4AY6A

Human o-glcnac transferase (ogt) in complex with udp-5sglcnac and substrate peptide
Total Genus 257
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
257
sequence length
717
structure length
698
Chain Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKIYDNRIVLNGIDLKAFLDSLPDVKIVKMLNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title O-Glcnac Transferase Invokes Nucleotide Sugar Pyrophosphate Participation in Catalysis
pubmed doi rcsb
molecule keywords UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYLTRANS F
molecule tags Transferase
source organism Homo sapiens
total genus 257
structure length 698
sequence length 717
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.255: Protein O-GlcNAc transferase.
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13414 TPR_11 TPR repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ay6A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ay6A01
3.30.720.150 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 4ay6A04
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4ay6A05
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ay6A03
2F3SA 2QN8A 2XEVA 5EX0A 3D1JA 3GPBA 2WQHA 4N5CA 3OTHA 2XGSA 3TG4A 3L7DA 4GYYA 4QLBA 4FKZA 1M5RA 3NB0A 1IHGA 1L7XA 4NC9A 2R4UA 3GZ1A 3OKPA 3OKAA 5JJ6A 2XA1A 1FS4A 2IEGA 1Z62A 2GEJA 4AM9A 3RSZA 2QLNA 4X6LA 2IYAA 2QN1A 4O6FA 3QWWA 4HOSA 1P4HA 2I6HA 1W3BA 1C3JA 3BCSA 3Q5MA 1YA0A 3Q47B 4U0ZA 3MKRA 3PE4A 4I9CA 1C50A 3H4TA 4WNDA 2QZSA 3AS4A 3MS2A 4F97A 2ONDA 4J8DA 4UQXA 4M60A 3BEEA 3CEMA 3DDSA 4J0UA 4MHSA 3QHPA 4MI9A 3MV2B 3LYAA 4KQ1A 4WNFA 1PN3A 4M7PA 4GCOA 3MT9A 4YI3A 3E3OA 1Z8DA 5D00A 1Y8ZA 5IKPA 2QN7A 2KATA 4N2SA 5TMEA 3S7FA 1XNFA 2HR2A 2Q7FA 3N71A 4W9RA 3ZHEA 1WUTA 1FU7A 2O6LA 4NESA 4CGVA 3L79A 3L01A 4YVQC 5LCWJ 3MT7A 2ACVA 5A7DB 5D0OD 5JTUA 2Q6VA 3BDAA 3LPZA 4HWGA 1HXIA 4WHMA 2QN3A 4CTOA 4RG6A 1NOJA 1PSWA 4W6QA 2QRHA 1NLMA 4HOQA 3FP3A 4GYWA 1C8LA 3OTGA 2GM9A 4AY5A 3OKCA 2P6PA 5FTPA 1AXRA 1PC2A 1OUVA 2ZB2A 1FU8A 3BD7A 5LCWC 3C48A 1HLFA 1Z6QA 3CUVA 3SYMA 1TJCA 3S2UA 5HXAA 4BWRA 4UI9J 1FU4A 4N9WA 3OY7A 2H1HA 2BFWA 3CEJA 3S7DA 1WV1A 4LEUA 9GPBA 5IKOA 3SZ7A 4MRAA 2HYZA 3L7BA 5CHEE 1BX3A 1NOKA 1FA9A 4BQEA 2C2LA 3MV3B 5BT1A 2BGTA 2VGXA 1V4VA 2L6JA 3FWVA 3RO3A 3PDNA 3UPVA 1E4OA 1F0KA 3S28A 2JLBA 2FF5A 5DBKA 4RIIA 2Y4UA 3QWPA 3CK8A 2FF4A 1IYGA 2QN2A 2UY1A 4UI9C 3NC4A 4WNEA 2C0MA 3FROA 3T3HA 3TSAA 2XA2A 3MRTA 2UWJG 4HOUA 4N2QA 2LSUA 1PNVA 3Q4AB 3S0JA 1WUYA 2ATIA 3GUHA 1QM5A 2C0LA 3GW4A 1XC7A 3ZCPA 3E4BA 3T5TA 4I2ZA 2IFUA 2MHKA 3AS5A 4J8EA 5KJMA 5DXFA 3U3WA 4X7PA 2PL2A 3L7AA 2OFFA 1KTIA 4APOA 5TVGA 4BT8A 1VGVA 1ELRA 2IUYA 2BISA 3D0QA 2WPVA 3OXGA 1QZ2A 2QFCA 3QKYA 1GPAA 2X6RA 3RHZA 4XIFA 1XV5A 1KT0A 1WAO1 3RKVA 5FZSA 3WC4A 4AN4A 6GPBA 1RZVA 3O3CA 3D0RA 1IXYA 5ARFA 5FJYA 3BD8A 4REMA 4LEIA 1FTWA 4JHRA 3UYKA 4YUAA 1JG6A 3CKBA 3G2JA 1YA6A 2QLMA 3CVQA 4HOTA 4BQIA 4EKEA 4Y6WA 3S27A 2X6QA 2AW3A 5GPBA 1L5WA 1B4DA 3WADA 5KJKA 3TOVA 3O48A 4UQYA 5CCLA 5TMBA 1ABBA 4I1AA 2G9VA 4NEQA 1QKJA 4WACA 4GPBA 1GPYA 3CVNA 3H4IA 4EJ2A 3Q3EA 5EX3A 4WUYA 3BD6A 2FBNA 1NZFA 3MS4A 1L5QA 4UQZA 5TMDA 3BEOA 3CUTA 1PYGA 4RENA 3OT5A 1XL1A 2C4MA 5G04J 2GEKA 2GPBA 3UYLA 3MT8A 4GZ3A 5HQ8A 2R66A 4G2TA 3S7JA 3QOUA 3S29A 1WV0A 3URZA 2VCHA 3EBOA 4Y6CA 4JA7A 3MTBA 4RBNA 3FFLA 3QWVA 3CK9A 2XA9A 4EL5A 5KJNA 1O6CA 4AIFA 2ASVA 3OXLA 2PQ6A 2FEZA 2QRMA 1GZ5A 1E1YA 3T3DA 2GJ4A 3RO2A 4GA2A 2R4TA 4X7RA 2PZIA 3KS2A 5G04C 2X0DA 3NCHA 4G26A 3HBFA 3QDNA 2V5FA 2XCCA 3TGOA 1EM6A 3C4VA 4MHOA 2VYIA 2JJMA 4N3BA 4MI6A 5ARGA 3ZCVA 4H7YA 1J39A 4AY6A 3RU0A 1P2DA 2X0FA 5BW8C 2VGYA 4RIEA 4EL0A 1P4JA 4GYOA 4H7XA 3TAXA 4KXKB 3ZFWA 1RZUA 3GZ2A 2XMPA 2QRQA 2R68A 2VQ2A 4X7MA 2PQNA 2AMVA 2LSVA 2JZCA 4F96A 4I9EA 1UQTA 3CUUA 4UI9K 4Z5XA 4XI0A 2IV7A 3MBOA 2R5SA 5EKQD 1AHPA 3ASDA 4YNDA 1Y8MA 3AMVA 2LNIA 2Y4TA 2QNBA 3VTXA 4XI9A 1RRVA 2KCKA 3MQFA 4YI5A 3ZCQA 3ZCUA 4U04A 2SKDA 5BNWA 4G24A 3TG5A 2KCVA 4J8FA 3CUWA 3RSCA 3S7BA 2FO7A 3CEQA 1JEJA 3DDWA 1NOIA 2FFRA 3UQ3A 1A8IA 2AV6A 1F6DA 4RIHA 2QLLA 3C4QA 2XGOA 3JYSA 2GT1A 2FETA 3RJVA 2YJNA 4LDPA 4CGWA 1L5VA 3G2KA 2F3UA 3BCUA 3G2NA 3WXXA 3UUXA 1C8KA 3ZCTA 4EQFA 4WNGA 3MRVA 1FTQA 1FCHA 1GG8A 1GFZA 3MS7A 4GA1A 4NRHB 8GPBA 2GPAA 1SXQA 2BGUA 1ZBPA 4JA9A 2C1XA 3MA5A 1GPBA 2OOEA 2PYIA 1P2GA 3COPA 3T7DA 3T3GA 3ZCSA 2AZDA 2FI7A 4F9FA 4ME2A 4B94A 3T3IA 3EBPA 3ZHEB 3IEGA 4RELA 4L22A 3IA7A 4GPKA 1WM5A 4RIFA 5DLDA 1H5UA 1QQEA 1P2BA 2VCEA 1NA0A 3ASHA 4BFCA 3CK7A 1JIXA 3GYZA 2PRIA 4FZRA 2GW1A 2KCLA 2IW1A 1NZDA 4U0UA 1EXVA 3VUFA 4RIGA 4GZ6A 2XPIA 3SF4A 1ZU2A 1WW3A 2P58C 3KD7A 1JIVA 5G05J 3EDTB 4N39A 2HO1A 4G23A 1NVKA 4N3AA 1ELWA 3L7CA 1FTYA 1YGPA 2IEIA 3Q3HA 4BQFA 2KS6A 3PE3A 2QN9A 4YVOA 2C1ZA 5DU2A 3Q15A 4HLNA 1P29A 2IYFA 4BTAA 3K9IA 2VSNA 1HZ4A 3CVLA 3R9AB 4KQ2A 3VDNB 5LQDA 3HYMB 5DIZA 1L6IA 1LWNA 3MEKA 3ESKA 5G05C 2BUGA 1K08A 4G2VA 4ABNA 3NF1A 1GGNA 3ASFA 3MRXA 2E2EA 3E3LA 2VGXB 3QKWA 4BTBA 2YHCA 5C1DA 2C9ZA 1UQUA 2G9QA 3IAAA 3G2LA 1A17A 3ASGA 1L5SA 3OY2A 1XL0A 2X0EA 2UY1B 3Q49B 3E3NA 3T3EA 3ZGQA 1Z6PA 4NQ0A 1KLXA 2F9FA 3CKCA 5ENZA 3CX4A 1B89A 3LY8A 3NP7A 4U0SA 5KJLA 1SXPA 3CUYA 3G2HA 2IV3A 4RG9A 2G9RA 3KAEA 4KBQA 2VSYA 2PRJA 2G9UA 2SKEA 1FC0A 4GCNA 2NC9A 3LCAA 3OTIA 3U4TA 2WTXA 5D0QD 3AS8A 4GA0A 4HORA 2H1FA 1UZUA 3Q3IA 3G2IA 2J9QA 2PYDA 3CVPA 4CDRA 4IN3B 3NP9A 4KYOB 3MSCA 1HH8A 3ZN3A 4A1SA 4N3CA 3LKUA 1KT1A 4F3VA 3HBNA 3RIBA 2ECPA 3VUEA 3HBMA 4MICA 3CV3A 1LWOA 3OXFA 3CV0A 4GZ5A 5CCMA 1P5QA 1JIUA 1P4GA 2F3PA 3DD1A 4WADA 2KC7A 2XCBA 2SKCA 1NZNA 4AMGA 2ACWA 1Y6FA 1E96B 5JTTA 3LY9A 3SYRA 5FT9A 3VTYA 4MI3A 3DZCA 3ZPJA 4I17A 4BT9A 4KQMA 3WAGA 1Y6GA 2XCIA 3CEHA 3MTAA 2DBAA 4EKYA 2QRPA 4AMBA 1WW2A 5M72A 2AVPA 1XOIA 4CTMA 3MTDA 2YQ8A 2IF4A 4I2WA 3VDMA 5HI7A 7GPBA 4PQGA 5A6CA 5I45A 3ULQA 2HY7A 5D01A 2PQRA 3NAZA 3NPAA 4M83A 1L5RA 5FZRA 1K06A 5FZQA 3RT1A 5JJ7A 5JJTA 2R60A 1XKXA 2VG8A 3ZCRA 1NA3A 2XCUA 1IIRA 4G25A 4U07A 5AYWD 4JL0A 2QRGA 2XGMA 3LY7A 1JG7A 2F3QA 3BCRA 2GPNA 4G1TA 3HBJA 4CTNA
chains in the Genus database with same CATH superfamily
1JYSA 1WZNA 2BMWA 2MYPA 2I8LA 1RYNA 5EJ4A 4D6XA 1DKNA 2GVZC 5CA0F 2F2TA 2P6UA 2WM9B 3PHCA 2JCGA 4UQXA 1ORIA 3UA4A 4O5OA 3NKFA 5HZHA 4MDFA 1KSGA 2C42A 5K0LA 1KMQA 2V6FA 4J3NA 1ZGZA 4QOHA 2A1IA 4ZFHA 1PFKA 2Z5VA 4I5FA 5IJ9B 1FU7A 4NR0A 2Y6UA 4K9PA 4DEVA 2YWFA 2P2NA 4AU1A 2Y99A 3UHOA 4D4HA 2XD9A 4ENPA 3JX9A 2B94A 4K6OA 3SYKA 3UQZA 2QWXA 5FTPA 4QTYA 1QZUA 3T5AA 5TT1A 1HDRA 3AUUA 1VDMA 1GFSA 3ZLTA 1W2WB 1BCRB 3AUFA 3BJMA 9GPBA 1ST2A 3Q73A 3BH0A 2G9NA 3MV3B 1EYZA 1J0EA 3L22A 5EQFA 3ASNE 4Q5IA 4ESOA 3DE3X 4W9NA 1AGXA 1HH4A 2ATIA 2N0SA 4KVZA 2B78A 4V3CA 1Z6TA 1BGVA 5AUNB 1G19A 3KU1A 4C4RA 1ZNZA 1MXHA 4Y0AA 4BNZA 1MX9A 2ZJ3A 1K97A 2I33A 4ZAWA 3NJ4A 3H8WA 4MW2A 2E49A 1X7WB 1T3HA 1JW9B 5FA5A 4TTTS 3O48A 3VBEA 2MU1A 3CM0A 1EBFA 1GAQA 4LJYA 1S3SA 1KPIA 4KXUA 3I2HA 2Q8NA 4DX5D 3AUSA 1ZOLA 4H16A 5DV9A 1H9BA 4MYRA 4ZQHA 2W2VA 4MQFA 3VNSA 4F6RD 1H2FA 3A25A 5LJLA 3ECSA 3WWEA 4ZYUA 3HXCA 3GPLA 4J2TA 1O87A 4Z9FA 1K92A 4DLAA 1IAVA 4RHFA 1X39A 3FULA 3D8HA 2Q5EA 5ICFA 1DX6A 2ZYSA 4FDUA 5HRAA 3EDCA 2B0JA 5CB0A 4JLAA 5CVEA 4EDHA 1IOLA 3KHSA 4JOSA 4IFEA 5BNWA 4G24A 5IYZF 2JHCA 4UNIA 1VKOA 2PO7A 1VM6A 4ER5A 4LUCA 3DHWC 1KQ3A 4OMFG 3A2MA 3I9V6 5JYEA 3EJWA 3LVFO 1B6GA 2NXJA 2R84A 3H3XA 1IOWA 4GOXA 1BE8A 1UPXA 3WB9A 3FR7A 5DLDA 3VSAA 2P30A 1JIXA 3UB2A 2PL1A 4DBLE 1EFKA 4IFBA 4EPVA 4M1MA 3B53X 3QQPA 4J94A 1K5DA 3Q3HA 1QQ7A 4YVOA 1KOGA 3D1LA 1MZVA 3P0FA 1DAGA 4KQWA 5DULA 4YBZA 1E7SA 4GU5A 2XUOA 2XCSB 2HZ7A 1KPSB 4PX5A 1LJLA 2OM2A 1QQTA 2B4AA 2BJVA 1J8FA 2J9QA 1HRDA 1FSFA 4ALLA 3PGXA 2C29D 4XWOA 4Q3OA 4LPSA 4CQMA 1L1RA 4OL9A 4UBLA 1TM3E 3FKJA 4LRYA 1QHYA 2O4CA 4IUCS 4YJFB 3V9AA 5F2EA 5IYZB 2HSWA 3GROA 1J9ZA 2B8EA 4FBLA 4P32A 4IRUB 1GZ6A 3EC1A 4HKTA 2WWWA 5A9SB 2XUFA 1LDEA 3BMCB 2IP4A 4MB0A 3H7AA 2CHUA 1XMJA 5LBIA 1WETA 1H23A 2BFAA 1M8FA 1S3IA 2QXYA 1PQPA 2F55A 2P9KG 1CERA 4LQDA 1GTL1 5KNCA 1N6HA 1CQIB 4WXYB 2B4KA 1V1MA 4MWZA 3E4DA 3HZRA 3GGGA 1SKAA 2DYRE 3R5KA 1WAMA 2PH3A 3A7EA 3ZQ4A 3BXZA 4MUHA 2PPVA 4CFYA 2WXOA 1J5PA 1Y8ZA 3PNPA 3L4BC 5AOBA 4LGYA 2XE6A 3UX4A 1H0SA 4LQLA 5CA0A 3E33A 1E1NA 3L04A 2JS7A 4ZQIA 5CDYA 2Y1EA 1SCIA 2J33A 4B3IA 5FBQB 3MJVA 1V4NA 1G3UA 1O0CA 3U4GA 1U02A 2IIBA 4LVCA 3QVGB 1FP4B 1V8PA 3H5NA 1M1YB 3I52A 1SUIA 2QLBA 2WT4A 1Q0TA 3V4FA 3ZK7A 5BSGA 1XMOB 4TOIA 3IHVA 1SM4A 2ZE7A 2IEZA 2O1EA 3SJZA 5BVGB 3QIVA 1IB0A 2FSFA 1OJ7A 1MUUA 1PNVA 1SKMA 4C1NA 5J4HA 4EG3A 4RTMA 1RKBA 4O4LB 4NL4H 2C2WA 4OOEA 4Z4QA 2HLDD 1YJ8A 1FQKA 1VPEA 4A0SA 2XUJA 3PEUB 1WXQA 2QUHA 1IPEA 5ARFA 3LHDA 2E4AA 4U8HA 3ZBPA 3JQBC 1QGDA 5KNDH 1DG3A 1FZTA 4HAIA 1G64A 4I8DA 1DEHA 5LB4A 4WNCA 1E9BA 4P31A 1UXGA 4LV8B 4MUKA 1HA3A 1QFJA 4H7KA 2EW2A 4PRYA 4HDMB 1CLEA 1JJBA 3AY7A 3S44A 3RE1A 4MYSA 3IP1A 1KO1A 3JWHA 4C76A 4FKBA 4PZLA 3IXLA 3OMLA 3NQ41 4HB5A 1OT5A 2GJ4A 2BMJA 4MW9A 3HMQA 3H0CA 1E79A 3G9ZA 2ZR9A 5AW6A 3DV0A 3NX4A 1PFVA 3CPEA 1E0KA 1YA4A 3FWKA 5DW0A 3VR3D 3I6IA 4L78A 2OKGA 3CNOA 2I54A 4I4CA 4HNTA 5JXWA 4RMJA 2Q62A 4M76B 4PSKA 4X71A 2V7BA 5E8JA 5DI3B 4HEHA 2WWXA 3AEKB 3ZE8A 4R1LA 1WB9A 3HSSA 2ORED 1JZTA 1KERA 5CEJA 4E4YA 5D6OA 4FILA 5CFPA 1EP2B 4PW0A 5FPTA 2Z1NA 2WA2A 4WLOA 1T9CA 4JGIA 4KNWA 1DUVG 3JYNA 3EXAA 3GCGA 4DQ0A 4UPVA 2B30A 5DT9A 4JA9A 5EXSA 1NRJB 1T4BA 2MINA 1OWMA 5T8KC 2NUBA 2HWKA 1E2FA 1P4AA 1W0KA 5JI3E 5ES3A 5EOVA 5GQSA 5CVJA 3P9NA 1SVMA 3JZAA 2XCTB 2EJWA 3LP5A 1QF7A 4EBBA 4OBBA 3X1YA 2FSVC 5L7WA 4XVUA 5LVAA 2Q0SA 1NVKA 5FUBA 3FNBA 4RABA 2CDNA 4HADA 2BFNA 2VHCA 4EOGA 1CZRA 4TRNA 4J4HA 2RBKA 3OTOB 3N53A 2I1WA 3KEAA 3EHEA 2VYNA 2P1ZA 1EFTA 1MC4A 1ZNXA 3U7JA 1F17A 1XVLA 5I3CA 3KJFA 1FSGA 3J5QB 1ZJ6A 3Q5DA 3ER6A 3GLFB 3K6SA 3AHIA 1FXWF 3LUPA 4FJ1A 5DASA 4R6WA 3L6AA 3HV0A 1EVEA 2CLFB 2HNKA 3AKDA 3FLMA 1BQ4A 2JCXA 3PQEA 4YN3A 3DWEX 4MR9B 3HBMA 2QTMA 2NUPA 3VV3A 5TNXA 2G1JA 2XKBA 4ND4A 1UJNA 4M6WA 3TB4A 2KJQA 3R7DA 3ZPJA 2YDYA 3QBJA 3I5PA 1NF9A 4WUVA 1SK9A 2BAGA 3NHJA 3KSZO 4RW0A 2QTRA 4DX2A 1Y1QA 3KQPA 1RC1A 3M6MD 1QK4A 2JJ2D 4KN5A 3W1WA 1C14A 4KVMA 1XKXA 4JZYA 1F12A 1H2RS 2DG2A 1CDOA 1EZZA 1UDCA 2F3SA 1IZ7A 1QH1B 3UJ9A 2I1VB 3GCDA 3V2XA 2BE9A 2REQB 1N1EA 1AOXA 1VE7A 1Y9EA 3ADCA 5C53B 2V98A 1L4NA 1OUMA 5TSDA 2KBFA 2EFCB 3EAGA 1W93A 2B9VA 3RWOA 3FTDA 2PWAA 4WNFA 3ZJYA 3MT9A 1JYFA 2UUAB 4UARA 1ZR4A 1U99A 2W37A 2JK0A 4XQ0A 4B3CA 3D9LA 1K1BA 1OWLA 1TIPA 2Q49A 3JD3A 2E1PA 2HK7A 5JCXA 2YFKA 3NWEA 3AF4A 3EZGA 4MVJP 4DM3A 1FU8A 4QYWA 5CLJA 3H65A 3IDAA 2V3WA 1B2RA 4UHHA 2WIAA 5L3RA 5CYPA 3U80A 1RPTA 2FWNA 2PD6A 2IYQA 3I9V1 4ARCA 3RYCA 2L6JA 2AOXA 3WR5A 3QLEA 4NBKA 3GZJA 1Z0AA 3L7IA 1VMAA 3TBFA 1TM4E 1TYDE 4OJQA 3F97A 1OH7A 5JSZA 3AU4A 1PJ2A 1PV4A 3NEJA 3PYMA 3IQIX 2HA5A 1GYQA 2QOEA 4E15A 3KQTA 4YRMA 3RKUA 1N3IA 1HL3A 1JBKA 1GCGA 1IONA 1ZD9A 1O9BA 5AI8A 1ZYUA 5CBPB 3GLIA 2YW9A 3AVWA 3AJIA 2FXVA 4TPKA 1CZHA 4GUAA 3HA7A 4MARA 4L7TA 3HXLA 1WXHA 2CKMA 4IJQA 4Y2RA 4B3GA 4MRPA 3LTEA 2QMYA 4JODA 1MGPA 3I4LA 2CLMB 5LP0A 3KLMX 2YJZA 4HDRA 4MJ7A 3L0CA 1WDMA 3S2SA 2I9KA 1O03A 1XF9A 2J3KA 1NBMA 2ZRIA 4GL4A 1SC1A 4EJMA 5JXIA 2DUWA 1QG0A 3PEYA 3ULKA 2W2XA 4Y6PA 1A8PA 4MWBA 1ESZA 1BVHA 4P0PB 2CDRA 4FE4A 4NYMQ 4Z4EA 2QP4A 3TSCA 1QBQA 2CLSA 2BEVA 4J8FA 4UDNA 2B7LA 621PA 4TKLA 4ZVLA 1RAIA 4IDOA 4L6CA 4UDYX 4NJOA 3QXJA 2ZB4A 3E0XA 2NSLA 2N9UA 3AUAA 1VRCA 2QUBA 1FFXA 1EHIA 2D3WA 4OF4A 3TZKA 4LW8A 4LOIA 3SWWA 3PXDA 2I87A 3LE8A 5TQVA 3U3KA 4E30A 4HWPA 1Z06A 4KFRA 1SC6A 3EDTB 3CWCA 2JNWA 1SULA 2FMFA 3FYSA 3CMMA 5HKAA 1NG9A 3UKOA 2BY4A 3SJBA 4X61A 3M1IA 3WKAA 3ZHSA 3GUZA 3EZ7A 2HDWA 4EAQA 2VS1A 2WT8A 3D4BA 3RW9A 1L5SA 1XL0A 4ZU6X 4OYSA 3P2BA 1SCNE 3Q87B 2GX6A 3KNZA 5DN6D 2P9YA 1NJ6A 5ERGB 2JLYA 3FNIA 1GNPA 2WSMA 2X4IA 4NFLA 3ZGYA 3UFBA 4R81A 1V11A 4PO8A 3KVNA 2V97A 2E6UX 3KUDA 4H7FA 5K9ZA 3VO8A 3W06A 4JI2B 4PGHA 4PGAA 1E7MA 3MA0A 3BD9A 1SXJB 4F2WA 4F1PA 1Q17A 1KQOA 2QR2A 1DEOA 1W88A 2CG3A 1YHYA 1FXWA 4L4ZA 3ETLA 5FADA 3AG3E 3VKHA 1YQWA 2D8AA 3RVLA 1EDEA 5JJTA 1F8UA 4M9ZA 3EF3A 4XH9B 3BKWA 4IIVA 3R20A 3D3WB 4XX1A 4Y7DA 4Z3OA 4AY4A 4S0ZA 5I9MA 1QYCA 3MN1A 2VHXA 3F5SA 1FVHA 3WK7A 1L4UA 2ES4A 4F46A 1A9XA 1CD5A 1RZRD 2GPWA 1H0HA 2XBUA 2OMEA 2IDMA 5SV2A 3ZCXA 3ES9A 3H2KA 3F2IA 5EMMA 3ELBA 4PN7A 1XB2A 2HMYB 1YRAA 3LBAA 1Z2NX 5A9TA 4JC5A 2N3ZA 4JWKA 1QV7A 4KYUA 2DWZA 3EDOA 3RRBA 2A0FA 1SG0A 1CLUA 5U4QA 5E6UB 4U2BA 4L5CA 1PR0A 1GCUA 1CUSA 4UVEA 3R7NA 4D56A 2R17C 2QRLA 3AERB 2X8AA 1XMPA 1FU4A 3CX3A 3JTEA 3NHMA 2UVPB 2V5VA 2YHEA 4XKBA 3UK7A 3NHKA 3SQXA 4PIPA 4YLGA 1Y8RB 3NC1C 3GW4A 2R8OA 3G13A 3N2EA 1JCQA 1K6EA 4HI8A 4YP1A 3BK2A 1VBFA 2QVZX 3DBHA 5U4XA 3TAHA 4KBYA 1CVLA 4F5EA 1QP0A 4WY5A 4O4IF 1UPAA 3PVCA 1JAHA 4M8NE 4BTLA 4D0NA 2Y1OA 6YASA 3O3CA 4WNAA 3GJ7A 2DM6A 3IBEA 1NMYA 4MYHA 2FB9A 2AOVA 5D5QA 2MDTA 1INZA 2NN3C 2NSYA 2YHAA 4P5EA 4URKA 2B2XA 4BWYA 2VNAA 3CWQA 2TYSB 5AK3A 5IVDA 5FV4A 2EYQA 3EGDB 3EBOA 3RVKA 3EHMA 3HEBA 4AIFA 1KTVA 3HB4X 1QX4A 4WBXC 4FOPA 2X0DA 3NCHA 2V5FA 5CITA 3IELA 3BBPA 3FJOA 4X5OA 1EK6A 1SOWA 4GM1A 3KPJA 4AFNA 3WGNA 5FYDA 1P6XA 1QQ6A 3FB1A 2XADA 4Z1OA 3RU2A 4KLZA 1PW5A 1IHUA 4IDFA 5KAPA 1XDZA 4F4IA 3W5UA 4Q19A 3PNYA 1KVQA 2PCJA 5DGIA 4H77A 5KHLB 2LKCA 4BNUA 4EUNA 4QWMA 1NI4A 1Q0PA 4ALJA 4X3OA 3VPAA 2IPXA 2KZTB 4A36A 1QOPB 2CLOB 4YFYA 4YGYA 4DV4B 4C0WA 1GVNB 4BO0A 3VHQA 1QYIA 5BOSA 1M9NA 3M70A 2AOWA 4U39A 2WF7A 3CPSA 3D6AA 5HDBB 4HPWA 3IXEA 3HCAA 3X2EA 3TOCA 3AKEA 3N0TA 4GXRA 3IXMA 5DBOA 4ZU3A 4WAUA 2RJNA 3A1TA 4M38A 2X0RA 3GX1A 3AVTA 4MV8A 3A26A 3SBOA 1IJEA 1WXDA 3A9SA 1YBAA 2JVIA 2WJPA 4BRUA 3AHHA 3JZMA 3KRTA 1R3UA 4YCLA 3FKSA 2VGXB 4RYDA 3IVCA 4BFLA 1OXUA 1F0YA 3FNFA 1XCOA 5F7XA 2AYXA 4G65A 1A5TA 3RNLA 2HUNA 2IZ7A 1RJ9A 2GRRB 3FGZA 2B0OE 2VDJA 2ZQYA 4QLAA 5J08A 2NACA 2A0KA 4BV8A 4G81A 3FWZA 1D6MA 2OGSA 3QX7A 1R9NA 1WMBA 1E32A 1J4AA 4HSEA 3RYTC 4G0UA 1ZVQA 4UUAA 3DPYA 4KYIB 2I76A 4MV7A 3KO8A 1XJCA 4JROA 2NP6A 4IKOA 3LUGA 3FOAA 5FXMA 1EB8A 5FR2A 5EJEA 3SK1A 3HKBB 4OQPA 1YCFA 3FR8A 4C07A 4DZRA 4BBJA 5AYWD 2QUZA 2Z6VA 1HNXB 3E8SA 1P7ZA 2GCOB 4PIMA 1OLOA 1T1RA 2OSBA 5KTRA 3SQOA 3ZYLA 5AJZA 2DF8A 4A3VA 4YQYA 1R37A 4MW5A 3WP1B 4BJHB 3RJMA 4X62B 3FPCA 2G36A 5F7JA 2PBZA 2OL4A 1A4IA 4EQ6A 3AR5A 1HBJA 4FKMA 1I7DA 2G72A 2HHAA 1ODLA 3RSQA 1E3IA 4DWWA 4GBMA 5KKAA 2OPHA 1PYDA 1SIWA 2XXAA 2HR2A 1DAKA 2VDRB 4QHYA 5NULA 5KEIA 1M8KA 5KQPA 2OV2A 1VLVA 5H68A 3WS7A 4B35A 2GM9A 2ZRKA 3H0KA 4BPRA 2YL2A 5G4LA 2EFEB 5LD2B 1P17A 4RTJA 4YDOA 4WOKA 1N2CB 4FX2A 2H4XA 3E37A 2Z2XA 3U7EB 1N75A 1VXRA 2PGAA 1DQSA 1ONSA 3DEAA 4MINA 3E81A 3Q7IA 2FF4A 5KYWA 2EGHA 4LBVA 4F2GA 5SYMA 3NUQA 4BZZA 1W1WA 4OMUA 4OB6A 2AW6A 5EUBA 3FPJA 5KJCA 2VH1A 5HOEA 3RAFC 2A2ZA 1KIFA 3EIHA 5CK4A 2GCIA 3GPIA 4HNQA 4OYYA 2GPJA 3CLRD 4N6OA 3EGXA 3HUUA 2HK6A 5ICMA 2F4VB 3ZWNA 3B1FA 4RZQA 1YA6A 4BLUA 4J0IA 1O8CA 2ZUFA 1LF0A 3OM0A 5L4SA 5MF6A 4TYMA 1M10A 3ACBA 4R71A 4DR6B 1ZBDA 5DTRA 4N1AA 4J76A 2X5NA 2GFQA 5KJFA 3BEOA 1PYGA 2PH1A 4O4IA 2DLNA 1VMKA 3EXHA 1NKVA 4A9AA 4HQFA 3ILVA 1HEIA 3AFGA 1CUHA 2O9JA 2X4LA 3PFIA 2HBZA 3CHYA 3R8CA 2QG4A 1H2ZA 2H11A 1P0CA 2BDTA 4LSZA 4RTPA 1ZXLA 4LF8B 1G8SA 1A9PA 1F06A 1JIQA 1LPOA 3H5WA 2E1RA 3ZCVA 2HWXA 3KTAB 3DVLA 1WBBA 3V6LA 1DFGA 1GPH1 2AK3A 2QVBA 1BXGB 4MV9A 3LBHA 2JIMA 4DL9A 5JASA 2B21A 4EA9A 2R5SA 4RVDA 2NPOA 2E5LB 3U4MA 4RQUA 2WZDA 3OU6A 1K3UB 3UHPA 1KJJA 3KZVA 3O38A 2H17A 1KFJB 3CVJA 3BGOS 1YCGA 1Y1PA 4WN3A 2X1HA 2OHHA 4JL8A 3ADOA 4MR7B 1AKQA 4LHXA 3X3HA 3FBTA 5K6AC 3QU2A 4KXWA 4CMJA 1K1EA 4ND2A 3BFVA 4K9SA 3QP9A 3IKOB 3I2KA 1QF6A 4J8SA 2Z56A 3FKQA 3LCUA 5CEDB 4MVWA 2B1GA 4OGGA 3R0XA 4Y6OA 1X86B 5B7PA 3VSBA 5DNWA 4V1CA 3V1MA 1A76A 2G70A 1QZ3A 4BDSA 2VAVA 1R64A 2ZWIA 5EUMA 3TRHA 2J85A 1RWWA 1Y0BA 3V31A 4G5GA 1BMFA 4U00A 4DM4A 1USVA 3U7IA 3ETDA 2NC9A 4CRWB 2WTXA 4K2HA 4G4GA 1YQ9A 1GZ3A 4HR7A 1NJFA 3M2PA 3LFUA 4PYJA 3ZZ1A 2PVSA 2SBTA 2XCBA 2SKCA 1JFLA 1UXJA 3ETEA 3QEKA 4JLWA 1KVUA 1O94C 3LFHA 1Z5NA 2WWGA 3IEVA 4NBNA 2FX3A 1C30A 1XQYA 1L5GB 2GNAA 3LHIA 4IQ8A 4N03A 3EX7C 2ISQA 5G3YA 3OM9A 1FXUA 1E1CB 5IJXA 3PRJA 2AG8A 2PSSA 4HGNA 2TMDA 4QLBA 1SHTX 2J5BA 3O31A 1NVVQ 1RPNA 1X80B 3H8SA 2O52A 3M2TA 2EKDA 2Z8YA 1SOAA 4DLZA 3Q75A 5EA2A 3KETA 4ZD6A 2C5FA 4HOSA 1OZ0A 5F64A 2Z2KA 4XTCS 3OHMA 3Q9UC 2I4IA 4AXXA 4AKTA 4JC8A 4IJ5A 5B1DA 4E5MA 2V6JA 3QHPA 2LE0A 3PKIA 4B7AA 4KWIA 1NHWA 3WLKX 4PLVA 3MCTA 3G6KA 5FUXA 3MTQA 4RG6A 1KY3A 4YY3B 2QM0A 3F90A 2H6IA 1CFZA 2HGZA 3OKCA 1Z35A 5IF9A 4ZIRB 3K4HA 4DCSA 2VNJA 1MJHA 2I2BA 2GVDC 3S2UA 5HXAA 3L07A 1OH8A 4PCUA 2CMHA 5HQ3A 1AT1A 1UPUA 3KVYA 5CHEE 4JI5B 5GOTA 1FFBA 1CY1A 2Q21A 4UDOA 2C9MA 4CF7A 4URFA 1ZKDA 1XA0A 1X1SA 2FPGA 2ZBPA 5K8VA 4FOLA 1B0UA 4TT3A 4D4IA 3QMPA 1JSCA 4ZZIA 1U0GA 4Q9AA 5GGXA 3IEXA 2WVIA 5TVGA 2FULA 7REQA 3KUCA 4TL7A 2KB0A 3EMBA 4CIWA 4IH4A 5JMTA 2PL3A 1S2GA 2CYBA 3TL6A 4XUGB 2WWFA 5I7RA 4KI7A 1XXHA 4OKSA 3PPVA 3ZDAA 3TOVA 4LF6B 1YRWA 2UKDA 4W7IA 1H5QA 1YDMA 4K5QA 1BW9A 1Z4QA 3VU9B 2ECFA 1KORA 4R1QA 1E6EA 4RO0A 3I45A 1BDIA 1U2QA 2VDLB 2CJFA 1E0JA 4CCYB 2RH8A 3NHSA 2AEEA 3A37A 3CK9A 5K0EA 3HG7A 3D6MA 3RVQA 5I4IA 2P9FA 4OHFA 3WYDA 1M34B 4QUEA 2FOXA 4D7AA 4B2YA 3I6YA 1QOQB 2A9QA 5EMNA 1BWQA 4YMSA 1UPFA 2ZSAA 3TH5A 1K98A 1KEEA 2LXMA 4BEJA 3TF5A 3ZY6A 3APFA 2GCEA 1TM2A 5LP6F 3MJEA 5H5JA 3G49A 4E03A 2FMHA 4BP1A 2P40A 1EGVB 3FTNA 3R6LA 1HETA 2QTNA 4QATA 1CQPA 1OWNA 1E2HA 3RS8A 1WCYA 4TMXA 1QU2A 2A9JA 2QI9F 3T7AA 3CRZA 3CLJA 3QVOA 3P0JA 1CQJB 3EH2A 4ZAYA 3P2OA 3H9GA 5TGZA 2VTDA 1YJCA 3SX2A 5DISB 2DWPA 4CT0A 3GZNB 4IYPA 4DIUA 1ONOA 2HMWA 1WY6A 2GCPA 2O3SA 3MAAC 4OI4A 4JLNA 5DWDA 4N6GA 4F2DA 1ZI8A 1JFRA 2MJLA 3HB7A 4TVBA 4N12A 3DSWA 2GK4A 4LC9A 4P3KA 3PE3A 1H3FA 1KFEB 1SQ0A 3P1JA 3RIYA 2VSNA 3TU3B 1ODTC 1YJAA 2ZP1A 4LFCB 2ZANA 1VJ1A 3OWOA 3MRXA 4BQOA 4RA6B 1J2YA 3O5AA 1QO7A 5J43A 3EAFA 4B34A 4ZCIA 3M5WA 4Y2JA 4U7TB 1IVNA 4UBKA 2H1FA 5CH5A 1B41A 2HV8A 3AFIA 4Y9RA 5HKOA 4XVCA 1WPQA 1LDMA 4DW8A 4GI3A 3GNLA 1QANA 4O2AF 4V3BA 1MHTA 2NU7A 5F2NA 3ROPA 4Y6GB 4KVGA 1GFIA 2IZ1A 3FPHA 1L2TA 4F8EA 5HTOA 2X5TA 4QL3A 1LQ2A 3HXBA 5BXQC 4JR0A 1E2PA 2IYUA 4DIEA 2WSSA 2X58A 3QYFA 2P9NG 1X7YB 4ARZA 3LX5A 5CD9A 4P3XA 5K0JA 4PS3A 3JXIA 4MULA 2C7PA 2KE5A 2WLTA 3QLUC 2O14A 3EPHA 1VTKA 3RFFA 3D8BA 3R8XA 4NMLA 4AZSA 1MJ0A 1XDSA 2QUIA 2JFZA 2HA2A 3MJWA 5G4KA 2W71A 1P9OA 4A1OA 4NS1A 1VMDA 3J81A 3GGDA 3DDSA 1F9EA 4YP7A 4DRYA 3VHXA 2QL5A 5BRJA 2B4YA 2ZR8A 2KATA 3T94A 4AP6A 3OT1A 4GBGA 1VPTA 4CQMD 2YJTD 2BI7A 1FVOA 3DZDA 5FHQA 4Q9KA 2Z9BA 2YIMA 1U7TA 4GZDA 3LX8A 3OQMA 2JRLA 3K2IA 2WJVA 2QEQA 3OAAA 5KOHB 2BFWA 1N5OX 3QVWA 2WJHA 4QELA 4JBHA 1A97A 3CTPA 2WTUA 4CETA 1FMJA 2XDQB 2D2FA 2FF5A 4PPNA 3IOYA 2FMXA 2W90A 4JGBA 4TV3A 4BQQA 5DGCA 3W5SA 3RG2A 4ILKA 3T6KA 4RA9B 3PLRA 3FVTA 4PYIA 1RBMA 4EMUA 4JBWA 5KNCD 1K8KG 3T61A 5BN5B 3S68A 3RRXA 4E2ZA 1YK0A 3ZU7B 5IJAA 3C98A 1XEWX 3B9QA 5LXTF 3TNLA 1PWEA 2P0EA 5IKXA 3Q41A 3QITA 3EU5A 1HZZA 5AOCA 4QIHA 4D0LB 5BSTA 2AG0A 1YKSA 1SD1A 4J0HA 2EP8A 2YRFA 3BHJA 2PBFA 4C7OB 4MWDA 4XR4A 3QPVA 4ZT5A 1EFVA 3U7FB 5GZ1A 2OZEA 1BU9A 3EDYA 3K9CA 4UMFA 2PGXA 2A5FA 4X84A 4K9QA 4F3YA 4PLPA 1DMSA 2CV1A 1J0CA 1UAYA 2PEYA 2WINI 5JH7B 2ZYRA 2V8OA 1NASA 4XYGA 2FPOA 4S05A 2DZNA 3AUYA 3UIOC 1GT91 4MKTA 5AOAA 1PWZA 1XZKA 2FN7A 4KCGA 4Z5XA 1OYVA 4TWBA 1HO8A 5L95A 1PL6A 1HC7A 4CEJA 1DPGA 4DA9A 1BMQA 2OB1A 3ONNA 4V0NA 3G0HA 3GA5A 4JL6A 3AIKA 2JAPA 1XHLA 3GP3A 2GRNB 2Q2NA 5KYNA 3C3AA 1MD9A 1FJXA 5TY0A 4RH1A 3FDZA 3LXRA 2Y0BG 2CXPA 4MS3A 1DKLA 1XIVA 3ZUVB 2DSTA 1AV6A 1J2RA 3L06A 3COPA 4LYFA 5I9IA 5EZ6B 4F9FA 4LUNU 1E59A 1QGUA 4LJ4A 4NZNA 3MJTA 3N28A 1ULUA 3AI2A 1LPPA 3EVBA 4IJMA 3BFXA 2AI1A 4CIDA 4ANVA 1W1UA 5CXQA 2JZNA 3Q0TA 4N5IX 2PKRA 3DLBA 1EUQA 9ATCA 3T9BA 4YUVA 4AJEA 3CZ9A 2ZVDA 1X94A 1E79D 3AEZA 2O2HA 1BMDA 1RD4A 1OXMA 2GD2A 3QELB 3A6PC 3RUDA 2VAXA 3NHYA 4LQ4A 4ND6A 2PT5A 3RIXA 4GKVA 3VZBA 2G08A 1ZMBA 4Q4HA 2NO5A 4M9SA 4ILGA 4ARAA 3L08A 1TIKA 3L4JA 3K4PA 2CMKA 5K4HA 4XGIA 1TZCA 1FLVA 5AXDA 3JYHA 4NMHA 3Q3IA 4CL3A 3NP9A 4NWIA 4DDWA 5CTAA 1ODCA 2VK8A 1UXIA 1HLPA 1YHZA 1QZTA 2WXKA 1PY1A 3RU7A 5JVDB 2H0QA 2IOFK 1SRRA 3DTVA 2PFKA 3IODA 3PQCA 3ISMC 4EQZA 1B2LA 3TOSA 3FHTA 3I5YA 4CLEA 2C4WA 4ZAVA 3QK0A 1N7IA 4FX5A 1W0KD 2HA3A 1ZU4A 3NAZA 2NAPA 1FCJA 1W5EA 1NW4A 4FBMA 4JEMA 4KXVA 4ACAA 2ATVA 4O2AA 3T7RA 4RS4A 5I9LA 4ER0A 1KJNA 2OE2A 1Y8CA 3GZ1A 1CZKA 5CLHA 1L7QA 2VXOA 3LJKA 2Z43A 3ZS9A 3A3PA 2O6HA 1W3BA 2VYND 5EWJA 1X1DA 1Y3BE 3PE4A 3THSA 2AB0A 3LYAA 2F37A 4JUBA 2HBYA 4KQIA 2A14A 1NNUA 4FDMA 1HFAA 5AVTA 4BRSA 5FOWA 2J0SA 5JZOA 2V9CA 5TDHA 2OEPA 3KJGA 1YQEA 4ENTA 4QT4A 2I4OA 1DO0A 3DKVA 2GSWA 2QTVA 2AC2A 2WWRA 5DP1A 2ACEA 5AW4A 4OREX 2O3RA 3I62A 2BKKB 3WL8A 5C80A 3JQEA 1T4DA 5LMUB 1X7GA 2YNQA 4LBYA 3JWJA 4DUYB 2EIHA 1U6JA 4D4GA 2IT1A 3O1JC 3QA3E 4N2QA 1MEOA 2WTAA 3UM0A 1OTYA 1IXSB 3BDVA 4PLWA 1H2EA 2UUOA 2CJYA 3I73A 5IWCA 5AKZA 4D3SA 1AZLA 3CRQA 1RCUA 3QXCA 4PAOA 1NUHA 3AP1A 4ZN6A 4QDTA 4YUAA 5K0BA 4JKIA 1F5SA 3AM5A 1XP5A 2P0AA 2JI7A 2WAOA 2RD2A 1LH0A 3OURA 4PEVA 4QDUA 1OIWA 2NIPA 4CLDA 5M04A 3UUEA 3A0RB 1SCKA 1P75A 3VSCA 3SFTA 3WQHA 2O8EA 5C5IA 2O2CA 5LXTA 3UHFA 4H15A 2H6HA 3AB7A 2W9JA 1JN0A 1GY8A 4X7RA 1PVDA 4IQGA 2FEPA 5FEUA 1T29A 4LF4B 1KFKB 3T3OA 3B1XA 2FZLA 2WM9A 4DA8A 3F6YA 1XLTA 1CRQA 1X1CA 2VBCA 2IDKA 3TXXA 4RKWA 4B45A 2JGKA 3E53A 3TDMA 2ERYA 2FW9A 4HRVA 3MOIA 2JFNA 2Q7XA 3ZI0A 2MRIA 3UQYS 2P5TB 5IJ9A 2WJ3A 1GEEA 3Q6IA 1NJ5A 3UQ3A 2XY4A 1JRLA 5IASA 4QSHA 4DG9A 3M6AA 3RJVA 4IZHA 1D6SA 5FI3A 2DPGA 3W8NA 4O4LF 4OJKA 2NO0A 4RF2A 4QJ3A 5K3FB 1E2NA 4YHHB 1BCRA 2CUNA 3P2KA 3OZEA 5JIBA 4KO2S 1X92A 4EY3A 3H87A 2FZ4A 3BQ9A 1RI4A 3HSKA 3FDFA 4BJ1A 2PAAA 4EYOA 4DLVA 2P58C 1CUFA 1CUZA 4TROA 1UZNA 1M6NA 1ZN7A 2ZETA 5M5BA 1AGNA 1EQAA 3RJTA 4KR6A 3GRRA 1KEPA 4NOLA 3C7CB 4HH0A 1XAGA 1Y5MA 1HZ4A 1ND6A 3PWSA 1AC5A 1NBMD 3WGQA 5IAAA 2A57A 3OLZA 1M1XB 3PGJA 3B6ZA 1UBKS 1Y80A 1K8RA 5GP1A 1X7WA 4HZGA 4Z51A 4R16A 2G06A 5AW1A 1CUYA 1QIIA 2ZYDA 3AS8A 1DELA 4YT4A 1DU4A 3WGOA 3CVPA 4HFJA 1NC3A 1G20E 3E3AA 3NHAA 4DLOA 4J9UE 5I4CA 2HBRA 1N54A 3V7FA 1QYXA 1EFRA 5GIPE 1F8GA 1AKVA 4AMBA 4XVRA 3O8RA 3ROQA 1ZN2A 4TTJA 4PHHA 3OQIB 3TQCA 3UWOA 5KOJA 5FZRA 3OEEA 3LCMA 5J4LA 1ICEA 3NTVA 2XEVA 4OQZA 5ITZF 1ODSA 3SC3A 1JHPA 3EYWA 3L05A 1PD0A 1T1GA 4CJXA 2LTAA 3RUAA 5DYWA 1XD2B 3PRZA 4XDZA 3GLGB 3M7IA 4RJ2A 5ISMA 3B89A 3UO8B 3I9LA 2H2IA 3GFOA 3M9XA 2QN7A 4N2SA 1G2IA 2P2LA 1R5OA 4J6IA 2WF8A 4TWRA 2A30A 3R23A 5T6MA 4YK7A 2O2IA 3EIXA 3E18A 3A9UA 3PUXA 4RETA 1GL9B 1R10A 4HUTA 4KJZA 4LK3A 3ZHVA 3OZRA 1FP6A 5KQMA 2A58A 1NE7A 3PUJA 1NMEA 2PE5A 2AD5A 1DEAA 1BX0A 2IBSA 5FDFA 1HT0A 2OFOA 3B5JA 4X24A 2W8ZA 3SD7A 1QZXA 3NM5A 1IYGA 3HXTA 1YOVA 1Y42X 1P1IA 2ZROA 2CHVA 3WWCA 3T5TA 1NWCA 2JIRA 5AXBA 2DU8A 3CZCA 4LV6A 3LP8A 1IVYA 3FMFA 1KSFX 2GKGA 2NW6A 4AXHA 5ITZB 2D4HA 3IHYA 3MB5A 4X90A 3CNQS 2I7TA 1OREA 3ZDXB 2CHZA 2A0UA 3GWGA 5DTQA 3SBTB 3BMQB 5IYZA 4MS1B 1FYWA 4KIUA 4ZFNA 2IU3A 2QL6A 3CH5A 1PAQA 5B1HA 5HHTA 4IZ6A 5ALIA 1CZUA 3D4OA 3GG9A 3FLAA 1R6AA 3B3FA 4QD3A 2XCOA 5K4AA 1Z7WA 4B85A 2EX0A 3HCEA 5JDCA 4HXIA 5DLEA 1BWRA 4FHGA 2QNIA 2O5VA 1E8OA 1XTTA 2ZCJA 3HC7A 3JZIA 1ECBA 3F47A 3CUEF 1XDGA 1YD7A 3BTOA 1PT8A 2NU8B 5JARA 1CQIA 4EGSA 1IOZA 4RCYA 1Q0LA 1NT2A 2R68A 1U90A 4KOEC 4NZ9A 3KSUA 4KYTA 1NBHA 2O0HA 2Z09A 3OX1A 3V4VB 4YRTA 4BMOB 3HVHA 4PFSA 3HR7A 4KQKA 4C7MA 3PNQA 5FJJA 3C4QA 4FP7A 2FJBB 4GYKA 3B3GA 5KYKA 1EFPB 4TLLB 3SLRA 4P93A 3HJAA 1PEDA 3TLGB 5M29A 3QVGA 1FP4A 3UOGA 4IOMA 3P5BA 1M1YA 1K6IA 2P6MA 3N6XA 1IH8A 5E4FA 4K40A 1PJLA 4HI0E 2X0KA 3WGMA 4IJUA 3OP4A 3UJ3X 3IVAA 5BVGA 1AMNA 3SF4A 2HJSA 4TL6A 4C7KA 3LL7A 3G1TA 1XEFA 4O4LA 4CG1A 3OCUA 4Z9AA 5I4KA 1J1IA 4MB6A 4MVJH 3NT5A 3BMXA 3H9EO 2GTIA 1S0UA 3WDMA 4F1WA 1IBRA 4WCVA 4ER7A 4RZHA 3PEUA 3W1VA 1AUQA 1SMKA 1LTQA 1HYEA 5DYIA 2BGIA 3TIIA 2NTNA 3OG9A 3VBCA 5JNWA 3ROKA 3D7SA 2XEDA 1DCQA 3O95A 3BIOA 4CKWA 3PGVA 4RMGA 4HDMA 2XMZA 1U0NA 2R5FA 2EZ8A 1TF2A 4LMBA 1H6DA 4I08A 1IHYA 3IDFA 2RHBA 1P5QA 5CAEA 4V02A 3SHOA 1KDOA 1CVIA 1KMIY 2Y05A 5KQLA 1CS4C 4D2IA 1VHLA 2QUKA 4IDNA 1JG3A 2ZI9A 3CE6A 2Q07A 1CHNA 1GCOA 1M0SA 2OHJA 4NFSA 1RPJA 2NO9A 4U07A 1CE8B 2YWGA 3PUZA 5L3QB 3ZBQA 3UTCA 5AI0A 4NJEA 4FNGA 5JHBA 3BTVA 1WLSA 3I92A 4RJKA 5DI3A 1ML4A 2PM7A 4IVRA 2OAQ1 1A8SA 3FKSD 3JQPA 5AM5A 4BECA 2BRUC 3BFKA 2CXQA 4US2R 1NA5A 1DC4A 2IYWA 3UGKA 1DCFA 2O19A 4DSOA 2ZATA 2JGRA 4KQ1A 3ZNOA 3HWWA 3GH3A 2C95A 4TWAA 3S7FA 2AG1A 5A5GA 4K6HA 4TQUS 5IC6A 3HCNA 2HIAA 4HMPA 1NF2A 4DLQA 1FSPA 3EVAA 3DW3X 3N70A 3VR6A 3ZKJA 5F7OA 1DWUA 3ZDEA 1IYZA 3HZZA 1T9ZA 1TZJA 4ZRNA 5JQGB 5E75A 1R8YA 5AKLA 4DB2A 2IYPA 4X91A 2KPOA 4MV5A 2N42A 5L7YA 4PHFA 5CRVA 1CF9A 1S9DA 2ZFUA 4D4MA 3R75A 2P2CP 3LS2A 1H6AA 3ND9A 5C7IO 1QFZA 2R00A 3JUEA 4C0QC 1P91A 3GLFA 4J1QA 3BEDA 3H9UA 1GGMA 2R6HA 1AUPA 4NJMA 1EXNA 1YCHA 3OU2A 1UFOA 4QBFA 4F7DA 2VQDA 2ZUUA 3K9HA 3NW9A 3IO3A 3NDBB 3RKSA 3DBRA 1WAO1 4MR9A 3KFLA 1E9FA 2D7JA 3DEYX 4I9NA 4ZCTA 3OEWA 1ABEA 5JRDS 3H1BA 3DEFA 2C3OA 1VRVA 3W2EA 5JYDA 2QROA 4WL0A 3FPAA 2XVXA 4Q15A 5KVQA 4XGNA 4WA8A 3U44A 1ZMRA 3U4IA 3NBFA 5FNVB 3QTTA 4PLZA 1A4XA 3C3CA 1NV8A 1V47A 4OQYA 4NYMR 1S2MA 1BE6A 4MPDA 4NZPA 1OASA 3BN3A 1GJRA 3RSLA 3CU5A 3I9OA 4K87A 3OKFA 4IXWA 1QH1A 5JY1A 2AKEA 5TQ2B 3UXHA 1B42A 3ZTYA 2EF0A 1UXKA 2UYGA 4EHAA 5EP3A 2PV0A 2R6CA 4CNBA 1ZEJA 4LPKA 3OCJA 2VQ2A 4HMQA 2YDXA 2A9KA 2OT3B 3I2JA 1E0DA 4ZT6A 3GNTA 3TZQA 1XZ8A 4PC3A 3KL4A 2XUGA 1NATA 3AEQB 3DMPA 1AHPA 2HB6A 2LNIA 1XZLA 1A2OA 3NTOA 1F7VA 4PICA 3M82A 3SQMA 2FFRA 3UW1A 3EIUA 1JU9A 2WM3A 1D03A 4D0GA 2GT1A 4M21A 3RSOA 1Z3IX 1MX3A 1CRLA 2NOAA 5AAOA 3NAQA 5IDWA 3N6RA 2I2FA 2BGLA 4MW1A 3IKTA 3R3SA 3GFRA 4F3CA 2WTMA 3DNMA 3SG0A 4MO2A 4L22A 3VZRA 3Q9NC 2Z98A 3V7WA 5I7FA 5A5EA 2GTHA 1VPVA 1XTKA 4D43A 2OAP1 3BXPA 4HRYA 4KDFA 2OORC 2VOJA 2RHJA 1AHIA 1SQSA 4HNHA 2BBWA 3UWKA 5DGHA 2XTAA 2HLPA 4TTAA 2WHQA 1T4CB 4Y9TA 5E1DA 1JZSA 3PFHA 2AC4A 3QVXA 1EUYA 3ZH9B 2Q3JA 2I8CA 2EQ5A 1GGEA 1IZ8A 4E21A 1G6OA 1U4OA 4PPYA 4RG9A 3UIEA 2QRKA 2SKEA 4I0WB 1U2GA 3FH8A 1DCMA 5C7LO 3AGPA 2EW1A 3UT7A 3C97A 1L4MA 4FM9A 2F9MA 2X5GA 5CFMA 2CY0A 2HNAA 3CV3A 5ECGC 3LT0A 4BO2A 3PRKE 1EF1C 3ESAA 2Y1KA 1YIDA 1MG0A 4JLMA 3IH5A 4XSVA 4DMGA 1GPDG 4ZVPA 1FVFA 3K1YA 1EB9A 2B1RA 3SZ3A 3B7BA 2WE8A 5TIIA 5A7GA 3RSGA 3LUFA 4OBWA 2R05A 1XFDA 4R1MA 5TPWB 4HDCA 1ZM7A 3D8SA 3KXKA 2FCAA 1QTIA 2NO1A 4M1QA 3UG7A 3M3DA 2VH5R 2BMDA 3HNPA 2QIPA 2VXBA 2NQTA 2GH1A 4UD2A 1JXQA 1LD3A 4M1OA 5T7BA 3LKBA 1U81A 3RSZA 2QSYA 1GL6A 3ZW8A 6ABPA 4EJ0A 2NVOA 4B3FX 1OH6A 1WP9A 2FWMX 3AFMA 2CGEA 2PLNA 3M4ZA 3QWAA 5HEKA 1ISSA 5LZ9A 2H2WA 4J6FA 4EHKA 2PMFA 3Q4GA 4RVUA 1ODFA 1BMFD 1U8FO 4E13A 3TX6A 3WLJA 3NOXA 4PCLA 2GJSA 4L0MA 3ZU2A 2DHQA 1JSXA 3GRKA 2GVNA 2ZXFA 4PBTA 3EPRA 3ZNNA 2C2HA 3DMHA 2OC4A 4DK5A 3GMSA 5BSFA 5ADUS 3FP3A 2ZB2A 4O08A 2QRVA 3WLIA 1ZM3A 3IEMA 1N0QA 4U7FA 2C3YA 2VT3A 1SRQA 3G02A 2IQIA 3LO8A 1YUNA 2B6CA 1ZH6A 3IDQA 1FYDA 5CYGA 2RCYA 3WB0A 5IFLA 3WGTA 1JNYA 1HURA 3O03A 1DAEA 3BK7A 4DABA 4KXFB 3VR2A 3WBKA 5DYYA 4IS2A 1XELA 5CFOA 4IXDA 1RAHA 2DGDA 4HVCA 1KC1A 1SXHA 4F12A 3JARA 3ZKWB 2VVTA 3X1KA 4L5YA 2XH8A 4P4TA 4BV9A 5I9NA 1E5TA 5BPPA 1D1TA 1SXJA 2WAMA 3PXEA 4E1BA 2QLTA 3A10A 1CB7A 2HLHA 4DNXA 1NZFA 2BI8A 2XTZA 2X1LA 3ASOE 1QKIA 4YUXA 6NULA 3HHPA 4L2IB 3ZNGA 3D3WA 4Q24A 3GZ4A 2ARKA 3CLSC 2CEKA 5U1PA 2XDAA 4QTZA 5K2MA 4JUCA 2R4TA 2ONJA 1QRDA 1Y48E 3EMDA 2A4KA 5T3YA 1FFYA 1KJ8A 1R8SA 2OBXA 2FEMA 2J9RA 4MRVA 4UVGA 2GM3A 5HKKA 4FFMA 2C8JA 2CT8A 2CUZA 4YRRA 1RZ3A 4RXUA 1O8BA 4Y98A 5DNAA 4TT3D 4ANUA 4KZ0A 1DC6A 4L95C 2R6ZA 3IPXA 2KCVA 1HE1C 2GERA 2OLJA 1N78A 1QK5A 2BJWA 3IOCA 5E6UA 2G1AA 3RGWS 2QGNA 5TPZA 2G76A 2DLDA 1W47A 2WG2A 2W5UA 1ORVA 1PUJA 3AERA 3C16C 4DHWA 4AKGA 3PQFA 3H9CA 4YC7A 4LRUA 3I4GA 4F4FA 2W48A 2UVPA 4G2NA 3DLCA 1IUNA 1D6JA 3CK7A 1QFYA 1QPZA 2OECA 1U4SA 4CU2A 5J40A 1Y8RA 2YQ4A 1HSOA 2OFPA 3R0ZA 5C51B 4Q4AB 2GEFA 3ZHZA 1Q21A 2HWWA 5ELXA 2AVDA 1FUEA 1XAHA 2EATA 2WMYA 2QJTA 5EJAA 4RH3A 3ASFA 4TS4A 5DM0A 1V45E 3PKZA 3T1YB 1GU1A 2A94A 5AM0A 3ZGQA 4U0KA 2F9FA 2DUUA 3C6QA 1RXWA 3EA4A 5FV7A 3A1FA 2JRCA 2EU8A 3CJRA 3ZVMA 2GARA 4EO4A 1J8QA 3M5PA 3HL4A 3FLBA 3KQMA 1G4AE 1WCIB 4NPAA 4QFBA 2ECPA 3SKXA 4JLUA 5I7UA 1IRXA 4WECA 3DZCA 5B3JA 3IL2A 1YFLA 5IHXA 2RHTA 2HEIA 4XWGA 4TXMA 3ZXYA 3LF2A 1WMFA 4L15A 2IY0C 4Q4DA 1TN8A 1EP3B 3F8TA 1LB1B 2GWHA 3S2FA 1OI3A 3ZHTA 2DH5A 4LZNA 5AXCA 4V0ME 3VI3B 2HIMA 2DVWA 4E5NA 1IJFA 4YVFA 2HQSA 2IPLA 1XDDA 3G8YA 4BLPA 3JQQA 1EH5A 1L7OA 1M2OB 1JX6A 2XJ4A 3SD5A 1RRGA 1CR2A 1YJQA 1YZKA 2HMUA 2Q1YA 2QQFA 4OXRA 1MOSA 3KJEA 4J49A 5C8VA 3MQ2A 1JFFB 3K9NA 1B14A 1OW3B 2XT6A 2ZVQX 3KSMA 1XGKA 3AL3A 2BHNA 4NV0A 2KZTA 3MAGA 1J0AA 5EHQA 4B89A 4ZQCB 2CL5A 3E3OA 4MP6A 4DDTA 5HSGA 1XZPA 4YP6A 2WXPA 2J3QA 4URVR 1HOTA 3PXUA 1F2DA 4N0QA 4DIMA 4FK8A 2C7QA 2FCRA 4HLEA 3NVAA 4KLRA 3VR5H 2R0QC 4BFRA 4E07A 4DWJA 3GMTA 1CNFA 2IDJA 3PC2A 5CG2A 2P6PA 2RGCA 1UJMA 4C22A 2CNBA 3JAWA 1FBNA 5A62A 2J6HA 2WSSD 4KKXB 2AR9A 2VGXA 1JJIA 4CM1A 4J3FA 2Y77A 4K88A 1ZM9A 1I3MA 4OIFA 2X76A 3OECA 4AKXB 4Z4FA 4BVAA 3WG9A 4BMCA 2BISA 4B6SA 3M5CA 3VTZA 3Q6NA 4DPLA 2X3FA 1E5DA 1DKQA 1WY7A 4PSCA 4LKOA 3IR5A 4NQRA 3I9NA 3N39C 4U2FA 2JGEA 2C5HA 3G89A 1U8TA 4EY7A 5BXUA 3EW9A 1T9KA 3DNPA 3IBFA 2Z5LA 4BO6A 3ZYKA 3SZUA 2WXLA 1XPJA 5LDGA 4L3OA 1SWWA 3ZK9A 1E2DA 1G5IA 3HKBA 2WFMA 4B4WA 3DE4X 2ISSD 3UMFA 5IEJA 2GPBA 5TXGA 1ZW6A 3S5JA 1N77A 2EV9A 2I6SA 4H3VA 2OYCA 4QQFA 3IEPA 5EKUA 1DJLA 1MOQA 4Q37A 3GUYA 3OAAD 1U7ZA 2H7VA 3GJ3A 3I6MA 2G17A 3NHFA 3Q7PA 1NXOA 1Z13A 3D3JA 2VDOB 4CT5A 1NU8A 3IXQA 4J16A 3FTEA 2XITA 1JNZB 2BTQB 4DPRA 3GGOA 4J0QA 4FIZA 5EHNA 4FYJA 1UBRS 3U31A 4K0KB 1CUIA 3GLVA 1NQWA 5B4VA 2IEJA 4JI8B 3VA7A 2IL1A 2HHLA 3HDHA 1VG9B 3PUIA 1QCCA 3BRCA 1CCWA 2ONYA 1Q2UA 3BUSA 4MCIA 3I9MA 3EUFA 2IU4A 2D0DA 1GZ4A 4NPCA 4B47A 2XWBF 1N2CA 2OXEA 4AYWA 4CKCB 4P7BA 4D6PA 4GP9A 4BMNA 5FLYA 2C2BA 4AKHA 1QO0A 4TXNA 4EF4A 2GW1A 2AFIB 3G2SA 4OB7A 1ZGCA 2P4SA 1YGPA 5LQKA 1O97C 2RH5A 4QPZA 4EG5A 1C4WA 2QN9A 4UNPA 4A2QA 3AK4A 4KQXA 4CT4B 3TLMA 3CZ5A 1M6WA 4P58A 2X86A 5BNZA 4GDMA 4IUBS 4YB8A 4BTBA 4JI1B 3UJHA 1MO2A 2Z6AA 3Q10A 2G9QA 1N2SA 4YJHB 1UF9A 1JFTA 4GMRA 2CNLA 3NDIA 1DDIA 2ZXWE 4ZDIA 4JI7B 2KHZA 4JYBA 4Q3NA 3ZZTA 3PH0C 4WLNA 2YJGA 4E6PA 4Q1CA 1UODA 2ZRPA 2ZDQA 4W1SA 1VCHA 4UBOA 4OXKA 3LOQA 1TD1A 1EVJA 1I4LD 1X7ZB 1QCZA 5DTJA 3LUJA 1PNRA 3V8NA 5DP2A 2J6IA 2QD3A 1FFEA 4ZGWA 3WAGA 3QFFA 1NE2A 3STHA 2Q0QA 2PNJA 4KAFA 3OZVA 4PQGA 1DBSA 2PGIA 1WM1A 3KTAA 4PFJA 3GEIA 4U9UA 4ATZD 1BXGA 1E3MA 2QRGA 4B33A 4UYKA 3QEOA 2G1PA 3L1VA 4JI6B 3GZTB 2YH2A 5CGQB 1RYEA 2Z8XA 2VDMB 3V8BA 3RRZA 3BL5A 1T8YA 4BLSA 4LY0A 5IABA 2P11A 2DT5A 1QZZA 1SU6A 2B6NA 2NYUA 5DF1A 4F4UA 3PIDA 3AUJB 3QFSA 4Q6WA 1L7BA 3U3JA 1YA0A 2FHSA 4I9CA 2IXFA 3G9QA 4W4TA 3EDQA 4KN9S 4L23A 3C3XA 4MR7A 4G1MB 3C1UA 3VZDA 3CW2A 1N3YA 4FOSA 2Y69E 4DV1B 3I8OA 2CL0X 3G7UA 3ITDA 3LGAA 1DTWB 3DTVD 1EUDA 3SEAA 1GZ7A 2Q99A 4BOYA 3IOBA 1XCBA 1L5HB 2CDCA 3BQOA 3X2SA 4EW3A 1TVCA 1L4LA 4GOMD 4JLJA 2IOYA 3MUOA 3EUVA 1YZNA 4BO8A 4R68A 4Z3KA 3NC4A 4XUDA 3CY6A 3NEAA 2XV1A 3B78A 2PLRA 3O7MA 1VL1A 4AUMA 3EUWA 2H16A 4OFZA 4CRWA 4NICA 3IRVA 5ALKA 1ELRA 1OROA 5MN4A 3ZD6A 2O57A 1IFXA 1XV5A 2P4QA 4XOIA 3RKVA 2ZS9A 3ZYQA 3U7HB 2W0SA 4CLXA 3DCIA 1NVTA 3PC8C 3ZD7A 2G04A 1V9SA 1ZD4A 4NCNA 1Z5OA 5TARA 4AZ3B 1IBLB 3VMMA 4BB6A 2Z04A 2VKTA 3HYTA 1FNCA 3F6CA 4O33A 1DQZA 1BH2A 1QFXA 3PFCA 2RAFA 1XRLA 1YMUA 1ZKMA 4UWLA 2CVOA 4BVFA 2W6MA 1X80A 1YS9A 1JR3E 2C3MA 1NQUA 1AMUA 3G8DA 3I2YX 5A04A 1BRTA 3P94A 2FPXA 5ARGA 3E9ZA 2I4LA 5TC4A 1L8LA 4A27A 1I6WA 4PO1A 5JPCA 4R4JA 3DEPA 1KA9H 4ROTA 3VH4A 4U7EB 2EWVA 1MO5A 4F0JA 4ZEXA 4LF7B 1X70A 2HK8A 2P90A 1JDUA 2G7MC 1X13A 3MCAA 4UM9B 3VXKA 4DVGA 1YRBA 3OPYI 1TVEA 2JEOA 4RKEA 1KAEA 1U7UA 4HGOA 5A3RA 3ED5A 4I55B 4OXYA 3BFJA 1D5WA 3T4EA 4B3JA 4WNGA 1ZMTA 2PUTA 4ZIRA 4AI6A 3C3EA 1CUEA 1ZMXA 1UDRA 4ZVVA 1S9HA 1DXQA 2R9VA 2VYCA 3S2EA 2IUTA 4UTXA 4LNAA 3ZHRA 4RHTA 1E2GA 3T3PB 1I5OA 2KCLA 1KE1A 1WB6A 4M87A 4BX9A 1K63A 1XYGA 4I6JA 3N07A 5JAUA 2M63A 5FRDA 3LGSA 2J6BA 3IPYA 3ZWAA 5AKYA 3F78A 3RROA 3SSAA 4D9NA 2IJGX 2AF3C 3GLSA 3RYIB 2YHCA 1B16A 1UQUA 2YFYA 1Z17A 1K7SN 2J1LA 1Y4SA 3H8JA 2VEDA 2CNOA 3MZLB 3NP7A 4OFBA 3PEEA 3LA6A 5JH7F 3WRYC 1K3FA 4UVDA 5JNUA 2JFUA 3VU9A 1RVV1 2CXOA 1YR7A 2CB9A 2CC2A 2DECA 1BG6A 5A3QA 4MICA 4WN9B 2ZUBA 4CCYA 4GZ5A 3N86A 1E1KA 3GVHA 4J7AA 4UEJA 3C6YA 5HKBA 1M34A 3GRPA 3QMWA 5DX0A 4HYEA 1V0JA 3A4IA 2RC6A 4YAGA 1Z4PX 4ERNA 2C0CA 3MVEA 5B2EA 3QH4A 4UWKA 3Q7RA 3ZCRA 4IM7A 3V4OA 2VP6A 4ILHB 4CQNA 5EGNA 4PM4A 3UMRA 5FORA 5JCOC 2D5BA 3MMNA 3RIEA 4TRJA 3AVPA 1E64A 1SC9A 3A9TA 1OE0A 3E2PA 2YOHA 3DA8A 3FYTA 4MIKA 5ETJA 4DN6A 4I1IA 4ECEA 1K4MA 2GKOA 2R2LA 4F97A 1L3BA 1EXDA 3NAMA 4KFSA 3L9TA 4H4EA 1RYDA 4P54A 1RJEA 2APJA 1GKUB 3L4KA 1WUJS 4FTWA 3LXXA 3I01A 4UU1A 5A6SB 2I2DA 2B61A 1VA4A 1N7GA 1ELKA 1EK1A 2J9FB 3GZNA 1ZQ1A 3IKVA 3W4IA 4C7VA 1JA9A 4F85A 1BJRE 2R7LA 3MZ0A 3WBJA 1E18A 2EQBA 2FEOA 3UG6A 4WEQA 3CZQA 1G3RA 1EFRD 3H2JA 4RVBA 3OTNA 4M7OA 3SYMA 3QGMA 1CR0A 4TL8A 1UPTA 2AFHB 2Y1GA 4IJVA 3KAKA 2FW0A 1V6SA 4U5QA 5A0TA 4J75A 1BOOA 3ER8A 3OEED 4RA6A 3SYTA 5JVDF 5DO9A 4B1FA 1I32A 3T5CA 2PZGA 1C8VB 4NRDA 4MMZB 4EUFA 3LM8A 2IY8A 2OFFA 3S70A 5MN6A 4BUZA 1EJ2A 2NZ8A 2IYRA 4S3MA 3OQJA 5LP6A 5FO0A 1G41A 3Q15C 1T34A 2C59A 5JJKA 3QFTA 1E2LA 1KDPA 4HFMA 4G0YA 1KI1A 3LBNA 3IV6A 3ECAA 2O59A 2IHZA 3EC7A 1UBFA 1T2UA 5GVRA 1H4VB 3IAXA 1E9EA 1X7YA 2BPOA 2ZZNA 2WKSA 3OIVA 1FPQA 2HLNA 3QK7A 1KEZA 2YKGA 1IQ0A 1YR1A 4EAAA 5KNGA 4KPYA 2F43B 5IC4A 2R97A 4DLKA 5F1KA 2X0FA 3QXSA 1HDEA 4AP9A 3DYIA 3GJ4A 2J0VA 2XMPA 3SZGA 4GLFA 5C2JB 2AMVA 1LQTA 2P75A 3FCYA 4FZJA 3E35A 4CDMA 2EOAA 3OPYB 1IL0A 2GRAA 3FUTA 4JJ6A 3W5AA 3KWMA 2QB5A 2V45A 1H0AA 1PZMA 3C5EA 2YWHA 1EIZA 1JR4A 4YR9A 4KXYA 3JQ6A 4Q7LA 2H63A 4U8GA 3HKDA 2HRBA 3AJEA 4AF7A 5KOHA 4E32A 1Q0RA 2AF4C 4QUJA 4FGKA 3V4LA 3QVJA 4QOGA 1T9GS 3ESQA 4XQGA 2FDCA 2XDQA 2COKA 1QQEA 1QB7A 1C9YA 4HPJB 3D2LA 3D7NA 3I3SR 4JVSB 3H3JA 1QAQA 4RA9A 1UMCB 4EO7A 4TLCA 3E4CA 5LQNA 5FTNA 1ETUA 3D02A 5KYYA 3IUYA 4IF6A 4Q9HA 2HPAA 4WLUA 2FZVA 5G05C 5BN5A 5IAOA 1YONA 5FFFA 3GBVA 2MMCA 4MVJI 2H52A 1KLXA 2Z5FA 5ILOA 4AJKA 2GETA 1RACA 5KWIA 4E33A 3HVKA 1CS0B 4D8WA 1W581 5AARA 2GAOA 3L4BA 1VHQA 5LLDA 3PEVB 5EESA 3VPHA 4LWPA 3N0RA 4C7OA 4O02B 1S01A 1LWOA 2IHUA 3BK1A 3DKIA 2M6SA 5DNDA 4YQEA 5FA6A 4D02A 1VLMA 3BDIA 5KU1A 3R5FA 721PA 4X8OA 3OOJA 1HFEL 4QDZA 1JU3A 5JH7A 4FMDB 3PZBA 4NH0A 3ZWDA 5B1IA 4D3ZA 3TWXA 2IE8A 4GKKB 4F4JA 5H59A 3B7GA 3LZCA 2BYTA 4NBLA 3TEMA 2XOXA 4G1TA 1QRUA 3W4KA 1OR8A 4OEHA 4FFWA 3EZ2A 5H4HA 1VPWA 4MRRA 4GZMA 3DCNA 4XWWA 2OXCA 2PUDA 1Z62A 2J3EA 1KWGA 2SCUB 3Q11A 4OQFA 4C3ZA 1T6ZA 1CR4A 2CHGA 1N2BA 2VL7A 1Z0DA 2P69A 3P27A 5G53C 1HYHA 5HRUA 3JQBA 4F72A 5A0FA 1D1QA 1LRJA 1TLTA 3II6X 4CUJA 4ENVA 2C7RA 1U5BB 1FF9A 3CLVA 2G1KA 2FXIA 1SW6A 2R59A 2XAAA 3A1NA 5FX2A 3P20A 4NS4A 1U3TA 2F8XK 1VQ1A 2PKQO 3CO5A 1FW6A 4RFVA 2AZTA 3HDTA 2BGMA 4K8RB 2C3PA 4DCUA 1OUVA 4LYHA 3O3MB 4HH4A 2MT9A 1JVNA 5LOVB 3CUVA 1E0SA 5AKXA 1KP9A 3DEIA 3WGYA 1HK7A 2Q3EA 4Z7JA 2HYIC 5EMKA 1VCNA 4PS1A 4R41A 1T6BY 2ZIFA 2OBFA 4NG5A 1OH5A 4IP0A 3CK8A 2EBUA 1T8RA 2J9ZB 4LN1A 3CSTA 3T3HA 3P97A 2Z6QA 5COQA 4HUQB 1P9LA 1SURA 4LNHA 2W2OA 4DG8A 3MKQB 4RJJA 3AKZA 1NKTA 4J8EA 4F92B 3GAZA 3GJZA 2YZNA 5CVCA 4LY3A 4HYQA 2BM0A 4WCFC 3NTUA 3OWHA 1TGVA 3OM8A 4A3TA 1U98A 3TRJA 3K71B 4YMLA 2QPTA 4L08A 5JVDA 3CKBA 2HF9A 5M34A 4ZOCA 1P5RA 2ZGGA 1G3MA 3QWFA 3O9VA 3ZRHA 4EHJA 4DE5A 5T8KA 3E15A 2YXPX 1Y4ZA 3CH7A 2IZ0A 3PR3A 4O3FA 3CT4A 3L93A 3K2EA 4XIJA 3VR6D 4B4VA 2FSVA 5KJNA 1PR5A 4TT8A 3QG1A 5C8XA 2Y6VA 4B6JA 3QDNA 4MDHA 3COWA 5FF9A 1CT9A 1T2FA 3DHEA 1ZJYA 5C35A 3AI1A 4J7CA 4EEZA 2P9LG 4PYNA 1UKBA 2D7DA 3WTCA 1NP6A 3C5RA 3EAQA 3MUEA 1KEUA 1RQPA 3TRFA 3S5UA 1J97A 5FP0A 3ASDA 1DIAA 4S1TA 3NBNB 5JMOA 3C7AA 4UQOA 4GRIA 1M1UA 2WUFA 2ZRGA 4JOBA 4RXMA 4C4OA 1SZDA 1D4OA 3DHVA 3FBWA 4NV3A 2B5VA 1E7UA 3FFBA 5IBRA 4LHYA 3B36A 2YHUA 2PUGA 3L7LA 4CGWA 1JCSA 1S89A 1L1QA 2HPVA 3BCUA 3WNZA 1AQIA 4MGEA 2W6IA 1XMSA 3ZEFA 3GQBB 4OYRA 3LD9A 1W85B 3WX0A 2PX5A 3HG0D 2CXXA 3QE9Y 2BZ1A 4BQSA 1U8CB 4RELA 2XOEA 4NE7A 4OHBA 4Z2AA 1ZH8A 2ZJ8A 3NS7A 3V48A 2EZ9A 3I9JA 3EG9B 1Y4UA 1F20A 2IXBA 1ZU2A 2JD2A 1E8NA 1R6UA 4B84A 2WJYA 1MIHA 1M8JA 3PVSA 2N46A 3Q8XB 3OMWA 4S2UA 4R01A 2C1ZA 2XZOA 1TJYA 4ZI2A 2I2OA 4G2VA 4FA6A 2V55B 3LCCA 1LKZA 4QYIB 3Q7FA 1O96B 2OBBA 2DFDA 2C9ZA 2C4TA 3CVVA 3QBTA 4CKBB 1Z36A 3FSGA 2BGKA 4YGXB 1HG1A 1C2TA 1U1FA 1VE5A 3CSDA 4ZHBA 3X1JA 2X8LA 3PRYA 4WZAB 3NORA 4GA0A 2WEKA 1GKKA 4HQ0A 4RD0A 2MR5A 2G3YA 4XVQA 2Q4TA 2C4NA 3KAJA 3W5HA 1DWQA 1M6EX 3KYBA 1KZ4A 3QIAA 4BLOA 5DHTA 3GLKA 1M8PA 3IALA 1XHEA 4X54A 5I45A 1G0NA 5JRZA 4DR3B 3F4BA 3C74A 5AW5A 1CQWA 4ZCMA 2HIGA 5HM8A 3VO2A 4D9HA 1JF8A 1R5BA 4TYYA 5AH0A 3TG4A 4Q01A 1IHGA 5K8JB 3DNFA 3OESA 3AF2A 4YJFA 2GO7A 3RUFA 1IY2A 1AWCB 1A72A 3CGWA 1GA6A 4RC9A 3VX3A 3O1IC 4DMCA 1J2JA 1RWKA 3MKRA 3O83A 4FCVA 4IRUA 2VTKA 2JFXA 4JITA 2WB4A 3MWLA 3WGJA 1SIOA 1YDHA 3SLGA 3REOA 5A9SA 2C0PA 3ICQB 1OGIA 5K3FA 3BMCA 2PRZA 3P45A 1EWVA 3AWIA 1AO3A 4JFRA 4Q1AA 4IHJB 4EZIA 4B6GA 2L69A 5A6VA 1CRWG 4BX0A 1I0ZA 5FYQA 4DILA 3EPKA 4DNOA 5A7FA 3VYTB 2B69A 2Y3AA 2PNFA 1XTQA 1HLFA 4TTQA 3FU5A 4D3YA 2FQQA 5A9RA 3V8RA 3GY0A 2AR7A 4UTOA 5AK5A 1FA9A 3DPSA 4OVKA 4K28A 4MZDA 4Q48A 1UQRA 3V34A 4R8MA 1G5PA 1E6UA 4JPSA 2UWJG 1NNLA 3PHHA 4JP8A 3B1JA 1UKZA 2XUKA 4PFQA 3OMSA 1GN8A 5HF8A 3GC6A 4LIPD 1SVOA 1O54A 4NDNE 2WHYA 1R0WA 1NLZA 2GLTA 2YMLA 3OFJA 5EJ8A 3OFNA 1P62B 5A23A 2HJHA 4I6EA 3EVFA 1B74A 3S8YA 3GT0A 4PSAA 4RF5A 4RSHA 1SHJA 1EIWA 2LV8A 1L7AA 4AC9A 3RAGA 1X77A 4XLTA 4N7JA 3W9SA 5EIBD 4ZAGA 1FRVA 3OQIA 1MJFA 2W22A 1J24A 1I4TD 1NL3A 2B35A 3UMGA 1FYFA 4C1BA 1TO6A 2PKCA 1IWOA 4UXJA 4CCSA 4YMUA 1A1SA 2WJGA 3CRNA 1DI0A 3S1LA 5BWBA 4U6SA 2EJCA 1IEWA 2E82A 4AP2A 1W9MA 1YU6A 1W59A 1XD2A 3GLGA 2AZ4A 1X8LA 2C82A 3D6UA 4BB0A 3D4IA 5JQGF 4I9EA 1UQTA 3FZYA 1V35A 3EQ6A 221PA 3Q3VA 3ABOB 3ND5A 3OUZA 2XMSA 5TE9A 3I5AA 4YV2A 3FNEA 3QXXA 3EXIB 4XB2A 3VR2D 1DDGA 4BFSA 2FP4B 4Q00A 3X43A 4AYTA 4MWTA 4HLQB 1M5TA 4KLNA 2X9GA 2LR0A 1WUKS 1ATIA 4DC1A 4EY4A 1CFJA 2ONZA 1WMSA 5F9MA 1KO8A 1SXJD 4NFYA 1GG8A 3ORRA 4M22A 4NBWA 3ZX5A 3MA5A 1VB3A 4OQQA 2WHEA 4H18A 4BJ5A 2D1FA 2HTEA 3P0RA 4B94A 4UKDA 1FW8A 4P0QB 4O0MA 1T6YA 4TTPA 2DP4E 4FC8A 5A1JA 2Z2ZA 3TQOA 2YV3A 1X1RA 3AEKA 1Z0JA 5GM2A 4ARIA 1DVRA 4DC9A 1KJZA 4IL5A 1JIKA 4XE5A 4MUMA 3G9UA 5FNVF 1AXGA 3COYA 4P92A 1RAAA 3FPFA 1GGKA 4F60A 5ITZA 1W7AA 1YF3A 1JSLA 5HKKD 3H5VA 5KKNB 4PIVA 2R85A 1XPRA 4ZO9A 3BMQA 3R76A 5GINE 2X0JA 4MS1A 2G9UA 4IIUA 3TBHA 4YMWA 1ZH0A 4RDCA 1MX6A 2LAIA 1E8WA 1ZVKA 1Z9BA 2YZ2A 2PD3A 2HU5A 1T43A 3QXHA 2FX5A 1DKUA 4QQNA 3KAPA 5TPZD 3TW4A 4GI7A 1T4GA 4RE6A 1G38A 1N4QA 1M66A 3H0EA 2NSDA 4TV8B 2NU8A 3L6DA 3KXLA 2FFGA 3KKOA 3IQWA 3DMRA 5BN4B 2VH2A 4BLQA 3IP6A 4I3HA 3N7AA 2ZBGA 1L5JA 1O2DA 2XCUA 4R2KA 5AYVA 3EWIA 1E4EB 4C04A 4Q4JB 3KEZA 5CT8A 1IHBA 3NASA 2VSOE 3R9XB 2EIME 4N5CA 3EF0A 3E34A 4NYJQ 1NVWQ 2R2AA 4EITA 2WYHA 5BXOA 4PAGA 1KP2A 4LXYA 1Y7TA 4C7JA 3HJCA 3OIGA 1NR1A 2IPAB 3FJYA 5D2CA 4W7HA 1RCTE 1EFPA 1UBOS 2YHIB 1BFUA 2BKLA 3TLGA 1BE1A 2AQIA 3CA8A 5BSVA 2J4CA 3FA2A 4ZI3A 1RKUA 2WYIA 4D9GA 4XCQA 4G0ZA 2FN9A 2HQRA 3INGA 4P5PA 2KBXA 3RM3A 4R2HA 2ZBFA 4OFXA 2BEJA 2EQXA 3VYSB 1TCUA 2REQA 2IKQA 3QBEA 4CDNA 4KGVA 1AXRA 4B80A 4HB2A 1DUSA 3CZ4A 3K9FC 3KDAA 3IP3A 3QWIA 4N7BA 3UT6A 3VZCA 1AURA 4OIMA 1SA0B 2ZJZA 3L41A 4GXQA 2GAAA 3LT1A 3NUGA 2YC2C 3K6KA 1DV1A 2NTJA 4AQDA 2PGNA 5CDFA 1GL7A 3UMYA 2A5EA 3WNCA 3BAFA 4HYYA 1NV9A 3U4QB 2VRCA 5UKDA 5IHPA 2BE7A 4MIEA 1H3NA 3WRXC 4BNKA 2IHBA 1BAPA 4U7HA 2W93A 3KZ1E 4ZQGA 2C4HA 3D0KA 1K5PA 2WMNB 3F6QA 4DG5A 3HCPA 3AJ9A 3DWFA 3JTMA 5KJKA 1WHTB 4HN9A 4YACA 5ALOA 4DCVA 1Z5SC 1M0EA 4KO1S 4YV0A 3YASA 3DAFA 3TKYA 3BXXA 2BELA 4LYGA 2ODEA 1DHTA 3ICOA 2ZAMA 5ECYA 3OOSA 2WUVA 5EE5B 5AW2A 1THTA 2AXZA 1CE8A 2IZ5A 4NTZA 1MB0A 2E4YA 4HGZA 5L3QA 1CY4A 3TTYA 5E76A 1DC2A 4KLCA 1Y5RA 3ZXSA 1YDWA 5J47A 4J7WA 3ELYA 4UOZA 4BNVA 3AL2A 1ORHA 2ZR7A 3MINB 3V7UA 4G4JA 5CBPA 4L6AA 4MKIA 2H9AA 3PYLA 3O2NA 2LUOA 3MBIA 2I91A 1WZIA 4UXHA 3K8QA 1V41E 1YT5A 1PZFA 2C92A 3O21A 4QX6A 4OBXA 5IT0A 2IU1A 4NATA 1J9GA 3TWTA 4Z2YA 2ZIGA 3VU8A 4A2PA 1DAIA 3L8EA 3RC8A 4A1GA 3QLVC 1V7PC 2F3UA 3HFSA 3VCXA 3EIWA 3GDWA 5JQGA 2OQRA 4PO3X 2G9ZA 3E27A 1P2GA 4KR9A 1LW7A 4Q3CA 2UYOA 4OD0A 3UJ8A 1YCSB 4XRGA 2GROB 1EHYA 2ZTSA 1WM5A 3ANLA 1TTQB 2RGAA 3JCZA 4LC0A 5LQAA 3U6BA 4PLTA 3T7EA 4DR2B 1X2BA 8MHTA 1KAMA 3K5HA 3OO0A 1HYQA 3GRVA 4XKJA 1PG0A 5EPEA 1SOMA 5BWLA 3DKRA 1GYRA 1KY2A 4QG7A 4NAUA 4NACA 2WWTA 3MGAA 3ND8A 1ZSNA 5GJVC 1Z6PA 8OHMA 1WDYA 4M0FA 2P6RA 3T3MB 1SXPA 3NNDA 1I51A 1JKJB 4G01B 2VZEA 2PM8A 2WNHA 3N5CA 3UJDA 2FSPA 1UZUA 2FGKA 4RKRA 1DTEA 3V3TA 4ZT4A 1X9IA 3EWSA 3MWKA 1MC5A 5KO2A 4GD3Q 2ZIRA 3C1TA 4TZKA 3TR5A 2FE1A 1Z2AA 3OXFA 1ZD8A 3EHQA 3TD2A 4C88A 2REXB 4TYWA 3RRMB 4OI2A 3OQVA 5TQ2A 5LMNB 5HIMA 3L8DA 1R4ZA 2B8NA 1N6PA 3VPCA 4FEEA 1VYUA 4HXYA 4QJ4A 5CA1B 3HEMA 4K9RA 1RQXA 1QO0D 2BP7B 4B87A 1WRBA 1MT3A 1NW8A 4G25A 3TPFA 2WHPB 4XGRA 4YHBA 2EZTA 4FKZA 3AEQA 3VPSA 4DAOA 5LU8A 4Y7CA 2BCEA 1Y8QB 3UY4A 1HDYA 2FN3A 4DF3A 1Z39A 2GEJA 3NGXA 4M0DA 1MEJA 4PONA 4YQFA 1JDBC 2P1DA 4AO6A 1N6OA 1F1JA 2NWQA 2VTVA 3JWEA 1P9NA 1H1TA 3VYUB 3JAMA 1GUZA