4AYBL

Rnap at 3.2ang
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
91
structure length
91
Chain Sequence
MEIKILKSESNYLELEIEGEDHTLGNLIAGTLRKISGVSFASYYQPHPLTDKIIVKILTDGSIAPKDALLKAIETVRVMASHYIDEIKGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
pubmed doi rcsb
molecule tags Transferase
total genus 24
structure length 91
sequence length 91
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4aybL00
3GTJK 4LK1A 3M3YK 1TWGC 3GTGC 4A3MK 5TMCA 3GTJC 5C3EK 3M3YC 3H0GK 3RZOK 2A6EA 4JK1A 4G7ZA 3HOZK 2WAQL 4A3MC 2CW0A 4QIWD 5C3EC 3H0GC 2PMZD 3RZOC 1TWHK 4A3DK 4BY1K 3HOVC 4A3JK 3S17K 3S16K 5IP9K 2PA8L 1TWHC 4BBRK 4XSXA 4BY1C 5IP7K 1TWFC 4A3JC 4A3DC 2JA6K 4AYBL 2O5JA 2Y0SD 3RZDK 3WODA 3S17C 3S16C 5IP9C 3FKIK 3HKZD 2R93K 4BBRC 5IP7C 2JA6C 5D4DA 3RZDC 4Y52K 2PA8D 4A93K 3FKIC 2R93C 4LK0A 4QJVA 1Y1VK 1Y1WK 4KMUA 4Y52C 4A93C 1ZYRA 1Y1VC 1Y1WC 3PO2K 2E2JK 4X6AK 5C4JK 4G7OA 4A3KK 2E2IK 5IYBK 3GTPK 3PO2C 2E2JC 2E2HK 1YNJA 4LJZA 5C4JC 2O5IA 3HOVK 4A3KC 4X6AC 1IW7A 2E2IC 5IYBC 5FLMK 3GTPC 2PPBA 3HOXK 4OINA 1TWFK 2E2HC 2VUMK 1SFOK 3HOYK 3S2HK 5FLMC 3HOXC 2R7ZK 2WAQD 2VUMC 4XLPA 1SFOC 3GTMK 3HOYC 4Q5SA 5C44K 3S2HC 2NVYK 4OIOA 4Q4ZA 2NVTK 1WCMK 5TMFA 2R7ZC 4GZYA 4BY7K 4BXXK 4A3GK 3GTMC 5IYCK 5C44C 3S1QK 4KN4A 2NVYC 2WB1L 2NVTC 3PO3K 4A3BK 1WCMC 1YNNA 4A3IK 4BY7C 4BXXC 4AYBD 5M3FK 4A3GC 1I3QK 1TWCK 3HOWK 5IYCC 3S1QC 3H3VL 3PO3C 4A3BC 1I6HK 4A3IC 5C4XK 3M4OK 1I3QC 1TWCC 4KN7A 4NOIA 3HOWC 1TWAK 5M3MK 3S1RC 5IYDK 1I6HC 1BDFA 2A69A 5C4XC 3M4OC 4C2MK 2JA7C 1TWAC 4XSZA 4XLNA 5IYDC 4YFXA 2R92K 5M5YK 3S1MK 1SMYA 3EQLA 4A3CK 2R92C 2NVQC 4BBSK 4OIPA 3S1MC 4YG2A 4A3FK 2YU9K 4A3CC 5M5XK 1HQMA 4LLGA 3I4MK 4BBSC 2A6HA 4A3FC 1I50K 2YU9C 4QIWL 4C3JK 3CQZK 3GTQK 3GTKK 3I4MC 3GTOK 2PMZL 4A3LK 4YFKA 3HOUC 1I50C 1R9TK 4OIRA 2B63K 3GTKC 3CQZC 3GTLK 3S1RK 3GTQC 3GTOC 3I4NK 4A3LC 3S14K 4MQ9A 1R9TC 4OIQA 2B63C 2JA7K 2Y0SL 2WB1D 3GTLC 5FJ8K 2NVXK 3I4NC 3HKZL 3S14C 3HOZC 3K7AK 4MEXA 1I6VA 2JA8K 3H3VD 2NVXC 3S1NK 4Y7NK 4QJVB 2A68A 3DXJA 2NVQK 4A3EK 1K83K 3K7AC 5M5WK 4ZH4A 2JA8C 1XPPA 4C3HK 4C3IK 4Y7NC 3S15K 3S2DK 3S1NC 4A3EC 1K83C 4YFNA 4MEYA 4G7HA 2JA5K 3S15C 3S2DC 2BE5A 1TWGK 3GTGK 2JA5C 3HOUK
chains in the Genus database with same CATH superfamily
4LK1A 1J6VA 3GTJC 4P9SA 4KMHA 1BS2A 1ZVUA 2PMZD 2E2IA 4A3DK 3HOVC 2E2HA 2FQTA 1JOEA 3TFHA 4AYBL 3RZDK 3WODA 1G51A 5IP9C 4J3NA 1XZPA 3GTMA 4A93K 3FKIC 1X31C 2R93C 2R93A 3A8IA 3MMLB 4Y52C 1O28A 1WOPA 3A8KA 4WILA 1YNJA 4X6AC 4KATA 3GTPC 1XXCA 2VUMK 1SFOK 1WIHA 3GSIA 3HOXC 2R7ZK 4P5BA 4XLPA 4GTAA 2V6UA 4Q4ZA 5TMFA 1F7VA 3IPJA 5IYCK 3PO3K 1WCMC 1WCMA 4A3GC 1USOA 1TWCK 3HOWK 3S1QC 1I6HK 5C4XK 1DCOA 3M4OK 3FOEA 1BDFA 2A69A 1O24A 2RH6A 2NVXA 4YFXA 1O2FB 1SMYA 4G0UA 4A3CK 2R92C 2NVQC 4OIPA 2R92A 1ZQ1C 3N0BA 3AD7C 5M5XK 2YU9C 4C3JK 2YU9A 1HI9A 3GTOK 2JH3A 3GDZA 3HOUC 2XCRB 4WJ4A 1IL2A 2B63K 3CQZC 3GTLK 3S1RK 3GTKC 3S0XA 4OIQA 4KM8A 2JA7K 3S14C 3N3YA 5L46A 1I6VA 4QJVB 2A68A 1K83K 2V6TA 5EGEA 3S1NC 4C3IK 2D6FC 5CJ9A 4MEYA 3QX3A 1WORA 3ADAC 2JA5C 2JA5A 3M3YK 3LAPA 3GTGC 4A3MK 3H0GK 1JVIA 4JK1A 4G7ZA 2WAQL 1XXBA 5C3EC 3RZOC 1TWHK 4BY1K 4KMDA 4KB4A 4A3JK 1JQWA 2PA8L 4XSXA 5IP7K 3LPXA 2Y0SD 1SFOA 3S17C 3S16C 3HKZD 4BBRC 2R7ZA 2JA6C 2PA8D 1Y1VK 1O2AA 4KMUA 3OEPA 1Y1WC 1Y1WA 4G7OA 3LAJA 3PO2C 2E2JC 4LJZA 1L0WA 5C4JC 4A3KC 2E2IC 5IYBC 5FLMK 1AB4A 2E2HC 3HOYK 1WSVA 4KC6A 1O27A 1O29A 4KASA 3S2HC 2NVYK 2NVTK 3GTMC 5C44C 1XXAA 4A3IK 4BY7C 4BXXC 4AYBD 1O26A 4A3BC 3GTOA 1I3QC 4XCHA 1I3QA 1TWAK 1DD5A 3S1RC 3GTLA 2B63A 5IYDK 1EFWA 4C2MK 2JA7C 4GTLA 2JA7A 2EBBA 5M5YK 3S1MK 1EQRA 1K83A 4A3FK 4BBSC 1WOSA 2A6HA 4KARA 5HL8A 3BUEA 4QIWL 3GTQK 4A3LK 1O2BA 3VA7A 3I4MC 3GIRA 1I50C 1XZQA 1R9TK 4Q5SA 1I50A 1XZPB 1B4AA 3I4NC 3H0GA 1PJ6A 2GSUA 2PHCB 4MEXA 4RMFA 2NVXC 4G0WA 1ISEA 1TWHA 3K7AC 4ZH4A 2JA8C 3S15K 4Y7NC 4GT9A 4A3EC 2KWAA 4G7HA 1IS1A 3S2DC 4C3HC 1VGXA 3TFIA 3G4CA 1KQ4A 1BJTA 3GTJK 1TWGC 3FOFA 1IQ0A 1TWGA 5TMCA 2A6EA 3CAGA 3HOZK 2CW0A 1IBAA 3BP3A 5IP9K 3OPFA 1XZQB 4A3DC 4KDDA 3FKIK 2R93K 4WJ3M 3SZYA 3RZDC 4Y52K 3T02A 3TTGA 2NVYA 4LK0A 2Y3PA 1J98A 4A93C 1EK8A 1ZYRA 2GAGC 4X6AK 5TJ3A 3AH5A 3GTPK 4GTCA 4BLAA 1TWAA 3AQPA 4P5AA 2PPBA 3HOXK 1VH2A 1TWFK 2WAQD 3V4GA 2VUMC 1SFOC 2GAHC 4FZBA 2VUMA 1WCMK 2P5MA 3Q3QA 2R7ZC 4A3GK 5IOQA 1O25A 3S1QK 4KN4A 2WB1L 2XCQA 4KAWX 1USMA 1DCPA 5M3FK 5IYCC 3H3VL 2ZFZA 3GTQA 3PO3C 3JSTA 4PABA 4DDQA 4KB2A 1TWCC 4KN7A 5IOSA 3BP8C 1TWCA 3HOWC 1DCHA 1I6HC 1IE0A 5C4XC 3M4OC 4ILDA 1INNA 1PJ5A 5IORA 4XSZA 4XLNA 2R92K 5JVOA 3EQLA 1WSRA 4FM9A 3AQOA 4KMAA 2XCOA 2P8TA 5CHPA 2YU9K 1F93A 4A3CC 4LLGA 4KM9A 3GTKK 1YX2A 3CQZK 2PMZL 4OIRA 4C3JC 5JFEA 3GTJA 3GTOC 3S14K 3A8JA 4MQ9A 2B63C 3GTLC 3HOZC 3S1NK 4BKWA 1BGWA 1F7UA 1K83C 1UV7A 3GEHA 2JA5K 4GTFA 2BE5A 4C3IC 3FKIA 3GTGK 1ZBSA 4AH6A 1C0AA 4LOWA 5C3EK 3M3YC 3RZOK 4A3MC 4GTEA 4QIWD 3H0GC 3G4AA 3GTPA 3S17K 2ZUFA 3S16K 3T01A 1TWHC 4BBRK 4BY1C 1TWFC 1YCLA 4A3JC 2JA6K 1TWFA 2O5JA 5IOTA 2CFAA 5IP7C 2RGRA 5D4DA 2V6SA 5EGHA 1V5VA 3NUHA 4QJVA 1Y1WK 2GSNA 1Y1VC 3PO2K 1Y1VA 2E2JK 5C4JK 4A3KK 2E2IK 5IYBK 4LR2A 3HOVK 2E2HK 2O5IA 4C45A 3AD8C 1IW7A 1J6XA 4OINA 3S2HK 5FLMC 3L4JA 2ZUEA 1VLOA 3HOYC 3GTMK 1GE9A 5C44K 2FQOA 1EI6A 4OIOA 4GZYA 4BY7K 4BXXK 2NVYC 2NVTC 4A3BK 2GSOA 1YNNA 3AD9C 1I3QK 1VJEA 3GTKA 3CQZA 4A3IC 1B4BA 4NOIA 2CFAB 1J6WA 5M3MK 4GTDA 4O2DA 1TWAC 3TFJA 5IYDC 3FHZA 4GFQA 3SZZA 1ZXOA 4C2MC 4M1XA 1WQHA 1VRQC 4BBSK 3N0CA 1F9NA 3S1MC 4YG2A 4PAAA 1HQMA 3I4MK 3T00A 4A3FC 1I50K 1WOOA 3GEIA 4YFKA 4G0VA 3GTGA 3GTQC 4BLBA 4A3LC 3I4NK 3ERED 2W7VA 3GEEA 1R9TC 1R9TA 2Y0SL 2WB1D 5FJ8K 2NVXK 3HKZL 3L4KA 4GTBA 1WQFA 3K7AK 3H3VD 2JA8K 4Y7NK 1EH1A 3DXJA 2NVQK 4A3EK 3HXAA 5M5WK 1XPPA 4C3HK 3S2DK 4YFNA 3OREA 2JA6A 5E68A 3S15C 1PJ7A 1TWGK 1WQGA 1RU0A 4LQYA 3HOUK
chains in the Genus database with same CATH topology
3GTJK 4LK1A 3M3YK 1TWGC 3GTGC 4A3MK 5TMCA 3GTJC 5C3EK 3M3YC 3H0GK 3RZOK 2A6EA 4JK1A 4G7ZA 3HOZK 2WAQL 4A3MC 2CW0A 4QIWD 5C3EC 3H0GC 2PMZD 3RZOC 1TWHK 4A3DK 4BY1K 3HOVC 4A3JK 3S17K 3S16K 5IP9K 2PA8L 1TWHC 4BBRK 4XSXA 4BY1C 5IP7K 1TWFC 4A3JC 4A3DC 2JA6K 4AYBL 2O5JA 2Y0SD 3RZDK 3WODA 3S17C 3S16C 5IP9C 3FKIK 3HKZD 2R93K 4BBRC 5IP7C 2JA6C 5D4DA 3RZDC 4Y52K 2PA8D 4A93K 3FKIC 2R93C 4LK0A 4QJVA 1Y1VK 1Y1WK 4KMUA 4Y52C 4A93C 1ZYRA 1Y1VC 1Y1WC 3PO2K 2E2JK 4X6AK 5C4JK 4G7OA 4A3KK 2E2IK 5IYBK 3GTPK 3PO2C 2E2JC 2E2HK 1YNJA 4LJZA 5C4JC 2O5IA 3HOVK 4A3KC 4X6AC 1IW7A 2E2IC 5IYBC 5FLMK 3GTPC 2PPBA 3HOXK 4OINA 1TWFK 2E2HC 2VUMK 1SFOK 3HOYK 3S2HK 5FLMC 3HOXC 2R7ZK 2WAQD 2VUMC 4XLPA 1SFOC 3GTMK 3HOYC 4Q5SA 5C44K 3S2HC 2NVYK 4OIOA 4Q4ZA 2NVTK 1WCMK 5TMFA 2R7ZC 4GZYA 4BY7K 4BXXK 4A3GK 3GTMC 5IYCK 5C44C 3S1QK 4KN4A 2NVYC 2WB1L 2NVTC 3PO3K 4A3BK 1WCMC 1YNNA 4A3IK 4BY7C 4BXXC 4AYBD 5M3FK 4A3GC 1I3QK 1TWCK 3HOWK 5IYCC 3S1QC 3H3VL 3PO3C 4A3BC 1I6HK 4A3IC 5C4XK 3M4OK 1I3QC 1TWCC 4KN7A 4NOIA 3HOWC 1TWAK 5M3MK 3S1RC 5IYDK 1I6HC 1BDFA 2A69A 5C4XC 3M4OC 4C2MK 2JA7C 1TWAC 4XSZA 4XLNA 5IYDC 4YFXA 2R92K 5M5YK 3S1MK 1SMYA 3EQLA 4A3CK 2R92C 2NVQC 4BBSK 4OIPA 3S1MC 4YG2A 4A3FK 2YU9K 4A3CC 5M5XK 1HQMA 4LLGA 3I4MK 4BBSC 2A6HA 4A3FC 1I50K 2YU9C 4QIWL 4C3JK 3CQZK 3GTQK 3GTKK 3I4MC 3GTOK 2PMZL 4A3LK 4YFKA 3HOUC 1I50C 1R9TK 4OIRA 2B63K 3GTKC 3CQZC 3GTLK 3S1RK 3GTQC 3GTOC 3I4NK 4A3LC 3S14K 4MQ9A 1R9TC 4OIQA 2B63C 2JA7K 2Y0SL 2WB1D 3GTLC 5FJ8K 2NVXK 3I4NC 3HKZL 3S14C 3HOZC 3K7AK 4MEXA 1I6VA 2JA8K 3H3VD 2NVXC 3S1NK 4Y7NK 4QJVB 2A68A 3DXJA 2NVQK 4A3EK 1K83K 3K7AC 5M5WK 4ZH4A 2JA8C 1XPPA 4C3HK 4C3IK 4Y7NC 3S15K 3S2DK 3S1NC 4A3EC 1K83C 4YFNA 4MEYA 4G7HA 2JA5K 3S15C 3S2DC 2BE5A 1TWGK 3GTGK 2JA5C 3HOUK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTJ K;  4LK1 A;  3M3Y K;  1TWG C;  3GTG C;  4A3M K;  5TMC A;  3GTJ C;  5C3E K;  3M3Y C;  3H0G K;  3RZO K;  2A6E A;  4JK1 A;  4G7Z A;  3HOZ K;  2WAQ L;  4A3M C;  2CW0 A;  4QIW D;  5C3E C;  3H0G C;  2PMZ D;  3RZO C;  1TWH K;  4A3D K;  4BY1 K;  3HOV C;  4A3J K;  3S17 K;  3S16 K;  5IP9 K;  2PA8 L;  1TWH C;  4BBR K;  4XSX A;  4BY1 C;  5IP7 K;  1TWF C;  4A3J C;  4A3D C;  2JA6 K;  4AYB L;  2O5J A;  2Y0S D;  3RZD K;  3WOD A;  3S17 C;  3S16 C;  5IP9 C;  3FKI K;  3HKZ D;  2R93 K;  4BBR C;  5IP7 C;  2JA6 C;  5D4D A;  3RZD C;  4Y52 K;  2PA8 D;  4A93 K;  3FKI C;  2R93 C;  4LK0 A;  4QJV A;  1Y1V K;  1Y1W K;  4KMU A;  4Y52 C;  4A93 C;  1ZYR A;  1Y1V C;  1Y1W C;  3PO2 K;  2E2J K;  4X6A K;  5C4J K;  4G7O A;  4A3K K;  2E2I K;  5IYB K;  3GTP K;  3PO2 C;  2E2J C;  2E2H K;  1YNJ A;  4LJZ A;  5C4J C;  2O5I A;  3HOV K;  4A3K C;  4X6A C;  1IW7 A;  2E2I C;  5IYB C;  5FLM K;  3GTP C;  2PPB A;  3HOX K;  4OIN A;  1TWF K;  2E2H C;  2VUM K;  1SFO K;  3HOY K;  3S2H K;  5FLM C;  3HOX C;  2R7Z K;  2WAQ D;  2VUM C;  4XLP A;  1SFO C;  3GTM K;  3HOY C;  4Q5S A;  5C44 K;  3S2H C;  2NVY K;  4OIO A;  4Q4Z A;  2NVT K;  1WCM K;  5TMF A;  2R7Z C;  4GZY A;  4BY7 K;  4BXX K;  4A3G K;  3GTM C;  5IYC K;  5C44 C;  3S1Q K;  4KN4 A;  2NVY C;  2WB1 L;  2NVT C;  3PO3 K;  4A3B K;  1WCM C;  1YNN A;  4A3I K;  4BY7 C;  4BXX C;  4AYB D;  5M3F K;  4A3G C;  1I3Q K;  1TWC K;  3HOW K;  5IYC C;  3S1Q C;  3H3V L;  3PO3 C;  4A3B C;  1I6H K;  4A3I C;  5C4X K;  3M4O K;  1I3Q C;  1TWC C;  4KN7 A;  4NOI A;  3HOW C;  1TWA K;  5M3M K;  3S1R C;  5IYD K;  1I6H C;  1BDF A;  2A69 A;  5C4X C;  3M4O C;  4C2M K;  2JA7 C;  1TWA C;  4XSZ A;  4XLN A;  5IYD C;  4YFX A;  2R92 K;  5M5Y K;  3S1M K;  1SMY A;  3EQL A;  4A3C K;  2R92 C;  2NVQ C;  4BBS K;  4OIP A;  3S1M C;  4YG2 A;  4A3F K;  2YU9 K;  4A3C C;  5M5X K;  1HQM A;  4LLG A;  3I4M K;  4BBS C;  2A6H A;  4A3F C;  1I50 K;  2YU9 C;  4QIW L;  4C3J K;  3CQZ K;  3GTQ K;  3GTK K;  3I4M C;  3GTO K;  2PMZ L;  4A3L K;  4YFK A;  3HOU C;  1I50 C;  1R9T K;  4OIR A;  2B63 K;  3GTK C;  3CQZ C;  3GTL K;  3S1R K;  3GTQ C;  3GTO C;  3I4N K;  4A3L C;  3S14 K;  4MQ9 A;  1R9T C;  4OIQ A;  2B63 C;  2JA7 K;  2Y0S L;  2WB1 D;  3GTL C;  5FJ8 K;  2NVX K;  3I4N C;  3HKZ L;  3S14 C;  3HOZ C;  3K7A K;  4MEX A;  1I6V A;  2JA8 K;  3H3V D;  2NVX C;  3S1N K;  4Y7N K;  4QJV B;  2A68 A;  3DXJ A;  2NVQ K;  4A3E K;  1K83 K;  3K7A C;  5M5W K;  4ZH4 A;  2JA8 C;  1XPP A;  4C3H K;  4C3I K;  4Y7N C;  3S15 K;  3S2D K;  3S1N C;  4A3E C;  1K83 C;  4YFN A;  4MEY A;  4G7H A;  2JA5 K;  3S15 C;  3S2D C;  2BE5 A;  1TWG K;  3GTG K;  2JA5 C;  3HOU K; 
#chains in the Genus database with same CATH topology
 4LK1 A;  1J6V A;  3GTJ C;  4P9S A;  4KMH A;  1BS2 A;  1ZVU A;  2PMZ D;  2E2I A;  4A3D K;  3HOV C;  2E2H A;  2FQT A;  1JOE A;  3TFH A;  4AYB L;  3RZD K;  3WOD A;  1G51 A;  5IP9 C;  4J3N A;  1XZP A;  3GTM A;  4A93 K;  3FKI C;  1X31 C;  2R93 C;  2R93 A;  3A8I A;  3MML B;  4Y52 C;  1O28 A;  1WOP A;  3A8K A;  4WIL A;  1YNJ A;  4X6A C;  4KAT A;  3GTP C;  1XXC A;  2VUM K;  1SFO K;  1WIH A;  3GSI A;  3HOX C;  2R7Z K;  4P5B A;  4XLP A;  4GTA A;  2V6U A;  4Q4Z A;  5TMF A;  1F7V A;  3IPJ A;  5IYC K;  3PO3 K;  1WCM C;  1WCM A;  4A3G C;  1USO A;  1TWC K;  3HOW K;  3S1Q C;  1I6H K;  5C4X K;  1DCO A;  3M4O K;  3FOE A;  1BDF A;  2A69 A;  1O24 A;  2RH6 A;  2NVX A;  4YFX A;  1O2F B;  1SMY A;  4G0U A;  4A3C K;  2R92 C;  2NVQ C;  4OIP A;  2R92 A;  1ZQ1 C;  3N0B A;  3AD7 C;  5M5X K;  2YU9 C;  4C3J K;  2YU9 A;  1HI9 A;  3GTO K;  2JH3 A;  3GDZ A;  3HOU C;  2XCR B;  4WJ4 A;  1IL2 A;  2B63 K;  3CQZ C;  3GTL K;  3S1R K;  3GTK C;  3S0X A;  4OIQ A;  4KM8 A;  2JA7 K;  3S14 C;  3N3Y A;  5L46 A;  1I6V A;  4QJV B;  2A68 A;  1K83 K;  2V6T A;  5EGE A;  3S1N C;  4C3I K;  2D6F C;  5CJ9 A;  4MEY A;  3QX3 A;  1WOR A;  3ADA C;  2JA5 C;  2JA5 A;  3M3Y K;  3LAP A;  3GTG C;  4A3M K;  3H0G K;  1JVI A;  4JK1 A;  4G7Z A;  2WAQ L;  1XXB A;  5C3E C;  3RZO C;  1TWH K;  4BY1 K;  4KMD A;  4KB4 A;  4A3J K;  1JQW A;  2PA8 L;  4XSX A;  5IP7 K;  3LPX A;  2Y0S D;  1SFO A;  3S17 C;  3S16 C;  3HKZ D;  4BBR C;  2R7Z A;  2JA6 C;  2PA8 D;  1Y1V K;  1O2A A;  4KMU A;  3OEP A;  1Y1W C;  1Y1W A;  4G7O A;  3LAJ A;  3PO2 C;  2E2J C;  4LJZ A;  1L0W A;  5C4J C;  4A3K C;  2E2I C;  5IYB C;  5FLM K;  1AB4 A;  2E2H C;  3HOY K;  1WSV A;  4KC6 A;  1O27 A;  1O29 A;  4KAS A;  3S2H C;  2NVY K;  2NVT K;  3GTM C;  5C44 C;  1XXA A;  4A3I K;  4BY7 C;  4BXX C;  4AYB D;  1O26 A;  4A3B C;  3GTO A;  1I3Q C;  4XCH A;  1I3Q A;  1TWA K;  1DD5 A;  3S1R C;  3GTL A;  2B63 A;  5IYD K;  1EFW A;  4C2M K;  2JA7 C;  4GTL A;  2JA7 A;  2EBB A;  5M5Y K;  3S1M K;  1EQR A;  1K83 A;  4A3F K;  4BBS C;  1WOS A;  2A6H A;  4KAR A;  5HL8 A;  3BUE A;  4QIW L;  3GTQ K;  4A3L K;  1O2B A;  3VA7 A;  3I4M C;  3GIR A;  1I50 C;  1XZQ A;  1R9T K;  4Q5S A;  1I50 A;  1XZP B;  1B4A A;  3I4N C;  3H0G A;  1PJ6 A;  2GSU A;  2PHC B;  4MEX A;  4RMF A;  2NVX C;  4G0W A;  1ISE A;  1TWH A;  3K7A C;  4ZH4 A;  2JA8 C;  3S15 K;  4Y7N C;  4GT9 A;  4A3E C;  2KWA A;  4G7H A;  1IS1 A;  3S2D C;  4C3H C;  1VGX A;  3TFI A;  3G4C A;  1KQ4 A;  1BJT A;  3GTJ K;  1TWG C;  3FOF A;  1IQ0 A;  1TWG A;  5TMC A;  2A6E A;  3CAG A;  3HOZ K;  2CW0 A;  1IBA A;  3BP3 A;  5IP9 K;  3OPF A;  1XZQ B;  4A3D C;  4KDD A;  3FKI K;  2R93 K;  4WJ3 M;  3SZY A;  3RZD C;  4Y52 K;  3T02 A;  3TTG A;  2NVY A;  4LK0 A;  2Y3P A;  1J98 A;  4A93 C;  1EK8 A;  1ZYR A;  2GAG C;  4X6A K;  5TJ3 A;  3AH5 A;  3GTP K;  4GTC A;  4BLA A;  1TWA A;  3AQP A;  4P5A A;  2PPB A;  3HOX K;  1VH2 A;  1TWF K;  2WAQ D;  3V4G A;  2VUM C;  1SFO C;  2GAH C;  4FZB A;  2VUM A;  1WCM K;  2P5M A;  3Q3Q A;  2R7Z C;  4A3G K;  5IOQ A;  1O25 A;  3S1Q K;  4KN4 A;  2WB1 L;  2XCQ A;  4KAW X;  1USM A;  1DCP A;  5M3F K;  5IYC C;  3H3V L;  2ZFZ A;  3GTQ A;  3PO3 C;  3JST A;  4PAB A;  4DDQ A;  4KB2 A;  1TWC C;  4KN7 A;  5IOS A;  3BP8 C;  1TWC A;  3HOW C;  1DCH A;  1I6H C;  1IE0 A;  5C4X C;  3M4O C;  4ILD A;  1INN A;  1PJ5 A;  5IOR A;  4XSZ A;  4XLN A;  2R92 K;  5JVO A;  3EQL A;  1WSR A;  4FM9 A;  3AQO A;  4KMA A;  2XCO A;  2P8T A;  5CHP A;  2YU9 K;  1F93 A;  4A3C C;  4LLG A;  4KM9 A;  3GTK K;  1YX2 A;  3CQZ K;  2PMZ L;  4OIR A;  4C3J C;  5JFE A;  3GTJ A;  3GTO C;  3S14 K;  3A8J A;  4MQ9 A;  2B63 C;  3GTL C;  3HOZ C;  3S1N K;  4BKW A;  1BGW A;  1F7U A;  1K83 C;  1UV7 A;  3GEH A;  2JA5 K;  4GTF A;  2BE5 A;  4C3I C;  3FKI A;  3GTG K;  1ZBS A;  4AH6 A;  1C0A A;  4LOW A;  5C3E K;  3M3Y C;  3RZO K;  4A3M C;  4GTE A;  4QIW D;  3H0G C;  3G4A A;  3GTP A;  3S17 K;  2ZUF A;  3S16 K;  3T01 A;  1TWH C;  4BBR K;  4BY1 C;  1TWF C;  1YCL A;  4A3J C;  2JA6 K;  1TWF A;  2O5J A;  5IOT A;  2CFA A;  5IP7 C;  2RGR A;  5D4D A;  2V6S A;  5EGH A;  1V5V A;  3NUH A;  4QJV A;  1Y1W K;  2GSN A;  1Y1V C;  3PO2 K;  1Y1V A;  2E2J K;  5C4J K;  4A3K K;  2E2I K;  5IYB K;  4LR2 A;  3HOV K;  2E2H K;  2O5I A;  4C45 A;  3AD8 C;  1IW7 A;  1J6X A;  4OIN A;  3S2H K;  5FLM C;  3L4J A;  2ZUE A;  1VLO A;  3HOY C;  3GTM K;  1GE9 A;  5C44 K;  2FQO A;  1EI6 A;  4OIO A;  4GZY A;  4BY7 K;  4BXX K;  2NVY C;  2NVT C;  4A3B K;  2GSO A;  1YNN A;  3AD9 C;  1I3Q K;  1VJE A;  3GTK A;  3CQZ A;  4A3I C;  1B4B A;  4NOI A;  2CFA B;  1J6W A;  5M3M K;  4GTD A;  4O2D A;  1TWA C;  3TFJ A;  5IYD C;  3FHZ A;  4GFQ A;  3SZZ A;  1ZXO A;  4C2M C;  4M1X A;  1WQH A;  1VRQ C;  4BBS K;  3N0C A;  1F9N A;  3S1M C;  4YG2 A;  4PAA A;  1HQM A;  3I4M K;  3T00 A;  4A3F C;  1I50 K;  1WOO A;  3GEI A;  4YFK A;  4G0V A;  3GTG A;  3GTQ C;  4BLB A;  4A3L C;  3I4N K;  3ERE D;  2W7V A;  3GEE A;  1R9T C;  1R9T A;  2Y0S L;  2WB1 D;  5FJ8 K;  2NVX K;  3HKZ L;  3L4K A;  4GTB A;  1WQF A;  3K7A K;  3H3V D;  2JA8 K;  4Y7N K;  1EH1 A;  3DXJ A;  2NVQ K;  4A3E K;  3HXA A;  5M5W K;  1XPP A;  4C3H K;  3S2D K;  4YFN A;  3ORE A;  2JA6 A;  5E68 A;  3S15 C;  1PJ7 A;  1TWG K;  1WQG A;  1RU0 A;  4LQY A;  3HOU K; 
#chains in the Genus database with same CATH homology
 3GTJ K;  4LK1 A;  3M3Y K;  1TWG C;  3GTG C;  4A3M K;  5TMC A;  3GTJ C;  5C3E K;  3M3Y C;  3H0G K;  3RZO K;  2A6E A;  4JK1 A;  4G7Z A;  3HOZ K;  2WAQ L;  4A3M C;  2CW0 A;  4QIW D;  5C3E C;  3H0G C;  2PMZ D;  3RZO C;  1TWH K;  4A3D K;  4BY1 K;  3HOV C;  4A3J K;  3S17 K;  3S16 K;  5IP9 K;  2PA8 L;  1TWH C;  4BBR K;  4XSX A;  4BY1 C;  5IP7 K;  1TWF C;  4A3J C;  4A3D C;  2JA6 K;  4AYB L;  2O5J A;  2Y0S D;  3RZD K;  3WOD A;  3S17 C;  3S16 C;  5IP9 C;  3FKI K;  3HKZ D;  2R93 K;  4BBR C;  5IP7 C;  2JA6 C;  5D4D A;  3RZD C;  4Y52 K;  2PA8 D;  4A93 K;  3FKI C;  2R93 C;  4LK0 A;  4QJV A;  1Y1V K;  1Y1W K;  4KMU A;  4Y52 C;  4A93 C;  1ZYR A;  1Y1V C;  1Y1W C;  3PO2 K;  2E2J K;  4X6A K;  5C4J K;  4G7O A;  4A3K K;  2E2I K;  5IYB K;  3GTP K;  3PO2 C;  2E2J C;  2E2H K;  1YNJ A;  4LJZ A;  5C4J C;  2O5I A;  3HOV K;  4A3K C;  4X6A C;  1IW7 A;  2E2I C;  5IYB C;  5FLM K;  3GTP C;  2PPB A;  3HOX K;  4OIN A;  1TWF K;  2E2H C;  2VUM K;  1SFO K;  3HOY K;  3S2H K;  5FLM C;  3HOX C;  2R7Z K;  2WAQ D;  2VUM C;  4XLP A;  1SFO C;  3GTM K;  3HOY C;  4Q5S A;  5C44 K;  3S2H C;  2NVY K;  4OIO A;  4Q4Z A;  2NVT K;  1WCM K;  5TMF A;  2R7Z C;  4GZY A;  4BY7 K;  4BXX K;  4A3G K;  3GTM C;  5IYC K;  5C44 C;  3S1Q K;  4KN4 A;  2NVY C;  2WB1 L;  2NVT C;  3PO3 K;  4A3B K;  1WCM C;  1YNN A;  4A3I K;  4BY7 C;  4BXX C;  4AYB D;  5M3F K;  4A3G C;  1I3Q K;  1TWC K;  3HOW K;  5IYC C;  3S1Q C;  3H3V L;  3PO3 C;  4A3B C;  1I6H K;  4A3I C;  5C4X K;  3M4O K;  1I3Q C;  1TWC C;  4KN7 A;  4NOI A;  3HOW C;  1TWA K;  5M3M K;  3S1R C;  5IYD K;  1I6H C;  1BDF A;  2A69 A;  5C4X C;  3M4O C;  4C2M K;  2JA7 C;  1TWA C;  4XSZ A;  4XLN A;  5IYD C;  4YFX A;  2R92 K;  5M5Y K;  3S1M K;  1SMY A;  3EQL A;  4A3C K;  2R92 C;  2NVQ C;  4BBS K;  4OIP A;  3S1M C;  4YG2 A;  4A3F K;  2YU9 K;  4A3C C;  5M5X K;  1HQM A;  4LLG A;  3I4M K;  4BBS C;  2A6H A;  4A3F C;  1I50 K;  2YU9 C;  4QIW L;  4C3J K;  3CQZ K;  3GTQ K;  3GTK K;  3I4M C;  3GTO K;  2PMZ L;  4A3L K;  4YFK A;  3HOU C;  1I50 C;  1R9T K;  4OIR A;  2B63 K;  3GTK C;  3CQZ C;  3GTL K;  3S1R K;  3GTQ C;  3GTO C;  3I4N K;  4A3L C;  3S14 K;  4MQ9 A;  1R9T C;  4OIQ A;  2B63 C;  2JA7 K;  2Y0S L;  2WB1 D;  3GTL C;  5FJ8 K;  2NVX K;  3I4N C;  3HKZ L;  3S14 C;  3HOZ C;  3K7A K;  4MEX A;  1I6V A;  2JA8 K;  3H3V D;  2NVX C;  3S1N K;  4Y7N K;  4QJV B;  2A68 A;  3DXJ A;  2NVQ K;  4A3E K;  1K83 K;  3K7A C;  5M5W K;  4ZH4 A;  2JA8 C;  1XPP A;  4C3H K;  4C3I K;  4Y7N C;  3S15 K;  3S2D K;  3S1N C;  4A3E C;  1K83 C;  4YFN A;  4MEY A;  4G7H A;  2JA5 K;  3S15 C;  3S2D C;  2BE5 A;  1TWG K;  3GTG K;  2JA5 C;  3HOU K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...