4AY6A

Human o-glcnac transferase (ogt) in complex with udp-5sglcnac and substrate peptide
Total Genus 257
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
257
sequence length
717
structure length
698
Chain Sequence
b'SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYLTRANS F
publication title O-Glcnac Transferase Invokes Nucleotide Sugar Pyrophosphate Participation in Catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 257
structure length 698
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ay6A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ay6A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4ay6A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4ay6A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ay6A03
3Q3EA 3MRXA 1IYGA 3RKVA 5FTPA 4G24A 5HQ8A 2HY7A 3DZCA 2F3UA 4YVQC 3SYMA 4W9RA 5G04J 2QNBA 1JIXA 3HBMA 3VUFA 1Y6GA 4B94A 4RENA 3BD7A 3QWWA 1O6CA 1WV0A 5CCLA 2VSNA 1NZDA 1LWNA 3NC4A 2KCVA 3JYSA 3S0JA 4GPBA 3QKYA 3SYRA 4GYOA 2IYFA 3BDAA 4KQMA 3CV0A 3MRTA 1GPBA 2QRGA 3CVQA 4BQFA 4RG6A 4WNGA 2AZDA 2KS6A 3RSZA 4GZ3A 3AS5A 2I6HA 2XCIA 4UQXA 2VCEA 2R4UA 1L5WA 4X7RA 4CGWA 1Y6FA 1FTQA 5I45A 4NC9A 1FU4A 2NC9A 2BISA 5TMDA 4UI9J 3DD1A 4N5CA 3FFLA 3ZCSA 2QZSA 5DXFA 4I9CA 2Y4UA 2JJMA 2ACWA 5CHEE 3ASDA 3OKAA 3T3HA 1K08A 3OT5A 3IEGA 2R4TA 2P58C 2AVPA 4I17A 1L5RA 7GPBA 1NA3A 2GT1A 3CEHA 2SKEA 1AXRA 5A6CA 2YQ8A 1GZ5A 3LYAA 4EL5A 4N3AA 2G9QA 4BFCA 3Q5MA 2PQ6A 3E4BA 1QZ2A 3ULQA 2BFWA 3G2NA 4RIGA 4G2TA 4CTNA 5KJLA 2P6PA 1BX3A 4N2QA 2LNIA 2FF5A 4JA9A 1GPAA 4WUYA 3PDNA 3QOUA 1PYGA 5LCWC 3NP7A 2X0EA 2JZCA 4H7XA 1V4VA 3LY7A 3IAAA 3BD6A 1E96B 3PE4A 3RO3A 2X0DA 3E3NA 2IW1A 3WC4A 5G04C 1PN3A 3E3OA 2OFFA 1C50A 4FZRA 3EBPA 1FTWA 1JG6A 4GA0A 5G05J 2FF4A 4HLNA 4G26A 2JLBA 2VGXA 2HO1A 3CK7A 4EKYA 1JG7A 3HBJA 1XV5A 3IA7A 4NQ0A 1C8KA 4GA2A 5IKPA 5FJYA 3CUVA 1F0KA 1OUVA 4WNFA 1YA6A 3RIBA 2QN9A 2FEZA 4PQGA 1KLXA 5KJNA 3AS4A 3G2IA 2XGOA 1GPYA 4REMA 3L7BA 1NOKA 3OTIA 3BCUA 3UYLA 1P4GA 2XA9A 2WQHA 3L7AA 4N3CA 1IIRA 4UI9C 1NOJA 3OKCA 2C9ZA 3SZ7A 3MS4A 5DU2A 4I1AA 4HORA 1XC7A 5FT9A 2C0MA 2X0FA 4J8FA 2VSYA 2QLLA 4GCOA 4X7MA 4CTOA 1KT0A 4GPKA 3MT8A 4J8EA 3L7CA 4X6LA 1GG8A 1PSWA 4MHOA 2QN2A 3FROA 3DDSA 2AMVA 3ASHA 3KS2A 3MKRA 5C1DA 1P2DA 1Z8DA 3MV2B 3L79A 4FKZA 4CDRA 4MI3A 1Z62A 3BCSA 1QKJA 2VYIA 2QFCA 4AN4A 3CVLA 3C4VA 3MSCA 1NLMA 5CCMA 3G2KA 3CUTA 4U0ZA 5TMEA 2FFRA 3BCRA 3KAEA 1XOIA 3GPBA 3UQ3A 3CK8A 1GFZA 2MHKA 5DIZA 1JIVA 1Y8ZA 1TJCA 4YUAA 4EQFA 2XA2A 3L7DA 3WADA 2GM9A 1LWOA 1AHPA 5KJKA 4JHRA 1J39A 2GEJA 4KQ1A 4NESA 2PL2A 4IN3B 2IV3A 2GW1A 4MI6A 5BT1A 3AMVA 4JA7A 3ZGQA 3Q4AB 5BNWA 1FU8A 4YNDA 1FTYA 2FBNA 3CKCA 3URZA 3T3EA 3MEKA 1L5SA 2Y4TA 1PNVA 2XMPA 4M7PA 2VGYA 3CEMA 3MRVA 3S27A 4MHSA 1WAO1 4H7YA 2G9UA 5D01A 1ZBPA 3ZCTA 5G05C 4U0SA 2SKDA 3AS8A 2BUGA 2G9RA 3ASGA 2ECPA 1ZU2A 5JTUA 3R9AB 3MTAA 2XGSA 4GYYA 2WPVA 1HXIA 3WAGA 2HR2A 4W6QA 4UQYA 2VCHA 4J8DA 4BQEA 3Q47B 3NB0A 1XKXA 2V5FA 4RIFA 3MTDA 3FP3A 1XL1A 3CEQA 5AYWD 5FZSA 4BTBA 2XCCA 3ZCQA 4M60A 5EX0A 3GW4A 3S7BA 1W3BA 2DBAA 2G9VA 3S28A 1JIUA 4AY6A 4HOSA 3CUUA 2UY1B 2O6LA 1XNFA 6GPBA 3COPA 4RIIA 1NZNA 1E4OA 1EXVA 3NPAA 3G2JA 3MV3B 3D0QA 3GZ1A 3ASFA 3ZHEB 5HXAA 3C4QA 4RG9A 4N9WA 3TSAA 4AMGA 1WW2A 1WW3A 2SKCA 4MRAA 3RO2A 4F3VA 4GCNA 4BWRA 1L5QA 2IEGA 3GUHA 4YI5A 3LCAA 3G2LA 3ZCPA 3T3IA 4G23A 2F3QA 2IV7A 2IFUA 4O6FA 3TGOA 1NVKA 2ASVA 1KTIA 1EM6A 4RIHA 2J9QA 3D1JA 2H1FA 1A8IA 3ZCRA 5JJTA 2UY1A 2VQ2A 2LSUA 4G1TA 2F3PA 1UQTA 2C4MA 4I2WA 4MI9A 3QKWA 3ZCVA 3ZHEA 3TG5A 2OOEA 4BT9A 2F3SA 3VDNB 3MS2A 3BEOA 1C3JA 1L7XA 3VUEA 3D0RA 4AMBA 2WTXA 3TG4A 3S2UA 3QHPA 4EL0A 5BW8C 4GZ6A 2C1ZA 3C48A 3LPZA 1ABBA 1WV1A 1WUTA 8GPBA 1P2GA 5FZQA 2KCLA 3CX4A 3RJVA 3TOVA 4UI9K 3OKPA 2KATA 3CEJA 3CK9A 2E2EA 3GZ2A 2PQNA 5TVGA 3OXLA 1GGNA 4L22A 3CV3A 4BTAA 5D0OD 3T7DA 2HYZA 3S29A 5KJMA 1F6DA 2GEKA 3VDMA 4F96A 3ESKA 5A7DB 2QLNA 2QRQA 2XCUA 1E1YA 4WACA 4RBNA 1HZ4A 5D00A 5LQDA 3OTHA 1UZUA 4LEIA 2C1XA 2UWJG 2IYAA 2R5SA 1XL0A 4AM9A 1IHGA 2ACVA 1WM5A 3EBOA 5ENZA 4WHMA 4AY5A 3HYMB 1FCHA 4LEUA 2IF4A 2ZB2A 3O3CA 4NRHB 2R60A 3U3WA 2KCKA 2PQRA 1RRVA 3QWPA 1IXYA 3MBOA 4HOTA 2C2LA 1L5VA 4HWGA 3MS7A 1Z6QA 3BD8A 2GPAA 3FWVA 4U0UA 4NEQA 2X6QA 3Q3HA 4GYWA 4KQ2A 1QQEA 2GJ4A 4QLBA 3UPVA 1ELRA 3E3LA 3HBNA 4F9FA 3Q3IA 2QRHA 2L6JA 4WADA 3EDTB 2QRPA 5JJ7A 5DBKA 3LY9A 9GPBA 1SXPA 4F97A 1M5RA 1L6IA 4GZ5A 1YA0A 3CKBA 4N3BA 4AIFA 3H4IA 2PRIA 3RT1A 3MT7A 2AW3A 3K9IA 3MA5A 3HBFA 4J0UA 1JEJA 3KD7A 1P4JA 1PC2A 3GYZA 2Q6VA 2R68A 2QRMA 5EKQD 2IEIA 4WNDA 5DLDA 3NCHA 4XI9A 4YI3A 2GPNA 4RIEA 3T5TA 3H4TA 4I2ZA 3Q15A 3VTXA 3QDNA 4Y6CA 1B4DA 1RZVA 5D0QD 2ONDA 3QWVA 3T3DA 3UUXA 2XPIA 1NOIA 2QLMA 2FI7A 1P4HA 5EX3A 1Y8MA 1P29A 3OY2A 2ATIA 2VGXB 3TAXA 5JJ6A 1H5UA 4JL0A 2R66A 4RELA 4BT8A 2YHCA 1VGVA 4EKEA 2XCBA 3BEEA 1WUYA 4M83A 2VG8A 2XEVA 3OY7A 4KBQA 2H1HA 4MICA 2C0LA 1B89A 3VTYA 4XIFA 2QN3A 3G2HA 1SXQA 5M72A 1FC0A 4ABNA 2PRJA 2KC7A 5GPBA 2GPBA 1KT1A 1FU7A 3NF1A 1NZFA 4N39A 5JTTA 2X6RA 3OXGA 3CVPA 3RSCA 4Y6WA 2IUYA 4EJ2A 4HOQA 4I9EA 3UYKA 3DDWA 4KXKB 3ZN3A 2QN7A 1P2BA 4BQIA 4CTMA 1A17A 4KYOB 4N2SA 1HH8A 3N71A 4UQZA 1FS4A 3O48A 2FO7A 4U04A 2AV6A 5FZRA 5HI7A 3S7DA 2QN8A 1C8LA 3WXXA 3ZPJA 1Z6PA 4ME2A 4Z5XA 4X7PA 1NA0A 4G25A 4HOUA 3L01A 3MTBA 3Q49B 3PE3A 3MT9A 4YVOA 3S7JA 1FA9A 4A1SA 4G2VA 1QM5A 3RHZA 3U4TA 2F9FA 2XA1A 2Q7FA 4U07A 1K06A 1YGPA 3RU0A 1UQUA 5IKOA 3OXFA 2QN1A 2YJNA 3ZCUA 4XI0A 2BGUA 3LKUA 2PYIA 1RZUA 4GA1A 3ZFWA 2PYDA 2PZIA 3CUWA 3MQFA 4CGVA 2XGMA 3OTGA 5LCWJ 3LY8A 2LSVA 3SF4A 1HLFA 2FETA 3T3GA 3CUYA 1ELWA 1P5QA 4LDPA 2BGTA 4APOA 5ARGA 4WNEA 3NP9A 3S7FA 5TMBA 3NAZA 3CVNA 5ARFA
chains in the Genus database with same CATH superfamily
3A14A 1YQTA 1CZNA 1C9EA 3JQFC 4TM8A 2I65A 4EW6A 1UWCA 2BE9A 2LCQA 4RL4A 1WV0A 1RM3A 3WAJA 4OHMA 4RCVA 4RSHA 3EVGA 3DO6A 4GWGA 2IYFA 1D5CA 5U4QA 3TWUA 1PR4A 3IOYA 2XLBA 4DIOA 1OWMA 1QO0D 5JAUA 1ZCFA 5L7WA 3PLNA 1W0CA 2X4IA 3VZCA 2O0KA 1UKAA 1ZHFA 3UKRG 2X5TA 3ZNNA 4I4TB 4RULA 2EWWA 4PS1A 3RI3A 5JVDB 2Q5HA 1UXGA 1NBME 4E09A 5K0GA 2ZISA 1CJBA 1IVYA 4NNJA 4ZDKA 2CHUA 2V4LA 4DJ5X 3BD6A 4OOFA 1DUVG 4QE3A 5E75A 2P2GA 3ZU6A 1Q0HA 4AY4A 1CEEA 1ENZA 2VNAA 3QU2A 1F6BA 4NE2A 1LPMA 3WLRA 3I2JA 1R7RA 4QQ8A 5A02A 5K0SA 1U3CA 5DTRA 4HXYA 3LC2O 1SOUA 1I01A 2XYQA 5CU7A 4US2R 1X1TA 4PLZA 1NBMD 4QEZA 2XZDA 2PBRA 3ESRA 4LX0A 3JD3A 2YJTD 1HDYA 3ISJA 4I1UA 2VDNB 5HRAA 2NXJA 4P3YA 4MI3A 3DHVA 1XZCA 2BKEA 3KALA 1X80B 3R8CA 1HGXA 2QU8A 3QGMA 4LBYA 4PR0A 5EMHA 4EHMA 3HEBA 1X92A 3EIXA 1O95C 3SKYA 3E9NA 3DE5X 1UN9A 3CKLA 5G05C 1DO2A 1US8B 1JNYA 4MUMA 5IM4A 1BXGA 2ZI5A 3PJDA 1TO6A 4LF6B 1L4KA 3ORSA 1EZZA 4IDCA 4IDPA 4RC9A 2FSFA 5MF6A 4PGMA 2YINC 3COPA 2Q27A 3N2EA 3D31A 4XB2A 2J07A 2VOEA 1MRSA 3BL5A 2SNIE 4HH4A 4YRMA 5IUNC 1E6UA 3CIFA 1JDBB 3LCAA 3DSUA 5CDUA 3JATB 3OU6A 3DOIA 1YH3A 3OUZA 2V9CA 3F6YA 4BCCA 5KEIA 4BFVA 3U3JA 2GNPA 1EXDA 1A5BB 2ZUVA 2L6BA 2ZYGA 3Q9UC 5F1PA 3FCCA 1PNOA 1VJDA 1YNOA 2ZVJA 1B1CA 2R6CA 1QGUB 1UJRA 1ZI6A 1CYEA 3HNPA 4HAYA 2X15A 3GLHA 4GSLA 4D6YA 1M1ZA 1NW3A 3TIGA 2O54A 4JD2G 3FNEA 1A95A 2JATA 5DM4A 3T35A 2UWJG 1XKLA 4TV8B 1AKTA 3MTJA 1QIGA 3FZEA 4X3PA 2K7ZA 4D3YA 4DR1B 3QWPA 3OTNA 1PJLA 4PH4B 1WY7A 1BKSB 4HNRA 1NY5A 1Y9JA 3T95A 3CISA 4OUDB 3K9BA 3PQCA 4DIDA 3ECSA 1JN0A 1MX1A 2WG1A 3AB3A 4UYJB 3C3JA 4O25A 1H2TC 4M0CA 3I05A 3ZI4A 4XUEA 1IHPA 4P6VF 2XVXA 4NIMA 5LJLA 1L5FA 4EZEA 3OJWA 1RQRA 3RIXA 3B3JA 2XTNA 5E7JA 3CTMA 1BEEA 4JHJA 1DKOA 4BVLA 1EP3B 4L9PA 4EENA 1TR4A 2EIME 2EIXA 3CO5A 1LV7A 1P1FA 5KYKA 3Q5DA 5CB4A 1I9GA 2IVFA 2XKJE 4HB0A 1EHCA 1YZ3A 4U2BA 1OFUA 4HLLA 4A3VA 3W1WA 4FC8A 4RJIA 1KPIA 1EXMA 1WMAA 2YV5A 3DDCA 4IEIA 1E8XA 2QJTA 2Q62A 2J9YB 2PRZA 1W59A 4FHDA 4JCOA 3TBFA 4JJEA 2O0JA 3GRYA 1CS0B 3JQQA 4MDEA 5CCLA 3V30A 2E37A 5BRNA 2B3TA 4I6JA 4J6IA 3F9RA 2AJLI 5L40A 4ARSA 4X7RA 3W5SA 4DJTA 2NC9A 3FHCB 4CCWA 3JYNA 3HXMA 4FYXA 1CF4A 1PTJC 5J2TF 4ZCPA 4M89A 4R83A 1CJTC 5BSKA 3B3AA 1GKUB 2WE7A 4YV0A 1U7WA 3HCOA 3M6WA 2B37A 2AZXA 2WJVA 4RZQA 3BRWA 3OOEA 4A3SA 5IDQA 1RI2A 3LWBA 1EWKA 4IULA 1QOZA 1VKJA 3K9NA 1U1GA 1HT0A 2QRNA 3GGPA 3DVAB 1OYVA 2FJ0A 2GN4A 4NBRA 1NJSA 3TI9A 4F3NA 1MOZA 1JHAA 1T2UA 1T1GA 2QQGA 1XN1A 4TTTS 1NOJA 1GXSB 1Y6RA 1BDMA 2VTEA 2CHQA 5DBOA 3G8AA 2HM7A 4DTCA 5DW0A 2XTMA 4UWGA 3L6DA 4EFMA 4MGHA 3JWIA 1N34B 2ZJ4A 3ZV7A 5HRCA 3LKBA 3TWVA 1DIBA 3BJIC 1MO2A 2EARA 3I52A 3VHLB 3NFRA 4KYIB 4BXOB 1JQJC 1L7OA 2XQIA 2JIQA 1NQOA 1R15A 4IL5A 2V7WA 4DILA 5JA4D 3CEQA 1B8NA 1CDOA 3JQAD 4FXPA 4D57A 1E3LA 1B3BA 1NXPA 2WP8J 1AKQA 4FYPA 4RIIA 1DI0A 1J8DA 3EMKA 1XF1A 4X0EA 1WP9A 3R7WA 2PH3A 3BIXA 3MWDB 1TK9A 4AM8A 4YI5A 1F8UA 3KPVA 2ZUSA 1BD3A 1WHSB 4G8BA 2X22A 3NOQA 4AJPA 3MYVA 4C08A 1VCOA 1P73A 4D98A 2BEVA 3A9UA 3L49A 3HABA 4GWLA 2GTPA 4IMIB 1PGPA 2F3SA 3NHBA 1C3JA 4RAQA 4J1QA 1LC0A 1AMUA 3L18A 4QPZA 3TQCA 1CJUC 3ZY3A 3QV2A 5E2IA 5GZ1A 1A8QA 3T61A 1NYTA 2W5UA 4B8WA 4ZK6A 1UKVY 1QYDA 2ZJ2A 1FOEB 5K7SA 4Q1FA 4HPJB 3IT2A 1RNLA 2QLNA 2YFKA 5TPWA 3TNDA 3VXKA 1Y8QB 1JCSA 4LHXA 5EWJB 4G0YA 5JU6A 3QKTA 2Z1MA 2N47A 3FYUB 1JKMA 2XTZA 3FVVA 4UHJA 3UT5B 4NYJQ 4GYWA 1VCMA 4R01A 2Q9UA 3UW1A 3CEPB 3DVLA 4HI9A 3BPSA 5C9ZA 3WDSA 3THXB 2QRMA 5LZ7A 3PNTB 2PH5A 1R6TA 1A4RA 3H4TA 3PUVA 2BTEA 1UBCA 2ZJ6A 5LDHA 2GEUA 3BB3A 1WCIA 1TK2A 4TKMA 3M33A 3F4BA 3KZ1E 1GRRA 1YIAA 4MLCA 4KE9A 3AESA 3FHTA 1QV6A 1GDDA 4EGFA 3QA3E 4ZJPA 2O8BB 2XWSA 1E64A 2C83A 2C04A 4UWKA 5LQCA 1ZJ4A 2AN4A 2H31A 4NAVA 4CIXA 3RVMA 2F9LA 2VYVD 2P1ZA 2IXFA 1ZNZA 4GECA 1U4SA 1DBWA 3L4BA 3TKLA 2F9FA 1QHHB 3OXFA 1RI1A 4ZXFA 2XGJA 4DV2B 4M4SA 5JJ5A 1HLFA 3DZFA 1ZIOA 5JQGB 1EP1B 3D5EA 2WB2A 2JAPA 4BQFA 1VCIA 3LLCA 5EOVA 4OB7A 1N0WA 4BE7B 3PDIA 1U8TA 4MQEA 3HWWA 3RHSA 2F67A 4ZCLA 2ENWA 1BVRA 1FMTA 4KPGA 2YCLA 3VR0A 2ISCA 1LBEA 1Z5WA 5KOHB 3BG5A 4XOIA 4YAJA 4JCCA 3MA0A 2YVKA 2DR0A 3A4LA 4GBGA 3ZNQA 4UAUA 4CKZA 4MRVA 1SKYE 2Z8YM 2VQ6A 2VXYA 5FV7A 1M72A 1C0KA 3FRJA 5LWHA 5TPZA 1QE0A 3HSKA 1O03A 2PGIA 3QVOA 4OJKA 4FDAA 4P80A 3VR3D 1X86B 4KRFA 3C43A 3UT4A 3KAKA 2FQQA 2B34A 3DUFB 4EKYA 5IKPA 2PKQO 2XMSA 2O7SA 3G2IA 1ZG3A 3HPRA 4X1IB 3K32A 2RFMA 1YR2A 3KM0A 1XZMA 1IY1A 2VK8A 1T13A 1WMSA 1VI6A 3F7NA 3L7CA 2ZIXB 4X71A 2XKKA 4S1NA 2H08A 3UENA 4OLJA 4FR5A 1JHYA 1RBMA 3G2PA 4D9BA 1YTLA 3FUFA 2A9KA 1XZKA 2G0NA 1LWOA 3RJTA 4B3CA 4PQYA 5BSWA 5F1YA 3T7AA 3N2KB 3G23A 1RXCA 4BGUA 5LYYA 2FBNA 4YMVA 4Z51A 2ZETA 1OU0A 3SI7A 4O1PA 3ZIAD 1ISJA 4XPIB 1HZZA 4DMGA 3GEBA 4ED9A 3ZW8A 1K98A 4NV3A 5CT4A 2X6FA 4GYYA 3EDCA 3ENWA 3EF0A 1U2SA 4BNMA 3IE1A 1V16B 3KLOA 2EG5A 3L0CA 4LWOA 1I14A 1RWMA 1J6UA 2VH5R 3AJIA 1S7CA 3HB1A 3QNKA 2XXJA 3AILA 4MMZB 5FTJA 1EESA 3LUKA 3W6OA 3PXUA 4XZ3A 3SHQA 3TLGB 1J99A 5GONA 7YASA 1F12A 2R5FA 5L7TA 2R1VA 4TXLA 1E3MA 2X2PA 1H6BA 3WJ2A 1F0YA 4LSZA 1PVDA 3S2UA 4L0CA 5JS2A 2XWQA 3FUUA 3P2IA 1L5ZA 1REQB 2GD1O 3CK9A 3PFCA 4WJLA 2C8LA 1JE0A 1MYOA 2XWJI 5CVEA 4HXEB 4JYAB 1D4FA 1M5UA 4K9NA 1LSUA 2R44A 4LWPA 1B3RA 2B98A 3G9TA 5KNGA 3JV7A 5HE9A 3AUYA 4OEHA 1GQYA 5A7HA 3SJUA 1E62A 3I01M 4Y2GA 2QM0A 4PTYA 1YS4A 3ZJ5A 2UUPA 1AV6A 2QNIA 2B8EA 1AGXA 1Z6QA 1H3NA 1OJLA 2WTAA 5DK6A 2VF4X 3FGOA 1RLJA 3QG1A 3N9IA 1QGED 4NJOA 1V47A 4I5DA 2W8ZA 4XEHA 3FTXA 4XSGA 2NIPA 1GOTA 1Z2CA 4MGZR 5D0QD 3PPYA 2Q07A 3H9JA 4KSCA 4YMWA 2AG5A 1WW8A 2IEZA 4K8OA 2DT8A 3ND5A 1EVEA 5L3RA 2VG8A 1UEJA 2BGRA 2BI4A 3LOQA 4YNBA 3EIUA 3ZV5A 1Q0ZA 4MULA 2AMJA 1AD2A 9LDBA 1A1SA 1A5AB 3X1MA 4NQZA 2N3ZA 1YR8A 4RNDB 2GX6A 2W98A 4EF5A 4GVPA 1BRMA 3KJFA 4OHXA 4WASA 1E8ZA 1MN6A 4MYHA 4DWVA 4MKFA 3PNQA 1X7XA 4EARA 4RXMA 4FD2A 4CGZA 3OHPA 3SD5A 1W0KA 3OCYA 2DTEA 3AVUA 2HK6A 3FOZA 4LVOA 3EHNA 2X19A 2I1QA 2QYJA 3D9IA 3CHQA 4AAYA 3UFXA 3VOBA 1RHUA 1S01A 4NY1A 5H7XA 3S7FA 4N6OA 2LVBA 3AG4E 1E5VA 2PWPA 1EWTA 1NLZA 5A9RA 3ROPA 1JIXA 3A1NA 1HF8A 2C2WA 4XM1A 4ZCQA 4IF4A 1R3UA 3G0IA 4H7HA 3TFQA 4KQMA 4GS5A 2MYOA 3QJGA 2H6GA 3GQVA 1N8TA 1KU0A 3PNPA 4LNGA 1DC6A 4CKBA 2IO2C 4UI9J 2A1UA 3UG6A 1X94A 4NS1A 3JVEA 3TL5A 3EXG2 4ZI3A 3G2VA 1GEEA 2HXSA 3QENA 3PJGA 3HKCA 4N7BA 4OKIA 2VK4A 1E9CA 4YRBA 2EX1A 4CM8A 1X0XA 2HPHA 5F23A 4YK7A 3ETGA 4DA7A 3EFOB 3FI9A 3HXOA 4EG1A 3HXEA 3PNBA 3DJFA 1ZLYA 3AF6A 2RD0A 3IEIA 4LS3A 4TMXA 4NYMQ 1ONOA 4HNTA 2I6QA 4OQMA 2NV2B 1ODFA 3RRUA 1IBLB 3AB8A 5GWXA 4Q37A 4QOHA 2YYSA 2B7CA 5K4AA 4UU8A 1OPRA 1KI6B 3OKCA 3D6UA 2KXPC 4I1AA 4C88A 1L5MA 2YWCA 1S9HA 1P2DA 1YOBA 5EPOA 4E13A 1HE5A 2EGGA 4G9GA 3GQBA 2GJKA 1FRQA 1GFWA 2XA2A 3WYDA 5J9FA 3H11B 3EXIA 4DRZA 1GPMA 3DKIA 1CE8B 2RH8A 2QVBA 3Q4AB 3S4YA 4GEGA 3VC2A 1UOOA 2WPDD 2HT6A 3BICA 3RJ9A 5I48A 2DLCX 3GRZA 1K7CA 2CBZA 4P7JA 3OG9A 5KHLB 3DV2A 4EJSC 3MD9A 3T12A 1ZI8A 4EMTA 721PA 2E0IA 2EAUA 1NSFA 2GJSA 4V0MA 2XS1A 3FM9A 1L4NA 4XSVA 2ZYUX 5FOVA 4BO4A 3B36A 1GSHA 2AR0A 2H65A 3DBRA 5C2YA 4B6SA 3BJEA 1SK8A 2IP1A 1QLWA 3I61A 1B74A 3PFGA 3NZUA 3DA8A 1JG1A 5F51A 1N5DA 5LR6A 1G5TA 5A4AA 2OB2A 1KZOA 2YN2A 1QVVA 3LPZA 1UPUA 5JAQA 3SYTA 4BMYA 4J8SA 4B3IA 3VLDA 2CNKA 4R69A 4EEXA 3ZBPA 2Y6VA 3PVZA 2YXDA 3CV3A 1PIWA 2PKWA 3FRHA 3FMIA 2F1HA 4O2AA 1OFIA 4RXUA 4UREA 2ZRGA 4NENB 3ZGLA 2E87A 4BB6A 1MMFB 1VQ1A 4IHKA 1IHGA 1ZCJA 3IT3A 2OPBA 4MW1A 2MINB 1MDFA 5A4MS 5JHAA 2OB1A 4ZKEA 4NCAA 5GAJA 4KIWA 5IVPA 4RCYA 1Q1EA 2A1TR 5ALWA 2C3MA 3EHDA 4YDRA 4XDZA 4KQ2A 1QU3A 3WLSA 3PDWA 4RA6A 1SVLA 1A2QA 1B6RA 3RVLA 5EYLA 3KRTA 4MP3A 2R7KA 4AJWA 1QRAA 1E2GA 1SZJG 1U8YA 2H92A 4PSVA 5C4MA 1PG2A 3PZRA 3C4JA 2XW6A 2O1WA 1XQ1A 1Z0SA 3FJ1A 3HYSA 4PLCA 1K1AA 1PJRA 3JWJA 1EE9A 1OC4A 5K0LA 3X1ZA 3JQGA 1ZICA 4YJHA 1ZCAA 1IXKA 3LUJA 3ZH9B 1Y9EA 1FUKA 2O5EA 3R6DA 4MW6A 2PA0A 4L75A 4RQAA 3S8MA 4WN3A 1NT2A 1OTHA 4ZKDA 1UM8A 3OEED 5F5LA 3FTSA 2XVZA 4YRNA 3HKBB 2EOAA 2ERXA 4AIIA 5JNSA 3E03A 4JU9A 4R1TA 1OIWA 3PC3A 1OD6A 1M76A 3I3OA 1JR2A 2YW2A 4XIYA 4KO1S 1H2YA 4B71A 1S0UA 3WNCA 1FP4B 1G2OA 3AFOA 1P5QA 2DTDA 1U94A 1ODLA 1Y8AA 3RUAA 1CQWA 3RVRA 5C7LO 3N8HA 2Y71A 2C82A 3H1PA 3RRNB 5JWOA 4WA7A 5GVSA 2E4WA 3V4RA 3ETCA 2CLMB 1J22A 4TS3A 2Y0DA 4BEBA 3V1NA 1NE7A 1KR5A 2ZIEA 3HL0A 3TE7A 4NC9A 3ZVKA 4Y6SA 3H2ZA 1YBVA 3SIXA 3G0OA 4R9VA 4H27A 3RSQA 3ZGYA 3MJEA 3D9JA 1YS1X 2GS9A 1GPJA 2GYUA 4H4CA 2ADFA 3GH1A 1SKBA 3LC7O 4LWZA 4DMLA 1W1UA 1RQXA 1BLXB 5KJLA 4NHEA 3WP0A 1DTEA 1YFJA 1T9HA 1H3FA 4K26A 3PXAA 1R16A 4I1PA 1P18A 3LY7A 1N6LA 1PX2A 1MZPA 1GM5A 2JFWA 1TYAE 3GVPA 5I9NA 3R0JA 2ZEJA 5LPNA 2X8LA 1Q7TA 3ME5A 1PS0A 2WAYA 1XNHA 1KDTA 1MJNA 1QGOA 4DJJA 3RYIB 1WCWA 5AM1A 1ST2A 4NZMA 1ECCA 4MB0A 4K87A 4GUDA 4BMNA 4D25A 3KAPA 4DCCA 2GEFA 2X8JB 1QHYA 2FKAA 2P7HA 3O7MA 4GPKA 2VH2A 2GZMA 1FS5A 3SFVA 5DNAA 4FKZA 3NHKA 4QGFA 2WSMA 1ZDMA 4XVRA 1QS0B 3RVBA 3SEZA 4FFNA 1W46A 3EGOA 3NHLA 3D7MA 2E1RA 2VTKA 2CDRA 5LNK1 4J03A 2ILRA 1ZHHA 2G9RA 4QATA 3LWNA 5CX4A 3PTZA 4G97A 4B40A 2FFJA 1B0UA 3NCTA 1E9RA 4X7BA 3O2QB 4FOTA 1JKIA 3W9SA 3B1JA 4H4EA 3FTUA 5FZSA 3A6HA 4RD1A 3HPQA 1EM8A 2K6GA 3GT4A 5DXAA 4KR6A 4P22A 3GR6A 4BEWA 2WYVA 1L6RA 4P7BA 3GJ7A 2P79A 1UBHS 2ZT5A 3ROXA 3KT8A 3T1YB 5TJHA 1VL5A 3BXGA 3E5RA 2IFUA 2RJ3A 2LDXA 1KI2A 3IILA 3HRKA 2A35A 2XMDA 1YQDA 4LY6A 3AZPA 3WIBA 1FRZA 1P2SA 3QHPA 2C94A 3C48A 4MWEA 1JPUA 4DEXA 1P2GA 5LM3A 4PS0A 5EUMA 4WNYA 1PK7A 1M1UA 1E3WB 3H65A 4ZCSA 2PQNA 2X14A 4WFKA 1PFGA 1IUKA 1R0LA 3G1WA 4L51A 2G63A 1ZVJA 2O3SA 3QNWA 2BEDA 3IPCA 3A4MA 4FEEA 5TR9A 2GLUA 4BFZA 3WLQA 4URFA 1Y5MA 1ZNXA 1R6DA 5F2NA 2JABA 2YWJA 5CLJA 4D0RA 4DNFA 4QDKA 5ECYA 3MS7A 3TIIA 3DONA 3UCFA 2PSDA 4I50A 4QLOA 3DEFA 1T2DA 3EZ6A 2LBPA 3SC2B 5HTOA 4IP0A 3SOZA 1KZ9A 3HWSA 3BG1B 2IZ5A 2ZQYA 3ML8A 2JGJA 5DISB 2YNQA 5A7FA 3GVHA 1OH6A 1G21A 1PBNA 1M1YA 4DEYA 4G5YA 1DG1G 1X9GA 5CLGA 4B7ZA 4IF6A 4ZZ2A 4M1OA 2VT3A 5FNVF 4A0QA 1XZJA 1KRHA 5CGZA 3CX6A 4IOKA 1MB3A 5ECWA 1A5ZA 1R50A 3KZMA 7ABPA 1XX6A 4PQRA 4ENRA 2C57A 5ARCA 3BRSA 3PUWA 3ICQB 5AENA 1L4YA 1L5KA 2QIOA 4G11A 3VAAA 1GILA 1Z8HA 4MMYB 3EZ7A 1WDKA 2XNDD 2ZJFA 1LCIA 2Z8XA 3C6QA 3OCVA 1IZ7A 3P94A 3LVRE 3CEAA 3ZWMA 1U6IA 1SN7A 3NBKA 2QN6A 4G0NA 4TKUA 1A1VA 4YMIA 2FW9A 2AXNA 3J7AC 3WQSB 2I2DA 1OGJA 4MO2A 4A2CA 4PZ0A 4ZOAA 1XYVA 4RESA 4J49A 3DMTC 4RA9A 3CVOA 3ETNA 3RSFA 3I64A 3LHKA 4AEZC 5KIAA 3PNVA 3FR7A 2R4TA 1PR6A 1UUFA 2GM5A 1SOWA 2ZE7A 4HNQA 4BFCA 4QQNA 4KXUA 4TPKA 1JHMA 5FO0A 4Z7NB 3WZLA 3JRXA 2DE0X 3BB1A 5FWXB 4QOSA 3UMFA 1P1HA 3IIEA 4ASUD 5CDYA 1TT5A 3N70A 1RYZA 4EGJA 5KSZA 4NJEA 1P4RA 2O6HA 1RWXA 4MYSA 4OJTA 4PCLA 1SIWA 3T1QA 2P78A 4NBWA 4GAEA 1ISRA 2PA3A 5JJBA 4G41A 3B70A 3AR8A 2ZJ7A 4R1SA 4D9GA 1KT0A 4MYCA 1BOOA 3A1SA 3OE5A 1YR1A 4CCYB 3NEYA 1KZGB 1NFIE 3ZU7B 1JKFA 5LMCA 3JZIA 1RWNA 2HHJA 1FFXB 2OFOA 4MQ5A 2GEJA 2R1ZA 1UJ5A 1AUQA 2HMWA 4NS4A 4LXHA 3AHFA 4LRUA 5BNTA 1PNVA 2CB9A 2QDKA 2YV2A 3BSSA 5IRCD 4RY2A 3CA8A 1T2CA 1QG2A 1AS3A 4KQFA 3L1JA 4LNUD 1YONA 2Q5QA 5ILQA 5FR2A 1V11B 1P0IA 1YS6A 1RPAA 4GI7A 4JJ8A 3ZHQA 4QXRA 3JUEA 4JJZA 2B1RA 2GJAA 4WEOA 4HX5A 3B8HA 4Q7JB 1V2GA 3H1GA 1YCFA 1GQSA 1NR7A 1Y98A 1A82A 1WXIA 3CR3A 3K8OE 4ZHSA 4L5BA 1KAGA 1M7BA 2JHAA 1C0EA 5JSUA 2BFPA 5DGIA 4NPCA 3LXXA 2PIDA 1ZIPA 2YWDA 3UJHA 4IDNA 4TXMA 2M6RA 1U3DA 2A2ZA 5MN5A 4ZCMA 4UDXX 2OXIA 4JXKA 3CKKA 4AY3A 5EJ9A 4QVIA 4PSUA 4HDMB 1CSEE 4HUJA 3PXEA 2VYNA 2C00A 1C3LA 4L50A 2XB6A 2Q99A 5T57A 2GHTA 3S44A 3TTUA 3R6WA 4LZWA 1GZSA 1UW4B 1JHDA 4UKDA 2I33A 1OYYA 2Q5JA 1SB8A 2RH5A 3SNXA 3OC6A 3VYVA 4P53A 3HU2A 2WHEA 2D7CA 4YVFA 5EXSA 2FPGA 1ADYA 3HYMB 4URZR 3AGQA 5CX1A 1XF9A 4TLLB 4RABA 4FIZA 2EBHX 3QU9A 5AJWA 4LYGA 4K5QA 4NLLA 4QLBA 1T6NA 3P9IA 5FLKA 1O95D 2ZWPA 4CLXA 3MKQB 4N40A 3H5NA 1SXPA 1M5RA 3NWJA 3QTTA 4DCMA 1IY9A 2FZ5A 3CX3A 3EIOA 4DR2B 5JW6A 4YRGA 2CLCX 3ECAA 1YFZA 3I6IA 3APDA 5ADUS 5AP9A 2A92A 4HAIA 1VPDA 3KSBC 5JASA 2WSSA 1HT2E 3ACCA 4WOPA 3T38A 4YCAA 5JXWA 3W8RA 2P9SG 3X2EA 2ZRIA 1RWBA 5EQDA 1CPYA 4MGYR 3VU9A 3ORHA 2H7XA 2Y76A 3ABQB 5H3CA 2Y0BG 4XR4A 3AY0A 5U9CA 3R44A 4JBNA 2CNBA 3MAJA 2XEHA 4EVRA 4KO3S 4B3JA 1Q0QA 4G0OA 2JEOA 3LKUA 1H2WA 4GVLA 3MHPA 3E1KA 1T29A 4W1SA 2I66A 2GFIA 3SF8B 3UXEA 3QMVA 1UJ6A 1HR0B 1IYGA 4K5AB 4XGRA 3F1LA 3IDFA 1NI1A 3KWMA 3TKYA 4MVJI 2X5HA 3LLMA 4LCBA 2JLSA 1MPTA 1OT5A 4QM6A 2MJLA 1U65A 3ZDCA 3RUIA 3ER8A 4KQWA 3A9RA 1E6KA 3ASDA 2P7IA 1X2EA 2XADA 2WUFA 3DO5A 5A3JA 3D2LA 5TT1A 1MC1A 3UAVA 2HJRA 4FQ5A 2JA1A 4P54A 1YZVA 4KXVA 4XX0A 3NO4A 4NF2A 2DUUA 1NTRA 1YVRA 2QSZA 2IS4A 4L0DA 3E3OA 2VDKB 4HFNA 1RMYA 4ETMA 5TGDA 3W2IA 2HRCA 3NV9A 1RWWA 3II6X 4IEFB 4AMZA 4E33A 5K3EA 4UI9C 3HDJA 3M6IA 5INTA 1YA4A 3L9TA 2QLLA 4KLCA 1FP7A 1VXOA 2LXLA 3MOIA 1KYVA 4URKA 4EFDA 4MPDA 4D9EA 5M04A 2O8CA 1U7DA 1EX7A 2CVHA 2VXCA 1Z4QA 4RD4A 1OLSB 1U4NA 1L7DA 2AMFA 2DC1A 3WGQA 4X63A 3URZA 1YCDA 2VGYA 1WCXA 5DO9A 4BQRA 2OVFA 2F48A 3RIYA 3QC1A 2H5JA 1TL7C 2F1IA 3MJVA 1TYQG 2L19A 3NB0A 4P3OA 3Q8KA 3FF1A 2IJGX 1GG9A 1QG6A 2WD7A 1Z2OX 2FJPA 4AXBA 2BI8A 2X9NA 3LYUA 3QXXA 1U1FA 4GTSA 2QNRA 3ZLTA 2VQEB 4DIFA 2JG3A 4D02A 3RE1A 1XCLA 1EVZA 3K0AB 1TYDE 2ECOA 2SECE 2AKEA 5F1KA 2KYRA 4I8XA 1OZGA 3P4UA 3RUEA 3KEGA 3CZ4A 4LJLA 4LVUA 2H4YA 3LDUA 1TC1A 4XYEA 2XCQA 1MCZA 2ODPA 1T2AA 2C7PA 5C2JB 1YR3A 3U3ZA 3ZHRA 1QK5A 3FPSA 3JQ7A 4PXAA 2Q5LA 4IZHA 4OA5A 3W3AD 3D7NA 1N0RA 1QUEA 4DUGA 2BTDA 1DJLA 2Q2QA 1E7QA 3ANLA 4C2UA 1DBRA 3EFEA 2XCUA 3HA2A 4US0R 5CJ2A 2OK8A 4CMCA 5IZ4A 4X3CA 1BI7B 4QFMA 3K6SA 2O8DA 1CUJA 1Y7HA 3OCUA 2WIBA 3R5HA 4NDNE 1UMKA 4HQ0A 1XRQA 3DM5A 3O4JA 1W4CA 1BW9A 3C70A 1Z0DA 1Z4MA 4ZI7A 1WLYA 3V8NA 2CG2A 7ADHA 4DHEA 2PUWA 4ZT4A 2Z1NA 3ESBA 2F8TA 1P4AA 2GI4A 3PNMA 3B6KA 2WICA 5EZYF 4DR7B 2RHRA 4LF5B 2DLNA 4ZHQF 3L8ZA 3W78A 3EEBA 3WGHA 3MJSA 3GEHA 3OHMA 4A73A 4XQEA 2VK1A 2XRFA 2YIVX 3ZWYA 1OA0A 5EX3A 4CR7A 1BFUA 1RZ3A 1WKVA 3R1IA 2X8AA 1R5NA 2LR0A 1S3GA 4YJGA 1B89A 4KVOA 4DPRA 4I9NA 1RKXA 4LYAA 4CEHB 4YAUA 2ZDGA 4LXTA 3H2GA 2ZYDA 4LUCA 4Q4HA 2ODWA 4QRIA 3NHRA 4RK4A 5FBLB 4IDFA 3SC3A 4TQUS 4L27A 5J2UF 4PZYA 5B6PA 3O92A 1C3XA 5BN5A 1H65A 4F84A 2ISQA 1D2EA 4ND7A 3WGTA 4LRZA 2A6PA 1IWOA 3BAZA 3EVAA 3ABIA 5LYJA 1ZJWA 5I9IA 5F73A 2PL5A 4CT5A 1TVCA 5KBAA 4LVNA 1RMTA 5JISA 1FMLA 1JLRA 1IE3A 4LDNA 1BPOA 5HKLA 3HBMA 5WRFA 3KE9A 3E35A 1VKHA 4DNPA 4DJFC 4ZVNA 3TPZA 2QQ0A 4BEVA 1N4DA 2CMDA 4ZVQA 3EIEA 2H1OA 4M86A 1TYCA 1ISMA 3ZPXA 5JNRA 4Q7MB 4TTJA 3VTZA 3PEEA 4C3VA 4DYVA 1UK8A 3OZXA 5HKBA 3CEHA 4PG5A 3ILYA 1KR2A 1JAXA 4CMIA 1QZ2A 2RKWA 1PL7A 2OD2A 4GZDA 4CM7A 3AG2E 5FORA 3I1IA 3F5MA 3E84A 1EFPA 1VE6A 3FPEA 2O1EA 1OFUX 5KTKA 4Q3LA 2OOKA 3IL2A 1Q11A 2QTNA 4UOZA 4H3KB 1SBYA 1XV5A 3VX3A 1CUHA 4A91A 3OCCA 4YRZA 4JL5A 4YMGA 3AU5A 1RAFA 1P9WA 3QLUA 3NBUA 3U7IA 4QKQA 5DI9A 4KHPB 4YDYA 5G4KB 5FH9A 3I2GA 4JXZA 1OH7A 5CA1F 1CUCA 3M1LA 3HO6A 4Q3NA 3WK6A 3FAKA 1AC5A 4XDYA 4UD6A 5FL3A 2RJOA 4H59A 1BXGB 2AR7A 4AROA 5CLLA 3KOZA 3D2CA 5KTTA 3SBDA 3MX3A 4F3RA 2GW1A 4RHTA 4J2TA 3AOEC 3DWFA 4P4TA 3HYTA 2VUSA 3UX4A 3HJBA 3Q5GA 3SX4A 2WTBA 2P2NA 1LDGA 4QUEA 5AT1A 4C7VA 2AN9A 2PG3A 5DEIA 2DHEA 1NR5A 1LLCA 4A15A 4I46A 5B1BE 4OIMA 3FPGA 3GZTB 4RV5A 1ELKA 4JHLA 1SKMA 1RW2A 1ZR2A 1N2OA 3CSSA 2V4UA 2BFAA 1XDSA 3UTCA 1VYVA 3CH6A 4K1LA 1YV9A 2O2SA 2FMUA 2RK4A 3ONVA 5FZQA 4BKUA 5AI5A 5E4FA 5JNVA 4QJIA 4O2LA 4G5GA 3P2EA 2R6ZA 5JIBA 2IUEA 3M1YA 3C39A 1H2VC 3TG8A 5IZCC 3FUVA 1ICIA 1TM5E 4UBNA 3ZV6A 3JCKC 1ZGZA 4JIMA 4RBNA 3VV3A 4RQIA 4DREA 5A5GA 4D3XA 4K5BA 3HXLA 4MR7A 4FOLA 4X92A 1OI4A 3SGLA 4Z3KA 4QC2A 1AA6A 3U3WA 3I5YA 3P1UA 4DAOA 1QPGA 2H1WA 3MWJA 1FIUA 4ZQEA 1MF7A 5KSWB 1XCGB 2DWZA 1UH5A 1B16A 3AJEA 5AJYA 1LQUA 4LFCB 3QEOA 4X8MA 2AK2A 3V6MA 4W5TA 4BYGA 2ATCA 2NPFA 3N76A 1CRWG 5FO1A 3P20A 5A4FS 3PJFA 4L73A 4L9SA 1ODTC 2PLNA 4RY8A 3CQCB 4G4JA 1YUMA 4C4SA 4QEKA 5C8YA 5JS7A 1NV8A 3OZCA 2YHCA 4D6PA 3E7DA 1WUYA 2H2WA 4ZTBA 5CB4B 4PQFA 1KAHA 4KBGA 3S2FA 4YMLA 5FWYA 1C80A 3GP3A 2WG2A 1U6JA 4BETA 3SFYA 2BKUA 3UIEA 2O59A 4B7AA 3AHCA 3DEIA 5E8RA 1L8AA 1DJQA 2IY8A 2WXLA 4QDZA 4O3FA 4OQYA 2H6FA 4Z53A 1IUOA 1KEEA 1EI9A 3DBHA 4D8WA 1EBBA 3APCA 1JA9A 1X6VA 5LDGA 2OOSA 1K6IA 5MFZA 4QECA 4JASB 2EX4A 3UMJA 2BR5A 2P30A 4CUJA 4FI3F 4H1WA 2CYCA 1J21A 1R2QA 4CGVA 5TT0A 4MAFA 3INRA 4ZO4A 2R8EA 4CMHA 3GAAA 1AQ6A 3D2BA 3Q0EA 3NKVA 1QDUA 2JJ2A 5GIOE 3KB1A 1U7UA 1HTTA 5JALA 2XB8A 4WMLA 1J25A 3BDAA 3QJYA 3AERA 4AZ0B 3CLUD 1WOYA 3QELB 1S0PA 1LEHA 4FCTA 3TXAA 2FK7A 3GWGA 3T1TA 1NVWQ 1E2EA 1W93A 3FFAA 2ZYSA 5EI5A 1S7GA 5KNCD 1X0VA 5E9QA 1CZRA 1IHXA 3JW8A 5AVWA 3INGA 5GIPE 4I2VA 1PJAA 3JZAA 4ZU3A 3FKSA 2Z30A 1CVIA 2B35A 3EE6A 1RWPA 3FH5A 5C53B 2P5UA 5ANRB 1JNXX 2D0IA 4R2MA 3GEDA 5E4JA 4UOEA 3PCTA 2X0EA 3CO0S 1OKKD 4CWAA 2TECE 4WZAE 3BK2A 1Z2EA 1NLYA 3UNXA 2A5GA 2ERYA 2I3AA 4RF4A 3WC4A 4FCWA 1N25A 3T7TA 4HBZA 2Y1DA 3K9FC 1MO6A 1R0ZA 4DLXA 3D3JA 2G70A 1R0CA 4MA0A 5DM70 1FNDA 5JCJA 4IG4A 3MWLA 1BA3A 2RSFA 2JGDA 3ZV4A 4E21A 5G41A 2YNMA 4AICA 4ZOLF 4MHOA 4OQEA 3IUPA 4C22A 3V4PB 1AHNA 4QHTA 4D42A 1U1DA 1N3IA 1RIFA 1OLOA 4Z4FA 3L0BA 2QUAA 3OZSA 4RQBA 2QJOA 4TTIA 3EMBA 3BQNB 4Q5IA 5CDFA 4AX4A 2HWWA 1BJTA 3DEYX 3NRJA 5F12A 1UPCA 3K70B 2VCHA 2OESA 3R7WB 4ALMA 4G1FA 3FYCA 2EW2A 1HO3A 2ZIZA 5J43A 2CMGA 4PZZA 1I24A 1OY3D 4PICA 2F8MA 3N5CA 2V5AA 4HOSA 1W49A 4I2NA 1JKXA 4ND8B 2XYRA 3C4QA 2JRCA 3OM8A 3ES9A 3EG9A 1T24A 1WB9A 1EFUA 2IEGA 3T1OA 5JO9A 3W34A 1QBGA 3B13B 1PJBA 3QEJA 4IPTA 2PMKA 1PFYA 3PH0C 3FPJA 1WBJB 1L7VC 2IYVA 5BNFA 3ONLA 5HEKA 2NP7A 2IOFA 1M33A 3IT0A 1NMYA 4E7PA 1ZIDA 5TPWB 4JJGA 4MIOA 5ICFA 1ECFA 4IIEA 4B73A 1XA4A 3RIEA 2KATA 4CF4A 1KEZA 1EA7A 3RT7A 3VZPA 2I7DA 3LY5A 3VR2D 3HL4A 4C4ZA 5ALSA 3BT7A 4BO0A 4GTMA 1HZJA 4RJLA 1Q21A 3FHEA 3LP5A 1RXUA 2QAJA 2HBRA 2X41A 3IEUA 1Z15A 2X0RA 4X66B 2NU6A 5AHRA 1WM5A 1MJFA 1E5XA 2GBPA 5AK5A 2OZPA 4RNCA 4NYIR 1DDOA 1JA1A 2GN8A 4TKVA 1FZTA 1PJQA 3PGVA 1TVMA 1WCIB 2BSAA 2R8ZA 2NG1A 1J1UA 4AMUA 1D8AA 3OZWA 3VJKA 3VNSA 1P4JA 3AESB 3FLBA 3GYZA 3AI1A 2R68A 1PAUA 3NYQA 2PLFA 1YJ8A 3CQGB 1KZ1A 3HNRA 5IKMA 2J7PA 2Y67A 4IJVA 4GBJA 2A9PA 1URPA 3KUKA 2DMRA 4ZU1X 3H16A 3ANXA 3HCWA 3K1AB 1QWOA 5BQXA 5LXTF 2UYHA 4MNTA 3TB6A 4LHZA 3VNUA 1ZM7A 4X7PA 3S7TA 3RU2A 4P7GA 4F3CA 4KR0A 2J30A 5CAEA 3LL7A 3PDIB 5TQ0A 4PZ9A 3TCNA 2YJNA 4V0OA 1PKEA 1IZZA 4A26A 2ZCVA 3MQFA 3EZGA 3DMNA 2NNLD 5DM2A 2XCSB 4MUEA 3WY9A 3UJNA 4JBWA 4B94A 4IJKA 5EKDA 1M66A 4KH1A 1GR1A 3JYSA 3S0JA 2E4AA 1L1QA 2CHVA 1U80A 1L4FA 1LB1B 1SCUB 6PFKA 2R4UA 1DX4A 1EUDB 1FTQA 3IGFA 2JFPA 5BVHA 4JVSB 2V7QA 1GP2A 3L6OO 3RG8A 4JHKA 2XJ4A 1Y48E 3KOXA 5AW2A 3TM4A 3AV3A 3R7FA 1IBMB 4EGQA 1H1DA 2PH7A 3LXMA 1T9BA 3HXDA 1QNFA 2H5IA 4KRYA 3OQMA 3ROFA 5JO0A 4YAKA 3WIDA 4DVGA 4R2JA 5HHTA 4D4MA 3KBBA 3EF3A 1XYYA 3F5DA 2X0DA 4DN6A 4O1MA 2GPSA 5KUTA 3ZOKA 2NTYC 1F2UA 1DQZA 3FWZA 1NVVR 3EHEA 2PWYA 2VP4A 4URUR 1EGAA 3C3PA 1ZOSA 4N7JA 4RTQA 1ZH6A 1RHKA 3QYJA 1E1LA 2XOKD 3R9MA 2VHYA 4TZ6A 4B9AA 2FCAA 1V37A 1E2NA 3KV1A 3ORFA 1Q15A 5BV0A 2NT3A 4X7MA 2QD5A 1R4MB 4Q94A 2BTQA 3VPBA 3O91A 4G9BA 3MSCA 2I8CA 1YYHA 3PPWA 2P9NG 3MUNA 2CXRA 4QUAA 1A7KA 2GQ0A 2P77A 3DWLG 3CLUC 1NBEA 4CM4A 3ONKA 5KBYA 1P0CA 3VTAA 2J8ZA 4HT3B 5HGJA 2WT8A 1MZVA 4LG1A 4JEMA 3ZBQA 3IXEA 3ULYA 4FYHA 3AEUB 3P9CA 3QVGA 1RM5A 3QMWA 1GR0A 2K2QB 1SKUA 3DYIA 2FEMA 3UC5A 3WLPA 5AYWD 5AK6A 4DCUA 3RS4A 3B9PA 4D4JA 2IDJA 3GLUA 4O4JB 1NZNA 1I2MA 3TQFA 5A03A 2DPMA 2FP4A 1TIPA 3QPDA 2HO5A 3L7KA 5J5VA 5LOVA 1V7QA 4ZJYA 5AHOA 2H59A 3G89A 4TQ9A 2GDZA 3E22B 4HF7A 3PHBE 1WBDA 2H1FA 3THYA 5JJTA 1DIRA 4OFBA 4RMIA 4PYLA 1YMUA 2CFTA 3VFDA 3VZDA 3WWEA 3VJLA 3U3XA 4RH0A 2W70A 4ALIA 3NT2A 3U7JA 3N53A 4FJYA 3PFFA 3WBKA 5D0OD 2GRJA 3DBVO 3TK1A 5C0OE 3IULA 3I92A 4HNUA 2GEKA 3L08A 4EHHA 3S2EA 4R2IA 2Y1KA 4Y2XA 3ENNA 3V9PA 4BMSA 1Q22A 3GF4A 4KGXA 3ON5A 4AKXB 2PKQP 3FCXA 1UAYA 4E2FA 2CVPA 1VHQA 4V24A 5EPEA 4B43A 1WNFA 4XB6B 4UHDA 3IP8A 4AS2A 1G66A 3KOYA 2Q2WA 5F77A 4E70A 1OWOA 3F3SA 1DB3A 3HACA 3ZU5A 5FPYA 2I4OA 4EOGA 2BZGA 1YZKA 4DSTA 3OZTA 3QVUA 5HIKA 3HH8A 2QGNA 4U2CA 3G2QA 2H1CA 4R3UC 4CL0A 3P2BA 3PXXA 1V6AA 3AM1A 4BLWA 4PC2A 4G1EB 2IHYA 4YQYA 4ER5A 4L3VA 2A84A 1Z4OA 4WESA 1FQJA 3LO5A 3UFXB 5L45A 3GW8A 1MOQA 3I34X 4NDAA 3KJZA 1U2GA 3H17A 2GARA 1PHPA 4Z5XA 5GGYA 3IQHX 1Z73A 1P5RA 2ZXEA 1U7XA 1AF7A 3N74A 3BXFA 1PZNA 4G67A 2C2ZA 3T3GA 1R0RE 2G4CA 5HVNA 3DE6X 3AL2A 2IGTA 3Q2OA 2V5QC 5K8TA 3ZYQA 4F5WA 1GRCA 4AO6A 4CKBB 5HJEA 3DOEA 1DVPA 3TMAA 2UVQA 3UMCA 4R2XA 4DCNA 3CH5A 3HKCB 4YRQA 3P97A 2I34A 4CM8B 3VYTB 3J5QB 3HN6A 4A23A 2NSHA 2ZUFA 4UQXA 3HCBA 4HN9A 4NH4A 4AYTA 1LBTA 3WIEA 4CNBA 4Q4JB 2KMLA 3CW2A 2P1DA 1PR1A 3KKEA 5DCWA 2JCXA 3MRSA 5BWLA 4ZVMA 4RKQA 2QUIA 3K2BA 5BPHA 1N8SA 1IC6A 3IKVA 3KZCA 1UMBB 3CXUA 1I33A 3O7WA 3KFVA 2W6IA 3LTNC 1LLFA 5FBKA 3RFTA 2MMCA 4JXTA 2B69A 4A7PA 3HJGA 2EWMA 2R8YA 3NOVA 2HR1A 1XLTC 3S55A 3FBGA 1KQGA 2QVYX 1U8FO 2JAQA 3UVEA 2LCIA 2Z5GA 4PYNA 4RX1A 2WQHA 4IW3B 4QUGA 5HBRA 5HKOA 4RTLA 3WK9A 2ZBDA 3EXIB 3B89A 4A03A 4DLSA 3R0IA 4NCIA 3LS8A 4DG8A 3DE3X 2BUAA 1SCDA 1QAQA 2NYVA 1G60A 4R7LA 3CK8A 2IY7A 4OU4A 4M8LA 1XXHA 1TM3E 2FJUA 4B85A 1PLLA 3JYOA 1J8FA 2XB2A 5KVVA 1MVLA 1DFHA 3KO8A 2HB6A 3OZ7A 1EGHA 4HRVA 3IMKA 4I55B 2JDID 2CE7A 2VUHB 5FYQA 3V8RA 5E9WA 4AECA 1Y34E 4EKDA 3DBRB 4K46A 1E2PA 1P17A 4ND2A 1JIUA 4HLEA 4ZGWA 3M1AA 3HRAA 3EQ9A 5IDXA 2Q3HA 4TV9F 1BJKA 2GM4A 2IX9A 3OLYA 3QK7A 1NN1A 1YDGA 3OBBA 2QRUA 3DW3X 1X8XA 4TVSA 4EY4A 1NKTA 5C37A 5ALHA 5DHUA 1TKRA 2K87A 3ILHA 4YRPA 4J8PA 4EAQA 5ER6A 3H2IA 5HUQA 4J29A 4B6RA 1PVVA 4O2AB 3TG4A 1COWA 3WAKA 2XCOA 4ZQBA 4Q9JA 2PKYX 3GBVA 2ZR0A 2P40A 4WT7A 3WYEA 4MKXA 4CM9D 3DZIA 3C7KA 1T9AA 2ZYAA 1BIFA 5T8KA 3R74A 2WUDA 5KJMA 2YFHA 3S8EA 3SHOA 2FR1A 1XHFA 1VJ5A 4RA6B 2REOA 2GN2A 4HPWA 3HCRA 1RRCA 4BCDA 1EINA 1FSGA 3MBOA 2X3MA 4DAEA 4F1WA 3H9GA 1W5FA 3H84A 5H1YA 2CHZA 1V96A 5G1PA 1QIIA 3JQGB 3BZUA 5A5EA 4UWHA 3HDQA 5FWDA 2IWRA 3JVVA 2Y68A 3LU1A 4PDXA 3PK0A 5CRUA 5K51A 5DN6D 4UASA 2VI5A 5IJXA 4YCSA 2CLOB 2R2LA 4HGOA 1VC2A 3EGXA 1EVJA 2Q1YA 5KX5A 3KR9A 1S63A 2QMUA 5FBHA 4GPIB 5LL6P 2VZ9A 3GBPA 3T8MA 3GO4A 2GPYA 2VF5X 2OO5C 3ZNOA 2QTAA 3MCXA 5P8WA 2GD0A 4Z4CA 2YZKA 1DTWB 5I7SA 1QHIA 4DDWA 3HDYA 3ENKA 4NPHA 1XXLA 4EI9A 1VKZA 1SHZA 5BOSA 4M3OA 4OU5A 5CM9C 1E2KA 1X7GA 5MGBA 3EPKA 1B6SA 1FJXA 4GYJA 2E18A 5B58C 2BM0A 2ZM6B 5FTPA 1EEHA 5EZ5A 4WE3A 1Q2ZA 4DV6B 2VQFB 2KBEA 1UBSB 4JLNA 3VI4B 3BHIA 2KCVA 3CVQA 5T4YA 3D8NA 3TI7A 3AY6A 3EDMA 4D9NA 3F78A 3AY3A 2DYKA 3V1KA 4GGPA 4EFNA 3IP6A 3T41A 4MUHA 2PS1A 5L4SA 3PWZA 4W5HA 1AURA 3LJ3A 1CTQA 1T8RA 3RU9A 3DOOA 3V8QA 2JLYA 5E9JA 5ALMA 3BEDA 3P4YA 5I7AA 4V2UA 3L4KA 2ZTMA 3CY6A 3S2GA 5EYPF 4B3FX 1XQ9A 4MK4A 2JNWA 1WS6A 1DJOA 3IDQA 4H1VA 1JB1A 2FPPA 4MVXA 1ZZGA 1EFVB 1J90A 2PUFA 2ZIUB 5ERXA 4P2GA 4J4HA 3HZOA 1Y6JA 4M22A 3EDRA 2H29A 5EAIA 2AQKA 1QONA 4OLFA 4ARUA 4L0QA 2GF2A 1IG0A 5EKUA 2BFDB 1W8DA 1E1CA 1YTUA 5BN1A 5J3JA 4RTOA 5KINB 4XTRA 1X19A 4GG1A 3MV2B 3NIBA 1BHSA 4Y2YA 1CUFA 1NP7A 1FLNA 2QTRA 4IHJF 5BY2A 1UWVA 2IYRA 3RVQA 5E8JA 4CYMA 4E5UA 4D4LA 2ZXFA 5FYDA 4ENTA 2GJ8A 5AOBA 3FPAA 4P1ZA 1EXNA 2OVBA 2AW5A 2WABA 2NUTA 1QTIA 4PG7A 1QYVA 3I4CA 2ZQ5A 1WDMA 4MYDA 4X1YB 3W8DA 1Y9ZA 3L0DA 4QGBA 1PRYA 1RKQA 4NU5A 1T36A 4HOYA 3I04M 5CP8A 2P1RA 2DHCA 3WAGA 2XUQA 3LX4A 1YVDA 1RYFA 3SJAA 1RR6A 3FP3A 1MH9A 1U3UA 4NECA 2H4FA 2C9CA 3ZDEA 3S28A 1PZFA 1FDTA 1JP7A 3N8GA 3TQQA 1CV2A 2QLFA 2FZVA 1N6PA 1ACMA 5BYBA 5CEAA 4C7JA 3BE4A 2J0VA 3JAMA 4FFBA 2K7FA 4M36A 2PT6A 2HYIC 1TCVA 1W5SA 4DWJA 3ZGXA 5JCZA 3E34A 2P4SA 4Q3KA 3THRA 1VRWA 1P61B 3OD1A 2NUPB 3OKPA 5TB5A 3VU0A 1Y89A 5ITZA 4WLOA 3UK1A 1K8XB 4EY5A 4M7RA 3HM9A 4CUZA 3B53X 3JASA 4D3FA 4JODA 3KHSA 4ANXA 2Y9PB 2I87A 3FNQA 3TNYA 2CHWA 1Y3HA 2X40A 4HTAA 4JR0A 2ILVA 4HWGA 4CDGA 3OOYA 5KJEA 4WWNA 4X93A 3SXJA 1DRUA 1PJ2A 1SEVA 2A9QA 2WD8A 1SCIA 3U09A 3TW8A 1G21B 4IIFA 3IJEB 5EHNA 1EX9A 1XQ6A 3KHKA 3ZCXA 4CEMA 3CZ9A 1P2VA 3MW8A 2BHSA 1JJIA 3C5VA 2BIFA 1UPBA 4WBNB 4OHPA 3KOUA 1JB9A 2LO6A 1AMNA 3IEXA 1NVXQ 4FS8A 5JZMA 1WXGA 3AUTA 5EGSA 4LE0A 2Y0EA 1CETA 1WB6A 4WLVA 2QROA 3B1XA 2EBFX 2XXBA 4RUKA 2ZIAA 2REXB 3IHTA 2YFYA 4L8LA 4EMSA 2GLXA 4TLBA 1T5DX 1U3TA 4IIJF 3PCXA 4L02A 3PKZA 4HGYA 1AX9A 4CM1A 3FH8A 4ZYLA 1H9CA 4KXMA 4M54A 2HLNA 1XDBA 3CTPA 2LSVA 4ZO8A 1ELWA 2AXPA 1B6TA 1WCV1 1V4NA 1IXVA 5CBPA 3ASZA 4RA9B 3WDKA 4EHNA 1H0HA 3BTUA 4DA9A 2L18A 1F4VA 2PM8A 5DGHA 3N07A 1T34A 4N9QA 4II3A 1ZL0A 3MRTA 5EIWA 3A2MA 1KP3A 3G7UA 3NHUA 4Z9AA 1ZX1A 4A63B 2N0SA 3PR1A 4C4YA 1CNMA 1E0JA 1TU0A 2FPMA 1ODSA 5FPSA 4DF3A 2PXXA 3WL3A 2P68A 1I2AA 3RSHA 1M75A 3BSWA 3D6TB 4LE2A 2J0EA 2JIZA 1SQMA 2J5XA 4Q19A 5DYYA 4FMPA 3RUPA 2XMRA 4G8DA 4GE3A 3AVTA 2LE0A 2J4CA 4IVRA 2W6NA 1TAHA 1T5IA 4KUHA 1F3OA 3FU0A 1CQPA 4EO9A 1JG6A 3P9YA 3T9CA 2PZBA 2KB0A 4BUZA 2JL1A 1TGVA 5IYZB 4RPLA 2G5TA 4GL2A 3VI3B 4MUXA 3TUZC 3QITA 1IK6A 1Z68A 4H6PA 4DEVA 2NTEA 4CCAA 2PX3A 3T9FA 2RAFA 2J5QA 4MWBA 4XLTA 1ULTA 5ENOD 1F06A 4NONA 4R81A 5JJCA 2ZRBA 4DLNA 3O03A 2DFNA 1QFXA 5LQSA 2OD9A 2Q45A 2DCUA 2HD4A 4YUAA 4GNRA 1G7RA 8AT1A 5T3UA 1IAVA 1YI0A 1JIIA 1RJ9A 3U3MA 1TNYA 4P7KA 5ENVA 3TXXA 3HFJA 1T6BY 3FTDA 1O5MA 2G8LA 3NDPA 4H7IA 3HC7A 3I83A 3N0WA 2VIIA 5A1TA 2GCOA 1TZ2A 3DSVA 5TX7A 3RADC 4XFDA 1DX9A 3A9CA 3P19A 2FFAA 2AVDA 4WCFA 5ICMA 3L8GA 4S04A 3RYFA 4YJ3A 1QGYA 5IARA 1VFNA 5C1IA 2QKYA 3DWGA 5D3MA 1QDLB 1QB7A 3CS3A 1KDVA 1UBRS 1XZHA 3KEMA 4UVDA 2UYQA 3MMXA 3L93A 2NQ8A 1TK3A 1JJFA 5I7RA 2V7VA 3KKZA 1CDDA 3WJ7A 1MNQA 3UAOA 1EFRD 4YP6A 2LPMA 4Q6BA 2FPGB 4B9EA 5CX1B 1XVTA 2JK0A 4XGKA 2YJZA 1TMKA 4LYYA 4QTYA 2I91A 2ZSBA 10MHA 3JY6A 1RE1A 3C3EA 3DMYA 3SK0A 2WFLB 1X7WA 1RRVA 2FZCA 1GQRA 3W2EA 2CYBA 3DE0X 1YU9A 1FSFA 3IS3A 2Z6AA 2IS6A 3BE6A 1S5PA 2IS2A 3LCJA 1BA2A 3AQIA 3N2GA 2PRIA 3TFOA 3MT7A 2IF2A 4UHKA 4KYVA 3SPXA 4N0EA 2O3UA 4F12A 4WKGA 4I9FA 3WHIA 3MPOA 2R2AA 3ERCA 2BSQA 3M4NA 5D5QA 3VU9B 4AZSA 2R85A 1GZUA 2JA2A 3OEWA 4A1FA 2Y27A 4KSBA 1NMQA 1E8DA 2RCYA 4EHDA 2HQOA 3R77A 3DSRA 2RB4A 4XIJA 1KQPA 2L69A 1CQJB 4MQUA 2QL9A 2C5HA 1EJ0A 2V5VA 1KO7A 5COQA 3HFRA 1XQXA 2YICA 1WETA 5LUBA 2VTVA 4XM2A 4TRQA 5FRDA 3AR9A 2FLKA 3FA2A 4Q3BA 4HUQB 1GDHA 4OGGA 1YGPA 3LAWA 3GDHA 1WM1A 1DKUA 5LZ4A 4BO5A 2QMYA 1MA3A 5E7MA 3SF4A 4EI8A 4A0GA 4TLMB 1I2DA 1TMOA 3V8EA 3U17A 1HO8A 5HQ8A 4YRLA 3EIJA 1GTL1 1SHJA 4MUIA 4D82A 4YV7A 2Q29A 2CLEB 4KR3A 3ZY5A 5DNYB 4RO0A 3OPXA 1Z0ZA 3QVKA 1UKZA 4XX0B 2R6AA 4N5CA 2V54A 3DSTA 1ZJYA 3EXHA 2GBFA 2JF0A 4GR9A 4WJZA 3U7GA 2DBZA 3S1AA 3VBCA 3AKDA 3CIOA 2ETVA 4CLDA 4EHJA 5FIUA 1BMFD 4IRXA 2COEA 4JA9A 2JZNA 2KPOA 2P2YA 4BV2A 1CHNA 3ZY2A 3C0KA 5ALRA 1EGVB 2J3LA 1X70A 3WA7A 1TIBA 2GJ9A 1KH3A 2EKPA 4CV2A 2AQHA 5FXMA 3V48A 3P8ZA 4IDOA 4J43A 2WMYA 4HH3C 4TV3A 1YZGA 2VJYA 4LYDA 4M7WA 4EHLA 1NOKA 4OLHA 1RWQA 5KYVA 4DLZA 4RDIA 1KDOA 5CLHA 1M2NA 1LRLA 2LKDA 3EN0A 2WLTA 2IYEA 2UXDB 1XT6A 4BO1A 3I6YA 2QX4A 1ZW6A 2Y4NA 3KYJB 1C4WA 1SXJB 3N3BC 4BX2A 5JANA 1XJQA 1QHXA 4K3UA 1ZN9A 1I4WA 5B36A 4UFNA 2WD7B 3KYDA 5IY5E 2CNWD 2QDXA 3ET5A 2A1IA 2C84A 3KBOA 4GTQA 4H0CA 4TUUA 3T3MB 5GM1A 5FEUA 2VP2A 4WY2A 1VMAA 1ULHA 2IBMA 1GTJ1 2YYZA 1BX0A 3BXOA 3IP3A 1NX9A 4WA8A 3GRFA 4DCGA 2F2TA 2OT3B 3CLJA 2B1JA 4UQPA 1B73A 4EBAA 4C6RA 4HGPA 2ARKA 3UHPA 2YV1A 1N54A 3E61A 4Q16A 4HLUA 3M8KA 3MILA 1JU9A 2EIHA 3F6PA 2HK9A 2XD4A 2WXGA 2RG1A 4HDNA 2FQYA 4B35A 3QKWA 2G1UA 2RFAA 2C7OA 3A9SA 3GXBA 4L74A 3J5PA 1W88B 2JIDA 3PQDA 1ENPA 3MGBA 5T4BA 5TQVA 3ZU4A 3BDIA 4LHSA 1E79D 1Z9BA 4AQDA 1NQAO 4BJHB 1BW9B 2ZI6A 2EDAA 3FU3A 2CNDA 2X13A 4S1WA 1LX7A 3IMFA 5LD2B 2RDMA 3B1VA 1K89A 1UXOA 4ZI7B 2VDWA 1A72A 2PQMA 3AB7A 4MUJA 4UPDA 1FUEA 1I6KA 1JZQA 2C2XA 2OWEA 4C6TA 3E9EA 1PX0A 2C07A 4NRHB 3I9MA 3IE2A 2VUUA 4D0NA 2PJUA 5FJJA 2VBIA 1W7AA 4MRUA 1MC5A 5LX8A 4YRSA 1XK6A 1T4CA 1CEXA 3HN7A 2CK3D 4YJGB 3NAQA 5CYPA 1OFTA 3C5RA 2A0UA 1ZUIA 2H16A 3HDHA 2ZSAA 2QVGA 1F3LA 4NPAA 5NULA 3P96A 1MX6A 5BN5B 4ATZD 4PLYA 1T6ZA 3K1YA 1LJUA 1EIWA 1BXKA 4UHFA 2VDLB 5DSZA 3O4FA 2ES4A 2GXSA 1A4IA 1A9PA 2XLCA 3RRMA 3S7DA 4R1NA 2W58A 2PX2A 4LJ7A 2WQZA 4LG6A 5JYCA 3ESCA 3TU3B 3R7AA 1RHJA 3I42A 1KTVA 5CBNA 2NW6A 1GWNA 1CQXA 2QUJA 2PYIA 4LZOA 1IATA 4RK1A 2W43A 2IIBA 2YZNA 2O8EA 2DBVO 4MVJE 4FONA 5AVZA 2QNBA 3ZLUA 4E5DA 3VISA 1JTFA 2HMSA 2J3QA 3T7RA 2HSGA 1WHTA 1D1SA 1P1JA 3GARA 4LXUA 2HK8A 1LLQA 2GNAA 3TQSA 1N92A 1QAMA 4NFLA 3AW8A 4N0PA 2JIMA 2DFTA 4COOA 2IEBA 2WVHA 3I28A 5CHEE 3CXRA 2Q0QA 3BUAA 1JA0A 2YWHA 2PBLA 1NA3A 4KZPA 1T35A 3KQHA 4KG7A 1WZNA 4JN6B 1PEAA 2ODTX 3DFUA 4FFOA 1RHMA 2O4CA 3VHXA 3E3NA 2CBGA 5C35A 3D0KA 4TGLA 3DBLA 3C72A 2VJOA 4AW9A 4ZEVA 1JVBA 3H2HA 5T4FA 4DDTA 3CUVA 5F2KA 3LHFA 1F0KA 1RYYA 1QQ5A 4C9BA 3GLHB 2GZ3A 1GPYA 1UOEA 2IBTA 3U4QA 4FFRA 4BFRA 4CMEC 1WVMA 4WINA 2QN2A 3QUCA 1F51E 3CNEA 1JEYA 4ZDIA 2XAUA 3IQZA 5KU7A 1CB7A 3Q7IA 3GLSA 1GFZA 4POAA 3IV0A 3AKEA 3KYBA 3O0DA 3PCRB 6AT1A 2P41A 3F6CA 4HAUA 1BU9A 4XYGA 1ESNA 3FVQA 4HADA 2Y77A 4OBEA 1GSIA 3BJMA 1C7IA 1X1AA 2UZ1A 1OCRE 4RKYA 5SYAA 2ZTHA 5FI5A 5KYUA 1ULBA 1Z06A 2WZBA 5FBZA 1YO6A 1Z8FA 4KR7A 4XSHA 3V7NA 2P62A 2F1JA 2HMUA 3O5AA 5HS0A 2X9VA 4Q0MA 5FV4A 3SHWA 4GPZA 2I2AA 3IURA 4M1WA 3H0CA 4INJA 4G56A 1ZOIA 1YE5A 3CB2A 1ORRA 2ZYHA 1YQXA 4WK4B 2F7SA 4O33A 1ORWA 3DT8A 4INPA 4YT5A 2KLHA 1RJGA 5LSAA 2XS8A 3FULA 3UQZA 3N8IA 1W94A 2DH6A 1HDCA 2BDEA 1BI8B 3I32A 4H1HA 1Z34A 5BR7A 2BGNA 4CKWA 4GH5A 4BC0A 2IYZA 2XV1A 4G4IA 3H8VA 1QCCA 1H8EA 2AOXA 4C30A 5D6NA 1PWXA 4DL9A 5L3ZA 5K3FA 4YDOA 3KJEA 3U4AA 5B2ZA 4MR7B 3OJOA 2QY7A 2WM2A 2DKNA 4BWVA 3DF7A 5A5FA 4RPGA 2EL9A 3E9ZA 4XZ4A 1CUWA 1RIIA 3TTYA 5T4EA 4LFBB 1PUXA 1KJYA 1XHLA 4ZO9A 3FB4A 3ADCA 1GU0A 1DV2A 1D03A 1Z6XA 2ZAGA 4B6GA 4H77A 2RGDA 2OSVA 3U4IA 1M0SA 1NI4A 3ETDA 2VPZA 3GT0A 4Y2TA 5CVDA 5C8YB 3TTVA 2EKDA 4KE8A 4OI1A 3FB1A 1E3QA 3CWZA 4RACA 4Z0HO 4RIEA 2A59A 1HLPA 1Z5PA 5CM8B 1IEWA 3CZMA 1Q1GA 1VE9A 4NXMB 1YB2A 1E9VA 1GGHA 3GJSA 3WK8A 4KITB 3L41A 3KD3A 3CNHA 1KEEB 1GV0A 3VPAA 3ZU3A 3QBDA 4RM2A 4P92A 2ZWOA 4RTRA 3HZRA 3PR2B 5BXUA 1JHXA 2V1XA 4X00A 1VJ1A 3ZKWA 3PGA1 2Z5FA 5IW8A 2XECA 5JDCA 4RH3A 4N2SA 1QXSA 1G64A 4D8XA 1RYHA 4GKBA 3DQPA 4JT4A 4QDJA 2D8MA 1R8QA 4QJBA 3QE9Y 1KEVA 2W83A 5AW0A 2NX2A 3DF9A 2RGYA 4ETNA 1Q1AA 2GXUA 4UCWA 4J0CA 2XA1A 1ENYA 1LPPA 4X90A 2QN1A 2PZEA 4WKPA 2UXBB 3ZZMA 3ZWPA 3ABKE 1MGPA 4TSFA 2ZYRA 4HXFB 2E3JA 3DKKA 4ANFA 3PE6A 4JGIA 3DPSA 1JDTA 3EQ7A 2VHVA 2HRQA 2I1VB 2ZK7A 3VVLA 4GMLA 2YIDA 4UNPA 4HL6A 4OGKA 1WDYA 2UU9B 4PGGA 5ALFA 5KQSA 4Z1OA 1UBUS 4JB0A 3Q12A 2JIBA 1T8UA 2EV9A 3MOGA 2CHGA 4MV4A 2MWMA 1R0BA 4QOFA 4ZCIA 3FYSA 3P2MA 2PS9A 2P4EA 3MFQA 2O9JA 4YN3A 3B2NA 3R3VA 2XQKA 1OLXA 1QYRA 2QJFA 4ZQCB 2B78A 1G5RA 2VP5A 3OU7A 3AR2A 2BEVB 5COBA 5HRUA 3OCJA 4OQXA 3BMOA 3PIDA 4FLHA 4MQ6A 4L4RA 4AP2A 3C1OA 2V7GA 2YXLA 3UFBA 4FFMA 4G2NA 3MCVA 2YOGA 1SHLA 1GRQA 2J0UA 3ZW3A 1JPVA 4MQLA 2JBWA 3DDOA 2UUAB 5SV2A 2CLKB 3L7AA 1Y8CA 3E6AA 5FWNA 1B8UA 2BSXA 3IVCA 1IXSB 4AP5A 5B1DA 5TXGA 1AHHA 1QZ3A 5KKCA 2Q0XA 3GRAA 4QGSA 1OCEA 2WYWA 4X9XA 3N7TA 4ARBA 2OD7A 2I80A 5AHWA 4F6LA 2MYPA 5EXXA 3WXBA 4BKMA 3B1FA 1VBMA 4IICA 1OWPA 3GGGA 3GH3A 5HZGA 1HNXB 2XPZA 3MEKA 4DW8A 1ZZEA 1H5QA 4M1SA 3WQBA 4CKXA 1DE0A 3R6GA 2R11A 4ZZ3A 4S1VA 4AJEA 3IKLA 1TCBA 1XKXA 3VZRA 4ZICA 2G77B 4MCAA 3CPHA 3NATA 5DHTA 1XYGA 5JUWA 2JFGA 1TECE 3ACDA 4V0LA 1R6UA 1FMJA 5EQTA 3H4VA 3QVWA 3M2TA 1Y3CE 1PZEA 4ARAA 4MARA 5B3JA 4BE9A 2F3QA 3BERA 4I3FA 3WL5A 4OHRA 2WNSA 2MSDB 3R0QA 1WUHS 1VLLA 4RSMA 4IXTA 3RFXA 1SCBA 1B6GA 4C4RA 5IAEA 1MHPA 5DGCA 4MDHA 1FF9A 4F4IA 4CN9A 5FBVB 4F4UA 2HLHA 4L22A 1CXZA 3LT0A 4WNCA 1CRPA 4HRNA 4L76A 1VHWA 3GLGA 4MQEB 1TVKA 1WKCA 4BTLA 4DY4A 5D00A 1TM1E 1VHLA 3RSSA 5EG5A 4YRRA 1TDJA 4Q3EA 3L5OA 2TMKA 3M6UA 1OR8A 3ABOB 3HDXA 3SHVA 4E5VA 1XRSB 3D54D 4CW7A 4ECAA 4M0FA 3Q78A 4H7DA 5ISMA 1SBTA 1W581 3D1LA 4M9QA 1L3IA 1VLJA 1GTMA 3F6RA 2BBOA 4QPPA 3RCBA 4E08A 3R8XA 2AEJA 4H31A 5ED4A 3KJNA 2GPNA 4MP6A 3R4VA 2HPZA 2AN1A 4MBGA 4DV7B 1HDXA 5JHGB 2FP3A 3O4ZA 3O0TA 3JXIA 3BEEA 4WY5A 3C3WA 4F56A 2SHKA 1SD5A 3WL6A 2NPIA 4Y6QA 5FL7D 1U2PA 4LGMA 4ZVVA 5TQ0B 3KQMA 4QQRA 2KWIA 1MU0A 2IUTA 4BDSA 4EMBA 1HEUA 3OIWA 4YECA 3F7OA 2P9ZA 1A76A 2XMQA 4BMOB 1V3TA 4NHOA 1O9HA 3TX2A 2NO5A 1UBMS 2EFEB 3U3KA 5HZHA 2ZJZA 4AK9A 2EC5A 5F98A 1ZI9A 1P5ZB 4ZYUA 3HA5A 2IXEA 5ICEA 2VBCA 5AI8A 1LTQA 3G5AA 5BVHB 4EW1A 3PA8A 4DA4A 5C51B 3QPBA 3MJRA 1BHO1 5IVDA 1XQYA 2ZYTX 3MTEA 2IOSA 4TUYF 2NSLA 2AJTA 4HVLA 4MHTA 3V80A 1FVXA 4M9SA 4X45A 1Y6FA 4LF8B 3OJCA 4W9NA 2HBQA 2I99A 1GL6A 1P6XA 4PZCA 2QSUA 3L8EA 2ZG6A 3CF4G 3GZSA 5A6CA 1IHDA 1F2UB 1D2NA 2C8VA 4UNSA 4FX5A 3P9XA 3TR6A 5GONB 3SYKA 2FZLA 4F46A 5A0TA 4MQ4A 3B1ZA 4Y2JA 2N9UA 2R1VB 3VVCA 4NICA 3WGJA 2W6CX 3B38A 4AC9A 5CLIA 2QYTA 2IW1A 3RREA 3FPKA 5DWDA 4JIGA 3K4HA 2QTHA 2FSVC 3VPFA 4P2BA 2BTQB 5JI3E 1HE4A 1FFDA 2QZJA 4ISCA 3DWEX 3QX9A 4REMA 2FUNB 4IIHA 5CIQA 5SZJA 3F4LA 5CH3A 5IJ9A 3RK1A 3ZBUA 3KOWA 2C9MA 4F71A 2HL6A 3PUIA 1NTOA 2EYQA 5EIEA 4CM4B 3Q5EA 1NG1A 3VHRA 2EJVA 4R6XA 3NB2A 3BCSA 3KWLA 1HNWB 1NLMA 1DX6A 1C30A 2Q6TA 5M5BA 4FGZA 2AWOA 1LLDA 4UHEA 4UNNA 1II9A 3ONEA 1KMHA 4N41A 5G1OA 3P0FA 4QXQA 3PQ7A 3L43A 2Y4TA 4P0TA 2PYZA 5KCMA 4NBKA 2B9EA 5C1PA 3KAJA 2BMJA 1C9JA 2E7ZA 1OOEA 1MQ9A 2AR9A 1L7NA 1OBOA 2FP4B 3ZZNA 1YS9A 4TWBA 5LOVB 4BMZA 3JQ9A 3LDAA 1SGWA 2QW1A 3CHSA 4QUJA 1KAOA 1PGOA 1VZ3A 3UHAA 1SQFA 4MV0A 3Q72A 2NLOA 1B43A 1VI2A 5ANLA 1F4PA 1NDQA 4MVJG 1GTSA 2J9RA 3FVTA 3FOFC 4G23A 5F9MA 1NXSA 3DWIA 3WXMA 4PX9A 1FTNA 1X7XB 4J6FA 1P1RA 4BQSA 5KWEA 1XMSA 5H68A 2JVIA 1RYBA 3KHUA 3H2SA 1KGDA 4XD7D 1IXZA 2YOHA 3ETLA 2DWCA 4HEA6 4M0DA 3PGMA 4BVBA 5K6RA 2FZWA 2KCLA 4OGFA 5DCUA 1ECLA 1GGNA 2X4GA 5AIBA 2RIRA 1P1IA 2VPPA 1LTHR 3GAFA 2AE2A 1M2JA 4U6SA 3RKUA 4QUKA 3V46A 3PEUA 6REQA 1VFPA 1QIEA 2ZB4A 4JYPA 2QY6A 2YUTA 5G2OA 1NRIA 4GKJB 6NULA 1AM4D 4G0UA 2D00A 3C6ZA 3I6ZA 3SR3A 4TTSA 1W87A 2A1UB 3GCXA 4Z49A 3OX2A 2HIHA 1VP3A 1G3MA 3PNKA 4C4OA 4OHKA 3UPVA 5DHSA 4EG6A 3EDTB 1JR6A 1JDBC 2G6TA 2HAEA 5KYGA 3I30X 4GZ5A 3L7MA 2W9JA 4TLCA 3F74A 4RVBA 3UMGA 1U9IC 5BPPA 3OEHD 3RK0A 2HWUA 5YASA 4Z1MA 4Y6CA 2H1IA 4EQ6A 2VDJA 1NNUA 5CNMA 1V55E 4WESB 1WF6A 4A0FA 3Q3GE 1Z08A 4XE5A 1P4HA 3WI7A 1CF9A 4D8VA 1VGVA 3QE3A 2LKCA 3EAFA 5K0JA 1EDEA 2R00C 1NVEA 5D1HA 1MJ5A 3K1ZA 4HEQA 3OO0A 1V35A 1BOFA 4E51A 1RE0A 4AKHA 4QVGA 1YQQA 2F4VB 4UAJA 2PUBA 1RQ2A 1YZHA 1F5SA 2IBSA 3O48A 4AX8A 3WQQA 5CEDB 3ZQUA 3H3FA 1U7OA 3GQBB 5AK3A 3A3YA 5LA6A 2XH8A 3QF7A 4GTPA 3T0GA 4W4TA 4LDPA 4HWPA 4HDKA 4PXYA 1KI8A 4A0SA 2ZBFA 1PDWA 3FW1A 3OQ1A 2AJAA 3PEYA 4C0AC 3A3NA 3KSZO 3KQQA 1ODCA 4UHHA 4JLOA 3EA5A 4YAFA 2JVJA 2A67A 4PAWA 4QXOA 5HQ3A 3PBKA 1S64A 3IP1A 3KT6A 1FFEA 4C7OA 1TXGA 4JLBA 3OT5A 2GAIA 1JGTA 1VG8A 4LV5B 1Z6GA 1L4EA 2FWNA 1AA9A 2O7VA 5TLSA 3RYCA 3SD7A 4DFDA 3NP7A 4HB4A 5GJCA 4NCHA 2J3EA 5GGXA 4KIFA 1MTOA 4B76A 4DLQA 4GYKA 2AT1A 3SBXA 1RI5A 2FE4A 4Y2PA 2VO1A 4BBJA 3CG4A 4R8VA 1O5TA 2Q4TA 2ODQA 1SA5A 1G8GA 3PC4A 2NAPA 1HH4A 1QB8A 4TMVA 2BRUA 4GTOA 5D5HA 1Q74A 1BX1A 3HB9A 3ZHVA 3ZDDA 3NJ8A 2P9CA 1SQ0A 1YCHA 3IUEA 3OT4A 1MB0A 3MYYA 5AR1A 5LU8A 4L95C 1YQGA 1D6JA 4Z4HA 5H81A 3AP1A 1HLGA 2MR6A 4BDTA 3AUJB 4BQNA 4EAAA 4AKIA 3W5VA 3VRHA 4JHRA 4RK0A 2I3BA 1CUDA 3RVJA 4X8QA 3T3EA 3FOEC 1QQ7A 1R0XA 3IUMA 5A6VA 1E77A 4CEJA 3GZNA 1LTKA 3O9MA 2D0OB 2QYHA 4N0QA 4J2HA 1J06A 3KQTA 5BURA 2ZDQA 3QXSA 2GYWA 3HUEA 4YJHB 4OH7A 1KHHA 1LLUA 3R9IA