4AYBL

Rnap at 3.2ang
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
91
structure length
91
Chain Sequence
MEIKILKSESNYLELEIEGEDHTLGNLIAGTLRKISGVSFASYYQPHPLTDKIIVKILTDGSIAPKDALLKAIETVRVMASHYIDEIKGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
total genus 24
structure length 91
sequence length 91
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4aybL00
5IYCK 3HOWC 1SMYA 2JA8K 4OIRA 4LJZA 4A3JC 3HOVK 3HOYK 3GTKK 5M5YK 2NVQC 4A3EK 3S1NK 4A93K 4XLPA 1TWAC 2YU9C 1TWHC 3EQLA 2PA8L 3PO2K 2Y0SD 4BXXC 2PMZD 4X6AK 3H0GK 5M5XK 4Q5SA 4Y52C 1Y1VK 4XSXA 5IYDK 4QIWD 3GTQK 5TMCA 1Y1WK 2R7ZK 2E2HK 5IP7C 1SFOC 4QJVA 4MEYA 4C3JK 2R92K 4A3LC 4XSZA 5TMFA 3S1QK 2WAQD 3HOUK 3S16C 4C3HK 2WB1D 4A3BC 5C4JK 4BBSC 1TWFC 3PO3C 4ZH4A 4BBRC 3GTGK 4OIPA 4LK1A 3S16K 4MQ9A 2WB1L 4A3KC 1I50C 3I4MC 3S2HK 2JA5K 3GTLK 3RZOK 1I3QC 3S17C 1HQMA 3GTJK 1SFOK 2E2IC 2NVXC 4JK1A 3S17K 1ZYRA 2NVYK 5IP9C 3GTLC 4YG2A 4A3CC 3S1MK 1XPPA 3S1RC 2NVTK 2PA8D 4C3IK 3RZDC 2E2JK 3GTGC 4BY1K 1TWFK 2PMZL 1I6HK 3GTPC 4YFKA 2NVTC 3HOUC 2VUMK 4KMUA 2VUMC 3GTJC 3S15K 2YU9K 2R93C 2E2HC 5D4DA 4A3MC 3M4OC 3GTMK 3S2HC 3GTMC 4A3JK 4A3MK 4BY1C 2NVYC 5IP9K 3HOVC 3M4OK 4A3CK 1TWGK 2WAQL 3GTOC 3S1RK 1K83C 4YFXA 3S1MC 1IW7A 5FJ8K 1YNNA 4A3LK 4A3KK 3PO2C 3GTOK 3GTPK 1I3QK 2R93K 3FKIC 3S14C 4AYBD 4A3EC 3I4MK 1Y1VC 5IYDC 3FKIK 3S14K 5C4JC 4BBSK 2E2IK 2NVXK 4G7ZA 3H0GC 5IP7K 3HKZD 1TWHK 1TWGC 1TWAK 3CQZC 4A3FK 1Y1WC 1TWCC 4G7HA 1I6VA 2R7ZC 2NVQK 4A93C 4A3BK 1I6HC 4X6AC 2JA6C 4Y7NC 3HOZK 4LK0A 4Q4ZA 2R92C 3S15C 5IYCC 3HOWK 5C3EK 4OINA 2JA8C 3DXJA 3RZDK 2E2JC 3HOYC 5M3FK 3HOXC 3K7AC 4AYBL 2CW0A 5C44C 4BY7K 2JA5C 3RZOC 1I50K 2A69A 5C44K 3GTQC 5M5WK 2B63K 1WCMC 3HKZL 4BBRK 3PO3K 3H3VL 5FLMC 1R9TC 5FLMK 3S1QC 4OIOA 1YNJA 1BDFA 3H3VD 5C4XK 4XLNA 2A68A 5C3EC 2JA7K 4QJVB 3S2DK 4A3GC 4MEXA 2A6HA 3M3YC 4A3DK 4Y7NK 3HOZC 2A6EA 3S2DC 4A3GK 4Y52K 4C2MK 2Y0SL 4A3DC 4BXXK 1WCMK 2PPBA 4OIQA 5C4XC 4KN7A 3S1NC 3GTKC 4QIWL 4A3IC 2O5IA 3K7AK 3M3YK 3HOXK 4KN4A 3WODA 4A3IK 2JA6K 4G7OA 2JA7C 4NOIA 4YFNA 1TWCK 2BE5A 3I4NC 3CQZK 5IYBK 4LLGA 4A3FC 2B63C 4BY7C 2O5JA 5IYBC 4GZYA 3I4NK 5M3MK 1K83K 1R9TK
chains in the Genus database with same CATH superfamily
5IYCK 5L46A 3HOYK 4OIRA 3HOVK 4KAWX 3GTKK 2NVQC 4A3EK 1USOA 3ADAC 3PO2K 2PMZD 3GEIA 3H0GK 4KB4A 4Q5SA 1Y1WK 4PABA 5IP7C 4MEYA 2E2HA 4XSZA 5TMFA 3S16C 5C4JK 1IQ0A 1GE9A 5IOQA 4LR2A 1ZVUA 2JA5K 3S17C 3GTJK 1SFOK 3BUEA 4JK1A 2ZUEA 3S17K 4A3CC 1EI6A 4YG2A 3S1MK 1DCOA 2NVXA 3S1RC 1JVIA 2NVTK 3RZDC 2CFAB 3HOUC 1TWFA 1HI9A 1O24A 2YU9K 3Q3QA 3M4OC 3GTMC 4BY1C 5IP9K 1K83A 3GTOC 4YFXA 1IW7A 2KWAA 4A3LK 2V6TA 3GTOK 3GTPK 3FKIA 4AYBD 3I4MK 2R93A 1B4AA 5C4JC 2E2IK 2D6FC 5IP7K 2EBBA 1J98A 3GTMA 1TWAK 1Y1WC 4G7HA 1YCLA 4X6AC 4LK0A 4Q4ZA 4C3JC 2R92C 1PJ5A 4OINA 2GSNA 3OPFA 2PHCB 3HOYC 1DCHA 1G51A 3MMLB 5M3FK 1EFWA 3HOXC 4AYBL 3FHZA 4GTAA 5C44C 1IL2A 4RMFA 2W7VA 5C44K 1WCMC 3AH5A 4LQYA 3TTGA 4GTDA 3S1QC 4OIOA 1YNJA 1XXAA 1V5VA 2A68A 1XZQA 3LAJA 4QJVB 4GTBA 2A6HA 3S2DC 4OIQA 4KN7A 3T01A 3HOXK 2JA6K 1WORA 4YFNA 1Y1VA 3CQZK 5IYBK 4AH6A 2ZUFA 3TFJA 5IYBC 4LJZA 4FM9A 4A93K 3S1NK 1O29A 4KC6A 3EQLA 2Y0SD 2P8TA 3OREA 2ZFZA 2R7ZK 1IS1A 1WSVA 1SFOC 3GDZA 4C3JK 2R92K 1DCPA 4KMHA 4BKWA 3ERED 1TWFC 3PO3C 4GTLA 3GTGK 1I50C 5CHPA 5E68A 1J6VA 3HXAA 3GTLK 1HQMA 2NVXC 1VH2A 1ZYRA 2NVYK 3GTLC 1SFOA 1XPPA 1VLOA 2PA8D 3GTGC 2PMZL 4YFKA 2VUMK 2VUMC 2JA6A 2R93C 4GTFA 3S2HC 1TWHA 2GSOA 2YU9A 4A3JK 4A3MK 2WAQL 3JSTA 5FJ8K 1YNNA 2GSUA 1WIHA 1X31C 1O2FB 2FQTA 1Y1VC 5IYDC 3FKIK 3HKZD 1ZBSA 2P5MA 1TWGC 3CQZC 1F7UA 2R7ZC 1I6HC 2NVQK 4C3HC 1XZQB 5JFEA 2JA6C 4Y7NC 3L4KA 1O2AA 2JA7A 5C3EK 3BP8C 4C45A 1XZPA 2JH3A 3GEHA 3T00A 1VGXA 3AQPA 1ISEA 3L4JA 3AD7C 1UV7A 3LAPA 1I3QA 3K7AC 1WOOA 1I50A 4BY7K 3RZOC 1WQFA 1WCMA 2B63K 4WJ4A 5FLMC 1R9TC 1BDFA 4KARA 1R9TA 3G4CA 1F93A 1ZXOA 4XLNA 5C3EC 1IE0A 4P5AA 4Y52K 4Y7NK 3A8IA 2Y0SL 4A3DC 1BS2A 4BXXK 1F7VA 4BLBA 3GTKC 5IORA 2XCQA 2XCOA 3M3YK 1DD5A 3OEPA 2JA7C 3I4NC 1INNA 4DDQA 1EK8A 3CQZA 5M3MK 3BP3A 3I4NK 1TWGA 3GSIA 4KM9A 4A3JC 4FZBA 2PA8L 4BXXC 4X6AK 1O28A 4Y52C 1Y1VK 1VRQC 5IYDK 4QIWD 5TMCA 1J6WA 2WAQD 3HOUK 4C3HK 4ZH4A 4BBRC 1F9NA 4LK1A 4MQ9A 4A3KC 3I4MC 3GTPA 3S2HK 3RZOK 3GTGA 3TFHA 2R93K 1VJEA 3GTLA 5IP9C 4O2DA 2E2IA 4BY1K 3H0GA 1B4BA 2R92A 3NUHA 3S15K 1XZPB 5D4DA 4A3MC 1IBAA 4KASA 4A3CK 1TWGK 3S1RK 3S1MC 4A3KK 3PO2C 3FKIC 1L0WA 4A3EC 1O26A 4GTEA 3GTJA 2VUMA 3S14K 2NVXK 1WOSA 3A8KA 3T02A 1TWHK 4A93C 4ILDA 4A3BK 4WILA 1EQRA 3SZYA 3HOWK 4GT9A 2E2JC 4C3IC 2CFAA 1I50K 3GTQA 3HKZL 2RGRA 2GAHC 2XCRB 3PO3K 3H3VL 4PAAA 5FLMK 1TWAA 1WQGA 3H3VD 2V6SA 3N0CA 4KMDA 4A3GC 4MEXA 5IOTA 4A3DK 2A6EA 4C2MC 3S0XA 1WCMK 2PPBA 1WQHA 4G0VA 3N0BA 2GAGC 3QX3A 5C4XC 3S1NC 3LPXA 4A3IC 2O5IA 3WODA 4NOIA 1TWCK 2BE5A 4BY7C 3FOEA 4A3FC 4LLGA 2B63C 1Y1WA 3HOWC 1SMYA 4GFQA 5CJ9A 1YX2A 2JA8K 3GTKA 3AD8C 1PJ7A 2NVYA 5M5YK 4XLPA 1PJ6A 1TWAC 2YU9C 1TWHC 1JOEA 1O25A 5M5XK 4M1XA 3A8JA 4XSXA 3GTQK 2E2HK 4QJVA 4A3LC 3AQOA 3S1QK 4A3BC 2WB1D 4BBSC 2JA5A 4OIPA 3S16K 2WB1L 3FOFA 4P5BA 1I3QC 3GIRA 4P9SA 2E2IC 1BGWA 4KB2A 2RH6A 4C3IK 3N3YA 2E2JK 4G0UA 1TWFK 4KMAA 4J3NA 3GTPC 1I6HK 2NVTC 1XXBA 4KMUA 5IOSA 3GTJC 2E2HC 1TWCA 3GTMK 3HOVC 3M4OK 2NVYC 1BJTA 1K83C 3GTOA 5TJ3A 1I3QK 3S14C 1C0AA 1O2BA 4LOWA 1AB4A 5EGHA 4BBSK 4G7ZA 3H0GC 1RU0A 2FQOA 4XCHA 5EGEA 4A3FK 1TWCC 1I6VA 3G4AA 3HOZK 3S15C 5IYCC 3IPJA 2JA8C 3DXJA 3RZDK 1J6XA 1KQ4A 3CAGA 1USMA 2CW0A 4KDDA 1WOPA 2JA5C 2A69A 3GTQC 5M5WK 4BBRK 5JVOA 3VA7A 4WJ3M 4KM8A 1EH1A 2Y3PA 5C4XK 3TFIA 2JA7K 3S2DK 1XXCA 3M3YC 3HOZC 4G0WA 4A3GK 1O27A 4C2MK 4GTCA 3V4GA 2V6UA 1WSRA 1ZQ1C 4QIWL 3K7AK 4KATA 4BLAA 4KN4A 4G7OA 4A3IK 1JQWA 2B63A 3SZZA 5HL8A 2O5JA 3GEEA 4GZYA 2R7ZA 3AD9C 1K83K 1R9TK
chains in the Genus database with same CATH topology
5IYCK 3HOWC 1SMYA 2JA8K 4OIRA 4LJZA 4A3JC 3HOVK 3HOYK 3GTKK 5M5YK 2NVQC 4A3EK 3S1NK 4A93K 4XLPA 1TWAC 2YU9C 1TWHC 3EQLA 2PA8L 3PO2K 2Y0SD 4BXXC 2PMZD 4X6AK 3H0GK 5M5XK 4Q5SA 4Y52C 1Y1VK 4XSXA 5IYDK 4QIWD 3GTQK 5TMCA 1Y1WK 2R7ZK 2E2HK 5IP7C 1SFOC 4QJVA 4MEYA 4C3JK 2R92K 4A3LC 4XSZA 5TMFA 3S1QK 2WAQD 3HOUK 3S16C 4C3HK 2WB1D 4A3BC 5C4JK 4BBSC 1TWFC 3PO3C 4ZH4A 4BBRC 3GTGK 4OIPA 4LK1A 3S16K 4MQ9A 2WB1L 4A3KC 1I50C 3I4MC 3S2HK 2JA5K 3GTLK 3RZOK 1I3QC 3S17C 1HQMA 3GTJK 1SFOK 2E2IC 2NVXC 4JK1A 3S17K 1ZYRA 2NVYK 5IP9C 3GTLC 4YG2A 4A3CC 3S1MK 1XPPA 3S1RC 2NVTK 2PA8D 4C3IK 3RZDC 2E2JK 3GTGC 4BY1K 1TWFK 2PMZL 1I6HK 3GTPC 4YFKA 2NVTC 3HOUC 2VUMK 4KMUA 2VUMC 3GTJC 3S15K 2YU9K 2R93C 2E2HC 5D4DA 4A3MC 3M4OC 3GTMK 3S2HC 3GTMC 4A3JK 4A3MK 4BY1C 2NVYC 5IP9K 3HOVC 3M4OK 4A3CK 1TWGK 2WAQL 3GTOC 3S1RK 1K83C 4YFXA 3S1MC 1IW7A 5FJ8K 1YNNA 4A3LK 4A3KK 3PO2C 3GTOK 3GTPK 1I3QK 2R93K 3FKIC 3S14C 4AYBD 4A3EC 3I4MK 1Y1VC 5IYDC 3FKIK 3S14K 5C4JC 4BBSK 2E2IK 2NVXK 4G7ZA 3H0GC 5IP7K 3HKZD 1TWHK 1TWGC 1TWAK 3CQZC 4A3FK 1Y1WC 1TWCC 4G7HA 1I6VA 2R7ZC 2NVQK 4A93C 4A3BK 1I6HC 4X6AC 2JA6C 4Y7NC 3HOZK 4LK0A 4Q4ZA 2R92C 3S15C 5IYCC 3HOWK 5C3EK 4OINA 2JA8C 3DXJA 3RZDK 2E2JC 3HOYC 5M3FK 3HOXC 3K7AC 4AYBL 2CW0A 5C44C 4BY7K 2JA5C 3RZOC 1I50K 2A69A 5C44K 3GTQC 5M5WK 2B63K 1WCMC 3HKZL 4BBRK 3PO3K 3H3VL 5FLMC 1R9TC 5FLMK 3S1QC 4OIOA 1YNJA 1BDFA 3H3VD 5C4XK 4XLNA 2A68A 5C3EC 2JA7K 4QJVB 3S2DK 4A3GC 4MEXA 2A6HA 3M3YC 4A3DK 4Y7NK 3HOZC 2A6EA 3S2DC 4A3GK 4Y52K 4C2MK 2Y0SL 4A3DC 4BXXK 1WCMK 2PPBA 4OIQA 5C4XC 4KN7A 3S1NC 3GTKC 4QIWL 4A3IC 2O5IA 3K7AK 3M3YK 3HOXK 4KN4A 3WODA 4A3IK 2JA6K 4G7OA 2JA7C 4NOIA 4YFNA 1TWCK 2BE5A 3I4NC 3CQZK 5IYBK 4LLGA 4A3FC 2B63C 4BY7C 2O5JA 5IYBC 4GZYA 3I4NK 5M3MK 1K83K 1R9TK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYC K;  3HOW C;  1SMY A;  2JA8 K;  4OIR A;  4LJZ A;  4A3J C;  3HOV K;  3HOY K;  3GTK K;  5M5Y K;  2NVQ C;  4A3E K;  3S1N K;  4A93 K;  4XLP A;  1TWA C;  2YU9 C;  1TWH C;  3EQL A;  2PA8 L;  3PO2 K;  2Y0S D;  4BXX C;  2PMZ D;  4X6A K;  3H0G K;  5M5X K;  4Q5S A;  4Y52 C;  1Y1V K;  4XSX A;  5IYD K;  4QIW D;  3GTQ K;  5TMC A;  1Y1W K;  2R7Z K;  2E2H K;  5IP7 C;  1SFO C;  4QJV A;  4MEY A;  4C3J K;  2R92 K;  4A3L C;  4XSZ A;  5TMF A;  3S1Q K;  2WAQ D;  3HOU K;  3S16 C;  4C3H K;  2WB1 D;  4A3B C;  5C4J K;  4BBS C;  1TWF C;  3PO3 C;  4ZH4 A;  4BBR C;  3GTG K;  4OIP A;  4LK1 A;  3S16 K;  4MQ9 A;  2WB1 L;  4A3K C;  1I50 C;  3I4M C;  3S2H K;  2JA5 K;  3GTL K;  3RZO K;  1I3Q C;  3S17 C;  1HQM A;  3GTJ K;  1SFO K;  2E2I C;  2NVX C;  4JK1 A;  3S17 K;  1ZYR A;  2NVY K;  5IP9 C;  3GTL C;  4YG2 A;  4A3C C;  3S1M K;  1XPP A;  3S1R C;  2NVT K;  2PA8 D;  4C3I K;  3RZD C;  2E2J K;  3GTG C;  4BY1 K;  1TWF K;  2PMZ L;  1I6H K;  3GTP C;  4YFK A;  2NVT C;  3HOU C;  2VUM K;  4KMU A;  2VUM C;  3GTJ C;  3S15 K;  2YU9 K;  2R93 C;  2E2H C;  5D4D A;  4A3M C;  3M4O C;  3GTM K;  3S2H C;  3GTM C;  4A3J K;  4A3M K;  4BY1 C;  2NVY C;  5IP9 K;  3HOV C;  3M4O K;  4A3C K;  1TWG K;  2WAQ L;  3GTO C;  3S1R K;  1K83 C;  4YFX A;  3S1M C;  1IW7 A;  5FJ8 K;  1YNN A;  4A3L K;  4A3K K;  3PO2 C;  3GTO K;  3GTP K;  1I3Q K;  2R93 K;  3FKI C;  3S14 C;  4AYB D;  4A3E C;  3I4M K;  1Y1V C;  5IYD C;  3FKI K;  3S14 K;  5C4J C;  4BBS K;  2E2I K;  2NVX K;  4G7Z A;  3H0G C;  5IP7 K;  3HKZ D;  1TWH K;  1TWG C;  1TWA K;  3CQZ C;  4A3F K;  1Y1W C;  1TWC C;  4G7H A;  1I6V A;  2R7Z C;  2NVQ K;  4A93 C;  4A3B K;  1I6H C;  4X6A C;  2JA6 C;  4Y7N C;  3HOZ K;  4LK0 A;  4Q4Z A;  2R92 C;  3S15 C;  5IYC C;  3HOW K;  5C3E K;  4OIN A;  2JA8 C;  3DXJ A;  3RZD K;  2E2J C;  3HOY C;  5M3F K;  3HOX C;  3K7A C;  4AYB L;  2CW0 A;  5C44 C;  4BY7 K;  2JA5 C;  3RZO C;  1I50 K;  2A69 A;  5C44 K;  3GTQ C;  5M5W K;  2B63 K;  1WCM C;  3HKZ L;  4BBR K;  3PO3 K;  3H3V L;  5FLM C;  1R9T C;  5FLM K;  3S1Q C;  4OIO A;  1YNJ A;  1BDF A;  3H3V D;  5C4X K;  4XLN A;  2A68 A;  5C3E C;  2JA7 K;  4QJV B;  3S2D K;  4A3G C;  4MEX A;  2A6H A;  3M3Y C;  4A3D K;  4Y7N K;  3HOZ C;  2A6E A;  3S2D C;  4A3G K;  4Y52 K;  4C2M K;  2Y0S L;  4A3D C;  4BXX K;  1WCM K;  2PPB A;  4OIQ A;  5C4X C;  4KN7 A;  3S1N C;  3GTK C;  4QIW L;  4A3I C;  2O5I A;  3K7A K;  3M3Y K;  3HOX K;  4KN4 A;  3WOD A;  4A3I K;  2JA6 K;  4G7O A;  2JA7 C;  4NOI A;  4YFN A;  1TWC K;  2BE5 A;  3I4N C;  3CQZ K;  5IYB K;  4LLG A;  4A3F C;  2B63 C;  4BY7 C;  2O5J A;  5IYB C;  4GZY A;  3I4N K;  5M3M K;  1K83 K;  1R9T K; 
#chains in the Genus database with same CATH topology
 5IYC K;  5L46 A;  3HOY K;  4OIR A;  3HOV K;  4KAW X;  3GTK K;  2NVQ C;  4A3E K;  1USO A;  3ADA C;  3PO2 K;  2PMZ D;  3GEI A;  3H0G K;  4KB4 A;  4Q5S A;  1Y1W K;  4PAB A;  5IP7 C;  4MEY A;  2E2H A;  4XSZ A;  5TMF A;  3S16 C;  5C4J K;  1IQ0 A;  1GE9 A;  5IOQ A;  4LR2 A;  1ZVU A;  2JA5 K;  3S17 C;  3GTJ K;  1SFO K;  3BUE A;  4JK1 A;  2ZUE A;  3S17 K;  4A3C C;  1EI6 A;  4YG2 A;  3S1M K;  1DCO A;  2NVX A;  3S1R C;  1JVI A;  2NVT K;  3RZD C;  2CFA B;  3HOU C;  1TWF A;  1HI9 A;  1O24 A;  2YU9 K;  3Q3Q A;  3M4O C;  3GTM C;  4BY1 C;  5IP9 K;  1K83 A;  3GTO C;  4YFX A;  1IW7 A;  2KWA A;  4A3L K;  2V6T A;  3GTO K;  3GTP K;  3FKI A;  4AYB D;  3I4M K;  2R93 A;  1B4A A;  5C4J C;  2E2I K;  2D6F C;  5IP7 K;  2EBB A;  1J98 A;  3GTM A;  1TWA K;  1Y1W C;  4G7H A;  1YCL A;  4X6A C;  4LK0 A;  4Q4Z A;  4C3J C;  2R92 C;  1PJ5 A;  4OIN A;  2GSN A;  3OPF A;  2PHC B;  3HOY C;  1DCH A;  1G51 A;  3MML B;  5M3F K;  1EFW A;  3HOX C;  4AYB L;  3FHZ A;  4GTA A;  5C44 C;  1IL2 A;  4RMF A;  2W7V A;  5C44 K;  1WCM C;  3AH5 A;  4LQY A;  3TTG A;  4GTD A;  3S1Q C;  4OIO A;  1YNJ A;  1XXA A;  1V5V A;  2A68 A;  1XZQ A;  3LAJ A;  4QJV B;  4GTB A;  2A6H A;  3S2D C;  4OIQ A;  4KN7 A;  3T01 A;  3HOX K;  2JA6 K;  1WOR A;  4YFN A;  1Y1V A;  3CQZ K;  5IYB K;  4AH6 A;  2ZUF A;  3TFJ A;  5IYB C;  4LJZ A;  4FM9 A;  4A93 K;  3S1N K;  1O29 A;  4KC6 A;  3EQL A;  2Y0S D;  2P8T A;  3ORE A;  2ZFZ A;  2R7Z K;  1IS1 A;  1WSV A;  1SFO C;  3GDZ A;  4C3J K;  2R92 K;  1DCP A;  4KMH A;  4BKW A;  3ERE D;  1TWF C;  3PO3 C;  4GTL A;  3GTG K;  1I50 C;  5CHP A;  5E68 A;  1J6V A;  3HXA A;  3GTL K;  1HQM A;  2NVX C;  1VH2 A;  1ZYR A;  2NVY K;  3GTL C;  1SFO A;  1XPP A;  1VLO A;  2PA8 D;  3GTG C;  2PMZ L;  4YFK A;  2VUM K;  2VUM C;  2JA6 A;  2R93 C;  4GTF A;  3S2H C;  1TWH A;  2GSO A;  2YU9 A;  4A3J K;  4A3M K;  2WAQ L;  3JST A;  5FJ8 K;  1YNN A;  2GSU A;  1WIH A;  1X31 C;  1O2F B;  2FQT A;  1Y1V C;  5IYD C;  3FKI K;  3HKZ D;  1ZBS A;  2P5M A;  1TWG C;  3CQZ C;  1F7U A;  2R7Z C;  1I6H C;  2NVQ K;  4C3H C;  1XZQ B;  5JFE A;  2JA6 C;  4Y7N C;  3L4K A;  1O2A A;  2JA7 A;  5C3E K;  3BP8 C;  4C45 A;  1XZP A;  2JH3 A;  3GEH A;  3T00 A;  1VGX A;  3AQP A;  1ISE A;  3L4J A;  3AD7 C;  1UV7 A;  3LAP A;  1I3Q A;  3K7A C;  1WOO A;  1I50 A;  4BY7 K;  3RZO C;  1WQF A;  1WCM A;  2B63 K;  4WJ4 A;  5FLM C;  1R9T C;  1BDF A;  4KAR A;  1R9T A;  3G4C A;  1F93 A;  1ZXO A;  4XLN A;  5C3E C;  1IE0 A;  4P5A A;  4Y52 K;  4Y7N K;  3A8I A;  2Y0S L;  4A3D C;  1BS2 A;  4BXX K;  1F7V A;  4BLB A;  3GTK C;  5IOR A;  2XCQ A;  2XCO A;  3M3Y K;  1DD5 A;  3OEP A;  2JA7 C;  3I4N C;  1INN A;  4DDQ A;  1EK8 A;  3CQZ A;  5M3M K;  3BP3 A;  3I4N K;  1TWG A;  3GSI A;  4KM9 A;  4A3J C;  4FZB A;  2PA8 L;  4BXX C;  4X6A K;  1O28 A;  4Y52 C;  1Y1V K;  1VRQ C;  5IYD K;  4QIW D;  5TMC A;  1J6W A;  2WAQ D;  3HOU K;  4C3H K;  4ZH4 A;  4BBR C;  1F9N A;  4LK1 A;  4MQ9 A;  4A3K C;  3I4M C;  3GTP A;  3S2H K;  3RZO K;  3GTG A;  3TFH A;  2R93 K;  1VJE A;  3GTL A;  5IP9 C;  4O2D A;  2E2I A;  4BY1 K;  3H0G A;  1B4B A;  2R92 A;  3NUH A;  3S15 K;  1XZP B;  5D4D A;  4A3M C;  1IBA A;  4KAS A;  4A3C K;  1TWG K;  3S1R K;  3S1M C;  4A3K K;  3PO2 C;  3FKI C;  1L0W A;  4A3E C;  1O26 A;  4GTE A;  3GTJ A;  2VUM A;  3S14 K;  2NVX K;  1WOS A;  3A8K A;  3T02 A;  1TWH K;  4A93 C;  4ILD A;  4A3B K;  4WIL A;  1EQR A;  3SZY A;  3HOW K;  4GT9 A;  2E2J C;  4C3I C;  2CFA A;  1I50 K;  3GTQ A;  3HKZ L;  2RGR A;  2GAH C;  2XCR B;  3PO3 K;  3H3V L;  4PAA A;  5FLM K;  1TWA A;  1WQG A;  3H3V D;  2V6S A;  3N0C A;  4KMD A;  4A3G C;  4MEX A;  5IOT A;  4A3D K;  2A6E A;  4C2M C;  3S0X A;  1WCM K;  2PPB A;  1WQH A;  4G0V A;  3N0B A;  2GAG C;  3QX3 A;  5C4X C;  3S1N C;  3LPX A;  4A3I C;  2O5I A;  3WOD A;  4NOI A;  1TWC K;  2BE5 A;  4BY7 C;  3FOE A;  4A3F C;  4LLG A;  2B63 C;  1Y1W A;  3HOW C;  1SMY A;  4GFQ A;  5CJ9 A;  1YX2 A;  2JA8 K;  3GTK A;  3AD8 C;  1PJ7 A;  2NVY A;  5M5Y K;  4XLP A;  1PJ6 A;  1TWA C;  2YU9 C;  1TWH C;  1JOE A;  1O25 A;  5M5X K;  4M1X A;  3A8J A;  4XSX A;  3GTQ K;  2E2H K;  4QJV A;  4A3L C;  3AQO A;  3S1Q K;  4A3B C;  2WB1 D;  4BBS C;  2JA5 A;  4OIP A;  3S16 K;  2WB1 L;  3FOF A;  4P5B A;  1I3Q C;  3GIR A;  4P9S A;  2E2I C;  1BGW A;  4KB2 A;  2RH6 A;  4C3I K;  3N3Y A;  2E2J K;  4G0U A;  1TWF K;  4KMA A;  4J3N A;  3GTP C;  1I6H K;  2NVT C;  1XXB A;  4KMU A;  5IOS A;  3GTJ C;  2E2H C;  1TWC A;  3GTM K;  3HOV C;  3M4O K;  2NVY C;  1BJT A;  1K83 C;  3GTO A;  5TJ3 A;  1I3Q K;  3S14 C;  1C0A A;  1O2B A;  4LOW A;  1AB4 A;  5EGH A;  4BBS K;  4G7Z A;  3H0G C;  1RU0 A;  2FQO A;  4XCH A;  5EGE A;  4A3F K;  1TWC C;  1I6V A;  3G4A A;  3HOZ K;  3S15 C;  5IYC C;  3IPJ A;  2JA8 C;  3DXJ A;  3RZD K;  1J6X A;  1KQ4 A;  3CAG A;  1USM A;  2CW0 A;  4KDD A;  1WOP A;  2JA5 C;  2A69 A;  3GTQ C;  5M5W K;  4BBR K;  5JVO A;  3VA7 A;  4WJ3 M;  4KM8 A;  1EH1 A;  2Y3P A;  5C4X K;  3TFI A;  2JA7 K;  3S2D K;  1XXC A;  3M3Y C;  3HOZ C;  4G0W A;  4A3G K;  1O27 A;  4C2M K;  4GTC A;  3V4G A;  2V6U A;  1WSR A;  1ZQ1 C;  4QIW L;  3K7A K;  4KAT A;  4BLA A;  4KN4 A;  4G7O A;  4A3I K;  1JQW A;  2B63 A;  3SZZ A;  5HL8 A;  2O5J A;  3GEE A;  4GZY A;  2R7Z A;  3AD9 C;  1K83 K;  1R9T K; 
#chains in the Genus database with same CATH homology
 5IYC K;  3HOW C;  1SMY A;  2JA8 K;  4OIR A;  4LJZ A;  4A3J C;  3HOV K;  3HOY K;  3GTK K;  5M5Y K;  2NVQ C;  4A3E K;  3S1N K;  4A93 K;  4XLP A;  1TWA C;  2YU9 C;  1TWH C;  3EQL A;  2PA8 L;  3PO2 K;  2Y0S D;  4BXX C;  2PMZ D;  4X6A K;  3H0G K;  5M5X K;  4Q5S A;  4Y52 C;  1Y1V K;  4XSX A;  5IYD K;  4QIW D;  3GTQ K;  5TMC A;  1Y1W K;  2R7Z K;  2E2H K;  5IP7 C;  1SFO C;  4QJV A;  4MEY A;  4C3J K;  2R92 K;  4A3L C;  4XSZ A;  5TMF A;  3S1Q K;  2WAQ D;  3HOU K;  3S16 C;  4C3H K;  2WB1 D;  4A3B C;  5C4J K;  4BBS C;  1TWF C;  3PO3 C;  4ZH4 A;  4BBR C;  3GTG K;  4OIP A;  4LK1 A;  3S16 K;  4MQ9 A;  2WB1 L;  4A3K C;  1I50 C;  3I4M C;  3S2H K;  2JA5 K;  3GTL K;  3RZO K;  1I3Q C;  3S17 C;  1HQM A;  3GTJ K;  1SFO K;  2E2I C;  2NVX C;  4JK1 A;  3S17 K;  1ZYR A;  2NVY K;  5IP9 C;  3GTL C;  4YG2 A;  4A3C C;  3S1M K;  1XPP A;  3S1R C;  2NVT K;  2PA8 D;  4C3I K;  3RZD C;  2E2J K;  3GTG C;  4BY1 K;  1TWF K;  2PMZ L;  1I6H K;  3GTP C;  4YFK A;  2NVT C;  3HOU C;  2VUM K;  4KMU A;  2VUM C;  3GTJ C;  3S15 K;  2YU9 K;  2R93 C;  2E2H C;  5D4D A;  4A3M C;  3M4O C;  3GTM K;  3S2H C;  3GTM C;  4A3J K;  4A3M K;  4BY1 C;  2NVY C;  5IP9 K;  3HOV C;  3M4O K;  4A3C K;  1TWG K;  2WAQ L;  3GTO C;  3S1R K;  1K83 C;  4YFX A;  3S1M C;  1IW7 A;  5FJ8 K;  1YNN A;  4A3L K;  4A3K K;  3PO2 C;  3GTO K;  3GTP K;  1I3Q K;  2R93 K;  3FKI C;  3S14 C;  4AYB D;  4A3E C;  3I4M K;  1Y1V C;  5IYD C;  3FKI K;  3S14 K;  5C4J C;  4BBS K;  2E2I K;  2NVX K;  4G7Z A;  3H0G C;  5IP7 K;  3HKZ D;  1TWH K;  1TWG C;  1TWA K;  3CQZ C;  4A3F K;  1Y1W C;  1TWC C;  4G7H A;  1I6V A;  2R7Z C;  2NVQ K;  4A93 C;  4A3B K;  1I6H C;  4X6A C;  2JA6 C;  4Y7N C;  3HOZ K;  4LK0 A;  4Q4Z A;  2R92 C;  3S15 C;  5IYC C;  3HOW K;  5C3E K;  4OIN A;  2JA8 C;  3DXJ A;  3RZD K;  2E2J C;  3HOY C;  5M3F K;  3HOX C;  3K7A C;  4AYB L;  2CW0 A;  5C44 C;  4BY7 K;  2JA5 C;  3RZO C;  1I50 K;  2A69 A;  5C44 K;  3GTQ C;  5M5W K;  2B63 K;  1WCM C;  3HKZ L;  4BBR K;  3PO3 K;  3H3V L;  5FLM C;  1R9T C;  5FLM K;  3S1Q C;  4OIO A;  1YNJ A;  1BDF A;  3H3V D;  5C4X K;  4XLN A;  2A68 A;  5C3E C;  2JA7 K;  4QJV B;  3S2D K;  4A3G C;  4MEX A;  2A6H A;  3M3Y C;  4A3D K;  4Y7N K;  3HOZ C;  2A6E A;  3S2D C;  4A3G K;  4Y52 K;  4C2M K;  2Y0S L;  4A3D C;  4BXX K;  1WCM K;  2PPB A;  4OIQ A;  5C4X C;  4KN7 A;  3S1N C;  3GTK C;  4QIW L;  4A3I C;  2O5I A;  3K7A K;  3M3Y K;  3HOX K;  4KN4 A;  3WOD A;  4A3I K;  2JA6 K;  4G7O A;  2JA7 C;  4NOI A;  4YFN A;  1TWC K;  2BE5 A;  3I4N C;  3CQZ K;  5IYB K;  4LLG A;  4A3F C;  2B63 C;  4BY7 C;  2O5J A;  5IYB C;  4GZY A;  3I4N K;  5M3M K;  1K83 K;  1R9T K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...