4AY7A

Methyltransferase from methanosarcina mazei
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
337
structure length
336
Chain Sequence
b'EFTLKTRLLAALKGEPVDKVPVCSVTQTGIVELMDVVGAPWPEAHTNPELMAKLALANHELSGLEAVRLPYLTVLVEAMGCEINMGTKNRQPSVTGHPYPKDLEGAAVPADLLQRGRIPVVLEAIKIIREKVGPDVPIVGGMEGPVTVASDLVSVKSFMKWSIKKTDLLEQALDIATEASIIYANAMVEAGADVIAIADPVASPDLMSPDSFRQFLKSRLQKFASSVNSVTVLHICGNVNPILSDMADCGFEGLSVEEKIGSAKKGKEVIGTRARLVGNVSSPFTLLPGPVDKIKAEAKEALEGGIDVLAPGCGIAPMTPLENVKALVAARDEFYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLCOBALAMIN\: COENZYME M METHYLTRANSFERASE
molecule tags Transferase
source organism Methanosarcina mazei
publication title Structure of the Corrinoid:Coenzyme M Methyltransferase Mtaa from Methanosarcina Mazei
pubmed doi rcsb
total genus 130
structure length 336
sequence length 337
chains with identical sequence B
ec nomenclature ec 2.1.1.247: [Methyl-Co(III) methylamine-specific corrinoid protein]:coenzyme M
pdb deposition date 2012-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 4ay7A00
4L64A 3PPGA 4L65A 1J93A 1R3VA 1U1UA 1XR2A 3GW3A 1U1HA 4L61A 4AY7A 1R3SA 4AY8A 1R3RA 3GVWA 1R3WA 4QQUA 1R3QA 3BQ6A 1R3YA 4WSHA 1JPKA 3GVVA 1U1JA 1YPXA 3L7RA 1JPHA 3RPDA 2INFA 4ZTXA 3PPFA 3GVQA 3GVRA 1U22A 4L6OA 1XDJA 1JPIA 4ZR8A 2Q71A 4ZTYA 1XPGA 2EJAA 3BQ5A 4EXQA 3PPHA 3PPCA 2NQ5A 3CYVA 1T7LA 3T0CA 3GW0A 4L5ZA 1R3TA 2Q6ZA 4L6HA 1UROA
chains in the Genus database with same CATH superfamily
4MIMA 4JTFA 3BJTA 1FQ0A 4H00A 2FLIA 1U33A 4UUIA 4DELA 3BW4A 4G7FA 2RAGA 2IXVA 4Y8EA 2WZEA 1VPYA 2WNNA 2P88A 2DUXA 4QISA 2PGRA 1NWTA 4C1KA 5RUBA 5F4XA 4YTQA 2J88A 2AAAA 2WVUA 4UWMA 4FMVA 3FS2A 4AAJA 1NF0A 1UWAA 1XQKA 2W3ZA 3VNYA 4ES4A 5J04A 3WBWA 1ICQA 3BGAA 3BAXA 4MY9A 5F2GA 3CQIA 4OKDA 4MHBA 5D8WA 1DJXA 4L65A 3VOIA 4M19A 4MVAA 2CPUA 2RDTA 1JF6A 4DYEA 5A5WA 3UGVA 4PFHA 2QGYA 3IJQA 5CLWA 4AIEA 4LQ1A 4HPNA 2OYKA 1BFNA 3W27A 5HMSA 2R9RA 3FDKA 3LTPA 1W9DM 2Z4GA 4WQ6A 3M0VA 4K37A 3PULA 3ORWA 4UR7A 2C71A 3BCDA 3TFXA 1YDVA 1KGUA 1P0DA 4JX5A 3QMSA 1E6SM 1TJRA 2YDAA 4A3UA 2EG7A 2HVMA 4W7WA 3RLVA 4OUIA 3CASA 4AZGA 2EPMX 1UWIA 4ICNA 2FVKA 4PMYA 4OBTA 1RCQA 3IV8A 3M47A 3C2VA 1GVFA 4E4PA 3HZ3A 5FAGA 3HFTA 4NXKA 1L9WA 1KRCC 3OVQA 3STEA 3IIZA 1RA5A 1W1PA 3TAKA 3JU2A 4IPNB 1KBBA 3KL3A 2O55A 5HA7A 5ABFA 3GVVA 4GIEA 2CLPA 4LV4A 3VIMA 4ZR8A 4X0NA 2XSBA 2ZVRA 4H9VA 2VYOA 4L9ZA 1Q6OA 1NJJA 5E5CA 4MFEA 3UZWA 1HXJA 2XVNA 1QPKA 5FF2A 3WEOA 3ZXWA 4YWIA 3CZJA 1Q3NA 3C2FA 2E1DA 2R1LA 3HPAA 4B5WA 4MWAA 3TUUA 4ADSA 2P5NA 1CECA 2PDJA 4O1AA 1EDGA 3FEQA 3PBVA 4HMNA 3CGTA 1V3IA 4EF9A 2QCDA 3C5QA 5HK4A 3NPVA 3GR4A 2X09A 4A35A 1AG1O 4ZVJA 3ITTA 1R30A 4LALA 1DV7A 2WC3A 3UCCA 2JK2A 2Z25A 3UG5A 1YNQA 3BPWA 2WVVB 4MWAB 4FOJA 1IZCA 3MKVA 4RK8A 1UD2A 1Y8BA 2ZQ0A 1DWAM 1IIHA 1HL8A 2O7SA 3TR2A 1P43A 1F9CA 3RCNA 1TR9A 3DKJA 4TU1A 2VFHA 1XH2A 2QF7A 3BSGA 5E0KA 1SR9A 4GYPC 4QITA 4KRUA 5XIMA 3FDGA 3PBMA 1OG6A 5CBIA 1OSEA 1VHNA 2OXNA 4ONVA 3POHA 1DIDA 4KGJA 4J9JA 1QPNA 1PVNA 2D73A 4J5NA 3GXFA 3ZT6A 2XUCA 1EJVC 4FXRA 1EJWC 3STPA 3N19B 5HJXA 4E2VA 3PZ9A 6REQB 1UWTA 4FP1A 2CHRA 2ZZ5A 1QNRA 4K39A 5FA5A 1QOPA 3DU0A 4IJRA 4DM1A 2YW3A 1O66A 3APTA 5KMYA 3LCGA 5FACA 3KHDA 1LUCA 4NZJA 1TPUA 4PUMA 2E09A 2GVEA 1CYGA 3LHVA 2G95A 5FL1A 4A2SA 1G9HA 3CB8A 3LZ5A 9RUBA 3O6CA 3LQGA 3RHGA 1TUXA 1FA2A 4JFUA 3KOZA 1UWRA 3E38A 3FNDA 5DANA 3RJYA 1WKFA 5HBFA 4MWAE 3HB9A 1CGXA 3UG8A 4MYXA 1NDYA 2PZNA 4WKFA 4HPJA 1XXXA 2YIHA 3H12A 3POCA 3ZSTA 4LRSA 3DKLA 5HNUA 4U10A 1WZMA 3QSRA 3R89A 2OCZA 2V6AA 1XRSA 3CHEA 3LXAA 4B5NA 4QS6A 2IQ0A 3ITXA 4AZCA 2PCQA 3SM0A 3SCOA 3WBAA 5F7UA 2YDRA 4HN4A 1JYNA 4ILSA 3EXSA 4O54A 3TNOA 2WMIA 1MDLA 4E2OA 1IEIA 2JQXA 3NO1A 2J8TA 2VEMA 2NQ5A 4ZL1A 3R8RA 1XYBA 5PTDA 4R33A 3B4UA 3BLFA 3H26A 5HDRA 3FKKA 4UR8A 3WL0A 2YLAA 1TQJA 2A4AA 1J12A 1GQJA 1JD7A 1MXSA 2JF6A 2ZA2A 1R2TA 4U33A 3UWEA 1E55A 4Z2JA 4AZCB 1OCBA 1CI1A 2VNCA 3EWDA 3R25A 3NQBA 1XUUA 1K02A 1ZJAA 3ES8A 5REQA 3AMCA 5C5YA 5DXXA 3M5VA 2ZRYA 1FDYA 1W8SA 3FIGA 1YBQB 3R12A 3H7VA 4ZOEA 4GVHA 4NF7A 3ES7A 4LOCA 2WK2A 2ZVIA 2DQWA 4KEZA 3UCQA 4O50A 2PDGA 4A8RA 1M3UA 4K7YA 5AB3A 1V77A 3WL1A 3TVAA 1I0DA 4PSRA 4J2MA 3W1XA 4C65A 4XD4A 3STFA 4FLOA 3T05A 4PUKA 2HPMA 1A0EA 3W86A 2VTFA 1OX6A 1C8VA 1IWBA 3PSVA 1MFUA 3PY2A 3EDJA 2G4FA 3IUHA 5K4XA 2F7FA 1UROA 3RO6A 4A8IA 4C6NA 2DZSA 1RQBA 3H2OA 4GI6A 1ICSA 4HCDA 4HCHA 3LM7A 3CMGA 2KZHA 1PTDA 5J5DA 5TIMA 4O11A 1SJDA 3VD7A 3Q65A 2G3MA 4Q4QA 1EA9C 1UZ4A 4NU7A 1HKJA 1EC8A 3B40A 4OZOA 3KFTA 3QQ1A 1UIPA 3BOFA 2C19A 1JGMA 4XZHA 2B4GA 3M5YA 3UXLA 3I6RA 3OG2A 3M0IA 1EIXA 2PWHA 4M6QA 3W2NA 1BTCA 5HUOA 4IF2A 1H1ZA 3Q2DA 4DUVA 3IAPA 1SUXA 4ICMA 1OGGA 1DWFM 5GNXA 1EGZA 3BURA 4N42A 4Q8MA 3M0ZA 4HMCA 2OQHA 4GIAA 1TE1A 2QCEA 4XK2A 4N6EA 3HM7A 4ZE5A 2O4MA 5LGXA 1VH7A 1DIOA 3BCFA 4NKCA 1UR9A 5A8GA 5JIWA 1L6SA 4QEHA 4ZO6A 1KLYA 1WZLA 5EY5A 4DI8A 1W1ZA 1FWSA 2RGLA 4JOMA 4Q8QA 4L9YA 1VQTA 3MP5A 2XIQA 1GORA 3T4WA 4PUWA 3LNMA 2VX7A 1MXGA 3LCIA 1Q6DA 3OLGA 5LIKX 3LPGA 3TCSA 1H2JA 3R6IA 2GSJA 5GJPA 4PC8A 4HQVA 4HJWA 3L4YA 4DO4A 3GX9A 4XAGA 4Z1CA 3W72A 4BZYA 1BXBA 2VELA 1VS1A 3PPGA 1KM3A 2QUNA 2OFJA 1PJ9A 2NQZA 3GUWA 4CD6A 1JDAA 1VYSX 2QPSA 1GUVA 2EBNA 3OZMA 4DF0A 4PB5A 1TREA 1B31A 2FTWA 2WJZA 4ACYA 2H3DA 1V6WA 2J6XA 1W1B1 2FHBA 2WZIA 2YX0A 3W7NA 4GUFA 4H4IA 4A6GA 3P0WA 3H4XA 3RU8X 1ISXA 2VCAA 1FHUA 5C6MA 1PSCA 2HCVA 2VRJA 1D7KA 2DT1A 3N9KA 4IIFA 1XV8A 2VX6A 3OIHA 3THQA 1AW5A 1VFSA 4M51A 4AQLA 4P8VA 4AW7A 1SW7A 1G0CA 5FF4A 1PDZA 1E1CB 5AHLA 1SJBA 2EEXA 3SUSA 3D5HA 3V75A 1V79A 3G0XA 1IEVA 1H0IA 3FY1A 4LWWA 1XF0A 3VIPA 2C15A 7ODCA 4LYQA 2PDNA 3CIWA 5DMNA 3ABRA 4H2CA 4GQ0A 3R94A 1YXCA 2Z1KA 4ZQCA 1XLKA 4HSHA 2EPNA 1KWGA 1CXLA 3S6OA 3LU2A 4HYWA 3ARRA 4F66A 4KKXA 7A3HA 2ABBA 3SGUA 5DT5A 2EKCA 3DFTA 4LYRA 2ZYFA 3VIOA 3TW9A 5AC8A 1IZKA 2CLOA 3BV7A 2F9RA 4KRTA 2PZ0A 3NR0A 2Y4SA 3MZNA 1LQAA 3A23A 2GK1B 4NT0A 2Z1SA 3TJ4A 2NXGA 1U1UA 2BDQA 4GCAA 5EFDA 1E0VA 1OZMA 2OB3A 4AZ5A 2ZRWA 3CV6A 1KKRA 4YU1A 1BKSA 2I5GA 2VX5A 4O10A 2W63A 1SO6A 3O1NA 4Q32A 2NLYA 1WZKA 2GJPA 1JCTA 4YIWA 5CGTA 1E4IA 1WXYA 1ONXA 3ELFA 2VR2A 4NHVA 4ATDA 3UJSA 3VOJA 4Q4MA 3ZWTA 2YBUA 4JICA 3IGXA 3VOHA 3N73A 3QJAA 4WKHA 3WLOA 1XLDA 3A9IA 4LUTA 1TPEA 2A3EA 4I9MA 1ISZA 3PFMA 1EX5A 2HZGA 2FMNA 3WLTA 7REQA 3ZFHA 3PFRA 1KFBA 2A3HA 3PC0A 4JTTA 3DEQA 4YVXA 2PDMA 1K6WA 2WKLA 2VCBA 2ZA3A 2NV1A 1YE6A 4GG9A 2Y2WA 4TX9A 2OZ3A 4LVGA 4WKAA 3CUGA 4BQ4A 3UYIA 3TQ0A 3TR9A 4YTSA 1PZ0A 2Y85A 2VC7A 4HU4A 4AG0A 1ME8A 2HROA 5CH9A 1P4CA 1KXHA 1FWCC 1S5VA 3KOFA 3ZJKA 3VI2A 4L4PA 2PRLA 2G5WA 3LYEA 5F4WA 4LY8A 3VIHA 3OO2A 3FSTA 4AEFA 1Y5VA 3AMDA 1TX0A 1W3HA 3CUHA 1RBLA 1C9WA 4YVPA 3ZWSA 4UQBA 4DWSC 2Q3RA 4NAFB 4IMDA 1HVQA 4XB3A 2QAFA 3VABA 2DH2A 4CU8A 1QPQA 3IJ9A 2NX3A 3S9YA 1UP3A 1LYXA 3A3XA 4B5SA 2AOSA 5D02A 1SFTA 1US0A 3NXLA 2V5LA 2XIIA 1K4HA 1UH2A 4HGXA 4MG4A 2VZUA 4JL2A 3FJ6A 1Q6CA 3TH6A 2YA0A 2EHHA 2A6NA 4J28A 1ESWA 4D71A 3K4WA 5CQ1A 3H24A 5EB8A 4KCWA 3GR8A 4GD0A 4CQDA 1F6PA 2WNQA 3E5BA 2P8BA 1Y5XA 2IMRA 3EKLA 5FI8A 2AQVA 5CPQA 1NP2A 2V2HA 1JPIA 4AC1X 4D6GA 4H8NA 2GOKA 1LDCA 1QWGA 4PMUA 3WQCA 4U2YA 1I1XA 3QKEA 3PZOA 4W8AA 1IWAA 2ZRZA 2HPIA 3BDKA 4F3HA 3V0SA 3FAXA 2VUNA 2D69A 3SCUA 3UR5A 3D3AA 1RV8A 1GTEA 3QKZA 1W6TA 1HNYA 2E67A 4HTBA 5BXPA 2C1HA 2GUBA 3CZGA 2BHUA 2PTYA 3SSZA 4E2DA 4JN7A 1J01A 3NQFA 4TX8A 3T40A 1W32A 4CVWA 3S1XA 4BA0A 1J2WA 4H8VA 2IPGA 4UFMA 1EYEA 2WCSA 1VYRA 1FXPA 2Q71A 4H7CA 1KFCA 2RHGA 5TF0A 4NNCA 4C5ZA 3GC2A 1HKMA 2GWNA 2POZA 3KBNA 4KEVA 3H55A 2BFGA 2Y8VA 3VX1A 4IX2A 2PGWA 4K8GA 2Y1HA 2W5FA 1PO9A 3FHAA 2ZDSA 4CQBA 5BXTA 4C6FA 1V7AA 1P1XA 3DYMA 3U5UA 4NAEB 3QSTA 4JAWA 4AD3A 5SWUA 3A4AA 1W17A 3GNXA 1OM0A 4KERA 2Z26A 3QXBA 1GOKA 3UR2A 2FQIA 3KCJA 2OSWA 1TV4A 4DJED 1MVYA 1BYAA 1LF1A 5ABGA 4RLIA 4V1YA 3O7UA 3OIXA 5CJMA 1KGXA 1ME7A 3UNTA 4QE5A 3NQ8A 2QMKA 2QCNA 4E38A 3MUIA 3NQ6A 4K68A 3BAYA 4NQ1A 1JCXA 4QP0A 1EC9A 4J2PA 1KBKA 1JL8A 3ARSA 3DFYA 2YCKX 4REQB 1P5BA 3WNMA 1SZRA 3UEQA 4B90A 4ENLA 2WVSA 3KX6A 4WK9A 1BEUA 1A4MA 5BU6A 1BVWA 3VZYA 3E6EA 1JDDA 1E0WA 2J62A 3WDJA 3MSRA 3II1A 2PD5A 5HULA 4ALDA 4O16A 1K9DA 4MF4A 1G4EA 4U3AA 3Q94A 2TRSA 3TONA 3VD4A 1GG0A 1TTPA 3WK1A 1KRBC 1TCDA 2CESA 4R53A 1CGWA 3R2GA 3CLWA 3WUEA 3NDOA 4F0SA 1RJPA 3P8JA 4C7GA 2BXZA 2NSXA 5EMMA 1B2YA 2V82A 3CEUA 2PLJA 3N6QA 4B9ZA 1V0NA 4KT2A 4PTWA 6XIAA 3UXKA 5FF0A 2RJHA 3AHVA 2BGQA 3TU9A 5HINA 3W71A 4XSLA 2CWNA 3OBEA 2NWSA 3W81A 3AWOA 3KWSA 1JCJA 3CPRA 4PMOA 4XIAA 3C0LA 1DJZA 2XG9A 1E0UA 1KXQA 2YR1A 4R27A 3BMXA 3B8SA 3LEPA 1EGVA 1C8QA 2OYMA 2VURA 1E9YB 1MI3A 1VIWA 1AH0A 4H9XA 3MHFA 4FR6A 5M1TA 2CCRA 4QTGA 4P7NA 1ZS2A 2VFGA 3SJNA 3W7DA 3GW3A 4Y9AA 4JEQA 4JNZA 1J0YA 3M0YA 4AYGA 1M04A 3INPA 4YCPA 4R7JA 3PVFA 4IZGA 2PGEA 1E5NA 2OODA 3LQLA 4BI6A 1J0HA 4H9YA 2Z24A 4QLKA 4GXPA 3NM1A 5EU9A 2AQOA 3MVTA 3VUSA 2YCLA 2WSQA 3EWCA 3NSXA 2B7OA 2CZDA 2YSWA 3AHTA 4DYKA 2OMAA 1XIFA 1D3HA 1Q65A 2OU4A 5HQLA 5TD4A 4O12A 3IACA 3MY9A 1ZPTA 3EZ4A 3IANA 3T0CA 3S9IA 1W9XA 4GZIA 1LQ0A 3BL3A 2DSVA 3DFNA 2HISA 2ZE0A 3ZVIA 4B4HA 3J7HA 1SMAA 4DJDC 3N11A 1H7PA 3LERA 4QXIA 2HS8A 1VC4A 3PAOA 1TA3A 3JZUA 4UBPC 4JQ4A 3TTQA 5A6SA 2JF7A 1HW6A 4W85A 2O9RA 1W2VA 1W1TA 2ACQA 3G8EA 4BFAA 4J7RA 4CQ9A 2EAWA 4F0MA 4JCMA 4NY2A 4QE4A 2OWWA 1IXNA 4S3DA 1OIFA 4Q7NA 2OQYA 2H6RA 3PWGA 4NXSA 3LGEA 2ZIDA 1H7RA 4IX0A 4O1BA 3OA3A 3B0UX 3VCNA 1VCGA 2WPGA 5BRBA 3H2FA 4TVCA 1W3NA 2V9DA 4CQ8A 3SUUA 3VNDA 2A85A 3LRKA 2E3ZA 3CUJA 4S2BA 1VFFA 4EF8A 5LNUA 3A12A 3W76A 3PTQA 1V6TA 4AF0B 3EX6A 3RLUA 3TMQA 2XFFA 4QLJA 1FKWA 1JD9A 1E43A 1NEYA 4IICA 3TMLA 1ECQA 4PRWA 2BG5A 1IE7C 1EO5A 1B54A 2VGGA 1EF2A 1NP0A 4FS9A 4JNYA 3GDMA 3GTNA 3W83A 2EPOA 5A6KA 3FGCA 3MI6A 2CERA 2WCGA 3CHVA 3DESA 1EHAA 4LSBA 1FWWA 3EWZA 1J0IA 4X9YA 1D9EA 4NX0A 2X1TA 3KP0A 1XPGA 4GYKA 2ZUMA 2LLEA 2J78A 4BI7A 4IMFA 4JTAA 1KGWA 4LT9A 3VDCA 3DDMA 1XD1A 2EO7A 2NXHA 4PA8A 6TIMA 1VD6A 3NG3A 3UZYA 2OR2A 1JZ6A 4IIBA 5LIYX 3C8NA 4B5XA 3AI0A 1XQLA 3DC8A 1ENUA 4JR5A 4RNHA 1UWQA 4AHPA 3VTRA 3GY1A 1XH0A 3VNJA 3VOGA 3OW1A 3U4FA 3OHIA 3BXWA 4P7OA 5E9AA 2FHFA 3E0FA 3E49A 4FNTA 3VIJA 4GPNA 5F2IA 5ABHA 2PTDA 4QSFA 2D2JA 4K2SA 1X98A 1E0XA 1LRTA 3T8LA 2NSOA 1M01A 3VCRA 1VRDA 2QHAA 5AYIA 4GO9A 4AZBA 1IQ8A 3TJIA 4X2RA 2EPLX 2O56A 4O28A 3E5PA 2ESCA 3IK4A 5C55A 3H4GA 4OBRA 1R9ZA 5C7VA 3W2LA 4AWEA 1CDGA 1JI2A 1ZUAX 4DPQA 3HV9A 3WELA 4BJHA 2L5HA 1O95A 1E70M 2WWDA 1HN1A 4H04A 1J79A 1WUEA 3WJSA 1QBBA 3VKCA 3P84A 3RRXA 5DLCA 3VDBA 3BOXA 2AL2A 3CHFA 3GM8A 3P82A 4HK6A 3NOEA 1E3XA 1R0MA 2VCCA 2O0TA 3P80A 4LW7A 3WBXA 5M17A 3NAVA 3F4DA 4JY9A 4L64A 3BAWA 4XV0A 5DRIA 1GW9A 4O8RA 3OPSA 3DI1A 3UXDA 1EGMA 4XAZA 4AYSA 4DLMA 1S2VA 3ZIZA 3ZQ9A 4P2VA 2V67A 1DTNA 1PCWA 3BQ5A 1M68A 4MUZA 1SQ7A 3G1YA 3VU2A 3GXTA 2EPKX 2CLHA 3LOTA 2VVNA 1BSLA 4HNCA 3AYVA 1FVPA 1J0JA 4PMQA 4Q8UA 4IGMA 1L6FA 1LOSA 2WWCA 4OU1A 1OGBA 2YL8A 2Z2UA 2GGGA 5I3KA 1W9UA 3VMOA 3THAA 1MW3A 2E68A 1WDQA 3W7HA 3EPOA 3ZR6A 2BY2A 1NQKA 3HQPA 4HZ7A 4EAYA 1QI4A 1IXOA 2H90A 1QK2A 2GQ9A 2PWFA 3LPPA 1XYLA 1PZ3A 4PRRA 3QGKC 1SFSA 1TV2A 2ZX6A 1XYAA 1SZFA 4ZB5A 3BG5A 1OBAA 3KW3A 1E6XM 1AMYA 1CXHA 2F84A 1PX4A 4FAMA 3U2EA 5A2AA 5CAHA 3MBFA 1EXPA 4EKJA 1VBGA 2A6LA 3FVMA 1WV2A 4PULA 3OGRA 2WVTA 4S38A 1K9FA 1W3TA 2BOEX 1OYCA 2DJXA 2YXOA 4F2UA 2QCLA 4V15A 5I78A 2GJXA 1LWHA 1RBOB 2QVHA 4RR4A 1ONWA 3AISA 2WZTA 1GHSA 3VA8A 3N12A 4A8LA 3AMGA 3PWAA 4YNGA 2O9TA 2D3LA 3PJUA 2NT0A 1GVYA 1E9IA 2NV2A 3RO8A 3PR2A 3PTMA 4WLCA 4F4RA 1H0GA 3CAQA 3L68A 1E71M 4MNLA 2QYGA 4F0HA 5GJNA 3QHOA 5EL1A 4GY7A 1CZ1A 3OJGA 4PUNA 3WMCA 1OD0A 2V5JA 3RM8A 2P76A 2GJXB 2VO5A 3NM3A 1PZ2A 1KCKA 2EG6A 1YDNA 2GZXA 4Y6GA 4C7DA 1VCVA 1AW1A 3WLSA 5I02A 3KLLA 3NQCA 2DVTA 3UZZA 1K8XA 4UOQA 4I6KA 3LTSA 3MMUA 1PDYA 1GJUA 2WJEA 1DYSA 1G01A 1XPYA 4J4KA 3B8DA 1CLVA 4AX7A 4AY7A 3QPZA 2OLAA 1R3WA 3CL8A 1CIUA 4IL2A 4D6CA 3MMDA 5HNNA 3UBPC 4EVZA 4LH8A 5L9FA 1WDRA 1RHCA 1MSSA 1V3LA 2ACUA 3PUGA 5FKYA 3URAA 3GG1A 1EXBA 2ISVA 2A79A 5BXSA 5C8BB 4RNJA 4HU0A 1ZU8A 2OELA 3VKAA 3NZRA 1GYMA 4FNQA 1POKA 5DMMA 1GZGA 4J3TA 3SEPA 1QWKA 3LN3A 3W7EA 3CJPA 2VZVA 4CD5A 3ANVA 2BSLA 1HP5A 1UUOA 4GISA 4IUGA 5DQPA 2Q8ZA 3FJNA 3QW4B 1DIKA 2YLLA 2CWXA 3WLHA 3MPGA 4PUUA 4IL0A 1K1DA 4HA4A 4B4FA 1G4TA 1RD6A 4HVXA 1XIHA 4WJ8A 1ADOA 3AHZA 5G4WA 3NGJA 1IT0A 2YFNA 3GVWA 3W70A 3DOPA 3N25A 4RE0A 3SZ8A 1QHPA 3BC9A 5H8UA 4JIHA 1S2UA 4W5ZA 1DXFA 1IF2A 4UTIA 3M46A 1QPOA 2DDXA 2W92A 3IGSA 1BXNA 3GG8A 3E2SA 2OLSA 4F9DA 4JTLA 2PEVA 3UA4A 1TIWA 2D22A 3WN6A 2DZBA 3SCVA 5G4EA 4GY1A 5BRQA 2G41A 4RW5A 3ZT7A 2VD8A 3HPZA 4RCXA 3UJFA 5ECVA 3ZJ8A 4ICCX 1EJUC 5IBXC 3RFAA 4GZEA 3FA3A 1W5MA 1X38A 4JS3A 4L7ZA 2A7NA 2XINA 2D23A 3CPUA 4O8AA 3S2LA 3GHTA 1YEYA 1ZSXA 5C2XA 5FL0A 1Z3NA 1UQYA 4AD4A 2VMFA 2HTMA 2BLEA 2FZNA 2IKHA 1O68A 1P48A 2WV8A 1TPVA 3K30A 4XTDA 3SJ3A 2P3EA 5ABEA 3AZSA 5HJLA 1VFUA 3RGTA 2W67A 3OYXA 2ZRUA 3ERPA 3PBWA 3GHUA 3TCEA 3CWOX 2GLKA 1A49A 3L66A 3NCOA 3N13A 1Q63A 3A5VA 1RP8A 1J0KA 4IP5A 2E6FA 2YB1A 3F1QA 4RDZA 2W61A 4H41A 1TV7A 1Q7MA 1T41A 3HMCA 3CL6A 1CENA 1U22A 4ZBCA 1H1NA 5D04C 4NJGA 1RBAA 1OVDA 3HPXA 3E3HA 4BEQA 3B9OA 3NPXA 3WQVA 1ZBVA 4AY8A 1GWJA 1HTIA 2E9BA 1FWRA 3W1LA 4E3VA 3AS2A 2PRHA 3L9CA 3S2NA 2VXNA 3EOUA 2IPJA 3V16A 5BWFA 2ZUUA 3OGVA 5AHEA 2GVYA 2BVDA 3QH2A 3OZOA 1IGWA 1K77A 3AXHA 2VGIA 4QBXA 5K2ZA 1WBJA 4FX8A 2GGIA 1BXCA 2QJNA 1QDSA 2BVYA 3W9ZA 3VKJA 1BYBA 4G1NA 3FA4A 3G77A 1BAGA 2OX4A 4X3ZA 3URBA 1W3LA 3ICJA 1QXLA 2DP3A 4CCDA 3BVJA 1PKNA 3VYLA 3K4AA 2WW5A 3RRAA 4PBEA 3RAOA 4Z2HA 3NNTA 3GQYA 1XS2A 3O0KA 2ATSA 3C0JA 1JNEA 3A64A 3O6AA 5AHNA 3CS2A 4QNWA 4PGLA 4M0XA 4NJKA 1XBXA 4FLQA 3AS3A 1UUMA 2PCEA 4DI9A 1MRQA 2P1FA 1AVAA 2VHLA 3G1XA 2HS6A 4RE3A 4KESA 2HK1A 3FJLA 2HE8A 3NIYA 1MQQA 1MNZA 3OZPA 4A3YA 1U1HA 3UY7A 1CGUA 3ALFA 2DU2A 3CUIA 4PUEA 3PUOA 6REQA 3ATZA 4QG9A 4WDWA 1D2KA 1XIIA 3I65A 4ROQA 2QCGA 1XLMA 2DH3A 2GVJA 5AC7A 5C9RA 1WNOA 1KR0A 2ZZ7A 1A3HA 4Y8FA 4FF7A 3SFKA 3CXOA 3GHSA 1A3XA 4ATWA 1OCQA 4LVBA 4DJFC 1OCNA 1TMHA 1Y7VA 3FAWA 4KMQA 4I5XA 2WSKA 3I4EA 1UASA 4GE8A 5FJIA 1DHKA 3WH9A 3TYUA 2RGMA 3GG0A 3T42A 3U2OA 1W31A 3VINA 1RD5A 1GK8A 4TR9A 4O19A 4A05A 5KZ6A 1B1YA 3UWYA 5IDIA 2PBGA 1JFHA 1TIMA 4QDPA 4C6QA 4RL3A 3ZT5A 2QDHA 5DMYA 1UWSA 4QIUA 4LXFA 3MYOA 1QHZA 3BGGA 1PWLA 3DX5A 5A94A 3W2KA 3MO7A 3NQ7A 3WLNA 4C6BA 2E5CA 5CPTA 4ZSUA 2PWEA 1TG7A 2OTDA 4IOTA 5ENLA 1A5MC 1B9ZA 3K4DA 5KSWA 1UD4A 3W7QA 1QRQA 1ITXA 5B7ZA 2ZUTA 3VCCA 3GNOA 3H70A 5K9DA 1OEPA 1DJWA 4HHHA 3AQUA 2WSRA 4RNFA 1AMKA 3BARA 4LBRA 2R1NA 1Y65A 5D9NA 4AZ7A 1FHVA 3OZYA 2QULA 4GRSA 2QCHA 1FH7A 3LRMA 2XGZA 1R3SA 3M4HA 1W1YA 2ZZ2A 1Z42A 3UP8A 3NA8A 3ARYA 1XBYA 1PIGA 1O4UA 2VX4A 4QGCA 2Z6IA 3W88A 3IVUA 1IT7A 2FVMA 5AYXA 1KFEA 3PZNA 1A47A 8A3HA 1M1BA 4EIVA 5LNVA 2JBMA 3GTFA 1JPMA 2V38A 3EMCA 3QPYA 4EPBC 1V3HA 4P8UA 3FXYA 1LT7A 3LMZA 1E6PA 1Q4NX 1KR1A 3B4YA 2OG9A 1H7XA 3U7BA 4Q4SA 2W27A 2P8CA 1RXOB 4BCEA 2C18A 1ADSA 5BZAA 1EIBA 1E1EA 4UFKA 3WQ5A 2XSXA 4XKYB 3VPLA 1L2UA 3SDOA 3VILA 4AEEA 1O94A 3PP7A 2J7FA 2I5IA 4NNAA 1FWFC 1EJRC 3VDAA 2BHYA 3N34A 4HBKA 3L0GA 4NNBA 4ZQOA 2XN2A 4H6KA 4AH7A 1P6WA 3SRKA 2ZTKA 1IR2A 4DBDA 2PFHA 5BMWA 3H22A 4L80A 1GNXA 2FZBA 4K1WA 3KS6A 2YW4A 5CC3A 1XICA 2PU1A 1YYAA 5HPCA 4MNKA 3EWYA 3M7SA 2YA2A 3W00A 3WDHA 3QOKA 1WAWA 2XGBA 1HL9A 5DCDA 3S1WA 3G5EA 4HZMA 2QJHA 1SZNA 3W4RA 1F3WA 4AVOA 1TELA 1PS9A 3USZA 4HU3A 2GGEA 3BG3A 3TA6A 4J1OA 2WC7A 3PB0A 4RV8A 3W37A 1G7UA 3A24A 1F6KA 5BWAA 1C8YA 2B7PA 3FYOA 4A8NA 2Q09A 2V68A 3AIWA 4GQQA 4PMNA 1B3WA 1R5YA 1HJVA 3N9RA 1XG3A 2P0IA 4HPHA 2YCIX 1FWDC 2PC8A 5E0CA 3FVDA 3LCXA 1J96A 1LUCB 2Z1WA 3AIQA 3T44A 4JKLA 3MANA 1JZ7A 4C1LA 4AX6A 1OFPA 2CBVA 5JH1A 3VGBA 3WD2A 1A0CA 1XYCA 3UWQA 1UB3A 2PDCA 4QROA 4Q7IA 5A6BA 2FJUB 1BGAA 4M7SA 2GVLA 3KWXA 3MO4A 3LRLA 4U5IA 1HT6A 2V5BA 1GJWA 2OWCA 4IIHA 5DN1A 5FESA 3THCA 4PYSA 3ZVHB 4Z1BA 2WLYA 4GKLA 4HMEA 3LUTA 4B16A 1MW1A 2J7DA 1M7XA 1UKPA 2I7GA 4IIDA 4MPQA 5I00A 2QIWA 3EX2A 3G1RA 4ERAA 3WQOA 4MNJA 2VQTA 2VFFA 2BB0A 3M41A 3APYA 5L6UA 3TX9A 4FK9A 3PB2A 5EGRA 4TMBA 4GQGA 2OSXA 3M0LA 5IHRA 1DTUA 3NEVA 1NFPA 4LV9A 2QUTA 5G1TA 4AFYA 2V2DA 3WLJA 4BF7A 4EXAA 4OVXA 3HQ1A 2X2YA 3MZ2A 2AL2B 1OT2A 1V3JA 4R34A 1LLOA 3EWBX 1W3KA 1EBHA 2FDMA 4MADA 2XH2A 1LP6A 5JBEA 4NVTA 1J10A 1SYTA 2XZ7A 4L61A 3IJIA 2VEGA 3BJFA 1J8VA 5AHFA 3GAYA 4JTHA 4DXKA 1JPKA 3GYEA 1YTEA 3RUBL 1JYVA 1XP3A 4Z2IA 4HD5A 1TJ2A 4QG6A 2QT3A 3EX3A 5JXQA 4GYFA 3RILA 1E72M 4LVDA 2PAJA 3WFZA 9XIAA 3AIBA 2QLYA 4AUBA 2BODX 1CGTA 1N8IA 5CSUA 1UA7A 3P0XA 5DY2A 3WZ0E 2FTPA 2A5HA 2X1SA 3URQA 4J3UA 3TYEA 1WXJA 3I3DA 4A22A 2DW7A 2C0HA 3LLXA 3E9AA 3OA5A 1H62A 3ZOAA 2BY0A 2OO0A 2ACSA 2JALA 5A6TC 1GG1A 2V81A 1WZAA 1GCYA 4BY3A 3BQ6A 5MHBA 1KBJA 2FFCA 3L7RA 3WKZA 3VD9A 3PJXA 2QW5A 2DV0A 3DAQA 3PWIA 3RR1A 3U48A 1R8LA 1O12A 1B3VA 1L6GA 4K8HA 5D9PA 3T78A 2C1GA 4UNLA 1F3TA 4JDBA 3G24A 1I2RA 2J27A 4TQTA 5FSEC 1KW1A 4LVAA 4CUCA 3LK6A 3MQTA 4K7VA 3WF3A 1Z32X 3KBJA 2V3GA 1C29A 2ZADA 4GQBA 3QR1A 1DWIM 3W7GA 1AW2A 4AHQA 5M2FX 4ZO9A 3W84A 2NQLA 1FHDA 1HL2A 1XH1A 1ZBWA 4S3CA 2V5DA 4US5D 4QE1A 3LCLA 3TYAA 1UR0A 1VFMA 4W8LA 2BNJA 3VO0A 1K9TA 1ZNNA 2HNEA 3AIVA 3NVDA 2BX7A 2X30A 1QOXA 3LDVA 1BSIA 4GX9A 3B05A 1EQCA 5C9XA 1Z6KA 2JGYA 5FSDC 2E8YA 5AYBA 1UKTA 3TK7A 2W91A 5KZEA 2WAGA 3WF2A 1RUSA 2E9MA 3CB3A 4MMWA 3M43A 2VFDA 3BW2A 3I6TA 3C3UA 1VYPX 3SCNA 3P74A 1SPQA 3D3FA 1F05A 7REQB 1FCVA 4Q4PA 1YLVA 3V5OA 3EKZA 2CIPA 1LCOA 3WH6A 1P7TB 3N9SA 5C54A 4XKYA 5K3VA 3DECA 4I7VA 4JQ1A 2GWGA 2Y24A 2ANUA 1V6XA 1TA3B 2WLZA 4FB7A 3LTYA 3T9PA 1R3QA 2XISA 3HG3A 5IFPA 3LNPA 1GOXA 6TAAA 1BG9A 1EPXA 4EWND 4FF5A 5G1YA 1UA3A 3UJRA 1AL8A 3W29A 4GIYA 4PTMA 4EOUA 1FTXA 2CBUA 1Q6LA 1RVKA 4Z2KA 2VUYA 4LAOA 2FIQA 3VE9A 3ANYA 4D8ZA 3K8MA 4IQLA 4F0KA 3FSUA 3TW7A 5AC4A 2ZX5A 3VIKA 2CC0A 4XAYA 4RZ6A 5FEPA 4WGHA 5DBTA 4JTQA 3CQHA 3FHQA 3WLMA 3TQVA 2DORA 2A1YA 1YNPA 2WQPA 3OGSA 2NVDA 1S2CA 4PRTA 4QFUA 3MUCA 1WPCA 5CPMA 4Z2LA 3GBEA 4L1XA 3QR0A 4W88A 5GPRA 1LQ2A 3QGVA 3PZGA 3UCDA 4LYKA 3I3BA 5DRCA 5F1VA 3T0BA 1JRCA 3F5JA 4B91A 3G1SA 1FWAC 2YCJA 4MJMA 4QS5A 3TN6A 5IHSA 2RDXA 4IMAA 1JIBA 1P0KA 1X6NA 4A21A 3LCHA 3BLEA 2PDKA 1OIMA 1AQ0A 2X41A 1OB0A 1W91A 4DUXA 5LNWA 3UESA 2EXOA 5CPSA 4S3EA 2Z7KA 4LCSA 3HIJA 4JQAA 2CETA 4ROPA 3DHUA 2UZ9A 3LX9A 5JQ9A 3MA8A 2QUMA 4TO8A 1CPUA 2CLEA 2VP8A 1ICPA 4Q4KA 1DEDA 4HSOA 1KKOA 4U28A 4JD4A 1C7SA 3WMSA 3F4CA 1MDRA 4L4OA 3W38A 2PC4A 3AC0A 1UP0A 2A21A 3WLLA 3DHDA 5DBUA 5A95A 2BP1A 2C3ZA 1OD8A 2ZC8A 1JDEA 4GNKB 3SQMA 3AMLA 4HZ8A 3W6LA 4X22A 1YXDA 1NAL1 8XIMA 4JDYA 2V5KA 3RITA 4DUOA 3WEZA 1AODA 2VM8A 3KDNA 1V93A 3HV8A 1G1YA 1UKSA 2HK0A 2PI6A 5HR7A 2I16A 2PLKA 1N7KA 4O1EA 4AIOA 3URNA 4DBEA 4J3WA 2DW6A 3UG3A 2XHYA 2Y0FA 2Y8KA 1X6LA 4E0CA 2AMGA 3KRBA 4NZ4A 4YHGA 3I7QA 4PBGA 4NRRA 3W02A 1JEZA 2PD9A 3SI9A 3W3OA 2FGLA 3TXVA 3BUVA 3NEHA 4XQ6A 1EWEA 4M81A 1EZ2A 3B97A 1CBGA 3MB9A 3BAJA 4EANA 1GPWA 2P10A 3DHPA 1QJWA 1TR1A 4X0VA 1JI1A 1MRAA 3GU1A 1ML1A 2OOGA 1A5LC 2I57A 3WUGA 4ACZB 2AKZA 1HJUA 3L23A 2F2HA 4N9EA 3FXGA 3JZEA 3O07A 2FZMA 3T81A 4QX4A 2QIIA 1Z44A 3UXIA 1DOSA 8XIAA 1TV3A 1C8XA 2PBOA 2BOGX 1M7OA 2DZUA 4U5KA 5TNVA 4C1NB 3EDFA 4QJ3B 1LM1A 1WA3A 3TOPA 1I2NA 1IIGA 1JUBA 2HMCA 1AQHA 1QW8A 3WUBA 2PF0A 1ZHAA 2WBGA 4QG8A 4JFSA 1RSCA 1GQIA 2TSYA 2WM0A 8CGTA 4S3JA 1DQUA 4UR9A 3S5SA 1KXTA 5FCZA 3RR4A 2DZVA 3ZR4A 3AALA 4JN6A 1UZDA 5EYWA 3MCMA 2FZDA 5KETA 1QT1A 1SR0A 2D20A 3NSNA 3BSMA 4YWSA 1ZJBA 5HQEA 1JDCA 3TTOA 1EC7A 1EDQA 4FI4A 3WNKA 3CMJA 2EJAA 5U7SA 3SN0A 1R2RA 1T8QA 2BASA 4R9XA 3PANA 4OOZA 1FFRA 5I6SA 4FXSA 4PCTA 4GIRA 3KBSA 4WOZA 3HJEA 4QJ1A 4GC3A 2VVSA 3A3HA 3W28A 2R14A 1BWLA 5CGMA 1KC7A 1F4AA 4GY0A 3NYZA 3NXFA 3ZLFA 1X1NA 1AUSL 2WKJA 4LVFA 4EACA 4QSHA 1HZYA 4R88A 4KETA 5AHIA 4XO7A 3N2OA 5EPDA 3IVTA 4IXHA 4CD4A 4KRZA 4HPGA 1JPHA 5I3JA 1EUNA 3W1AA 4KCUA 4TUFA 4ADTA 3P14A 3ZLGA 3LCWA 3U2ZA 3T55A 1NIUA 2VOTA 3H2MA 1HJSA 2CYGA 2WSPA 3S9ZA 2F6UA 1LOQA 5D37A 5TAOA 3C61A 4QAWA 2IS7A 1C93A 4GLEA 2G0WA 1VHCA 3RYSA 2I1OA 3S8HA 1V5XA 4S2CA 3AJ7A 3LI1A 2XM2A 4H6EA 2XVGA 4LUTB 5D2XA 3SUVA 3W2JA 3WK2A 1Z7AA 1FUYA 3EA2A 5AVHA 3WCZA 2ISWA 4TXEA 3TSDA 3HU7A 3SY8A 2WQDA 1X6UA 1O5KA 4Q7BA 1PYFA 3N2TA 3SCSA 1UD5A 1IZJA 1VBJA 2RH9A 1LROA 4ZSTA 2J9YA 3C2EA 1REQB 1XCFA 4XVEA 2FMOA 1V3KA 2YCLB 4HPXA 1KM6A 3I68A 2YL9A 1TPC1 1H5VA 1EJSC 4IMEA 1JYWA 3PPHA 3W7MA 3VAVA 1Z69A 5XINA 4QJ5B 3L4ZA 4WY0A 2A3AA 3V5FA 1QNOA 1LWJA 4Q6JA 1V51A 4LEFA 5C0QA 1X1ZA 3EOEA 4LB3A 4MKVA 4W9TA 1K7XA 3PHAA 3AROA 3ABXA 2R24A 3T4CA 2F6XA 4JKMA 3WFLA 1XGZA 2E6AA 1IEXA 3P8IA 5E93A 5CG0A 3EBVA 3NZQA 3CIVA 4MB3A 4WCJA 4IISA 5HNRA 1N82A 4LU0A 5J8LA 2QJMA 4PMZA 4QJ4B 2WBKA 3H53A 1FWGC 2NT1A 3NO3A 3ATYA 3ABOA 3PZIA 5HJYA 2IKGA 1XSKA 3GNNA 2W79A 2Q6ZA 4MYAA 1B3ZA 4LCRA 1C9DA 3CH0A 3WNLA 3PAJA 3VC5A 1RAKA 4IQDA 1I0BA 2BTMA 2BV9A 3E2QA 2PB1A 3TIMA 2XM1A 4UTTC 4D8AA 2YBTA 4KH2A 3O2LA 4GCXA 3ENLA 1US3A 2CZFA 1Q7ZA 3TWAA 3HQNA 4WX2A 2E0PA 4R3UA 3ZJ7A 4HOZA 2VDIA 3RMEA 3H8AA 1HX0A 1JZ5A 2Z29A 3W75A 4TVUA 1XLGA 3AHYA 5JVLA 4LUYA 5BU9A 2PUZA 4ZB0A 3EA1A 3BSHA 4IUOA 5K9CA 1FWEC 3EEGA 3U2CA 4I9TA 4WIWA 3FOKA 2VDHA 3W85A 1EJTC 2OYLA 5BOFA 5HWNA 1A50A 1IWPA 1LL6A 3QY8A 3IJDA 2UBPC 1ZALA 4UXDA 3B9AA 4OBSA 4JL1A 1A5UA 4BI5A 4IT1A 1NDVA 4PL2A 4HOWA 1D8CA 4CNPA 4H83A 4RE2A 1OX4B 3AHXA 3UWUA 3M64A 2FPVA 1TYGA 2ZX8A 3G1AA 4L6HA 2Z28A 4E8DA 1GQNA 1EL3A 1J5SA 4FPSA 2DQXA 2F6KA 7TIMA 1GVIA 3NL2A 5FJUA 1PHQA 4IJCA 4YCOA 1TE6A 3M1ZA 4JTIA 2DSZA 1WE5A 3F5KA 1T7LA 3DG3A 3KOYA 3NUKA 1FWTA 3RU6A 3RX2A 1UKQA 1SSDA 4AWSA 2E6YA 1U5HA 4JHMA 3WK3A 2TMDA 3VZXA 3A4WA 3W6MA 3W1PA 5CLTA 1KD0A 4AVNA 3LV5A 2FGBA 1XM3A 4OOUA 4JIIX 3BLIA 1AH3A 2F61A 4AXKA 3A6OA 2Y61A 3OQ8A 4A4AA 3UW6A 2E77A 2BS9A 5HAOA 1W3JA 3MKCA 4HIBA 3ITYA 4WRHA 1G94A 3BANA 1ZAIA 3CBWA 3VKDA 4AC7C 5E1QA 3UU0A 1JZ2A 5C2CA 4REQA 3P5YA 3VD5A 1I4NA 4MJ4A 3NZGA 4Q8TA 4WF7A 1ZY9A 5M03A 3PPFA 3SGZA 1UZ1A 3ARXA 1I6NA 3WQWA 4FNRA 4O0KA 4DPPA 4M1RA 5I77A 1XL9A 1G7VA 1XSIA 4UMAA 1HQTA 3TLQA 1KFKA 1T8XA 1PUDA 4J40A 4GI9A 1L2QA 3S47A 4JHZA 4JTSA 5CXPA 1K8YA 3MCNA 3P3BA 1HKVA 3STGA 4D6HA 3EDKA 4NASA 3RMJA 3LLFA 2DIEA 3HGOA 4TV6A 1Z9AA 1XFBA 5A8MA 4MOZA 1VEPA 1SJAA 1LBLA 4Z2GA 1OADA 1XRVA 4MAVA 1S5TA 4JIEA 2DPEA 2WMGA 3QV8A 4L6OA 1TUFA 5AVNA 2J25A 2IQTA 3F4NA 4IPPA 3GNPA 2UV8G 1C90A 2CEQA 3V5CA 1JNDA 1G5AA 4JTDA 3MT1A 2G3IA 2WC4A 3HO8A 4OUEA 3VGFA 4D1IA 1UD8A 2J4GA 1X97A 1FOBA 5LIWX 5BW6A 1CXKA 4XZIA 5D2VA 4Y90A 3W2UA 3GFZA 4P61A 1HGWA 2REQA 3E96A 4TX6A 4AD5A 4ZGYA 3STCA 4ZXOA 1VJZA 4LAZA 3HGJA 3BLPX 2IQDA 1XI3A 3MI2A 4WHBA 4L4MA 3VNMA 4XTIA 4HCLA 3WJWA 3DBPA 1A3WA 4H8UA 1W5OA 5AN7A 3C52A 2CZ5A 1NTHA 4D6JA 4O57A 5FEXA 3DHFA 3AXIA 1VCFA 1ZLPA 2ZC1A 4MKSA 3RLGA 4NZ5A 2WANA 3B8WA 3JS3A 2XFYA 5J5RA 4IQJA 2I17A 3NDYA 3OP2A 4ZE4A 3TQKA 2V0TA 4PODA 3C2YA 1WP6A 1OT1A 3WNNA 4DO7A 4BKNA 5T91A 1K9EA 5LYRA 3MS8A 1FWBC 4I9AA 4EPDC 1PYMA 2ABAA 1WXZA 4N02A 1T5AA 4DWSB 2Y62A 1K8ZA 1KFWA 4BQ3A 1VLWA 1S2AA 1W54A 4IWWA 4LPCA 6ALDA 2OEJA 2P50A 4ERIA 3C2RA 3UPMA 2RDWA 3KOWA 1B0IA 2HQAA 2X0YA 1P6BA 3V36A 4TIMA 5FJOA 3VC6A 1BRLA 3OLDA 5FF7A 4Q8PA 1QOQA 3N2CA 5JBFA 4Z0SA 3KTSA 1E4LA 3A22A 1KBIA 7XIMA 1IXPA 2ZBTA 3LGGA 1UR1A 3VGGA 1KV5A 3LSBA 4QM1A 3SW6A 5DY3A 1H7WA 1KLZA 1VBHA 5G5IA 4FSAA 2CLFA 3NPWA 1EP3A 3U7VA 1NSJA 3S6DA 4ZOBA 2Y7FA 4FEZA 1SSGA 4H1ZA 4JTGA 5F4SA 5HATA 2VGFA 3LM3A 4QRNA 3GXDA 2WHLA 1AQFA 3T0AA 2OT1A 2P53A 3BGJA 4POCA 1H11A 4LS2A 3WDPP 3LG3A 1SVDA 4FZIA 4RZ5A 4UTTA 2Z27A 2YBVA 3L5LA 3RCMA 2BHZA 3WNOA 2R94A 1HIZA 4JN8A 4IPJA 2E8ZA 1W0MA 4BQ5A 5IOBA 3KBWA 5HMDA 1J4EA 4RDYA 2MANA 4JIRA 4IH3A 2QCCA 1TRDA 1V6UA 1R3RA 1QFEA 4XUGA 4D8LA 2FB3A 1OFAA 1U30A 3R1ZA 4PMDA 3G1VA 4ZMGA 1EQPA 1VEMA 1V0LA 2QEZA 4HU8A 1W8GA 1UIOA 3GC5A 4C7FA 4ML9A 4G1KA 5E0FA 3AWNA 3QTPA 1LG1A 1UR3M 2XWDA 2YL6A 3MUZ1 2JKEA 4LNCA 2WMFA 4Q8VA 3SQLA 1SGJA 3P93A 1NWSA 2PP1A 4OFCA 3R7MA 1PWMA 8RUCA 4JBRA 4JZ5A 3IIXA 2WM1A 4IJBA 1H50A 3TC6A 4ORIA 4FNUA 1F3XA 4MB5A 3BLLA 1ZP4A 2J77A 2E28A 3DI0A 1TVLA 2XH7A 2BXYA 4GO8A 4XD6A 3KZSA 2C14A 1F4HA 1P6CA 3BLDA 3AYRA 3AXXA 3MCOA 4QHRA 1RALA 5FF3A 2HVOA 1F6YA 2OKTA 3REQB 4DJDD 1DJIA 1QI2A 1E9ZB 3B8UA 3JW7A 3P6LA 3SN1A 2I9EA 5HMEA 4LS1A 4HK7A 4L1WA 1XGDA 1LL4A 3GE7A 1VAHA 1YW1A 3DERA 1MEIA 5AECA 4IPIA 4GVGA 1L6WA 1P0NA 2XN0A 3DBNA 1UWUA 3QV9A 4XUYA 1JCYA 4EPKA 5AY7A 1AD1A 5GNYA 2ZXBA 1TPB1 3AZTA 5HOSA 2NX1A 3SCTA 1KM0A 1S5NA 4I8YA 5T9CE 1E9LA 4K8EA 1JG9A 4L6DA 4R5EA 4UZSA 1AFSA 4GK8A 5DO8A 2PDBA 3H7UA 1B9BA 3I6EA 4JCLA 1FCQA 3W7LA 3EXTA 1AQMA 4BK9A 4YHEA 4UFIA 2YA1A 2AQWA 1TZ9A 1I8JA 4UQ9A 4N2YA 5C9WA 1R46A 3EPMA 3DENA 2ZZ1A 2QF8A 5TBOA 3VVGA 4QQ3A 3UF9A 1THFD 5A8NA 5AZ1A 8TIMA 3ARQA 3WH8A 2E5DA 3VD3A 4AVFA 2CITA 3GRIA 3CAWA 1XYMA 3ZJ6A 4CQAA 2X42A 4BWLA 3MSDA 2YDQA 4DWDA 3LA4A 1S3HA 2R1KA 2FKPA 3S83A 3QV6A 3UGRA 4CGTA 4YPJA 1XLHA 4LRTA 2OX1A 5H8PA 4D6FA 4XZMX 2IKIA 1LTDA 4CEXC 4ZODA 5CAKA 3SUTA 2X40A 2ZTJA 3T1GA 1D3GA 1SFJA 3KS5A 2R1PA 3HN3A 3SIMA 3RX3A 2J9XA 3GNDA 1EP2A 1S39A 1GKRA 2OPJA 3PUEA 1WAUA 4Q3MA 2Y63A 4HK5A 4F0RA 2EF9A 6PTDA 5EMYA 3I7SA 1XYFA 4UFHA 3RDKA 3WD4A 2ALDA 2OEKA 3U57A 3MBDA 1PPIA 1W2PA 3GTIA 3ARUA 1GKPA 4KFOA 4S23A 5M5DA 2O9PA 1F2JA 1UOKA 1JDFA 3NURA 1DWHM 5HQMA 3UR8A 2FJKA 3AYTA 3QFWA 4H6QA 4IXXA 4X2PA 1RQEA 4RNIA 4N7QA 4L1GA 1J18A 2DSKA 3V18A 1UR4A 5F1UA 5C7HA 1YRRA 2HVNA 3QFEA 3M16A 4GMEA 1FBAA 3DFSA 1SW3A 5LA2A 3T08A 4GX8A 2PLCA 3MUY1 2ZUWA 1Q85A 3VNIA 3DGBA 4DO5A 1MZHA 4DX3A 1FDZA 2HV5A 3Q58A 1QPRA 3TC3A 2QAPA 4B9YA 1VLIA 3UETA 4DWSA 1TVNA 3KCLA 3B03A 1XYZA 3CQKA 1N8FA 3PBUA 3TYDA 3FN9A 1GQLA 4HYRA 4LX4A 2J47A 4I90A 3NPUA 1QATA 2V69A 2ZUVA 2B7NA 3WQEA 1SMDA 2PE4A 1TV5A 3G6LA 1LT8A 1GEHA 2E25A 1TWZA 4C1NA 4XZLX 1K8CA 2X0SA 2TPSA 3T09A 4HMDA 1FWNA 1BRLB 1LOLA 3O0FA 4MZ8A 5EMUA 2WSYA 1ODZA 2C91A 4N4PA 1CXEA 1R3YA 3S1GA 2ZXAA 3W22A 4DVOA 4NG3A 1YPIA 3AUOA 1F07A 1JAKA 2EKGA 2XU2A 4UMBA 1W1A1 5KINA 3ZVHA 1LBMA 4W5UA 2QPUA 1VZWA 1NM9A 4PZVA 2ISSA 4DLFA 3G0SA 1RPKA 4P5UA 3LZ3A 3VMPA 1TPFA 1V02E 4DF2A 2DZAA 4I7WA 4WOQA 3UWWA 2FDSA 5F2LA 3L4VA 4EP8C 1W56A 2ZXDA 3VK5A 1OC7A 2VDGA 3MHGA 1R7AA 3EYPA 4V28A 2VENA 3DN5A 4ZCWA 3ZYZA 4QCEA 4KWWA 3H2EA 3ZS4A 2DIJA 2AMXA 3MTWA 1PTAA 3DH7A 3RM4A 2H9AA 2ZZ3A 1TV8A 4ZXLA 4H7ZA 3CQ0A 1B90A 1ITUA 1RK5A 1WO2A 4A29A 3CWNA 2ZKMX 1A5BA 5LXEA 4Q8NA 1OX4A 2XWEA 1YX1A 1DE5A 3LI0A 2VD9A 3TV8A 4JYDA 2DVXA 3S42A 1ZCCA 2HXUA 3QW3A 3FFSA 2BXVA 2C0AA 5IXEA 4GGHA 4ZQRA 3ABQA 4QLLA 1GYLA 3N18A 3GXIA 2GSHA 4AEOA 1DWGM 5LSMA 5AYZA 3UQNA 3U4AA 3V0UA 1I45A 4FA3A 4GVFA 3CIXA 4DRSA 3KVJA 2W0UA 5U4NA 1XR2A 3RG6A 2NWRA 3AS0A 1PAMA 2FZ8A 2GJLA 3DFOA 4C6KA 3OB8A 1E3ZA 1I2OA 3MV01 1CNVA 4ZOAA 2RFGA 3NQVA 5FEWA 1B5TA 1V0KA 4IQEA 5GVJA 4NI3A 3U9IA 4Q22A 4F0LA 4AU0A 3M9YA 4UB9A 3R4IA 5AC5A 1KTCA 2NQ9A 4MJ2A 3IJ8A 3D47A 1AZ1A 3CUZA 1O1ZA 4P7RA 2PDLA 3GFXA 3SCQA 1H49A 1UQZA 3G1DA 1TJ0A 4LBSA 2HEJA 3N4FA 4MFDA 4ERGA 3L65A 2J74A 2YXXA 3GB6A 2QCDB 5FJRA 3CTLA 4MUPA 4AIBA 4OWGA 3O63A 1PTGA 1UJPA 1ODUA 3W7IA 4V33A 1JCLA 1NDWA 3OVPA 1EH9A 3G1HA 4GC4A 3AYSA 3AUJA 9XIMA 4Y96A 3KCOA 2GGHA 1E0TA 3S46A 5LHEA 1CGYA 2X8RA 4FLRA 3CV1A 3K1DA 1V4YA 3PZTA 3K2GA 4Q6XA 2W4XA 3PUDA 1A5KC 3SY1A 3GW0A 1R3TA 1RZMA 2OZTA 4C6EA 1G6CA 3E0VA 5BYWA 1ZRQA 2VOMA 3GC4A 5D9MA 5EA9A 1CEOA 1DQWA 3KTCA 4DNMA 2NXIA 3IV3A 1H09A 1PEZA 4LY4A 4M56A 5CKSA 4QAIA 2J6VA 2RDUA 2BZNA 4UFLA 1ZL1A 3H2NA 5D2TA 4DAFA 4X63A 3UA3A 5I3IA 4D72A 4MB1A 5H8MA 4BF9A 1BGGA 4E3TA 4F9JA 1XC6A 1C92A 1CW2A 1XUZA 4GABA 1GJPA 1VJIA 1JF5A 4FOKA 3CM4A 4TV5A 3EDDA 1BYCA 1FXQA 3L5MA 4G56A 4H6RA 4I3GA 2FTYA 4CLMA 3WG6A 1U5JA 3LV6A 3C2OA 4MZYA 3B04A 5BOOA 4DJEC 1WB0A 5IFTA 4JIPA 1SO3A 4JQ3A 3FKRA 4YN5A 2GUYA 4MAZA 2PDXA 2PTWA 3TQPA 1XX1A 3WQ4A 1I9CB 2VFIA 2B7QA 1JAEA 3CO4A 3XINA 5EMKA 4AD2A 3C6CA 1HFBA 2QJGA 3QR3A 2WHKA 2TODA 4PUJA 2ZICA 1EP1A 4DZ5A 1TSIA 1F7BA 3KOXA 4JYEA 4EK7A 2V8ZA 3UJEA 3CUFA 1P7TA 1XBVA 3HQOA 5D05A 2ADAA 1E1FA 1X96A 1KRMA 1UOZA 1FX6A 4HNNA 4YXGA 2DZTA 3SB0A 2VRQA 3TC7A 4NZ3A 2X1IA 1ZJIA 3EX1A 5A8QA 3NJ3A 1I60A 5GNZA 3G2GA 3TWBA 4N9CA 1SZGA 2Y88A 1IR1A 4EXBA 4XZBA 5A6AA 1UD3A 3LHZA 4AF0A 1FRBA 3CK5A 2PLMA 2YB4A 3OYZA 1WUFA 5HANA 4X60A 2R8WA 4Q8WA 1A5NC 3VIGA 2GDVA 4PCPA 3TN3A 1YTKA 5D09A 3LB0A 3DG6A 3AIRA 4IFKA 5EBUA 6CGTA 1ZENA 4S3GA 1HKIA 2OJPA 1GT8A 3BLOA 4YVVA 3GSMA 1XIJA 3CYVA 5ABTA 1EWDA 2VT0A 3MWCA 4L56A 3N2XA 3BAKA 3G0UA 1SJCA 1Z41A 4JTRA 3LENA 3IARA 3BO9A 2CU0A 4PTXA 4TVDA 4WD0A 4DM2A 1XLAA 1Y0EA 3GH4A 4D9PA 2Z1XA 1AZ2A 2D0FA 3K13A 3UVAA 1YQ2A 3HFYA 1REQA 1R9XA 4GJJA 3O15A 1QNVA 1KWKA 1BQCA 3JVAA 2J13A 3WQ8A 4ATLA 3MWAA 4C91A 4GYPA 1B3OA 1TRIA 4GFIA 2ZUNA 1W9BM 1PCKA 1XRFA 1YNYA 4RPQA 2VC6A 2C6QA 5AZ0A 5I3FA 5K7JA 2D0GA 5I06A 4IFOA 4RZBA 1Q13A 2XGIA 3D46A 3LPOA 4UNKA 4AMCA 1HVXA 1QAPA 2WJDA 4PE8A 4M24A 3JUGA 1KCLA 3MUXA 4CNUA 1KCXA 4US6A 2FPYA 1CGVA 1L0PA 3EWWA 1R47A 1TCMA 3T7VA 4DYJA 5CG7A 5LA0A 2Z0IA 2PDUA 2PWUA 3QEZA 1QU4A 3TP4A 4WEVX 3VZZA 2WKGA 3GWQA 3NFUA 4PCFA 4NZFA 1JQVA 4NIRA 4INFA 1DJHA 3IWPA 2TAAA 3QGAC 2UY5A 1SW0A 4KPLA 1A0DA 3TA9A 4HTYA 1YBQA 2ACRA 4G7EA 3OBKA 4IIEA 3BCJA 1CXFA 1AD4A 4RXGA 1IGSA 3Q45A 1TQXA 1OF8A 3HGSA 4N9BA 2JEPA 1EJ7L 3RXZA 2CLLA 3EDEA 4ZTYA 4FALA 3L21A 4MDOA 1HG3A 3HTWA 3R43A 4F40A 3NTYA 4JPGA 1R85A 3ONBA 3THDA 3GZ3A 4GUIA 4US5A 1J0ZA 3QOMA 4MLRA 2R6OA 1UP2A 3M7WA 3PTKA 4JNMA 2XIMA 3T0TA 3IGHX 4HYVA 3F7JA 3CYJA 2D2OA 1K7EA 3MP4A 3K1GA 4JHOA 2DSUA 4FNPA 4E6MA 1GVQA 4W7UA 3TOYA 4UIOA 4LJ3A 3AFBA 1TB3A 4M8UA 3PBGA 3PG9A 4S3AA 3EGJA 5I3GA 1WKYA 3F4WA 4LTSA 4PFMA 4AHOA 3P62A 3BG9A 3M0MA 1M41A 1M7PA 2DT0A 2YJQA 1Q5MA 2MNRA 1DP0A 2X1RA 1ITCA 4UTHA 1IYXA 3AJXA 4OJYA 4UQCA 3QYQA 2BOFX 3HOJA 3TYZA 3VUPA 1FDJA 2EPHA 5BXRA 3C8FA 2DVUA 3T6CA 3VNLA 3NQEA 1NWUA 4MJZA 1YHTA 3L12A 4MWAC 3A4JA 1KTNA 2IXUA 4GVIA 2VWTA 3N3MA 2Q02A 1BD0A 3FEMA 5LA1A 5LKYA 1XG4A 2A2IA 3G8RA 2Q8LA 4XIMA 3UYCA 2PP3A 2CBIA 1TMLA 1UKOA 5AKQA 3IIPA 2C16A 4F48A 3L5AA 4KIEA 4FIRA 4CU6A 1BG4A 2KAUC 4Z17A 3HJZA 3HA1A 2NQJA 1Q6RA 5FJJA 3V35A 4CNOA 2VZSA 4GJIA 5MF5A 3K8LA 1Q2RA 2DT3A 4HJFA 1O7AA 4CN1A 3R5EA 3KL0A 1JR1A 3BZGA 3OQEA 4WDTA 2HE5A 1UUQA 2Y7EA 4MKNA 2G4JA 5D8ZA 1UH3A 4XAFA 3GO2A 2NVAA 2IKJA 3MJYA 4M6UA 1GEQA 1RY0A 3RPDA 4LUIA 3SCPA 3WJZA 4B3LA 3PJTA 3QY6A 3HG5A 4Z42C 2QPXA 5D9OA 4FHAA 3IAQA 5I5RA 2OWXA 3LSCA 1NARA 2BGSA 1SO5A 3DYPA 4JTJA 3W87A 3DXIA 1OF6A 4NZCA 1J6OA 1X39A 3NQ2A 5K4ZA 1Q8JA 3GK0A 1IEQA 3ITGA 1OCJA 1D3CA 3C86A 3U0HA 2OT0A 3CUXA 1Q8AA 3QLDA 4BWLC 2PODA 3GS6A 3VGDA 2ASHA 2C7FA 2WB5A 3CZEA 4O52A 1NFBA 5DT7A 1OX5A 3U8GA 5G2HA 1B57A 2ZWYA 3B8VA 3MSYA 3NL5A 4CEUC 3RPTA 3R58A 5I24A 2H9AB 2QJJA 3P60A 3BLKA 3GHRA 3PTDA 3W07A 3XISA 1PBGA 1MMFA 3PZUA 3WBYA 3RN6A 4FR1A 2IPFA 1KM5A 3AAMA 1A5CA 2W9MA 1T6MA 2NV9A 4L5ZA 3GR7A 3B06A 4DEFA 1IEWA 1M65A 1UC4A 2KX9A 2O4QA 1ZGDA 2D2HA 3T2PA 3VKKA 5E9XA 4TOQA 3MYPA 1PV8A 3DCPA 1HJXA 1DKWA 1O5XA 3BICA 3WQGA 5KEZA 4ASTA 1UD6A 1TPDA 3ITLA 1QTWA 3GXPA 4P7LA 1PKLA 4KEUA 3S6TA 3A13A 2PDPA 3TE9A 1RH9A 3NQGA 3WYZA 3LGDA 3SO7A 1J11A 1XLLA 1JXKA 4W84A 1NWRA 1BQGA 1V6YA 4LAUA 4AB4A 3NVTA 1GVRA 2EG8A 2CNCA 3N14A 3CH9A 1VENA 5H2ZA 4Y9NA 2IW0A 3CEPA 3MP3A 4Q4OA 4D6IA 3A47A 2QXWA 3ITOA 4LGXA 4N0RA 1VP5A 4ORMA 3R0UA 5JH2A 3IUIA 1XCWA 2G50A 3KL5A 2QQ6A 4PEKA 1CTNA 1TTJA 4DO6A 1M6JA 3OVGA 4BQ2A 3IVSA 4ADUA 4UC5A 3KVKA 1MEHA 3BE7A 3S2MA 2V30A 2OSYA 2X0HA 3H54A 4UQDA 1WX0A 1BF2A 2OKOA 1MW0A 1GQKA 3NQAA 3OHMB 3PF3A 4J3XA 4ZB2A 4EE9A 1T99A 2HNHA 4WY0F 5CZSA 4LANA 3O8AA 4NJJA 4MY1A 1DL3A 3QMRA 2PDYA 2E5BA 5H91A 4CNNA 3UERA 3IJLA 2VGBA 4FO4A 3TZNA 3S5YA 3PG8A 1OC6A 1DIEA 1TWSA 4CVUA 2BBFA 4GI4A 1EHNA 3WUFA 1A53A 1S3TC 3LXBA 3LBMA 3E2RA 3MKKA 3S1UA 2QZRA 2GGJA 2Z2AA 2INFA 3W73A 3EKGA 4CQCA 3TFCA 4M80A 3DGRA 1YDOA 3TYBA 3V3WA 4C6DA 1RVGA 1ONRA 3MU7A 4NUWA 1TWDA 3QY7A 1X7IA 1H3GA 2FGZA 3CNYA 3M6YA 4M7TA 4I5RA 4DJEA 4Q8OA 4LF1A 3B8TA 1Z48A 1E5JA 1V6VA 2HBXA 1EB3A 1S2TA 3LMYA 4PTVA 2CKSA 3MDUA 2QVNA 5T8GA 5D30A 4YTRA 5LNRA 1TJPA 1LJYA 3W1QA 5CGQA 3WJXA 4NZ1A 3TW6A 1E6QM 1YPXA 4S3FA 1MW2A 2JIEA 3SRFA 3CU2A 4IG2A 2V5CA 3FGCB 1B4KA 2BWGA 3OEXA 3RCYA 2XSAA 2BVTA 3ARWA 2XVLA 3EA3A 1T96A 3ECQA 5CPLA 4GOAA 3P7YA 1AK5A 1KRAC 1XFCA 2I9UA 2J9ZA 1BHGA 1ZP3A 2P0OA 2XN1A 3W1NA 4H7VA 3M5XA 2CLMA 1RLDA 5I23A 2XVKA 4HA0A 3W1RA 4KCTA 4U4MA 2O7QA 3AMKA 3CHCA 2XIBA 1XINA 3FCPA 1VFHA 1FFQA 1VFLA 4E2BA 3G22A 4M3PA 5B80A 4DUWA 4JFWA 4NSBA 2VC5A 4XZ9A 5AFDA 1ADDA 4JFVA 1UPMB 1X1OA 3ITVA 5G4HC 4X9SA 3VFCA 1GTHA 2DUAA 2RUSA 1KM1A 5D33A 3VM7A 3SFWA 3NQMA 4LBUA 2E6DA 4RZ4A 4UCGA 4WDXA 1A5SA 1M9HA 1EO7A 1XSJA 5XIAA 4OT7A 4B2DA 3A5FA 2Y7GA 3P2VA 3CPGA 1EDTA 4KGLA 2ZZ4A 1K70A 2G3FA 3GXMA 3WQ6A 4JTKA 2J8GA 3SSJA 2NVCA 3GVGA 1GOQA 1OC5A 1HKWA 3N29A 3NZ1A 4UTUA 1UCWA 3K8KA 2A3BA 3V7PA 4B3ZA 4LFYA 4Z1DA 1NOWA 3R10A 3WJYA 2VEPA 3BMVA 3O05A 4AWTA 2CZEA 2PDQA 4WJXA 2J8FA 1W1VA 4GZ7A 2CZVA 2FVLA 3EPNA 5JMUA 1A4LA 1CXIA 4OQVA 1VFOA 2JEQA 3TKFA 4E4UA 2B81A 2GQ8A 4ZO8A 1KFLA 4RUBA 1S2WA 5LHFA 4DF1A 4ACZA 1R6WA 4XZWA 1FP9A 1KM4A 4AZIA 3KLKA 4OE7A 1OFEA 1X7FA 3BWWA 1NY1A 3EAUA 2G97A 2YZ5A 4QDMA 4C6MA 4S3KA 1TZ7A 1TX2A 1VGAA 2W6RA 1EOKA 1FH9A 3WENA 4UOZA 1RJQA 3E2VA 2PWGA 3ARTA 1XHGA 4HNLA 3B0VC 4CU7A 4DBSA 3N04A 3EEZA 2Y6ZA 5EKYA 3PSWA 2G96A 2AAMA 1JYXA 4I9JA 3ZR5A 3GTXA 1RLCL 3AIUA 3EOSA 3BAIA 2B0MA 4W7VA 1B3YA 3HPFA 4UTWA 3MV11 1GZJA 1OYBA 1J2BA 2DT2A 1XBZA 1MQPA 2WNZA 3O06A 1GVEA 1CB2A 1EBGA 3T8QA 1SZEA 4UOJA 1WKDA 1EUAA 3GDTA 1UMYA 3ZO9A 5M3WA 1UBPC 3BOLA 3GAKA 3TNBA 3ZLHA 1QI3A 1FWHC 5A6LA 3W24A 4NJHA 2REQB 1IXQA 1WDWA 3QHMA 5A69A 2J75A 4IM4A 3N15A 3UG4A 3WNPA 5AHMA 4B15A 3DZ1A 3CO8A 1F61A 2FFIA 2I56A 1DQXA 5CZKA 1QVBA 1H5YA 3IK2A 4LS0A 3PZQA 1VR6A 3ZMRA 1D8WA 3ITCA 3UXAA 5DCBA 3O9NA 3IJ6A 5I03A 3NL6A 3GDRA 3LHWA 3IPWA 4M5PA 3TXZA 4G5DA 4MPKA 5D2YA 2NLIA 1S1PA 1ZFJA 3WH7A 1J5TA 4LYPA 3WH5A 4WZHA 3W1TA 4TTUA 5E6ZA 3UD6A 2WYSA 1HKKA 1UYQA 4H9TA 2G3NA 2Y70A 1V0MA 4NL1A 3LS9A 1KV8A 1TFVA 1KB3A 3VGHA 2X16A 1DJGA 1YXYA 4U3CA 5LNSA 4S1FA 4WSHA 1OY0A 2XFWA 4JX4A 4KWVA 2JFEX 3WK0A 3QF0A 1UH4A 2OZ0A 1K7FA 4AZHA 1EFZA 4HNUA 3U6WA 4PTNA 4XKMA 3T0DA 3EB2A 3MI3A 2NZLA 4G7EB 2PWDA 3TTSA 5I2UA 1LBFA 4JGDA 1CB7B 3S5ZA 4J35A 2NW0A 4GI8A 1CLKA 4D6DA 3IIVA 4LF2A 2ZE3A 4HNVA 1A5AA 1GW1A 3TTYA 1OYAA 9CGTA 1GGOA 5C9ZA 2XH4A 4Z1AA 4FXFA 2AGKA 2C79A 1QNSA 4NAFA 2Q01A 4O4VA 1NQ6A 3JR2A 2OVLA 4F2BA 1ZB5A 4RE4A 3L0KA 4DBUA 3GUGA 1N8WA 4KQNA 4C6CA 1GONA 1N2VA 3SY5A 3B0YA 5FOOA 3GU9A 5JBDA 3VKBA 5JIPA 3UWVA 3LXCA 3EB3A 4UFJA 3FYYA 1D7FA 1XIGA 4KEMA 5D38A 4PUDA 3WDIA 3GKAA 1LRNA 2FH6A 4IIGA 4LUJA 3WBEA 3S5NA 4D6EA 3SBFA 2OQLA 4PB4A 4AD0A 4E8GA 4GXWA 5D2WA 4IGNA 1QR7A 3CAKA 3B8IA 4YYCA 1EA0A 4CN6A 3KBVA 2PP0A 4WDUA 4EPEC 1FH8A 3CMFA 3MDWA 3LBOA 4U2ZA 4MZ1A 4RV3A 1SU5A 3O6YX 1UR8A 3GFYA 1ALDA 4IG2B 4CKQA 2VC9A 3BTNA 2VJXA 1PX3A 5IBXA 5CJNA 3R11A 4C6OA 3VE7A 2PMQA 4DJDA 5ABFB 2ZCGA 1OGSA 4PSPA 3KRSA 3ARPA 4ZFMA 3P61A 3H7RA 2UY2A 3V0TA 5BRPA 2G3JA 1B4EA 3ARZA 1EEPA 2YYTA 3AU2A 1BLIA 3EWXA 4O17A 3DYOA 3DFQA 1R7OA 3KP1A 3TSBA 4ZQNA 2CBJA 4LB4A 1Q6FA 3KRZA 3YPIA 4J3SA 2Q3OA 4PMJA 1EF3A 5A6JA 3A21A 1VBRA 5HXMA 4OTKA 4A3QA 3AO0A 3NSMA 4C6LA 4GYJA 1V03A 4RKAA 5CSRA 1XW8A 1JULA 2YFOA 3KHJA 3D6NA 4JXCA 2E4TA 4DQWA 4IGHA 4H2HA 2H8ZA 3G3DA 4NJIA 5KZMA 1P0BA 2O9OA 4ZOCA 4AMAA 1F73A 2XZ9A 3SIZA 3KVMA 1TWIA 3LLDA 5BOEA 4PH6A 2J7CA 4W86A 2C13A 1Z8AA 1C91A 5C2GA 1AH4A 1JUEA 3CV2A 3WO8A 4ZENA 4UTKA 1L8NA 4KFPA 1Q4WA 5HWJA 3IRDA 4YJ5A 4NX5A 3TN4A 1QNPA 1W9VA 2PDWA 1H51A 3V4BA 4A3HA 4RW3A 1B30A 2XFRA 3PJWA 4RX0A 4WJEA 4MB4A 4WY0B 5LZLA 4C90A 5BNKA 5ECUA 2NUWA 1JUKA 2Y8UA 4BEUA 1L6YA 5EMLA 2POTA 3CTTA 3RLHA 4KWUA 3LD5A 1RY8A 3IJ7A 1K6AA 1ZJHA 3OTRA 5HPOA 4E4FA 1CCWB 5FD0A 1PE1A 3V1HA 4FX7A 1BVZA 4FOUA 3LHUA 3QM3A 1X8FA 1G69A 4L9XA 3WF4A 3QC0A 3WF1A 2O92A 1H1YA 1R86A 4ZEPA 3WFAA 1XDLA 2ISDA 4GZJA 2PDIA 4JTUA 1DJNA 4QQUA 2Y89A 3SCRA 4K38A 4UQAA 4K6AA 3M44A 2NX9A 1E6RA 1E56A 4YTUA 2QCMA 3DG7A 4P7QA 3G6MA 1KBLA 3H2AA 3KDOA 5GJMA 1OFRA 1ZCOA 3TJXA 2C1IA 2WOQA 6A3HA 4GXMA 4D1JA 2X1UA 3W7PA 3QMTA 4A3RA 1GZ1A 2F38A 1ELSA 4H19A 2UWFA 2OGJA 1H63A 5B7YA 1LORA 4GQRA 5A6MA 3HG2A 4Z08A 2X2GA 3OU8A 1G4SA 4V2XA 3ID7A 2XTKA 2VQUA 5I3DA 4OV4A 2HDJA 3GKFA 1A80A 3L4WA 4XD3A 3MW7A 1NOUA 1OWQA 4J3VA 1ITQA 3VIFA 3L67A 3W7OA 2FYMA 1HJWA 1QO2A 4J27A 1UHVA 2WJFA 3L2MA 2ISFA 1OFQA 5A3HA 1RQHA 2DFAA 1EX1A 1VJSA 2GYIA 7ENLA 3WX7A 1E73M 2ZDRA 3MMTA 3VOFA 2OOFA 1F74A 2GSEA 1WBHA 1XDMA 1G67A 3QZEA 1TPWA 2HJPA 4HSNA 3N4EA 3GDLA 4J3ZA 3MC5A 2D3NA 3FX4A 2Z1BA 4N6FA 3E0IA 4NP7A 4B2DD 3B3DA 1XJBA 4GJ1A 2QJIA 4G6CA 5CEWA 1RPXA 3CLMA 2QDDA 4DJFD 4BF5A 2XIOA 4GFSA 4JEJA 3VGEA 4B3KA 1JCNA 2VKZG 5DF0A 4G2DA 3R79A 5E09A 2WCAA 4TTGA 2JIWA 3B0XA 1RJRA 2QUVA 1UBSA 3WDQA 3PZMA 3LHTA 1I1WA 2XDFA 4Q4RA 4N4QA 2E9LA 2WPBA 3QPEA 1JFXA 1OJXA 2PF8A 2GJNA 3UPWA 3VIIA 4AD1A 2V63A 3CWHA 3UNDA 3KUMA 2DZXA 4RPPA 1RCOB 3NWRA 4FIQA 3ZSSA 5AYYA 4LEQA 4HB7A 4WSKA 3LHYA 4RDWA 3L4UA 4URIA 1UJQA 5CPNA 3VNKA 1TKKA 1UPPA 1VPXA 3QTGA 2PRMA 3SECA 1CT5A 3KEHA 1ISWA 2DZWA 4GUJA 4JX6A 1V8EA 2YGYA 1Q6GA 1A5OC 2ZRVA 4IHCA 3PN8A 5I09A 3S2CA 4CN4A 1DE6A 3ISIX 1QO5A 4LUSA 3R0DA 2D24A 4NYYA 5A8OA 3DUGA 3TEVA 2I5QA 1BPLB 4B92A 3FW6A 4PMVA 4GUHA 3M5ZA 2ZFAA 3E74A 3WIJA 2HBVA 4OV9A 3WLIA 4PTDA 1OZQA 4HOXA 4MWAD 1IT8A 1XDJA 2J7GA 3W6YA 1OK4A 1TPH1 2DUZA 3EB4A 3F4VA 4XWUA 3HURA 4LAKA 1J9YA 1PZ1A 4CCEA 4KWOA 3FJ4A 2VEFA 3GLCA 4W8BA 5A1AA 2Z1VA 4UQEA 1W5PA 1FHLA 2OGYA 5T9BG 1VFTA 4WUIA 1ZTVA 2FH8A 2PGFA 5G2WA 1PXGA 3F5LA 1XISA 4HA1A 3R13A 4LAMA 3ABSA 1EOMA 5DXYA 1OFDA 4QR6A 4Y9MA 3ARVA 3CZLA 2XYLA 5A2CA 1GOOA 4OHQA 3W1MA 1KO0A 1RK6A 1TWWA 3RK8A 5HMFA 2OO6A 4HP5A 2GUUA 3B9DA 2AGTA 3VM5A 1UZHA 1MUCA 2FPTA 2GK1A 3VFLA 2VRKA 3VDGA 4DZIA 3UVIA 3OVRA 2W66A 1XWYA 1KM2A 2PA6A 2YOCA 4H01A 1PB0A 4DZHA 2EQDA 3I7RA 3REQA 1ME9A 5H1WA 4A2RA 1TVPA 4XZNX 3E1F1 3KTXA 2Z00A 4HZ6A 1HGYA 1UC5A 2V3DA 3W0KA 1EEXA 1PIIA 4E5TA 1ZAHA 4GBDA 2H8XA 4X61A 3WMBA 1F8MA 1H4PA 4DXVA 4QDWA 4AWUA 2PDHA 4UTMA 1K03A 3QBUA 4ZZ9A 4Z1YA 1XRTA 4GNVA 4MNMA 2ON3A 1UG6A 3L4TA 4BR1A 1TZZA 3HMJG 3LCFA 4QCFA 4PBFA 3PK7A 3SUWA 3DFHA 4RDVA 3TYCA 3NGFA 3G3MA 3C0SA 2UY3A 2X05A 1GKQA 2X7VA 1V3MA 1TJ1A 2UY4A 3NDZA 1Q2SA 2J79A 4OIFA 5I79A 5CJ5A 3B0PA 1E1CA 3IUDA 3GYCA 1M53A 1Q45A 2D2GA 5BROA 1RA0A 2ZXQA 1NF7A 3G18A 4YYFA 3GU2A 5CZJA 1SO4A 5HWMA 1JJKA 3QQWA 5HR6A 2G8ZA 5DELA 4KS0A 1PKYA 3HF3A 3RM9A 3APGA 5D03A 3GBDA 3GIQA 3F2BA 4I6VA 4LNYA 3WSUA 5G1MA 1IHIA 4DJFA 3VXGA 4LCQA 3O16A 3KM8A 3BZJA 1I2PA 1XLEA 5C71A 6ENLA 3IEBA 4XAPA 1UW9A 4CD8A 4MDPA 1W1IE 1WDDA 1N55A 1HO4A 2QV5A 3T07A 2G37A 2YDSA 4WXYA 4XX6A 2Y5JA 2DY3A 5I0DA 1Z89A 4B5VA 3AZRA 4P8XA 3WEMA 3KBMA 4S3BA 5I7GA 1O1HA 3UY8A 3QN3A 3FA5A 4K3ZA 1MWOA 1OQFA 1ZZMA 3WLKX 5CZ0A 1LWIA 4H9UA 2VFEA 3TLLA 4XVDA 1AJ2A 3QZAA 3M07A 3UPBA 1KXVA 4PR4A 3CAVA 4PCNA 3W26A 3WQFA 1NELA 1XKJA 4OGZA 4ECLA 3AICA 3H4WA 2GQAA 2INZA 3S0CA 1H60A 5DCEA 5CCZA 4Y7EA 5EBAA 2MUCA 2A0NA 1MNSA 2V3EA 2IUZA 4ZQPA 1UMLA 1O5QA 2DEPA 1FKXA 3K46A 3HPSA 4C60A 2ONEA 4M6PA 1OK6A 2XH0A 4FLSA 3KE0A 2GJRA 1U83A 4XISA 2GQ3A 1EZWA 2F8QA 2JKAA 4R7WA 3WQDA 4DXXA 3SADA 5CC5A 2B31A 1F76A 1Q6QA 3QVQA 1MFVA 1XD0A 2ZX9A 4GINA 4C6PA 2GDQA 4M6VA 3WMLA 1VB9A 3GIYA 4C6IA 1MYRA 1RCXB 3KAOA 3N3TA 3RPMA 1EPVA 4F79A 3TN5A 2WMKA 2VR4A 3GXNA 2PURA 3UZXA 1OFBA 1QNQA 4ZQMA 4IP7A 3R8HA 3UWZA 3KZPA 3VMNA 4O18A 2TYSA 4MSSA 4Y9OA 1R38A 1QW7A 4JY8A 1QI5A 2E40A 1PX8A 3CT7A 1XC4A 4NRSA 1MEWA 4EX4A 3P5ZA 3RX4A 2WMJA 2QR6A 3NZPA 2HXTA 5IDZA 3ANUA 1QUMA 4F2TA 5KITA 4MLJA 3L2LA 3R0KA 4G9PA 1AJ0A 4KIRA 2GL5A 1KQYA 5D4YA 2QUUA 3AXMA 4JYFA 4CCCA 4XO6A 2YKKA 4H8HA 3BK0A 1F8IA 2GPTA 3L2IA 4WGXA 3U3HA 3C0QA 5DFAA 3E02A 3DFPA 3C3NA 3OLIA 1DWJM 4HN8A 3N17A 1GOWA 3EMZA 1JXJA 4DAIA 3M0HA 2FZ9A 3EMQA 3AOFA 1AJZA 4RXFA 1JPDX 2OLHA 3S3GA 5A2BA 5JUVA 2EJ1A 3SR7A 1YTDA 4ZO7A 1E51A 4RJEA 5DEZA 4D2JA 1YPFA 1W5NA 3TSMA 2V2CA 3EXRA 1J93A 3LBCA 5KZDA 5CC6A 1FY6A 2DJLA 3GIPA 1C3FA 3ZZ1A 4B5TA 1VIZA 4XD5A 1NH6A 1W37A 3UZJA 3GVQA 3NO5A 2E1WA 1S46A 4ML4A 2GFTA 2JKPA 1US2A 4LUSB 3L0NA 5LXXA 4Y9PA 1XLFA 2R82A 1U2YA 1U5VA 5BMXA 1MZRA 4CCZA 3HG4A 1CLXA 1E6NA 2Z7GA 1NU5A 1JVNA 2WHJA 2QMJA 5FJTA 3GH7A 4O4WA 1DPMA 1MUMA 1ECEA 5K9XA 3MSGA 1DBTA 3NYDA 5LIUX 1YDYA 1O5RA 1C7TA 4O13A 3EWUA 4QNEA 5TQLA 4K1GA 4JKKA 5AOUA 4PCSA 3B9NA 4O0QA 4UCFA 3USBA 1LRQA 3GH5A 4XSMA 1LLWA 2X7WA 3WQPA 4WXZA 2CHOA 5CZTA 1O60A 2RKXA 4UTFA 4O53A 1GHRA 3SGGA 2WMHA 4O1DA 2CLIA 4CNSA 2Z2BA 2SFPA 4NILA 3MMWA 4CD7A 4MM1A 2CXEA 1B3XA 4H3DA 2ICSA 3BH4A 3BMWA 2INEA 3UR7A 1QW9A 1VPQA 3C56A 4XBKA 1BVNP 4GH3A 1R9YA 1H7NA 1BTMA 2CLKA 2ODOA 1ZQ5A 3NL3A 2PTZA 2E7FA 3WLPA 1T0OA 1PL9A 1GOIA 1JZ8A 4QEEA 4AISA 4GA8A 1DHPA 1WYIA 3SRHA 1S1RA 3D0CA 1ZBKA 2XPKA 3QRHA 3JRKA 3PZVA 4HHPA 4MY8A 1TO3A 2WVVA 3I3EA 5IRPA 1HUVA 2AL1A 3DC0A 1KNWA 2CW6A 4KF1A 3AXKA 1E15A 1M03A 4IMGA 5FJPA 4W4QA 4AZ6A 4XBJA 2WO5A 4WR3A 3H2CA 4DHGA 2VR5A 3OOQA 4JFTA 5JU6A 1NDZA 1F5ZA 2YXGA 1XIDA 1L8PA 1Q66A 1K3UA 4G8TA 2QGHA 4MGGA 1S5WA 3C4UA 2ZRXA 3OBAA 1F3EA 1NOFA 4W89A 3THUA 2BY1A 4BHYA 2J7BA 1VEOA 3Q37A 3F03K 1TTIA 3S5OA 1E6ZA 5GQBA 4GUGA 4DNHA 2PTXA 1WDSA 3KVLA 4K36A 4GNJA 1YMYA 2DIKA 3TDFA 1EJXC 3QQ0A 4L4LA 1W3IA 1MQRA 3TZFA 1R3VA 2XIJA 3WLRA 3F2DA 1KTBA 2PSNA 3GNRA 1VF8A 4FNSA 1XCXA 3N2BA 4R9OA 5DX7A 4O15A 5HUPA 3H6OA 1QK0A 1K4GA 1WDPA 2QV4A