1TTQB 2OQVA 3IP8A 1F0KA 5SY6A 5SYMA 1YVUA 1LPBB 1UMCB 1NMYA 3Q41A 2P75A 4ML3A 1PL6A 3FOEC 1VE3A 3O83A 3LA6A 3G9XA 4IUCS 4NOKA 4E03A 2A3RA 3CKLA 2X5JO 3GZ4A 3O8RA 3PHHA 4MS6A 1RYNA 3OOJA 2J0EA 3L8CA 3ZKAA 3TKYA 1D0SA 2OAEA 3C4JA 2HIAA 3OZVA 1K5PA 1GDDA 5SZKB 4RD3A 4YLYA 5CECB 4JJFA 3LTNC 1VGRA 1D0IA 3RC9A 2BBWA 2YWJA 2XT0A 5EKSA 2PD6A 1CR1A 3FAZA 3BIWA 2JJ1A 4JQZA 1J0XO 1GUFA 4LAFA 3EEFA 1WUIS 3UMRA 3QPCA 1OXUA 2HFJA 4F8JA 2OUKA 2O9JA 5HKLA 1B74A 5A2GA 2R86A 1JHXA 3I62A 3GF4A 2YXBA 4HLUC 3WL6A 2JLRA 1OVGA 4P34A 3C3EA 1U7IA 2ADFA 5AJUA 2VP3A 1HE2A 2VJQA 3WO1A 1KAHA 1NTOA 2Y0BA 3R3JA 3I9V6 3RYIA 3L22A 1HXIA 4BFVA 4C7JA 2P0YA 4LDNA 2BMWA 3FTYA 4XI9A 4TV8F 3KETA 3ILSA 3S4YA 2ZYAA 4KPFC 5TC4A 3HKBA 3VR6H 3FCCA 1N2EA 3ON5A 7YASA 1PV4A 2GEFA 4QEZA 5LBIA 4WWHA 3CX8A 3KQNA 3ABOB 3LPAA 4REQB 5CLFA 3LXRA 3SJAA 2XPCA 4OGKA 2XZTG 1DG9A 4LF9B 2CBGA 3A14A 2JI6A 1TMOA 1KWKA 3Q75A 1SCJA 3AG3E 5THKA 2QRGA 1DIGA 1U31A 3V4FA 3AF1A 3ESZA 3SR3A 4JI0B 1GHTA 1RRFA 3IDZA 4KTTE 1JG7A 4JFAA 5G1OA 5F2NA 1XHEA 3ZGXA 5L4LA 2ZSAA 1WXFA 3ZDBA 4H2DA 1V54E 1E0DA 5ALIA 2JCYA 1G20E 4WKCA 5F51A 1RHQA 3USZA 1Z2PX 1VCOA 1JFRA 4O2AA 4JBWA 4PG7A 1URPA 3RT1A 4DR6B 4TZ6A 1T4DA 1G5FA 1AMUA 1T4CA 1YRLA 3CB4A 3PNSA 1QYWA 4F6RD 2GCNA 1JUDA 4NR0A 1G8MA 3PPVA 3NOOA 3NBMA 4RY0A 4CGZA 3FYUA 2ILVA 4H7HA 4URWR 4P84A 4DX6D 4ZYVA 1VPWA 3BWVA 1UFVA 1OY1A 2YV3A 3VSDA 4OVUA 1OE0A 2ST1A 1V47A 2ZRBA 4I0WB 1ESEA 1YQUA 3SQMA 4BPRA 4KMOA 1GUZA 4LNUA 3QWIA 3BDVA 1QQAA 4YYEA 1TTHA 5ADVA 4ZCTA 1X0VA 4TSFA 4RFSA 5IAOA 2GR9A 3BHIA 3IT3A 4IJMA 1OI7A 3V2GA 3GFOA 3OX4A 1LPMA 4Y6PA 3OZXA 1F51E 4JVSB 4YJDA 4DYHA 5FJYA 4B3CA 4PSVA 4U7EB 5KMGB 1UUFA 1VLMA 4K81B 2I6GA 4X66B 3IDAA 1IATA 3PC2A 1WP4A 5TGZA 2I9PA 1FNCA 3OFND 1NJFA 5PNTA 2ZXEA 1L7VC 4NBKA 3E6AA 1M7BA 4A6PA 3G2WA 1R6DA 4OM8A 3JALA 3L4BC 3TLBA 4WY5A 1BG6A 2PZLA 3RHTA 2HT6A 4RHFA 1NBIA 3Q47B 3GFVA 2HJWA 1BH2A 3DDZX 3DLTA 4L50A 2WXJA 4RJJA 4ZI7F 2KM1A 1HLDA 3IJ5A 4M1TA 3RIEA 3L79A 4ILHB 3G8BA 3LG2A 2H2HA 2H54A 4ZGBA 2Z3VA 4Q4AA 3WGKA 1UDBA 3WIDA 2W6ZA 4DLNA 3MERA 2P6UA 5TGTA 1MO6A 4HOUA 2ZATA 1ISFA 4KJZA 1RT9A 3W2GA 3T4EA 2PUFA 2WILA 4KBGA 3R0IA 1WDKA 2QSYA 1ETUA 3STXA 4RM2A 1E0AA 1RI5A 4YMIA 3G1TA 1JXMA 4E5YA 1E9FA 1GGFA 5DW0A 1QBKC 2X4DA 3THXA 3O92A 1IUKA 1ULUA 1RADA 1X1RA 4ZI7A 3EMBA 4YXWD 5IW8A 1FBTA 5DNCA 1JNXX 3DCNA 2F37A 2ANBA 4UTOA 3ZQUA 3FUVA 3CX3A 4EGJA 5KQPA 3EVGA 3X0DA 3TVDA 3QBEA 4A1OA 2O48X 4MRAA 1YBMA 4J03A 1AHIA 2DQSA 1Q15A 1E2HA 4B76A 4JLMA 2JBHA 2CJWA 2X15A 2EQAA 4QELA 1GNPA 3HY4A 2XNHA 5TMBA 3L8GA 2UVQA 3FETA 2WB2A 4JR0A 1MX1A 1S1MA 5IWAB 4CJXA 4BNDA 2DX7A 3ZU2A 2PV0A 3T1HB 3KKLA 5J59A 1MGPA 3GQBB 2BTOA 4PE5B 1TAUA 1RYBA 1KI3A 5E3JA 1LVGA 3LS2A 2VHYA 2RIPA 3FFLA 2A7QA 1WQ4A 5CGQB 2ZRAA 2UVDA 2QTFA 3VA7A 1OX5A 3DKKA 2QAGC 1SXJD 3DF7A 3V3KA 1K8RA 3HDHA 4BXOB 3MAJA 4AV7A 1I2BA 3VKWA 4HGZA 3K9LA 2EEZA 1FDTA 1N7JA 4GX0A 1R4NB 2W2XA 1GPNA 1M83A 4XASA 3TAUA 3F5DA 3ZDRA 2J45A 3QHAA 3DOFA 1KI1A 1XCGB 2IHKA 3WRWA 3AS4A 4KV7A 1DOAA 3CVVA 3RF7A 2ODNA 1PCXA 2IQ5A 2LVBA 1AXGA 3IVGA 5CTJA 4IJ6A 1NM5C 3G59A 3X44A 2C9ZA 2DKFA 2R44A 1GKIA 2HPVA 1SUDA 3G2JA 3OLZA 4K03A 1U81A 2PZJA 1OZGA 2YJ4A 2ZIXA 1OWNA 3A9WA 5AQAA 4EJSA 5H4HA 2NVOA 3FUTA 4FJ2A 3L43A 2I99A 3KLNA 3NHRA 3ZHCA 4AS2A 2NW6A 3PKZA 1GDTA 2HI0A 2IX3A 4EYOA 4C0SA 3L4SO 3W6OA 3KQVA 1ZI6A 1JJAA 4GTSA 2P9BA 4FFBA 4UMVA 4NFHA 3C70A 2XY4A 3AKCA 1RWVA 5EMMA 2CV1A 2BPOA 3NJ4A 2GAOA 4U0SA 4Q05A 1U2PA 2JNWA 4EEKA 3ELWA 3GRAA 3CUEF 2P9KG 3OZUA 2ZETA 4QVKA 4YMSA 3R3SA 1J8YF 1OXJA 1EUCA 1IOVA 4KQWA 4D8TA 1SU7A 1JPVA 3EGOA 1CWUA 3UGTA 1OFTA 2OAP1 4HTAA 2HHCA 4UBKA 1TA4A 1RKBA 1L4YA 1UWVA 4TLDA 4R41A 4TXNA 2M6RA 4UXIA 2BBSA 4MJ3A 3T34A 4G26A 4PQFA 2HWYA 1NR7A 2XCBA 3P2BA 2J0SA 3RUEA 4XVUA 4EW2A 3EXG2 3FNEA 4GX1A 1FFCA 4ZO8A 3TGOA 2Q50A 1ZIXA 2J31A 3FU0A 2AC4A 2PGAA 1NNLA 1F6DA 1PBTA 3LQKA 4AROA 5CMYA 1XX6A 5IVKA 4I1IA 1FX1A 5ALZA 4OFBA 2KATA 2GM9A 2I4NA 2B4AA 4WFQA 4BLPA 4KDFA 3PUVA 2GEDA 3Q1LA 2AXEA 3G0HA 2CN1A 1Y3HA 3WDLA 3MD9A 5A3SA 4R1TA 2QN9A 3AL0C 1M75A 1AIPA 2IPMA 3N2GA 4I7EA 3D7RA 4NURA 4JUFA 3SYTA 3AF2A 1CY8A 3FA2A 2QSZA 1KPGA 2WWFA 1CF9A 2JC3A 2YIMA 4P7KA 4C4SA 1W8DA 4BFYA 3IT2A 3RK0A 3PX7A 2REBA 2XWJI 2V6MA 3G49A 1FLAA 4E7PA 2XVZA 1I01A 2PUWA 1B26A 4X90A 4ETMA 1H42A 1DEHA 4KE8A 4L2YA 2IYQA 3P9SA 3QXXA 1UXJA 1JWAB 2ZCJA 4A0SA 3O7MA 2O5CA 3LUDA 4IMPA 3CRQA 4R2XA 2X3MA 2Z2YA 2CE2X 1C0PA 4C0JA 1K5DA 3EEQA 4OI4A 2VWHA 2QN8A 2C97A 2OSVA 1HKUA 4NACA 2BEUA 1D09A 4NZMA 1K6XA 1V6SA 5ANLA 1ST3A 2KM4A 1W2HA 2ZRIA 2G9VA 3VNRA 2OYSA 3KHUA 3P4YA 2QY6A 4ZO9A 2YJNA 3HCAA 1U90A 1RHRA 1QGYA 4OA5A 3KSBC 3MWDB 4PYQA 3AS5A 3TRKA 3G88A 4R1MA 3R7WA 2H11A 4BLSA 4ERXA 3FAKA 4UBOA 3Q88A 1SOVA 4HGYA 2ID9A 4F9GA 1A4UA 1USGA 2F1JA 4FCCA 4B5LA 4J7WA 1D03A 3DC7A 4ZOEA 3RH0A 1QRSA 4EG6A 2CHUA 3LT1A 2V9ZA 2WPDD 3ZE9A 5EE3A 4OUDB 2H17A 5D86A 3OWHA 3APFA 5KCMA 1Y80A 5D51S 5CHYA 1EFPA 2AQIA 5C52B 2ZITA 4ZCQA 1TU0A 5AKZA 5EP1A 3QQPA 3ZNPA 3MRXA 5JBNA 3B1WA 2D4AA 4MPRA 1WHSB 1SZJG 1UP7A 1TM5E 5DP2A 3LFHA 2EWWA 3ZZ0A 3GPBA 4J8EA 3L1UA 4RQAA 4N7JA 2BKVA 4KQ1A 5TQVA 3AUKA 1PE0A 3A58B 1Z37A 4UKDA 2DWUA 2BM1A 3RAUA 5IBPA 2QN1A 4XJXA 3WWYA 1K1AA 2HU8A 9LDBA 1N2SA 2EQXA 4F3RA 3WWCA 2ZJ2A 3GJXC 1EM8B 1T8PA 1XTRA 1GXSA 3CXUA 1R2QA 4O4JF 2UZ1B 3GLFE 5CM2Z 2WMOB 5T4HA 2NZWA 3TOCA 1YASA 4AX4A 1OLSB 3GVXA 5A0FA 1YMPA 1RAIA 3BA1A 2C3PA 4RSRA 3ZKWB 3WGGA 4XOUA 4D9CA 2B9EA 4BL5A 3GLHE 5C7YA 4RE6A 1OTXA 1RD4A 4JGGA 1ZC3A 4CDRA 1G2PA 4L8GA 1ST2A 4UWFA 3EZLA 4XIYA 4G0NA 1NQXA 1ZC4A 5COAA 1YZ3A 3ABSB 2X4LA 1GCUA 4UFPA 2V9CA 1T8WA 4NU0A 4O4LB 4KN8A 1BQ3A 3UHFA 3FUMA 4ZGGA 5EYPF 1I36A 2GRNB 1MGOA 3EXG1 2Z1NA 1W88A 4OHUA 4EG4A 4J0FA 2GWRA 5TS3A 1W4RA 4PSDA 4NPCA 4TTIA 5JADA 8OHMA 3SDSA 1V8DA 4RM3A 1AKUA 5LYJF 4ZVNA 3ZOKA 5JCXA 4H7IA 4ENQA 3FMOB 3SWWA 4BDTA 1H3EA 3BXXA 1QO0A 4ARZA 2ADOA 2XUPA 3LBIA 3CX4A 1QVZA 3KFLA 4NABA 5BQOA 3EXFA 5DM2A 1GZSA 2EGHA 1X39A 2BCJQ 4C89A 3KB6A 2WXRA 3GNTA 3CWQA 4K6CA 3E4CA 1IUOA 3JARA 2J9XB 3R7LA 3CB2A 2X77A 3DBRA 5ARBA 2OMEA 3B6IA 1JBEA 5GONB 1AK9A 1JR3E 2PSJA 2AN3A 1XZGA 5EYPA 1U0NA 3HVUA 1IY0A 4ZJPA 1QMOE 3C0KA 2I22A 4U9UA 5T3UA 4I5DA 4IIEA 3AJ8A 3I9FA 3NBQA 5K8LA 4XYMA 1SHTX 2HM7A 4BDSA 2YHUA 2O8DB 1M5TA 1W4BA 5FIOA 3RYHB 1K0UA 1PZNA 1QH1B 1OTHA 1QGUB 3C5EA 3T4XA 4EA9A 4MS1A 4L5BA 3PNLB 3K70B 2Q3DA 4IM7A 3KLOA 5E2IA 4QXPA 1X1AA 2BGMA 2VLBA 3CW2A 3VYWA 1XZEA 3GPCA 4C6TA 4AMBA 1TUBA 3JQDA 2I3BA 1KE1A 3PLAE 4H1TA 1SC6A 5TPZD 2GBLA 5JS8A 4WVFA 1DIAA 2A5DA 4C0BA 3ASFA 2C4MA 4QAJA 4BWYA 2QUBA 3QKSA 4HLCA 1FU7A 5ETJA 4C5BA 3R5SA 2WXOA 4D98A 1Z4LA 1E2IA 1LLDA 3FU3A 2EGGA 1O1RA 4I4CA 3EARA 1GNSA 4ARIA 4W99A 3FI0A 3A3OA 3KZ1E 2NUPB 3PUYA 2PANA 4C9BB 1K89A 3GD5A 2PSHA 2DWCA 4TXPA 5EXPA 4F5YA 2QQFA 3ETGA 3WMWA 2X3YA 5IUKC 3GZJA 4CCSA 1BI7B 4UFNA 1CQIB 5TY0A 3GPLA 2B1IA 1RM3A 4LNBA 4E4YA 1EVZA 1C7QA 1C0LA 4R3UC 2P9LG 5ALKA 3HKDA 1TEXA 3GH1A 5KVSA 2HXYA 2IYZA 1EWQA 2PL2A 2JGDB 5AO9A 1QONA 3OPYA 2RHGB 3REQA 3LH5A 2BFWA 4X85A 4U5QA 3DLAA 1BD8A 4GCNA 1WPRA 4FDAA 2ZPTX 4NECA 5JMWA 4EEZA 3VUEA 2DU8A 2VO1A 2OLKA 3UWKA 3KR0A 3LUCA 3Q10A 1KP2A 4WW0A 5JDIC 3OLWA 2PH7A 1MO3A 4LECA 2KQUA 1ZONA 2ENUA 1NLZA 2FJ0A 1RRVA 3AESA 4EB8A 2Y1LA 1QS0B 2HM8A 4UUAA 3L7JA 3VLEA 4EVIA 4ZOBA 4G24A 3PYLA 1XZAA 1U8UA 5B3SE 2FZKA 5FTNA 3VR5D 3CIAA 1IIBA 2JI9A 1LNZA 3QUBA 1NFIE 4MHTA 3O94A 4WNEA 1YL6A 2H1FA 3P9KA 5JDCA 3UNXA 2QE7A 4BP3A 1J0EA 4I1OA 4RENA 4D10C 2D1YA 3K6RA 4P7FA 4PDXA 1V3QE 2YV2A 3DZIA 4YV2A 2J7PA 3RAPR 2FLVA 1SA0A 5A0TA 4MKGA 4LJLA 3A06A 2EQBA 3Q9NA 1Q0LA 3AQIA 2PKWA 1TJYA 1M5RA 2H08A 2VNHA 3M6VA 2WVAA 1OAOC 4B2IA 4R5MA 1UOOA 1JECA 3PRYA 4OXXA 3PFHA 2JA2A 5DGCA 1ESDA 3V1KA 4C7KA 2YWCA 3WZ2A 3OU7A 2WW8A 4JJ4A 2NGRA 3ZYCA 5E7QA 3TX2A 1CRZA 5EUBA 1J09A 4LTMA 1W0CA 4JMLA 3O4IA 2QR2A 5DNVA 2DAPA 3A7DA 4FW8A 4UNSA 2YHEA 1TVMA 3NP7A 4I55A 3I8XA 1U2QA 5AYVA 4FLBA 2Y4OA 4BVBA 4QDXA 3KVOA 3CT4A 1TYQG 3INNA 1YC2A 4OBBA 2AG0A 1DRJA 2X2PA 4TUYF 4GL2A 4Q4CA 2R751 4ZVLA 2MOWA 5KYVA 1A7UA 1UK8A 4CLOB 4B6JA 1RJWA 1PZHA 1TM7E 4ESVA 4ACLA 3TTUA 4ZQBA 3IQEA 3B5IA 1FJGB 2VBIA 3NHMA 4TMFA 5B7GA 1Z13A 1T26A 2WM2A 3OHPA 2WSLA 4HT3B 4RESA 5LMZA 3BMQB 2V4HC 2NP7A 4NICA 3RS0A 4FADA 4LHXA 4R84A 2W22A 3BAFA 4RJTA 1G3QA 4E08A 4MULA 1YZVA 3ADKA 1WKBA 4E5PA 1FXWA 4Y2UA 2P9TA 2PUTA 3ZDAA 1UZNA 2VTBA 2W2LA 5BT1A 3VNQA 1AOXA 4YASA 1BN7A 1F6WA 3C3YA 1PC2A 3MWFA 2WUDA 3I2IA 4PRLA 1ID8A 4PIVA 2VFAA 3REOA 5IS2A 1ACLA 2FWJA 2A67A 2WZCA 2CLHB 4G2NA 2C4NA 1RFGE 2V7GA 3CLSD 5E6UB 3PQDA 3TOVA 2DM6A 4A23A 2FF5A 3OZFA 2NV2B 5LZ8A 3SC2B 1UBSB 5BW6B 2LKDA 2FW8A 4FBGA 5A62A 3CVPA 2H1LA 2J9QA 1BSVA 1RXYA 3W3AA 3TLCA 1CY7A 1G6KA 2CNWA 1OWPA 4RF2A 2ZBEA 3GEMA 5FBLB 3D6AA 3C3PA 4B4DA 4M0LA 4RTOA 4IBOA 1CEQA 4BAUA 3UMBA 2PDAA 1VBFA 1YJQA 4DREA 3GLKA 2PD4A 3DNMA 3VM6A 4G36A 4JFRA 3QFCA 1KEZA 2Q3LA 4KLCA 2XODA 1LTXA 1KMHB 3BC1A 3LIIA 2PNFA 4DDHA 4MQ6A 3HLKA 1XA3A 1XA0A 1F60A 3EVEA 2ZT5A 1FP1D 3APDA 1NIJA 5I7HA 5DTJA 3EDYA 5F78A 4YRRA 3HXTA 2GPNA 4CU5A 4H3SA 3TCNA 1XFDA 3CBQA 3UCFA 3DL0A 2PJDA 3FPHA 2GPJA 1N2CA 3QWVA 3GDOA 3M4NA 4Y2HA 5AW4A 3IS3A 4RH1A 1D04A 4GYYA 4RPKA 1I2CA 1L5KA 1PKEA 3D43A 1FYWA 1Q0PA 3WNQA 5JHBA 1D4OA 5ERGB 3ZHBA 4F9EA 4NAVA 4ZMSA 1TZKA 4X00A 4JASB 1NONA 5ESRA 1CW2B 4OHYA 4GD3Q 4ZA2A 5JSZA 3PHLA 1T0IA 3ZLUA 5EHGA 1CP2A 4PXSA 1Z25A 5B1SA 3RSOA 3ELYA 3UIPC 2VRNA 1O87A 4K9PA 3V1YA 2VZLA 2WT8A 2BFAA 3VU9B 2X5TA 2PXXA 1FPMA 3TNYA 2G7MC 4UTPA 1L8XA 3L07A 3R9MA 4BX8A 1H8HD 1EK1A 3X1WA 3OHSX 1C2TA 2MSEB 4P33A 3QUAA 3O48A 1DJLA 1EDZA 3LX6A 2GPYA 1U0TA 3ZE6A 4EO4A 4OYLA 2YNMD 1C50A 3UKRG 3DD1A 3DFZA 3DYIA 4O8ZA 1XPJA 2R02A 5AOBA 1VMIA 2Y4UA 2LDBA 1YUNA 2Z8YA 4ZREA 5HFJA 1WY7A 2H4ZA 1NVXQ 3R5JA 3TO5A 3J7TA 1ORDA 3HN2A 1TK9A 4XVHA 4AUEA 3RKVA 3NWPA 1E61A 1SC3A 3UAWA 1BXKA 4QOSA 4H7DA 3ZDEA 3SX2A 3LUFA 3VPDA 4ZAWA 1MORA 1K86A 3UHOA 1ZGBA 3GW4A 4P3KA 4L0MA 3OEWA 5AI6A 4PGHA 3GN1A 3U60B 2R48A 2X19A 5I9NA 1V1JA 5ECYA 1Z7GA 1RI2A 1E8XA 1WKCA 2NZVG 2GBGA 2A9OA 2H1HA 5ALXA 1ZLXA 4L4XA 2IV3A 5CBNA 2YDYA 3I2JA 2IA5A 2ZE7A 1N4AA 4TS4A 4NSNA 2KHZA 4GF5A 5E38A 3U3RA 2H4HA 2BEVA 2QL7A 2MSLA 5HRUA 3T94A 1MHPA 4HP8A 3CZRA 3F5SA 3A4YA 1C3OA 1B2LA 2AJTA 2XVMA 1BCRB 5DJ5A 4R8MA 1A2KC 1HDOA 4UHDA 4V38A 2RAPA 4QDTA 1SVMA 1VHJA 1WCIB 3EUFA 3ABRB 4LWPA 2XMBA 3D6NB 1T5LA 5EC8A 4GMRA 4EENA 2IOLA 3ZGYA 4Y9DA 4ARBA 4BFSA 4LXIA 4Q1VA 2WA2A 1T36A 2ZG6A 5A5GA 1J9ZA 3AC0A 3KQQA 1J8VA 1PTJA 1IAQA 2ZJ0A 1N3LA 5JI3E 4HJRA 4URVR 1GARA 1K8XB 1M2NA 5AR1A 2JCVA 3V97A 1OUVA 4KQHA 1A69A 5AW8A 4IIJF 2ZQZA 1ZB1A 1VLHA 3IBEA 1QP7A 4XKJA 2WKRA 4HYEA 1SBYA 1CVRA 1XEWY 1I4TD 1TZCA 3JQRA 3QE3A 5KWJA 1CQJA 3AERB 4C2TA 1O54A 3JD0A 3SDBA 1N5OX 1AH2A 4K5AB 4AMYA 2JH8A 2Z2XA 3SO8A 1XD8A 4AG5A 5D3QA 2PMFA 5DRYA 3KAPA 1LF5A 1AUXA 2BUBA 1A8QA 3QHQA 1Y8QA 3DTVD 2HQOA 1H2HA 4RANA 3O8QA 4ZT2A 1RLIA 1JP7A 3J81k 3DL4A 3SBSA 4ZHQF 3AI3A 1QRTA 2HD4A 2A5YB 3H8WA 2ET6A 1PK8A 4O3MA 3FDHA 2I54A 4D46A 1O0CA 2PM8A 3T7CA 4TTRA 3I01M 1ONBA 1R4MA 1JG6A 4MS3B 3ZHYA 3KKPA 4QXAA 3IXEA 3D31A 2OFFA 3GA0A 1Q16A 1DV2A 1WPGA 4IIJA 5FEUA 1TJCA 2FF7A 3CR3C 2X38A 4FMCB 1BFDA 3CGWA 3H5AA 3UH0A 2F3QA 1H19A 2HXGA 3T9DA 2Z58A 1DAMA 3OOSA 4DLBA 3S5UA 2CUTA 2C92A 3E3NA 2QT1A 3KQYA 4BE7B 5CVJA 4YAUA 4LMPA 4FMBB 5DP1A 3LU1A 4OAVB 4XX5A 5A9TA 3S1AB 2CYAA 5IXSA 1C9YA 1U0SY 2WIAA 4ZHQA 1P72A 1AKNA 3ROMA 3VYRB 1N6IA 3PNBA 2UY1A 4WI1A 1OKKA 3CZ5A 4CHTA 1WDWB 2QLMA 2YQ8A 2WDZA 1U4SA 1XK6A 2XR1A 4LXQA 2XKAA 4GFDA 4TRRA 3DXZA 4H27A 1HT0A 2IUTA 2WHXA 2W2NA 1I3NA 3M2PA 2GPSA 4P58A 5ADUS 4AJWA 2AFRA 1IUNA 4RVUA 3UGQA 3CSDA 3LNTA 4MMXB 4X24A 2Q49A 4G8JA 4AUMA 4HG2A 1SBZA 2PU5A 5B2ZA 1VFPA 2FZ4A 1US8B 5HUHA 4UHBA 2RGNA 3R1IA 1WLYA 3NBUA 2VUSA 4UBJA 2AOXA 3FOFC 4F3YA 2D1QA 1IYZA 5B37A 3L7NA 4PLHA 5JQWA 1BDJA 2ODPA 3IQXA 5F3WB 3ZIMA 4M2LA 4CL0A 1N78A 1N2OA 2HZBA 1UXOA 3HXCA 1R66A 2H4YA 2IXEA 3T8YA 3D4NA 4DY4A 1ZU2A 2G0AA 3OZSA 4F97A 3TSWA 1IH8A 4TTTS 2PS1A 1EJ0A 3B89A 5KNCD 1PR6A 4G0ZA 4CBVA 1DB3A 1Z88A 4Q4JB 3DH0A 2NZ2A 2O7NA 1M1YE 4P0PB 2CMFA 3D2CA 3IBYA 5KYXA 2UYCA 2JZCA 1GGEA 3HUEA 4CG3A 5CJ2A 4IV8A 1Q84A 4K05A 3HVRA 1ISPA 4GDFA 3KAEA 5J08A 3D7MA 4D6XA 4RZIA 3M1IA 2PSFA 4LY9A 4F46A 4FFLA 3MA0A 4CR7A 2F17A 1EDUA 1NZDA 2FSGA 3MRSA 3VZSA 1ZOPA 2ODQA 4C4TA 1ZM7A 2IXDA 2V9PA 3UANA 1C1HA 4NAHA 1XVLA 1PAUA 3LXUX 2IJGX 1OFUA 3OU2A 4EBAG 4ZICA 3PD0A 2X8JB 4UNQA 4B2YA 3BHMA 1CUAA 1RRPA 3DE4X 1KORA 4S0ZA 1H94A 3KEZA 4FJYA 1EHCA 1U0GA 4UUPA 4MIKA 1H2FA 3CURA 1F7VA 1KO7A 1L4FA 2Z83A 1G60A 3T9FA 4YAIA 5JWOA 2B35A 3H1EA 3ZN2A 3OJLA 3WKBA 3TGPA 3A4MA 4DKXA 4R5HA 4K6FA 3F2VA 2NUTA 1IHDA 4F4HA 2ZWOA 4IEIA 1KJIA 4F91B 4Q34A 4MS4B 4X8QA 2O2IA 3WWPA 2IYXA 4FDMA 4ZT3A 3KAQA 5AI9A 4PLWA 1C14A 1AQJA 5TQ0A 1ZR2A 4CMKA 3FF4A 5ALJA 4D4JA 5ALGA 2IIBA 3CF6R 1I80A 2EU8A 1ZK1A 2ASEA 3BFVA 3E0QA 1RTTA 2WWXA 3ADBA 3HIZA 4DEVA 3PPXA 2YHBA 1EVIA 4IFIA 4Q3AA 2BEDA 5TEVA 3TECE 4G8CA 3AOEA 2C82A 5B3LA 5LP1A 1KNXA 2FSHA 1N0VC 5J2UA 8ADHA 2GH1A 1G2QA 2ATVA 3AUJB 3JYPA 3K73O 3DTTA 4WOBA 5K8TA 1XCBA 4CM7A 1TYEB 1FMTA 3CSFA 3D8RA 2WHYA 4CUZA 5AHXA 3ZVNA 2XX3A 1RWWA 4EVRA 4QQKA 3D9NA 3HBJA 3BFXA 2QI9F