4AY9X

Structure of follicle-stimulating hormone in complex with the entire ectodomain of its receptor
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
342
structure length
306
Chain Sequence
CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNSAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSTEFDDLCNEVVDVTCSPKPDAFNPCEDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOPROTEIN HORMONES, ALPHA POLYPEPTIDE
publication title Structure of Follicle-Stimulating Hormone in Complex with the Entire Ectodomain of its Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/receptor
total genus 86
structure length 306
sequence length 342
chains with identical sequence Y, Z
ec nomenclature
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01462 LRRNT Leucine rich repeat N-terminal domain
X PF12369 GnHR_trans Gonadotropin hormone receptor transmembrane region
X PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4ay9X00
1P8VA 3E2JA 5GMHA 3O6NA 2P1MB 4NKHA 4PQ8A 4CNMA 1XECA 1M9SA 3SB4A 4R6JA 1FQVA 4BSSA 2UZXA 3GOZA 4M7EC 5AWBA 1P9AG 3A79B 5LFNA 5B4PA 1K5DC 4PSJA 4XGOA 3E3ZA 4L3FA 3WPCA 5GMFA 1FO1A 4FS7A 2OMZA 4LSXA 3KJ4A 4CC4A 4R07A 4HQ1A 2BNHA 2JE1A 4LXSA 1PGVA 3RGZA 4U08A 4GLPA 3FXIA 4R0AA 4ECNA 4FHOA 4Q3IA 3RFJA 3RW7A 2Z66A 3OJAA 4G8AA 3VQ2A 4PEQB 4V2EA 1OTMA 4I6JB 4CNCA 5AWAA 1M9LA 1O6SA 4BSRA 4R6GA 3W3GA 5AWDA 3C6OB 4ECOA 1XKUA 2JQDA 5CMNA 3ULVA 2OMVA 2UZYA 4LSXC 4R09A 4CC4C 1H6TA 2WQUA 3G39A 1FS2A 4YEBB 1DFJI 4LXRA 3WN4A 4R6AA 3OJAB 3W3LA 2O6QA 4TZHA 2P1PB 2V9TB 5IYXC 4R58A 4GT6A 2Z64A 4OQTA 4FDWA 3CVRA 3BZ5A 4WP6A 1WWLA 5CMPA 1FT8A 2OMTA 5AZ5A 3W3MA 2WQWA 1OOKG 2FT3A 2Z82A 3M19A 1D0BA 3ULUA 3OGLB 2A0ZA 3UL7A 4BV4R 2IFGA 4KXFB 5GMGA 3DZEA 1OTNA 3W3JA 1JL5A 4R5CA 4CP6A 4MN8B 2Z7XA 3UL9A 4RCWA 1DS9A 1O6VA 2V9SA 4H09A 1OTOA 2RA8A 5IJDA 4NKGA 4KT1A 2ELLA 4P91A 2WQXA 5GS2B 5D3IA 4PERA 4Z61C 4FCGA 4XOSA 3C6NB 4R5DA 4RCAB 2JE0A 1H6UA 5B0NA 4C2BB 1QYYA 2R9UA 4UFRA 4FD0A 4LI1A 4Z94G 4M7EA 1A4YA 4LSCA 1K5GC 3RJ0A 3RGXA 3G04C 4PKIG 4QC0A 4EZGA 2Z7XB 4Y61B 5B0TA 5HZLB 2P1OB 4WYKA 2Y5QA 4Q3GA 3WPFA 1OZNA 4CILA 2OMUA 3E6JA 4ARRA 4ARNA 4B8CD 3ZYJA 1LTXA 2CA6A 4KNGA 5FTTB 1GWBA 3WPIA 4AW4A 2ASSB 4U09A 4Z8GA 1XCDA 1XEUA 2Z63A 3CIGA 3E4GA 2O6SA 2WQVA 2Q4GW 2XWTC 1U0ND 4J0MA 2OMWA 2ASTB 2RR6A 1Z7XW 3RFEA 3P72A 2XOTA 4V2DA 3C6PB 3WPDA 3UL8A 4BSUA 3RFSA 4Q62A 3TSRE 3REZA 3G3AA 1OGQA 4Z79A 4R08A 4Z64C 2Z81A 3ZYIA 2OMXA 3ZYOA 1KOOA 2P1NB 4U7LA 3WPGA 3JB9j 5AWCA 4L3AA 3G06A 4LI2A 2BEXA 1G9UA 1W8AA 4FMZA 5GS0A 3ZYNA 2V70A 3ULAA 3OGKB 2ID5A 4J4LA 4C2AB 3M18A 1P8TA 3O53A 3RIZA 4V2CA 3VQ1A 3W3NA 5HDHA 1SQ0B 4QXEA 4LSAA 4MQWX 5GQRK 5IJBA 2OMYA 3CIYA 4IM6A 3RW6A 4RWTC 1DCEA 1ZIWA 2Z65A 3UN9A 4R6FA 1M10B 5A5CA 3WPHA 4QBZA 1O6TA 1M0ZA 2P1QB 3WPBA 3PMHG 2WFHA 2Z62A 1XWDC 1KOHA 2O6RA 1A9NA 1YRGA 3G3BA 4P8SA 4U06A 3OGMB 3WPEA 1IO0A 4AY9X 4K17A 5IJCA 3W3KA 4XSQA
chains in the Genus database with same CATH superfamily
1P8VA 3E2JA 4NZTM 5GMHA 3O6NA 2P1MB 4NKHA 4PQ8A 4CNMA 1XECA 1M9SA 3SB4A 4R6JA 1FQVA 4BSSA 2UZXA 3GOZA 4M7EC 5AWBA 1P9AG 3A79B 5LFNA 5B4PA 1K5DC 4PSJA 4XGOA 3E3ZA 4L3FA 3WPCA 5GMFA 1FO1A 4FS7A 2OMZA 4LSXA 3KJ4A 4CC4A 4R07A 4HQ1A 2BNHA 2JE1A 4LXSA 1PGVA 3RGZA 4U08A 4GLPA 3FXIA 4R0AA 4ECNA 4FHOA 4Q3IA 3RFJA 3RW7A 2Z66A 3OJAA 4G8AA 3VQ2A 4PEQB 4V2EA 1OTMA 4I6JB 4CNCA 5AWAA 1M9LA 1O6SA 4BSRA 4R6GA 3W3GA 5AWDA 3C6OB 4ECOA 1XKUA 2JQDA 5CMNA 3ULVA 2OMVA 2UZYA 4LSXC 4R09A 4CC4C 1H6TA 2WQUA 3G39A 1FS2A 4YEBB 1DFJI 4LXRA 3WN4A 4R6AA 3OJAB 3W3LA 2O6QA 4TZHA 2P1PB 2V9TB 5IYXC 4R58A 4GT6A 2Z64A 4OQTA 4FDWA 3CVRA 3BZ5A 4WP6A 1WWLA 5CMPA 1FT8A 2OMTA 5AZ5A 3W3MA 2WQWA 1OOKG 2FT3A 2Z82A 3M19A 1D0BA 3ULUA 3OGLB 2A0ZA 3UL7A 4BV4R 2IFGA 4KXFB 5GMGA 3DZEA 1OTNA 3W3JA 1JL5A 4R5CA 4CP6A 4MN8B 2Z7XA 3UL9A 4RCWA 1DS9A 1O6VA 2V9SA 4H09A 1OTOA 2RA8A 5IJDA 4NKGA 4KT1A 2ELLA 4P91A 2WQXA 5GS2B 5D3IA 4PERA 4Z61C 4FCGA 4XOSA 3C6NB 4R5DA 4RCAB 2JE0A 1H6UA 5B0NA 4C2BB 1QYYA 2R9UA 4UFRA 4FD0A 4LI1A 4Z94G 4M7EA 1A4YA 4LSCA 1K5GC 3RJ0A 3RGXA 3G04C 4PKIG 4QC0A 4EZGA 2Z7XB 4Y61B 5B0TA 5HZLB 2P1OB 4WYKA 2Y5QA 4Q3GA 3WPFA 1OZNA 4CILA 2OMUA 3E6JA 4ARRA 4ARNA 4B8CD 3ZYJA 1LTXA 2CA6A 4KNGA 5FTTB 1GWBA 3WPIA 4AW4A 2ASSB 4U09A 4Z8GA 4NZRM 1XCDA 1XEUA 2Z63A 3CIGA 3E4GA 2O6SA 2WQVA 2Q4GW 2XWTC 1U0ND 4J0MA 2OMWA 2ASTB 2RR6A 1Z7XW 3RFEA 3P72A 2XOTA 4V2DA 3C6PB 3WPDA 3UL8A 4BSUA 3RFSA 4Q62A 3TSRE 3REZA 3G3AA 1OGQA 4Z79A 4R08A 4Z64C 2Z81A 3ZYIA 2OMXA 3ZYOA 1KOOA 2P1NB 4U7LA 3WPGA 3JB9j 5AWCA 4L3AA 3G06A 4LI2A 2BEXA 1G9UA 1W8AA 4FMZA 5GS0A 3ZYNA 2V70A 3ULAA 3OGKB 2ID5A 4J4LA 4C2AB 3M18A 1P8TA 3O53A 3RIZA 4V2CA 3VQ1A 3W3NA 5HDHA 1SQ0B 4QXEA 4LSAA 4MQWX 5GQRK 5IJBA 2OMYA 3CIYA 4IM6A 3RW6A 4RWTC 1DCEA 1ZIWA 2Z65A 3UN9A 4R6FA 1M10B 5A5CA 3WPHA 4QBZA 1O6TA 1M0ZA 2P1QB 3WPBA 3PMHG 2WFHA 2Z62A 1XWDC 1KOHA 2O6RA 1A9NA 1YRGA 3G3BA 4P8SA 4U06A 3OGMB 3WPEA 1IO0A 4AY9X 4K17A 5IJCA 3W3KA 4XSQA
chains in the Genus database with same CATH topology
1P8VA 3E2JA 5GMHA 3O6NA 2P1MB 4NKHA 4PQ8A 4CNMA 1XECA 1M9SA 3SB4A 4R6JA 1FQVA 4BSSA 2UZXA 3GOZA 4M7EC 5AWBA 1P9AG 3A79B 5LFNA 5B4PA 1K5DC 4PSJA 4XGOA 3E3ZA 4L3FA 3WPCA 5GMFA 1FO1A 4FS7A 2OMZA 4LSXA 3KJ4A 4CC4A 4R07A 4HQ1A 2BNHA 2JE1A 4LXSA 1PGVA 3RGZA 4U08A 4GLPA 3FXIA 4R0AA 4ECNA 4FHOA 4Q3IA 3RFJA 3RW7A 2Z66A 3OJAA 4G8AA 3VQ2A 4PEQB 4V2EA 1OTMA 4I6JB 4CNCA 5AWAA 1M9LA 1O6SA 4BSRA 4R6GA 3W3GA 5AWDA 3C6OB 4ECOA 1XKUA 2JQDA 5CMNA 3ULVA 2OMVA 2UZYA 4LSXC 4R09A 4CC4C 1H6TA 2WQUA 3G39A 1FS2A 4YEBB 1DFJI 4LXRA 3WN4A 4R6AA 3OJAB 3W3LA 2O6QA 4TZHA 2P1PB 2V9TB 5IYXC 4R58A 4GT6A 2Z64A 4OQTA 4FDWA 3CVRA 3BZ5A 4WP6A 1WWLA 5CMPA 1FT8A 2OMTA 5AZ5A 3W3MA 2WQWA 1OOKG 2FT3A 2Z82A 3M19A 1D0BA 3ULUA 3OGLB 2A0ZA 3UL7A 4BV4R 2IFGA 4KXFB 5GMGA 3DZEA 1OTNA 3W3JA 1JL5A 4R5CA 4CP6A 4MN8B 2Z7XA 3UL9A 4RCWA 1DS9A 1O6VA 2V9SA 4H09A 1OTOA 2RA8A 5IJDA 4NKGA 4KT1A 2ELLA 4P91A 2WQXA 5GS2B 5D3IA 4PERA 4Z61C 4FCGA 4XOSA 3C6NB 4R5DA 4RCAB 2JE0A 1H6UA 5B0NA 4C2BB 1QYYA 2R9UA 4UFRA 4FD0A 4LI1A 4Z94G 4M7EA 1A4YA 4LSCA 1K5GC 3RJ0A 3RGXA 3G04C 4PKIG 4QC0A 4EZGA 2Z7XB 4Y61B 5B0TA 5HZLB 2P1OB 4WYKA 2Y5QA 4Q3GA 3WPFA 1OZNA 4CILA 2OMUA 3E6JA 4ARRA 4ARNA 4B8CD 3ZYJA 1LTXA 2CA6A 4KNGA 5FTTB 1GWBA 3WPIA 4AW4A 2ASSB 4U09A 4Z8GA 1XCDA 1XEUA 2Z63A 3CIGA 3E4GA 2O6SA 2WQVA 2Q4GW 2XWTC 1U0ND 4J0MA 2OMWA 2ASTB 2RR6A 1Z7XW 3RFEA 3P72A 2XOTA 4V2DA 3C6PB 3WPDA 3UL8A 4BSUA 3RFSA 4Q62A 3TSRE 3REZA 3G3AA 1OGQA 4Z79A 4R08A 4Z64C 2Z81A 3ZYIA 2OMXA 3ZYOA 1KOOA 2P1NB 4U7LA 3WPGA 3JB9j 5AWCA 4L3AA 3G06A 4LI2A 2BEXA 1G9UA 1W8AA 4FMZA 5GS0A 3ZYNA 2V70A 3ULAA 3OGKB 2ID5A 4J4LA 4C2AB 3M18A 1P8TA 3O53A 3RIZA 4V2CA 3VQ1A 3W3NA 5HDHA 1SQ0B 4QXEA 4LSAA 4MQWX 5GQRK 5IJBA 2OMYA 3CIYA 4IM6A 3RW6A 4RWTC 1DCEA 1ZIWA 2Z65A 3UN9A 4R6FA 1M10B 5A5CA 3WPHA 4QBZA 1O6TA 1M0ZA 2P1QB 3WPBA 3PMHG 2WFHA 2Z62A 1XWDC 1KOHA 2O6RA 1A9NA 1YRGA 3G3BA 4P8SA 4U06A 3OGMB 3WPEA 1IO0A 4AY9X 4K17A 5IJCA 3W3KA 4XSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P8V A;  3E2J A;  5GMH A;  3O6N A;  2P1M B;  4NKH A;  4PQ8 A;  4CNM A;  1XEC A;  1M9S A;  3SB4 A;  4R6J A;  1FQV A;  4BSS A;  2UZX A;  3GOZ A;  4M7E C;  5AWB A;  1P9A G;  3A79 B;  5LFN A;  5B4P A;  1K5D C;  4PSJ A;  4XGO A;  3E3Z A;  4L3F A;  3WPC A;  5GMF A;  1FO1 A;  4FS7 A;  2OMZ A;  4LSX A;  3KJ4 A;  4CC4 A;  4R07 A;  4HQ1 A;  2BNH A;  2JE1 A;  4LXS A;  1PGV A;  3RGZ A;  4U08 A;  4GLP A;  3FXI A;  4R0A A;  4ECN A;  4FHO A;  4Q3I A;  3RFJ A;  3RW7 A;  2Z66 A;  3OJA A;  4G8A A;  3VQ2 A;  4PEQ B;  4V2E A;  1OTM A;  4I6J B;  4CNC A;  5AWA A;  1M9L A;  1O6S A;  4BSR A;  4R6G A;  3W3G A;  5AWD A;  3C6O B;  4ECO A;  1XKU A;  2JQD A;  5CMN A;  3ULV A;  2OMV A;  2UZY A;  4LSX C;  4R09 A;  4CC4 C;  1H6T A;  2WQU A;  3G39 A;  1FS2 A;  4YEB B;  1DFJ I;  4LXR A;  3WN4 A;  4R6A A;  3OJA B;  3W3L A;  2O6Q A;  4TZH A;  2P1P B;  2V9T B;  5IYX C;  4R58 A;  4GT6 A;  2Z64 A;  4OQT A;  4FDW A;  3CVR A;  3BZ5 A;  4WP6 A;  1WWL A;  5CMP A;  1FT8 A;  2OMT A;  5AZ5 A;  3W3M A;  2WQW A;  1OOK G;  2FT3 A;  2Z82 A;  3M19 A;  1D0B A;  3ULU A;  3OGL B;  2A0Z A;  3UL7 A;  4BV4 R;  2IFG A;  4KXF B;  5GMG A;  3DZE A;  1OTN A;  3W3J A;  1JL5 A;  4R5C A;  4CP6 A;  4MN8 B;  2Z7X A;  3UL9 A;  4RCW A;  1DS9 A;  1O6V A;  2V9S A;  4H09 A;  1OTO A;  2RA8 A;  5IJD A;  4NKG A;  4KT1 A;  2ELL A;  4P91 A;  2WQX A;  5GS2 B;  5D3I A;  4PER A;  4Z61 C;  4FCG A;  4XOS A;  3C6N B;  4R5D A;  4RCA B;  2JE0 A;  1H6U A;  5B0N A;  4C2B B;  1QYY A;  2R9U A;  4UFR A;  4FD0 A;  4LI1 A;  4Z94 G;  4M7E A;  1A4Y A;  4LSC A;  1K5G C;  3RJ0 A;  3RGX A;  3G04 C;  4PKI G;  4QC0 A;  4EZG A;  2Z7X B;  4Y61 B;  5B0T A;  5HZL B;  2P1O B;  4WYK A;  2Y5Q A;  4Q3G A;  3WPF A;  1OZN A;  4CIL A;  2OMU A;  3E6J A;  4ARR A;  4ARN A;  4B8C D;  3ZYJ A;  1LTX A;  2CA6 A;  4KNG A;  5FTT B;  1GWB A;  3WPI A;  4AW4 A;  2ASS B;  4U09 A;  4Z8G A;  1XCD A;  1XEU A;  2Z63 A;  3CIG A;  3E4G A;  2O6S A;  2WQV A;  2Q4G W;  2XWT C;  1U0N D;  4J0M A;  2OMW A;  2AST B;  2RR6 A;  1Z7X W;  3RFE A;  3P72 A;  2XOT A;  4V2D A;  3C6P B;  3WPD A;  3UL8 A;  4BSU A;  3RFS A;  4Q62 A;  3TSR E;  3REZ A;  3G3A A;  1OGQ A;  4Z79 A;  4R08 A;  4Z64 C;  2Z81 A;  3ZYI A;  2OMX A;  3ZYO A;  1KOO A;  2P1N B;  4U7L A;  3WPG A;  3JB9 j;  5AWC A;  4L3A A;  3G06 A;  4LI2 A;  2BEX A;  1G9U A;  1W8A A;  4FMZ A;  5GS0 A;  3ZYN A;  2V70 A;  3ULA A;  3OGK B;  2ID5 A;  4J4L A;  4C2A B;  3M18 A;  1P8T A;  3O53 A;  3RIZ A;  4V2C A;  3VQ1 A;  3W3N A;  5HDH A;  1SQ0 B;  4QXE A;  4LSA A;  4MQW X;  5GQR K;  5IJB A;  2OMY A;  3CIY A;  4IM6 A;  3RW6 A;  4RWT C;  1DCE A;  1ZIW A;  2Z65 A;  3UN9 A;  4R6F A;  1M10 B;  5A5C A;  3WPH A;  4QBZ A;  1O6T A;  1M0Z A;  2P1Q B;  3WPB A;  3PMH G;  2WFH A;  2Z62 A;  1XWD C;  1KOH A;  2O6R A;  1A9N A;  1YRG A;  3G3B A;  4P8S A;  4U06 A;  3OGM B;  3WPE A;  1IO0 A;  4AY9 X;  4K17 A;  5IJC A;  3W3K A;  4XSQ A; 
#chains in the Genus database with same CATH topology
 1P8V A;  3E2J A;  4NZT M;  5GMH A;  3O6N A;  2P1M B;  4NKH A;  4PQ8 A;  4CNM A;  1XEC A;  1M9S A;  3SB4 A;  4R6J A;  1FQV A;  4BSS A;  2UZX A;  3GOZ A;  4M7E C;  5AWB A;  1P9A G;  3A79 B;  5LFN A;  5B4P A;  1K5D C;  4PSJ A;  4XGO A;  3E3Z A;  4L3F A;  3WPC A;  5GMF A;  1FO1 A;  4FS7 A;  2OMZ A;  4LSX A;  3KJ4 A;  4CC4 A;  4R07 A;  4HQ1 A;  2BNH A;  2JE1 A;  4LXS A;  1PGV A;  3RGZ A;  4U08 A;  4GLP A;  3FXI A;  4R0A A;  4ECN A;  4FHO A;  4Q3I A;  3RFJ A;  3RW7 A;  2Z66 A;  3OJA A;  4G8A A;  3VQ2 A;  4PEQ B;  4V2E A;  1OTM A;  4I6J B;  4CNC A;  5AWA A;  1M9L A;  1O6S A;  4BSR A;  4R6G A;  3W3G A;  5AWD A;  3C6O B;  4ECO A;  1XKU A;  2JQD A;  5CMN A;  3ULV A;  2OMV A;  2UZY A;  4LSX C;  4R09 A;  4CC4 C;  1H6T A;  2WQU A;  3G39 A;  1FS2 A;  4YEB B;  1DFJ I;  4LXR A;  3WN4 A;  4R6A A;  3OJA B;  3W3L A;  2O6Q A;  4TZH A;  2P1P B;  2V9T B;  5IYX C;  4R58 A;  4GT6 A;  2Z64 A;  4OQT A;  4FDW A;  3CVR A;  3BZ5 A;  4WP6 A;  1WWL A;  5CMP A;  1FT8 A;  2OMT A;  5AZ5 A;  3W3M A;  2WQW A;  1OOK G;  2FT3 A;  2Z82 A;  3M19 A;  1D0B A;  3ULU A;  3OGL B;  2A0Z A;  3UL7 A;  4BV4 R;  2IFG A;  4KXF B;  5GMG A;  3DZE A;  1OTN A;  3W3J A;  1JL5 A;  4R5C A;  4CP6 A;  4MN8 B;  2Z7X A;  3UL9 A;  4RCW A;  1DS9 A;  1O6V A;  2V9S A;  4H09 A;  1OTO A;  2RA8 A;  5IJD A;  4NKG A;  4KT1 A;  2ELL A;  4P91 A;  2WQX A;  5GS2 B;  5D3I A;  4PER A;  4Z61 C;  4FCG A;  4XOS A;  3C6N B;  4R5D A;  4RCA B;  2JE0 A;  1H6U A;  5B0N A;  4C2B B;  1QYY A;  2R9U A;  4UFR A;  4FD0 A;  4LI1 A;  4Z94 G;  4M7E A;  1A4Y A;  4LSC A;  1K5G C;  3RJ0 A;  3RGX A;  3G04 C;  4PKI G;  4QC0 A;  4EZG A;  2Z7X B;  4Y61 B;  5B0T A;  5HZL B;  2P1O B;  4WYK A;  2Y5Q A;  4Q3G A;  3WPF A;  1OZN A;  4CIL A;  2OMU A;  3E6J A;  4ARR A;  4ARN A;  4B8C D;  3ZYJ A;  1LTX A;  2CA6 A;  4KNG A;  5FTT B;  1GWB A;  3WPI A;  4AW4 A;  2ASS B;  4U09 A;  4Z8G A;  4NZR M;  1XCD A;  1XEU A;  2Z63 A;  3CIG A;  3E4G A;  2O6S A;  2WQV A;  2Q4G W;  2XWT C;  1U0N D;  4J0M A;  2OMW A;  2AST B;  2RR6 A;  1Z7X W;  3RFE A;  3P72 A;  2XOT A;  4V2D A;  3C6P B;  3WPD A;  3UL8 A;  4BSU A;  3RFS A;  4Q62 A;  3TSR E;  3REZ A;  3G3A A;  1OGQ A;  4Z79 A;  4R08 A;  4Z64 C;  2Z81 A;  3ZYI A;  2OMX A;  3ZYO A;  1KOO A;  2P1N B;  4U7L A;  3WPG A;  3JB9 j;  5AWC A;  4L3A A;  3G06 A;  4LI2 A;  2BEX A;  1G9U A;  1W8A A;  4FMZ A;  5GS0 A;  3ZYN A;  2V70 A;  3ULA A;  3OGK B;  2ID5 A;  4J4L A;  4C2A B;  3M18 A;  1P8T A;  3O53 A;  3RIZ A;  4V2C A;  3VQ1 A;  3W3N A;  5HDH A;  1SQ0 B;  4QXE A;  4LSA A;  4MQW X;  5GQR K;  5IJB A;  2OMY A;  3CIY A;  4IM6 A;  3RW6 A;  4RWT C;  1DCE A;  1ZIW A;  2Z65 A;  3UN9 A;  4R6F A;  1M10 B;  5A5C A;  3WPH A;  4QBZ A;  1O6T A;  1M0Z A;  2P1Q B;  3WPB A;  3PMH G;  2WFH A;  2Z62 A;  1XWD C;  1KOH A;  2O6R A;  1A9N A;  1YRG A;  3G3B A;  4P8S A;  4U06 A;  3OGM B;  3WPE A;  1IO0 A;  4AY9 X;  4K17 A;  5IJC A;  3W3K A;  4XSQ A; 
#chains in the Genus database with same CATH homology
 1P8V A;  3E2J A;  5GMH A;  3O6N A;  2P1M B;  4NKH A;  4PQ8 A;  4CNM A;  1XEC A;  1M9S A;  3SB4 A;  4R6J A;  1FQV A;  4BSS A;  2UZX A;  3GOZ A;  4M7E C;  5AWB A;  1P9A G;  3A79 B;  5LFN A;  5B4P A;  1K5D C;  4PSJ A;  4XGO A;  3E3Z A;  4L3F A;  3WPC A;  5GMF A;  1FO1 A;  4FS7 A;  2OMZ A;  4LSX A;  3KJ4 A;  4CC4 A;  4R07 A;  4HQ1 A;  2BNH A;  2JE1 A;  4LXS A;  1PGV A;  3RGZ A;  4U08 A;  4GLP A;  3FXI A;  4R0A A;  4ECN A;  4FHO A;  4Q3I A;  3RFJ A;  3RW7 A;  2Z66 A;  3OJA A;  4G8A A;  3VQ2 A;  4PEQ B;  4V2E A;  1OTM A;  4I6J B;  4CNC A;  5AWA A;  1M9L A;  1O6S A;  4BSR A;  4R6G A;  3W3G A;  5AWD A;  3C6O B;  4ECO A;  1XKU A;  2JQD A;  5CMN A;  3ULV A;  2OMV A;  2UZY A;  4LSX C;  4R09 A;  4CC4 C;  1H6T A;  2WQU A;  3G39 A;  1FS2 A;  4YEB B;  1DFJ I;  4LXR A;  3WN4 A;  4R6A A;  3OJA B;  3W3L A;  2O6Q A;  4TZH A;  2P1P B;  2V9T B;  5IYX C;  4R58 A;  4GT6 A;  2Z64 A;  4OQT A;  4FDW A;  3CVR A;  3BZ5 A;  4WP6 A;  1WWL A;  5CMP A;  1FT8 A;  2OMT A;  5AZ5 A;  3W3M A;  2WQW A;  1OOK G;  2FT3 A;  2Z82 A;  3M19 A;  1D0B A;  3ULU A;  3OGL B;  2A0Z A;  3UL7 A;  4BV4 R;  2IFG A;  4KXF B;  5GMG A;  3DZE A;  1OTN A;  3W3J A;  1JL5 A;  4R5C A;  4CP6 A;  4MN8 B;  2Z7X A;  3UL9 A;  4RCW A;  1DS9 A;  1O6V A;  2V9S A;  4H09 A;  1OTO A;  2RA8 A;  5IJD A;  4NKG A;  4KT1 A;  2ELL A;  4P91 A;  2WQX A;  5GS2 B;  5D3I A;  4PER A;  4Z61 C;  4FCG A;  4XOS A;  3C6N B;  4R5D A;  4RCA B;  2JE0 A;  1H6U A;  5B0N A;  4C2B B;  1QYY A;  2R9U A;  4UFR A;  4FD0 A;  4LI1 A;  4Z94 G;  4M7E A;  1A4Y A;  4LSC A;  1K5G C;  3RJ0 A;  3RGX A;  3G04 C;  4PKI G;  4QC0 A;  4EZG A;  2Z7X B;  4Y61 B;  5B0T A;  5HZL B;  2P1O B;  4WYK A;  2Y5Q A;  4Q3G A;  3WPF A;  1OZN A;  4CIL A;  2OMU A;  3E6J A;  4ARR A;  4ARN A;  4B8C D;  3ZYJ A;  1LTX A;  2CA6 A;  4KNG A;  5FTT B;  1GWB A;  3WPI A;  4AW4 A;  2ASS B;  4U09 A;  4Z8G A;  1XCD A;  1XEU A;  2Z63 A;  3CIG A;  3E4G A;  2O6S A;  2WQV A;  2Q4G W;  2XWT C;  1U0N D;  4J0M A;  2OMW A;  2AST B;  2RR6 A;  1Z7X W;  3RFE A;  3P72 A;  2XOT A;  4V2D A;  3C6P B;  3WPD A;  3UL8 A;  4BSU A;  3RFS A;  4Q62 A;  3TSR E;  3REZ A;  3G3A A;  1OGQ A;  4Z79 A;  4R08 A;  4Z64 C;  2Z81 A;  3ZYI A;  2OMX A;  3ZYO A;  1KOO A;  2P1N B;  4U7L A;  3WPG A;  3JB9 j;  5AWC A;  4L3A A;  3G06 A;  4LI2 A;  2BEX A;  1G9U A;  1W8A A;  4FMZ A;  5GS0 A;  3ZYN A;  2V70 A;  3ULA A;  3OGK B;  2ID5 A;  4J4L A;  4C2A B;  3M18 A;  1P8T A;  3O53 A;  3RIZ A;  4V2C A;  3VQ1 A;  3W3N A;  5HDH A;  1SQ0 B;  4QXE A;  4LSA A;  4MQW X;  5GQR K;  5IJB A;  2OMY A;  3CIY A;  4IM6 A;  3RW6 A;  4RWT C;  1DCE A;  1ZIW A;  2Z65 A;  3UN9 A;  4R6F A;  1M10 B;  5A5C A;  3WPH A;  4QBZ A;  1O6T A;  1M0Z A;  2P1Q B;  3WPB A;  3PMH G;  2WFH A;  2Z62 A;  1XWD C;  1KOH A;  2O6R A;  1A9N A;  1YRG A;  3G3B A;  4P8S A;  4U06 A;  3OGM B;  3WPE A;  1IO0 A;  4AY9 X;  4K17 A;  5IJC A;  3W3K A;  4XSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...