4AYBL

Rnap at 3.2ang
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
91
structure length
91
Chain Sequence
b'MEIKILKSESNYLELEIEGEDHTLGNLIAGTLRKISGVSFASYYQPHPLTDKIIVKILTDGSIAPKDALLKAIETVRVMASHYIDEIKGLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
pubmed doi rcsb
molecule tags Transferase
total genus 24
structure length 91
sequence length 91
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4aybL00
3GTPC 3GTOK 3PO3C 4A3LC 2R93K 2NVYC 2R93C 4MQ9A 2NVXC 4MEYA 1I3QK 3HOYC 1TWCK 4KN4A 2JA7C 2PA8D 5IP9K 3FKIK 3M3YK 3K7AK 2JA6K 3RZDK 3HOUK 2A6EA 2R92C 3M3YC 3K7AC 5M3MK 2A69A 5FJ8K 3RZDC 3HOUC 2A68A 5IP7C 3CQZK 2WAQL 4YFKA 4XLNA 3S1QK 4AYBD 3HKZD 1TWHC 4Q4ZA 2VUMK 1R9TC 4QIWD 3M4OK 2E2IC 5IYCK 3H0GC 3HOXC 2JA5C 4BY7K 3S15C 1I50C 2JA8K 3S1NC 3GTPK 3PO3K 5C44C 4A3LK 5C3EK 4A3EC 2WB1D 4Y52C 2NVYK 3GTJC 5C3EC 5IYDC 2NVXK 2PMZD 2NVQC 3HOYK 3HOWC 2JA7K 2B63C 1IW7A 2WAQD 3PO2C 2WB1L 5IYBC 1SFOC 2E2HC 2R92K 3I4NC 2PMZL 2E2JC 5M5YK 4QJVA 5IP7K 3GTKC 4OIRA 1Y1VC 4OIQA 4MEXA 1TWGK 1TWHK 4G7OA 2R7ZC 4LK1A 1TWGC 4XSXA 4C2MK 3GTQK 1I6HK 2CW0A 1R9TK 3S1RC 5M5XK 3GTQC 2E2IK 4A3GC 1I6HC 4A3MC 4C3HK 3H0GK 3HOXK 4OIOA 2YU9C 3S2HC 2JA5K 1K83C 4BBSC 4YFNA 2A6HA 4BBRC 3S15K 1I50K 5M5WK 1I6VA 3S1NK 5TMFA 3S1MK 4YG2A 2Y0SL 4GZYA 4Y7NC 5C44K 3S1MC 4A3EK 4Y52K 4A3JK 3GTJK 4A3FC 3S16C 5IYDK 2NVQK 4A3JC 4JK1A 1TWFC 3HOWK 1YNNA 4C3JK 4A3KC 3GTLC 3RZOC 4X6AC 4A93C 2B63K 3PO2K 4A3CC 4LLGA 5IYBK 2E2HK 1SFOK 1WCMC 4LJZA 1TWAC 5C4JC 3HOZC 3I4NK 4KMUA 1ZYRA 1Y1WC 2E2JK 3GTKK 3HOVC 4BY1C 1Y1VK 3S2DC 2R7ZK 4A3DC 3GTGC 4YFXA 3S1RK 1XPPA 3S17C 4A3GK 3I4MC 4Q5SA 4A3MK 4XSZA 3S2HK 3S14C 2YU9K 4BXXC 1K83K 2Y0SD 2NVTC 3GTMC 4BBSK 4BBRK 2PPBA 4ZH4A 4A3IC 5FLMC 4Y7NK 5C4XC 4C3IK 3GTOC 4OIPA 5TMCA 4A3FK 3S16K 1TWFK 3WODA 3RZOK 4A3KK 3GTLK 1I3QC 4X6AK 4A93K 1TWCC 1BDFA 2O5JA 4A3CK 5IP9C 3FKIC 1WCMK 5C4JK 4QJVB 1TWAK 1YNJA 4NOIA 1Y1WK 2JA6C 1HQMA 3HOVK 3HOZK 4A3BC 3DXJA 2PA8L 4XLPA 4BY1K 3CQZC 4A3BK 3S1QC 1SMYA 3S2DK 4A3DK 4G7HA 2BE5A 3GTGK 4G7ZA 5D4DA 2VUMC 3S17K 3I4MK 3M4OC 3H3VD 4BXXK 4AYBL 3HKZL 3S14K 5IYCC 2NVTK 3GTMK 4KN7A 4OINA 4A3IK 4QIWL 5FLMK 3EQLA 4BY7C 5M3FK 2O5IA 2JA8C 3H3VL 4LK0A 5C4XK
chains in the Genus database with same CATH superfamily
3GTPC 2NVYC 3CQZA 4MQ9A 2GAGC 3HOYC 1TWCK 2PA8D 5IP9K 3K7AK 2JA6K 4XCHA 3RZDK 1XZQA 2A69A 3HOUC 2A68A 1VH2A 1V5VA 1XZPA 1BGWA 5IORA 1R9TC 1PJ6A 3GTPA 4C3HC 2NVYA 1ZVUA 1WSRA 2CFAA 3BUEA 4A3LK 3FKIA 3GEIA 3GTJC 2NVQC 4G0UA 2JA7K 3PO2C 4WJ4A 2E2HC 1R9TA 3T01A 1ZXOA 4RMFA 2W7VA 1TWHK 3TFIA 4LK1A 3GTQK 2V6TA 1I6HK 4KMHA 2E2IK 2V6UA 3H0GK 1AB4A 3GTJA 3S15K 3T02A 1EQRA 2E2HA 5TJ3A 2XCRB 4A3JK 4GT9A 3S16C 2R92A 5IYDK 4JK1A 1TWFC 3RZOC 4A3KC 1XXBA 1F7VA 1DCPA 1GE9A 1XZQB 5EGHA 1G51A 3HOZC 3I4NK 1ZYRA 5EGEA 1Y1VK 4GTBA 1XZPB 1PJ7A 1ISEA 3QX3A 4YFXA 3SZZA 1K83K 1RU0A 1UV7A 4BBRK 1IBAA 1TWFA 4ZH4A 1O2BA 2XCQA 3MMLB 2V6SA 4BLAA 5C4XC 2ZUEA 4OIPA 4GTLA 3GTLK 1ZBSA 1BDFA 1XXAA 4A3CK 5C4JK 1TWAK 3TTGA 3HOVK 3DXJA 1USOA 4G0VA 2D6FC 3S1QC 3LAJA 5IOQA 1B4BA 1EH1A 3GEEA 4KAWX 1IL2A 3AD8C 3S14K 2NVTK 4KN7A 4OINA 1O26A 2KWAA 2Y3PA 4BY7C 4LK0A 2P8TA 3PO3C 1WCMA 2R93C 2NVXC 1YCLA 4FZBA 4M1XA 1XXCA 3FKIK 3HOUK 3M3YC 4A3BK 4XLNA 2WAQL 4P9SA 3JSTA 4AYBD 1IS1A 4C2MC 4QIWD 3S0XA 5IYCK 4G0WA 2EBBA 1X31C 3HOXC 2JA5C 1IE0A 2R93A 4GTDA 2FQOA 5C44C 4A3EC 3AD7C 5C3EC 3OPFA 4C3JC 2B63C 2WB1L 2R92K 2VUMA 2PMZL 2E2JC 5M5YK 3LPXA 5IP7K 3GTKC 3OEPA 4GTFA 4OIQA 2JA5A 2CW0A 4J3NA 2ZUFA 3S2HC 2YU9C 3G4CA 4YFNA 1I50K 5CJ9A 3GDZA 3S1NK 4Y7NC 3S1MC 2GSNA 4C3IC 4Y52K 3VA7A 3GTKA 1INNA 5E68A 3HOWK 4X6AC 1O28A 2XCOA 5IYBK 3FOFA 1SFOK 2YU9A 1J6WA 4P5AA 3S2DC 2R7ZK 4A3DC 3S1RK 4A3GK 4A3MK 1EK8A 4GTEA 3GTMC 2Y0SD 4BBSK 2PPBA 4A3IC 5FLMC 4BLBA 3ERED 4KC6A 4A3FK 3N0CA 4AH6A 4A93K 1TWCC 3AH5A 3V4GA 3ADAC 5IP9C 1WCMK 2JA6C 1YNJA 1Y1WK 2PA8L 4XLPA 4BY1K 3GTMA 4G7HA 3GTGK 4G7ZA 4BKWA 3S17K 3I4MK 4BXXK 4KM9A 4KASA 2PHCB 1TWCA 2O5IA 3AQOA 2CFAB 2GSUA 1SMYA 3IPJA 1WQFA 3GTOK 2JA6A 4A3LC 2R93K 1USMA 1I3QK 4MEYA 3T00A 1L0WA 2JA7C 1O25A 3M3YK 1O24A 3CQZK 4YFKA 4PABA 3HKZD 1TWHC 2VUMK 3M4OK 2E2IC 3H0GC 5CHPA 4GTAA 1JOEA 3S15C 2JA8K 2JA7A 3GTPK 4WJ3M 5C3EK 2WB1D 2NVYK 4ILDA 5IYDC 2PMZD 3HOYK 1TWHA 1WSVA 3I4NC 1JQWA 4QJVA 1BJTA 1WOOA 3BP8C 3H0GA 4OIRA 1Y1VC 4KB2A 1TWGC 4XSXA 1R9TK 4GFQA 4C3HK 4OIOA 3N3YA 1K83C 1VRQC 4BBRC 3G4AA 4KMDA 5M5WK 2NVXA 4KB4A 1WOSA 3S1MK 1EI6A 3AQPA 3GTJK 1EFWA 2NVQK 1Y1VA 1YNNA 3A8JA 3GTLC 4KDDA 3PO2K 4KARA 1TWGA 4A3CC 2E2HK 5C4JC 1DD5A 1TWAC 4KMUA 3HOVC 1DCOA 1K83A 4C45A 3A8KA 2ZFZA 4LQYA 1XPPA 5IOTA 4DDQA 3S14C 2NVTC 2GSOA 3TFJA 3GTLA 3TFHA 1VJEA 4WILA 3GIRA 2B63A 1TWAA 2P5MA 3S16K 1TWFK 3RZOK 4A3KK 5HL8A 3FKIC 3HOZK 4NOIA 4QJVB 2RH6A 1HQMA 4A3BC 4AYBL 5IYCC 4QIWL 1BS2A 3EQLA 5M3FK 3H3VL 5C4XK 3Q3QA 1O29A 4KN4A 4LR2A 3GEHA 1C0AA 2A6EA 2R92C 3K7AC 5M3MK 5FJ8K 3RZDC 2JH3A 5IP7C 3OREA 4LOWA 5JVOA 3S1QK 1ZQ1C 4Q4ZA 3L4JA 3BP3A 4BY7K 1I50C 3S1NC 3PO3K 3FHZA 4Y52C 3FOEA 2NVXK 3HOWC 1O27A 1IW7A 2WAQD 3LAPA 3L4KA 5IYBC 1SFOC 3HXAA 4MEXA 1B4AA 1TWGK 1KQ4A 4O2DA 4G7OA 1I50A 2R7ZC 4C2MK 3S1RC 1J98A 5M5XK 3GTQC 4A3GC 1I6HC 4A3MC 3HOXK 2JA5K 4BBSC 2A6HA 1DCHA 1VLOA 5L46A 1I6VA 2GAHC 1WQHA 1WOPA 4PAAA 2Y0SL 4YG2A 5TMFA 1F7UA 4GZYA 5C44K 1SFOA 4A3EK 4A3FC 1F9NA 3A8IA 4A3JC 1WIHA 4C3JK 4A93C 2B63K 4FM9A 2R7ZA 4LLGA 1HI9A 1WCMC 4LJZA 3GSIA 3GTQA 1Y1WC 2E2JK 3GTKK 2E2IA 4BY1C 4KATA 3SZYA 1F93A 3GTGC 3S17C 1WQGA 4Q5SA 3I4MC 4XSZA 3S2HK 4BXXC 2YU9K 1J6VA 5IOSA 1JVIA 4Y7NK 1O2FB 4KMAA 4C3IK 3GTOC 1Y1WA 5TMCA 3N0BA 2FQTA 3WODA 1O2AA 1I3QC 4X6AK 3AD9C 2O5JA 1J6XA 4GTCA 3GTGA 1VGXA 5JFEA 1YX2A 4KM8A 3CQZC 1IQ0A 2RGRA 3S2DK 4A3DK 2BE5A 2VUMC 5D4DA 3M4OC 3H3VD 3HKZL 3GTOA 3NUHA 1PJ5A 3GTMK 4P5BA 4A3IK 5FLMK 1WORA 1I3QA 3CAGA 2JA8C
chains in the Genus database with same CATH topology
3GTPC 3GTOK 3PO3C 4A3LC 2R93K 2NVYC 2R93C 4MQ9A 2NVXC 4MEYA 1I3QK 3HOYC 1TWCK 4KN4A 2JA7C 2PA8D 5IP9K 3FKIK 3M3YK 3K7AK 2JA6K 3RZDK 3HOUK 2A6EA 2R92C 3M3YC 3K7AC 5M3MK 2A69A 5FJ8K 3RZDC 3HOUC 2A68A 5IP7C 3CQZK 2WAQL 4YFKA 4XLNA 3S1QK 4AYBD 3HKZD 1TWHC 4Q4ZA 2VUMK 1R9TC 4QIWD 3M4OK 2E2IC 5IYCK 3H0GC 3HOXC 2JA5C 4BY7K 3S15C 1I50C 2JA8K 3S1NC 3GTPK 3PO3K 5C44C 4A3LK 5C3EK 4A3EC 2WB1D 4Y52C 2NVYK 3GTJC 5C3EC 5IYDC 2NVXK 2PMZD 2NVQC 3HOYK 3HOWC 2JA7K 2B63C 1IW7A 2WAQD 3PO2C 2WB1L 5IYBC 1SFOC 2E2HC 2R92K 3I4NC 2PMZL 2E2JC 5M5YK 4QJVA 5IP7K 3GTKC 4OIRA 1Y1VC 4OIQA 4MEXA 1TWGK 1TWHK 4G7OA 2R7ZC 4LK1A 1TWGC 4XSXA 4C2MK 3GTQK 1I6HK 2CW0A 1R9TK 3S1RC 5M5XK 3GTQC 2E2IK 4A3GC 1I6HC 4A3MC 4C3HK 3H0GK 3HOXK 4OIOA 2YU9C 3S2HC 2JA5K 1K83C 4BBSC 4YFNA 2A6HA 4BBRC 3S15K 1I50K 5M5WK 1I6VA 3S1NK 5TMFA 3S1MK 4YG2A 2Y0SL 4GZYA 4Y7NC 5C44K 3S1MC 4A3EK 4Y52K 4A3JK 3GTJK 4A3FC 3S16C 5IYDK 2NVQK 4A3JC 4JK1A 1TWFC 3HOWK 1YNNA 4C3JK 4A3KC 3GTLC 3RZOC 4X6AC 4A93C 2B63K 3PO2K 4A3CC 4LLGA 5IYBK 2E2HK 1SFOK 1WCMC 4LJZA 1TWAC 5C4JC 3HOZC 3I4NK 4KMUA 1ZYRA 1Y1WC 2E2JK 3GTKK 3HOVC 4BY1C 1Y1VK 3S2DC 2R7ZK 4A3DC 3GTGC 4YFXA 3S1RK 1XPPA 3S17C 4A3GK 3I4MC 4Q5SA 4A3MK 4XSZA 3S2HK 3S14C 2YU9K 4BXXC 1K83K 2Y0SD 2NVTC 3GTMC 4BBSK 4BBRK 2PPBA 4ZH4A 4A3IC 5FLMC 4Y7NK 5C4XC 4C3IK 3GTOC 4OIPA 5TMCA 4A3FK 3S16K 1TWFK 3WODA 3RZOK 4A3KK 3GTLK 1I3QC 4X6AK 4A93K 1TWCC 1BDFA 2O5JA 4A3CK 5IP9C 3FKIC 1WCMK 5C4JK 4QJVB 1TWAK 1YNJA 4NOIA 1Y1WK 2JA6C 1HQMA 3HOVK 3HOZK 4A3BC 3DXJA 2PA8L 4XLPA 4BY1K 3CQZC 4A3BK 3S1QC 1SMYA 3S2DK 4A3DK 4G7HA 2BE5A 3GTGK 4G7ZA 5D4DA 2VUMC 3S17K 3I4MK 3M4OC 3H3VD 4BXXK 4AYBL 3HKZL 3S14K 5IYCC 2NVTK 3GTMK 4KN7A 4OINA 4A3IK 4QIWL 5FLMK 3EQLA 4BY7C 5M3FK 2O5IA 2JA8C 3H3VL 4LK0A 5C4XK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTP C;  3GTO K;  3PO3 C;  4A3L C;  2R93 K;  2NVY C;  2R93 C;  4MQ9 A;  2NVX C;  4MEY A;  1I3Q K;  3HOY C;  1TWC K;  4KN4 A;  2JA7 C;  2PA8 D;  5IP9 K;  3FKI K;  3M3Y K;  3K7A K;  2JA6 K;  3RZD K;  3HOU K;  2A6E A;  2R92 C;  3M3Y C;  3K7A C;  5M3M K;  2A69 A;  5FJ8 K;  3RZD C;  3HOU C;  2A68 A;  5IP7 C;  3CQZ K;  2WAQ L;  4YFK A;  4XLN A;  3S1Q K;  4AYB D;  3HKZ D;  1TWH C;  4Q4Z A;  2VUM K;  1R9T C;  4QIW D;  3M4O K;  2E2I C;  5IYC K;  3H0G C;  3HOX C;  2JA5 C;  4BY7 K;  3S15 C;  1I50 C;  2JA8 K;  3S1N C;  3GTP K;  3PO3 K;  5C44 C;  4A3L K;  5C3E K;  4A3E C;  2WB1 D;  4Y52 C;  2NVY K;  3GTJ C;  5C3E C;  5IYD C;  2NVX K;  2PMZ D;  2NVQ C;  3HOY K;  3HOW C;  2JA7 K;  2B63 C;  1IW7 A;  2WAQ D;  3PO2 C;  2WB1 L;  5IYB C;  1SFO C;  2E2H C;  2R92 K;  3I4N C;  2PMZ L;  2E2J C;  5M5Y K;  4QJV A;  5IP7 K;  3GTK C;  4OIR A;  1Y1V C;  4OIQ A;  4MEX A;  1TWG K;  1TWH K;  4G7O A;  2R7Z C;  4LK1 A;  1TWG C;  4XSX A;  4C2M K;  3GTQ K;  1I6H K;  2CW0 A;  1R9T K;  3S1R C;  5M5X K;  3GTQ C;  2E2I K;  4A3G C;  1I6H C;  4A3M C;  4C3H K;  3H0G K;  3HOX K;  4OIO A;  2YU9 C;  3S2H C;  2JA5 K;  1K83 C;  4BBS C;  4YFN A;  2A6H A;  4BBR C;  3S15 K;  1I50 K;  5M5W K;  1I6V A;  3S1N K;  5TMF A;  3S1M K;  4YG2 A;  2Y0S L;  4GZY A;  4Y7N C;  5C44 K;  3S1M C;  4A3E K;  4Y52 K;  4A3J K;  3GTJ K;  4A3F C;  3S16 C;  5IYD K;  2NVQ K;  4A3J C;  4JK1 A;  1TWF C;  3HOW K;  1YNN A;  4C3J K;  4A3K C;  3GTL C;  3RZO C;  4X6A C;  4A93 C;  2B63 K;  3PO2 K;  4A3C C;  4LLG A;  5IYB K;  2E2H K;  1SFO K;  1WCM C;  4LJZ A;  1TWA C;  5C4J C;  3HOZ C;  3I4N K;  4KMU A;  1ZYR A;  1Y1W C;  2E2J K;  3GTK K;  3HOV C;  4BY1 C;  1Y1V K;  3S2D C;  2R7Z K;  4A3D C;  3GTG C;  4YFX A;  3S1R K;  1XPP A;  3S17 C;  4A3G K;  3I4M C;  4Q5S A;  4A3M K;  4XSZ A;  3S2H K;  3S14 C;  2YU9 K;  4BXX C;  1K83 K;  2Y0S D;  2NVT C;  3GTM C;  4BBS K;  4BBR K;  2PPB A;  4ZH4 A;  4A3I C;  5FLM C;  4Y7N K;  5C4X C;  4C3I K;  3GTO C;  4OIP A;  5TMC A;  4A3F K;  3S16 K;  1TWF K;  3WOD A;  3RZO K;  4A3K K;  3GTL K;  1I3Q C;  4X6A K;  4A93 K;  1TWC C;  1BDF A;  2O5J A;  4A3C K;  5IP9 C;  3FKI C;  1WCM K;  5C4J K;  4QJV B;  1TWA K;  1YNJ A;  4NOI A;  1Y1W K;  2JA6 C;  1HQM A;  3HOV K;  3HOZ K;  4A3B C;  3DXJ A;  2PA8 L;  4XLP A;  4BY1 K;  3CQZ C;  4A3B K;  3S1Q C;  1SMY A;  3S2D K;  4A3D K;  4G7H A;  2BE5 A;  3GTG K;  4G7Z A;  5D4D A;  2VUM C;  3S17 K;  3I4M K;  3M4O C;  3H3V D;  4BXX K;  4AYB L;  3HKZ L;  3S14 K;  5IYC C;  2NVT K;  3GTM K;  4KN7 A;  4OIN A;  4A3I K;  4QIW L;  5FLM K;  3EQL A;  4BY7 C;  5M3F K;  2O5I A;  2JA8 C;  3H3V L;  4LK0 A;  5C4X K; 
#chains in the Genus database with same CATH topology
 3GTP C;  2NVY C;  3CQZ A;  4MQ9 A;  2GAG C;  3HOY C;  1TWC K;  2PA8 D;  5IP9 K;  3K7A K;  2JA6 K;  4XCH A;  3RZD K;  1XZQ A;  2A69 A;  3HOU C;  2A68 A;  1VH2 A;  1V5V A;  1XZP A;  1BGW A;  5IOR A;  1R9T C;  1PJ6 A;  3GTP A;  4C3H C;  2NVY A;  1ZVU A;  1WSR A;  2CFA A;  3BUE A;  4A3L K;  3FKI A;  3GEI A;  3GTJ C;  2NVQ C;  4G0U A;  2JA7 K;  3PO2 C;  4WJ4 A;  2E2H C;  1R9T A;  3T01 A;  1ZXO A;  4RMF A;  2W7V A;  1TWH K;  3TFI A;  4LK1 A;  3GTQ K;  2V6T A;  1I6H K;  4KMH A;  2E2I K;  2V6U A;  3H0G K;  1AB4 A;  3GTJ A;  3S15 K;  3T02 A;  1EQR A;  2E2H A;  5TJ3 A;  2XCR B;  4A3J K;  4GT9 A;  3S16 C;  2R92 A;  5IYD K;  4JK1 A;  1TWF C;  3RZO C;  4A3K C;  1XXB A;  1F7V A;  1DCP A;  1GE9 A;  1XZQ B;  5EGH A;  1G51 A;  3HOZ C;  3I4N K;  1ZYR A;  5EGE A;  1Y1V K;  4GTB A;  1XZP B;  1PJ7 A;  1ISE A;  3QX3 A;  4YFX A;  3SZZ A;  1K83 K;  1RU0 A;  1UV7 A;  4BBR K;  1IBA A;  1TWF A;  4ZH4 A;  1O2B A;  2XCQ A;  3MML B;  2V6S A;  4BLA A;  5C4X C;  2ZUE A;  4OIP A;  4GTL A;  3GTL K;  1ZBS A;  1BDF A;  1XXA A;  4A3C K;  5C4J K;  1TWA K;  3TTG A;  3HOV K;  3DXJ A;  1USO A;  4G0V A;  2D6F C;  3S1Q C;  3LAJ A;  5IOQ A;  1B4B A;  1EH1 A;  3GEE A;  4KAW X;  1IL2 A;  3AD8 C;  3S14 K;  2NVT K;  4KN7 A;  4OIN A;  1O26 A;  2KWA A;  2Y3P A;  4BY7 C;  4LK0 A;  2P8T A;  3PO3 C;  1WCM A;  2R93 C;  2NVX C;  1YCL A;  4FZB A;  4M1X A;  1XXC A;  3FKI K;  3HOU K;  3M3Y C;  4A3B K;  4XLN A;  2WAQ L;  4P9S A;  3JST A;  4AYB D;  1IS1 A;  4C2M C;  4QIW D;  3S0X A;  5IYC K;  4G0W A;  2EBB A;  1X31 C;  3HOX C;  2JA5 C;  1IE0 A;  2R93 A;  4GTD A;  2FQO A;  5C44 C;  4A3E C;  3AD7 C;  5C3E C;  3OPF A;  4C3J C;  2B63 C;  2WB1 L;  2R92 K;  2VUM A;  2PMZ L;  2E2J C;  5M5Y K;  3LPX A;  5IP7 K;  3GTK C;  3OEP A;  4GTF A;  4OIQ A;  2JA5 A;  2CW0 A;  4J3N A;  2ZUF A;  3S2H C;  2YU9 C;  3G4C A;  4YFN A;  1I50 K;  5CJ9 A;  3GDZ A;  3S1N K;  4Y7N C;  3S1M C;  2GSN A;  4C3I C;  4Y52 K;  3VA7 A;  3GTK A;  1INN A;  5E68 A;  3HOW K;  4X6A C;  1O28 A;  2XCO A;  5IYB K;  3FOF A;  1SFO K;  2YU9 A;  1J6W A;  4P5A A;  3S2D C;  2R7Z K;  4A3D C;  3S1R K;  4A3G K;  4A3M K;  1EK8 A;  4GTE A;  3GTM C;  2Y0S D;  4BBS K;  2PPB A;  4A3I C;  5FLM C;  4BLB A;  3ERE D;  4KC6 A;  4A3F K;  3N0C A;  4AH6 A;  4A93 K;  1TWC C;  3AH5 A;  3V4G A;  3ADA C;  5IP9 C;  1WCM K;  2JA6 C;  1YNJ A;  1Y1W K;  2PA8 L;  4XLP A;  4BY1 K;  3GTM A;  4G7H A;  3GTG K;  4G7Z A;  4BKW A;  3S17 K;  3I4M K;  4BXX K;  4KM9 A;  4KAS A;  2PHC B;  1TWC A;  2O5I A;  3AQO A;  2CFA B;  2GSU A;  1SMY A;  3IPJ A;  1WQF A;  3GTO K;  2JA6 A;  4A3L C;  2R93 K;  1USM A;  1I3Q K;  4MEY A;  3T00 A;  1L0W A;  2JA7 C;  1O25 A;  3M3Y K;  1O24 A;  3CQZ K;  4YFK A;  4PAB A;  3HKZ D;  1TWH C;  2VUM K;  3M4O K;  2E2I C;  3H0G C;  5CHP A;  4GTA A;  1JOE A;  3S15 C;  2JA8 K;  2JA7 A;  3GTP K;  4WJ3 M;  5C3E K;  2WB1 D;  2NVY K;  4ILD A;  5IYD C;  2PMZ D;  3HOY K;  1TWH A;  1WSV A;  3I4N C;  1JQW A;  4QJV A;  1BJT A;  1WOO A;  3BP8 C;  3H0G A;  4OIR A;  1Y1V C;  4KB2 A;  1TWG C;  4XSX A;  1R9T K;  4GFQ A;  4C3H K;  4OIO A;  3N3Y A;  1K83 C;  1VRQ C;  4BBR C;  3G4A A;  4KMD A;  5M5W K;  2NVX A;  4KB4 A;  1WOS A;  3S1M K;  1EI6 A;  3AQP A;  3GTJ K;  1EFW A;  2NVQ K;  1Y1V A;  1YNN A;  3A8J A;  3GTL C;  4KDD A;  3PO2 K;  4KAR A;  1TWG A;  4A3C C;  2E2H K;  5C4J C;  1DD5 A;  1TWA C;  4KMU A;  3HOV C;  1DCO A;  1K83 A;  4C45 A;  3A8K A;  2ZFZ A;  4LQY A;  1XPP A;  5IOT A;  4DDQ A;  3S14 C;  2NVT C;  2GSO A;  3TFJ A;  3GTL A;  3TFH A;  1VJE A;  4WIL A;  3GIR A;  2B63 A;  1TWA A;  2P5M A;  3S16 K;  1TWF K;  3RZO K;  4A3K K;  5HL8 A;  3FKI C;  3HOZ K;  4NOI A;  4QJV B;  2RH6 A;  1HQM A;  4A3B C;  4AYB L;  5IYC C;  4QIW L;  1BS2 A;  3EQL A;  5M3F K;  3H3V L;  5C4X K;  3Q3Q A;  1O29 A;  4KN4 A;  4LR2 A;  3GEH A;  1C0A A;  2A6E A;  2R92 C;  3K7A C;  5M3M K;  5FJ8 K;  3RZD C;  2JH3 A;  5IP7 C;  3ORE A;  4LOW A;  5JVO A;  3S1Q K;  1ZQ1 C;  4Q4Z A;  3L4J A;  3BP3 A;  4BY7 K;  1I50 C;  3S1N C;  3PO3 K;  3FHZ A;  4Y52 C;  3FOE A;  2NVX K;  3HOW C;  1O27 A;  1IW7 A;  2WAQ D;  3LAP A;  3L4K A;  5IYB C;  1SFO C;  3HXA A;  4MEX A;  1B4A A;  1TWG K;  1KQ4 A;  4O2D A;  4G7O A;  1I50 A;  2R7Z C;  4C2M K;  3S1R C;  1J98 A;  5M5X K;  3GTQ C;  4A3G C;  1I6H C;  4A3M C;  3HOX K;  2JA5 K;  4BBS C;  2A6H A;  1DCH A;  1VLO A;  5L46 A;  1I6V A;  2GAH C;  1WQH A;  1WOP A;  4PAA A;  2Y0S L;  4YG2 A;  5TMF A;  1F7U A;  4GZY A;  5C44 K;  1SFO A;  4A3E K;  4A3F C;  1F9N A;  3A8I A;  4A3J C;  1WIH A;  4C3J K;  4A93 C;  2B63 K;  4FM9 A;  2R7Z A;  4LLG A;  1HI9 A;  1WCM C;  4LJZ A;  3GSI A;  3GTQ A;  1Y1W C;  2E2J K;  3GTK K;  2E2I A;  4BY1 C;  4KAT A;  3SZY A;  1F93 A;  3GTG C;  3S17 C;  1WQG A;  4Q5S A;  3I4M C;  4XSZ A;  3S2H K;  4BXX C;  2YU9 K;  1J6V A;  5IOS A;  1JVI A;  4Y7N K;  1O2F B;  4KMA A;  4C3I K;  3GTO C;  1Y1W A;  5TMC A;  3N0B A;  2FQT A;  3WOD A;  1O2A A;  1I3Q C;  4X6A K;  3AD9 C;  2O5J A;  1J6X A;  4GTC A;  3GTG A;  1VGX A;  5JFE A;  1YX2 A;  4KM8 A;  3CQZ C;  1IQ0 A;  2RGR A;  3S2D K;  4A3D K;  2BE5 A;  2VUM C;  5D4D A;  3M4O C;  3H3V D;  3HKZ L;  3GTO A;  3NUH A;  1PJ5 A;  3GTM K;  4P5B A;  4A3I K;  5FLM K;  1WOR A;  1I3Q A;  3CAG A;  2JA8 C; 
#chains in the Genus database with same CATH homology
 3GTP C;  3GTO K;  3PO3 C;  4A3L C;  2R93 K;  2NVY C;  2R93 C;  4MQ9 A;  2NVX C;  4MEY A;  1I3Q K;  3HOY C;  1TWC K;  4KN4 A;  2JA7 C;  2PA8 D;  5IP9 K;  3FKI K;  3M3Y K;  3K7A K;  2JA6 K;  3RZD K;  3HOU K;  2A6E A;  2R92 C;  3M3Y C;  3K7A C;  5M3M K;  2A69 A;  5FJ8 K;  3RZD C;  3HOU C;  2A68 A;  5IP7 C;  3CQZ K;  2WAQ L;  4YFK A;  4XLN A;  3S1Q K;  4AYB D;  3HKZ D;  1TWH C;  4Q4Z A;  2VUM K;  1R9T C;  4QIW D;  3M4O K;  2E2I C;  5IYC K;  3H0G C;  3HOX C;  2JA5 C;  4BY7 K;  3S15 C;  1I50 C;  2JA8 K;  3S1N C;  3GTP K;  3PO3 K;  5C44 C;  4A3L K;  5C3E K;  4A3E C;  2WB1 D;  4Y52 C;  2NVY K;  3GTJ C;  5C3E C;  5IYD C;  2NVX K;  2PMZ D;  2NVQ C;  3HOY K;  3HOW C;  2JA7 K;  2B63 C;  1IW7 A;  2WAQ D;  3PO2 C;  2WB1 L;  5IYB C;  1SFO C;  2E2H C;  2R92 K;  3I4N C;  2PMZ L;  2E2J C;  5M5Y K;  4QJV A;  5IP7 K;  3GTK C;  4OIR A;  1Y1V C;  4OIQ A;  4MEX A;  1TWG K;  1TWH K;  4G7O A;  2R7Z C;  4LK1 A;  1TWG C;  4XSX A;  4C2M K;  3GTQ K;  1I6H K;  2CW0 A;  1R9T K;  3S1R C;  5M5X K;  3GTQ C;  2E2I K;  4A3G C;  1I6H C;  4A3M C;  4C3H K;  3H0G K;  3HOX K;  4OIO A;  2YU9 C;  3S2H C;  2JA5 K;  1K83 C;  4BBS C;  4YFN A;  2A6H A;  4BBR C;  3S15 K;  1I50 K;  5M5W K;  1I6V A;  3S1N K;  5TMF A;  3S1M K;  4YG2 A;  2Y0S L;  4GZY A;  4Y7N C;  5C44 K;  3S1M C;  4A3E K;  4Y52 K;  4A3J K;  3GTJ K;  4A3F C;  3S16 C;  5IYD K;  2NVQ K;  4A3J C;  4JK1 A;  1TWF C;  3HOW K;  1YNN A;  4C3J K;  4A3K C;  3GTL C;  3RZO C;  4X6A C;  4A93 C;  2B63 K;  3PO2 K;  4A3C C;  4LLG A;  5IYB K;  2E2H K;  1SFO K;  1WCM C;  4LJZ A;  1TWA C;  5C4J C;  3HOZ C;  3I4N K;  4KMU A;  1ZYR A;  1Y1W C;  2E2J K;  3GTK K;  3HOV C;  4BY1 C;  1Y1V K;  3S2D C;  2R7Z K;  4A3D C;  3GTG C;  4YFX A;  3S1R K;  1XPP A;  3S17 C;  4A3G K;  3I4M C;  4Q5S A;  4A3M K;  4XSZ A;  3S2H K;  3S14 C;  2YU9 K;  4BXX C;  1K83 K;  2Y0S D;  2NVT C;  3GTM C;  4BBS K;  4BBR K;  2PPB A;  4ZH4 A;  4A3I C;  5FLM C;  4Y7N K;  5C4X C;  4C3I K;  3GTO C;  4OIP A;  5TMC A;  4A3F K;  3S16 K;  1TWF K;  3WOD A;  3RZO K;  4A3K K;  3GTL K;  1I3Q C;  4X6A K;  4A93 K;  1TWC C;  1BDF A;  2O5J A;  4A3C K;  5IP9 C;  3FKI C;  1WCM K;  5C4J K;  4QJV B;  1TWA K;  1YNJ A;  4NOI A;  1Y1W K;  2JA6 C;  1HQM A;  3HOV K;  3HOZ K;  4A3B C;  3DXJ A;  2PA8 L;  4XLP A;  4BY1 K;  3CQZ C;  4A3B K;  3S1Q C;  1SMY A;  3S2D K;  4A3D K;  4G7H A;  2BE5 A;  3GTG K;  4G7Z A;  5D4D A;  2VUM C;  3S17 K;  3I4M K;  3M4O C;  3H3V D;  4BXX K;  4AYB L;  3HKZ L;  3S14 K;  5IYC C;  2NVT K;  3GTM K;  4KN7 A;  4OIN A;  4A3I K;  4QIW L;  5FLM K;  3EQL A;  4BY7 C;  5M3F K;  2O5I A;  2JA8 C;  3H3V L;  4LK0 A;  5C4X K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...