4AYBL

Rnap at 3.2ang
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
91
structure length
91
Chain Sequence
MEIKILKSESNYLELEIEGEDHTLGNLIAGTLRKISGVSFASYYQPHPLTDKIIVKILTDGSIAPKDALLKAIETVRVMASHYIDEIKGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
total genus 24
structure length 91
sequence length 91
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4aybL00
4QIWD 2A68A 1R9TC 4A3KK 2NVTC 4LK1A 3PO3K 4BY1C 5M3FK 4A3GC 1SFOK 1I50C 2Y0SD 2YU9K 3HOVK 5IYCK 1I6HK 5FLMC 1TWHK 4BXXC 2CW0A 5IP7C 5M5WK 4Y7NC 3S17C 4A3IC 4KN7A 4NOIA 2NVXK 4XLNA 1WCMC 2A6EA 1Y1VC 3DXJA 1YNNA 3I4MK 4X6AC 5C4JK 1SFOC 1I50K 2YU9C 3S14C 4OIQA 4KMUA 4MEYA 4XSXA 4MEXA 3HOUC 3S16C 2R92K 4BBRC 1K83C 3HOZC 1TWAC 4A3BK 3S17K 3S1QK 3GTQK 4ZH4A 2PMZL 4AYBL 2R93K 2NVQK 3RZOK 2WB1L 3S2DK 4A3LC 4A3MK 3S15C 3S1MK 4A3KC 3PO3C 3GTMC 4XLPA 4BBSC 3HOVC 4A3GK 3CQZC 5IYCC 2JA7C 1WCMK 4A3EC 3WODA 4LK0A 1XPPA 2PMZD 4AYBD 4C3HK 3S1MC 5IP9K 5M5XK 4Y7NK 3H3VD 4OIRA 1IW7A 1I3QK 4LJZA 2E2HK 3PO2C 1TWFC 3GTKK 3I4NK 3H0GC 5C44C 4BBRK 3EQLA 1R9TK 1Y1WK 4C3IK 2NVTK 2JA6K 5FJ8K 4BY1K 5IYDK 4Q4ZA 2E2IC 3S2DC 4GZYA 5C4XK 3PO2K 3I4MC 4X6AK 3GTOK 3HOWK 5IYBC 1BDFA 1TWCK 1I6VA 2BE5A 2PA8L 2WAQD 4YFXA 4YFNA 4OIPA 3GTGC 3GTQC 3HOYC 3S2HC 4A93C 4KN4A 3S16K 3S1NC 4A3DK 2NVYK 3S1RC 2JA8K 4QIWL 3GTJK 3RZDK 3GTPK 3HOWC 4BBSK 5IYDC 4A3FC 2JA6C 2Y0SL 2JA5K 3M4OK 5C3EK 4A3CC 3K7AC 4MQ9A 4OINA 1YNJA 1TWFK 1HQMA 2PA8D 4XSZA 4A3JC 3HOZK 2WB1D 2JA8C 1TWGK 1I3QC 4QJVB 3HOXK 2B63C 4Y52K 4QJVA 3GTLC 4A3DC 3FKIK 3HKZD 4C3JK 5TMCA 5FLMK 2R92C 4BY7C 5IP9C 3M3YK 2A69A 4G7ZA 1TWCC 3HOYK 2E2JK 2JA5C 2PPBA 2E2IK 3GTKC 3I4NC 4G7OA 2O5IA 4YG2A 2NVYC 3GTMK 4BY7K 3S1QC 2R7ZC 2WAQL 4A93K 3GTLK 3GTGK 2VUMC 4C2MK 3CQZK 3FKIC 2JA7K 3HKZL 5M5YK 3GTOC 3RZDC 1TWAK 2E2JC 3S14K 5C3EC 4G7HA 1Y1WC 3S1NK 2A6HA 3K7AK 4JK1A 3H0GK 5C44K 3S1RK 1Y1VK 1ZYRA 4YFKA 3GTPC 1TWGC 3HOXC 3H3VL 4A3BC 4A3CK 2R93C 5M3MK 3S2HK 2O5JA 4A3LK 4OIOA 5TMFA 5IP7K 3HOUK 5IYBK 4A3EK 4Q5SA 5C4JC 3GTJC 4A3FK 3M4OC 1I6HC 2E2HC 5D4DA 4A3MC 1SMYA 3M3YC 3S15K 2R7ZK 3RZOC 4A3IK 2NVQC 4LLGA 1TWHC 4Y52C 2B63K 2VUMK 4BXXK 2NVXC 1K83K 4A3JK 5C4XC
chains in the Genus database with same CATH superfamily
3MMLB 1R9TC 4A3GC 1SFOK 1I50C 2Y0SD 5IP7C 4Y7NC 2ZFZA 3GEHA 3S17C 2YU9A 1YNNA 5C4JK 1TWAA 4PAAA 4MEYA 4XSXA 1IS1A 1EI6A 2R93K 2PMZL 4AYBL 3GDZA 4FM9A 3S2DK 4A3LC 4A3MK 3S15C 3Q3QA 5L46A 3PO3C 3GTMC 1ZVUA 4BBSC 3HOVC 1KQ4A 3CQZC 4A3EC 3WODA 1TWGA 1XPPA 4LK0A 3S1MC 3N0CA 1J6VA 1IW7A 1EQRA 1VH2A 3GTKK 1ISEA 4BBRK 4PABA 4C3IK 3GTPA 2JA6K 4BY1K 4Q4ZA 2E2IC 5C4XK 3HOWK 1JVIA 5JVOA 1VLOA 2BE5A 2PA8L 2WAQD 3AH5A 4YFNA 1DD5A 5IORA 1WIHA 1F93A 1R9TA 2JA8K 4RMFA 3IPJA 3RZDK 1VRQC 5IOTA 2Y0SL 4MQ9A 2W7VA 1YNJA 1WQGA 1TWFK 4KARA 2PA8D 4XSZA 5IOQA 4A3JC 1I3QC 4Y52K 4QJVA 2Y3PA 3QX3A 5FLMK 5IP9C 3T02A 2JA5C 4P5BA 2PPBA 4KB4A 2VUMA 3GTMK 4BY7K 1USMA 4C3HC 3N0BA 3CQZA 4KASA 2NVYA 3LPXA 3CQZK 1XXAA 5EGHA 3S14K 3GTMA 3N3YA 2RGRA 1DCOA 3GTPC 1DCPA 5M3MK 4C2MC 4O2DA 3AQOA 5IP7K 4GTBA 5C4JC 2XCRB 4KB2A 1G51A 4ILDA 3GTJA 1ZBSA 5CJ9A 1SMYA 4A3MC 3S15K 1DCHA 1ZQ1C 2NVQC 2B63K 4A3JK 1AB4A 2A68A 3TFJA 5CHPA 2YU9K 5FLMC 1TWHK 4BXXC 1I50A 3A8IA 1PJ6A 1F7VA 4A3IC 1Y1VA 4NOIA 5IOSA 2NVXK 2NVXA 3DXJA 3GSIA 1PJ7A 1YX2A 1I50K 1SFOC 4KMUA 1F7UA 3BP8C 4MEXA 3HOUC 2R92K 4BBRC 3S17K 4BLAA 2WB1L 4KATA 1VGXA 1O26A 1USOA 4A3KC 4XLPA 4LOWA 1VJEA 2V6SA 4BKWA 3G4AA 2PMZD 4AYBD 5IP9K 3H3VD 1B4BA 1EK8A 3PO2C 1TWFC 3BUEA 4DDQA 3EQLA 1R9TK 1Y1WK 5IYDK 1INNA 5FJ8K 3I4MC 4X6AK 1XXCA 4YFXA 2KWAA 2GSUA 4A93C 4KN4A 1GE9A 3S16K 2R92A 1J6WA 3HOWC 3GTPK 2JA6C 4A3FC 3ERED 3SZZA 4OINA 2WB1D 2JA8C 1TWGK 4QJVB 3HOXK 1O2AA 4G0UA 4C3JK 2R92C 5TMCA 1TWCC 2E2JK 2FQOA 4G7OA 4KM8A 3I4NC 4YG2A 4WJ4A 3LAPA 2R93A 4LQYA 4GTCA 1YCLA 2R7ZC 3A8KA 5M5YK 3GTOC 1TWAK 1B4AA 1TWCA 5C3EC 4C3IC 3S1NK 3NUHA 4P5AA 2CFAB 4JK1A 4KAWX 3S1RK 1ZYRA 3H3VL 4GT9A 1X31C 3AD8C 4OIOA 5TMFA 3HOUK 1XZQB 1O27A 3H0GA 4BLBA 1F9NA 3CAGA 5TJ3A 1I6HC 2E2HC 2RH6A 1WQFA 4WJ3M 4LLGA 4Y52C 2VUMK 2NVTC 3PO3K 2P5MA 3HOVK 5JFEA 2PHCB 2JH3A 1WSRA 1IL2A 1XXBA 4XLNA 2A6EA 1Y1VC 3I4MK 4X6AC 1JQWA 2YU9C 3S14C 1WORA 2B63A 3S16C 1WQHA 1TWAC 2GSNA 1O2FB 4ZH4A 3AD7C 3RZOK 3GTOA 3AD9C 1JOEA 5IYCC 1WCMK 4KC6A 4LR2A 1IBAA 3G4CA 2E2HA 1I3QK 2E2HK 3I4NK 3H0GC 3JSTA 5C44C 3FOEA 1O24A 3FHZA 4XCHA 2GSOA 3A8JA 3GTGA 4GZYA 3PO2K 3GTOK 5IYBC 4A3CC 1TWCK 1I6VA 3GTQC 3S2HC 1BJTA 3S1NC 4A3DK 3S1RC 4QIWL 3GTJK 1EFWA 4BBSK 5IYDC 3M4OK 4P9SA 3VA7A 1HQMA 4AH6A 3GTLC 3FKIK 2CFAA 2A69A 4G7ZA 3HOYK 3GEIA 4G0WA 3GEEA 2O5IA 2NVYC 3ADAC 1K83A 1C0AA 4G0VA 1HI9A 4GTLA 3GTGK 2VUMC 4C3JC 2R7ZA 3RZDC 2E2JC 1IE0A 1Y1WC 3OEPA 3K7AK 3H0GK 5C44K 1Y1VK 4YFKA 2R93C 1TWHA 2O5JA 1BS2A 4M1XA 4A3LK 5IYBK 4FZBA 4A3FK 4KMAA 2FQTA 1IQ0A 3M3YC 4GTAA 4C45A 3RZOC 3LAJA 1O29A 1WOPA 4GTEA 4KDDA 2V6UA 2E2IA 4QIWD 3SZYA 4A3KK 4LK1A 4GTDA 4BY1C 5M3FK 1I6HK 2P8TA 5IYCK 2CW0A 1O28A 5M5WK 4KN7A 4WILA 1WCMC 1SFOA 3TTGA 1L0WA 2ZUFA 3BP3A 4OIQA 1V5VA 3T00A 1K83C 3HOZC 4A3BK 3L4JA 3S1QK 3GTQK 3S0XA 2NVQK 1ZXOA 1BGWA 1XZPB 3S1MK 4A3GK 1WOOA 1Y1WA 2EBBA 2JA7C 3FKIA 4C3HK 1XZQA 5M5XK 1TWFA 4Y7NK 4GFQA 4OIRA 4LJZA 1EH1A 2NVTK 3OREA 3S2DC 5HL8A 2D6FC 1BDFA 3HOYC 4OIPA 3GTGC 4KMDA 2JA6A 3GTQA 2NVYK 3TFIA 1RU0A 2JA5K 1PJ5A 1WSVA 4GTFA 3K7AC 5C3EK 3GTKA 1I3QA 3L4KA 2GAHC 3HOZK 3HXAA 1XZPA 1WCMA 2B63C 4A3DC 3HKZD 2JA5A 4BY7C 1UV7A 1J98A 3M3YK 1O25A 2E2IK 3GTKC 3S1QC 2WAQL 4A93K 3GTLK 2JA7A 4C2MK 2JA7K 3FKIC 3AQPA 3HKZL 3GTLA 2V6TA 4J3NA 4G7HA 2A6HA 5E68A 4A3BC 1TWGC 3HOXC 4A3CK 4KM9A 3V4GA 3TFHA 3FOFA 3S2HK 5EGEA 4A3EK 4Q5SA 1J6XA 2ZUEA 3OPFA 3GTJC 3M4OC 3T01A 4KMHA 1WOSA 2XCOA 3GIRA 2XCQA 5D4DA 1O2BA 2R7ZK 2GAGC 4A3IK 1TWHC 4BXXK 2NVXC 1K83K 5C4XC
chains in the Genus database with same CATH topology
4QIWD 2A68A 1R9TC 4A3KK 2NVTC 4LK1A 3PO3K 4BY1C 5M3FK 4A3GC 1SFOK 1I50C 2Y0SD 2YU9K 3HOVK 5IYCK 1I6HK 5FLMC 1TWHK 4BXXC 2CW0A 5IP7C 5M5WK 4Y7NC 3S17C 4A3IC 4KN7A 4NOIA 2NVXK 4XLNA 1WCMC 2A6EA 1Y1VC 3DXJA 1YNNA 3I4MK 4X6AC 5C4JK 1SFOC 1I50K 2YU9C 3S14C 4OIQA 4KMUA 4MEYA 4XSXA 4MEXA 3HOUC 3S16C 2R92K 4BBRC 1K83C 3HOZC 1TWAC 4A3BK 3S17K 3S1QK 3GTQK 4ZH4A 2PMZL 4AYBL 2R93K 2NVQK 3RZOK 2WB1L 3S2DK 4A3LC 4A3MK 3S15C 3S1MK 4A3KC 3PO3C 3GTMC 4XLPA 4BBSC 3HOVC 4A3GK 3CQZC 5IYCC 2JA7C 1WCMK 4A3EC 3WODA 4LK0A 1XPPA 2PMZD 4AYBD 4C3HK 3S1MC 5IP9K 5M5XK 4Y7NK 3H3VD 4OIRA 1IW7A 1I3QK 4LJZA 2E2HK 3PO2C 1TWFC 3GTKK 3I4NK 3H0GC 5C44C 4BBRK 3EQLA 1R9TK 1Y1WK 4C3IK 2NVTK 2JA6K 5FJ8K 4BY1K 5IYDK 4Q4ZA 2E2IC 3S2DC 4GZYA 5C4XK 3PO2K 3I4MC 4X6AK 3GTOK 3HOWK 5IYBC 1BDFA 1TWCK 1I6VA 2BE5A 2PA8L 2WAQD 4YFXA 4YFNA 4OIPA 3GTGC 3GTQC 3HOYC 3S2HC 4A93C 4KN4A 3S16K 3S1NC 4A3DK 2NVYK 3S1RC 2JA8K 4QIWL 3GTJK 3RZDK 3GTPK 3HOWC 4BBSK 5IYDC 4A3FC 2JA6C 2Y0SL 2JA5K 3M4OK 5C3EK 4A3CC 3K7AC 4MQ9A 4OINA 1YNJA 1TWFK 1HQMA 2PA8D 4XSZA 4A3JC 3HOZK 2WB1D 2JA8C 1TWGK 1I3QC 4QJVB 3HOXK 2B63C 4Y52K 4QJVA 3GTLC 4A3DC 3FKIK 3HKZD 4C3JK 5TMCA 5FLMK 2R92C 4BY7C 5IP9C 3M3YK 2A69A 4G7ZA 1TWCC 3HOYK 2E2JK 2JA5C 2PPBA 2E2IK 3GTKC 3I4NC 4G7OA 2O5IA 4YG2A 2NVYC 3GTMK 4BY7K 3S1QC 2R7ZC 2WAQL 4A93K 3GTLK 3GTGK 2VUMC 4C2MK 3CQZK 3FKIC 2JA7K 3HKZL 5M5YK 3GTOC 3RZDC 1TWAK 2E2JC 3S14K 5C3EC 4G7HA 1Y1WC 3S1NK 2A6HA 3K7AK 4JK1A 3H0GK 5C44K 3S1RK 1Y1VK 1ZYRA 4YFKA 3GTPC 1TWGC 3HOXC 3H3VL 4A3BC 4A3CK 2R93C 5M3MK 3S2HK 2O5JA 4A3LK 4OIOA 5TMFA 5IP7K 3HOUK 5IYBK 4A3EK 4Q5SA 5C4JC 3GTJC 4A3FK 3M4OC 1I6HC 2E2HC 5D4DA 4A3MC 1SMYA 3M3YC 3S15K 2R7ZK 3RZOC 4A3IK 2NVQC 4LLGA 1TWHC 4Y52C 2B63K 2VUMK 4BXXK 2NVXC 1K83K 4A3JK 5C4XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QIW D;  2A68 A;  1R9T C;  4A3K K;  2NVT C;  4LK1 A;  3PO3 K;  4BY1 C;  5M3F K;  4A3G C;  1SFO K;  1I50 C;  2Y0S D;  2YU9 K;  3HOV K;  5IYC K;  1I6H K;  5FLM C;  1TWH K;  4BXX C;  2CW0 A;  5IP7 C;  5M5W K;  4Y7N C;  3S17 C;  4A3I C;  4KN7 A;  4NOI A;  2NVX K;  4XLN A;  1WCM C;  2A6E A;  1Y1V C;  3DXJ A;  1YNN A;  3I4M K;  4X6A C;  5C4J K;  1SFO C;  1I50 K;  2YU9 C;  3S14 C;  4OIQ A;  4KMU A;  4MEY A;  4XSX A;  4MEX A;  3HOU C;  3S16 C;  2R92 K;  4BBR C;  1K83 C;  3HOZ C;  1TWA C;  4A3B K;  3S17 K;  3S1Q K;  3GTQ K;  4ZH4 A;  2PMZ L;  4AYB L;  2R93 K;  2NVQ K;  3RZO K;  2WB1 L;  3S2D K;  4A3L C;  4A3M K;  3S15 C;  3S1M K;  4A3K C;  3PO3 C;  3GTM C;  4XLP A;  4BBS C;  3HOV C;  4A3G K;  3CQZ C;  5IYC C;  2JA7 C;  1WCM K;  4A3E C;  3WOD A;  4LK0 A;  1XPP A;  2PMZ D;  4AYB D;  4C3H K;  3S1M C;  5IP9 K;  5M5X K;  4Y7N K;  3H3V D;  4OIR A;  1IW7 A;  1I3Q K;  4LJZ A;  2E2H K;  3PO2 C;  1TWF C;  3GTK K;  3I4N K;  3H0G C;  5C44 C;  4BBR K;  3EQL A;  1R9T K;  1Y1W K;  4C3I K;  2NVT K;  2JA6 K;  5FJ8 K;  4BY1 K;  5IYD K;  4Q4Z A;  2E2I C;  3S2D C;  4GZY A;  5C4X K;  3PO2 K;  3I4M C;  4X6A K;  3GTO K;  3HOW K;  5IYB C;  1BDF A;  1TWC K;  1I6V A;  2BE5 A;  2PA8 L;  2WAQ D;  4YFX A;  4YFN A;  4OIP A;  3GTG C;  3GTQ C;  3HOY C;  3S2H C;  4A93 C;  4KN4 A;  3S16 K;  3S1N C;  4A3D K;  2NVY K;  3S1R C;  2JA8 K;  4QIW L;  3GTJ K;  3RZD K;  3GTP K;  3HOW C;  4BBS K;  5IYD C;  4A3F C;  2JA6 C;  2Y0S L;  2JA5 K;  3M4O K;  5C3E K;  4A3C C;  3K7A C;  4MQ9 A;  4OIN A;  1YNJ A;  1TWF K;  1HQM A;  2PA8 D;  4XSZ A;  4A3J C;  3HOZ K;  2WB1 D;  2JA8 C;  1TWG K;  1I3Q C;  4QJV B;  3HOX K;  2B63 C;  4Y52 K;  4QJV A;  3GTL C;  4A3D C;  3FKI K;  3HKZ D;  4C3J K;  5TMC A;  5FLM K;  2R92 C;  4BY7 C;  5IP9 C;  3M3Y K;  2A69 A;  4G7Z A;  1TWC C;  3HOY K;  2E2J K;  2JA5 C;  2PPB A;  2E2I K;  3GTK C;  3I4N C;  4G7O A;  2O5I A;  4YG2 A;  2NVY C;  3GTM K;  4BY7 K;  3S1Q C;  2R7Z C;  2WAQ L;  4A93 K;  3GTL K;  3GTG K;  2VUM C;  4C2M K;  3CQZ K;  3FKI C;  2JA7 K;  3HKZ L;  5M5Y K;  3GTO C;  3RZD C;  1TWA K;  2E2J C;  3S14 K;  5C3E C;  4G7H A;  1Y1W C;  3S1N K;  2A6H A;  3K7A K;  4JK1 A;  3H0G K;  5C44 K;  3S1R K;  1Y1V K;  1ZYR A;  4YFK A;  3GTP C;  1TWG C;  3HOX C;  3H3V L;  4A3B C;  4A3C K;  2R93 C;  5M3M K;  3S2H K;  2O5J A;  4A3L K;  4OIO A;  5TMF A;  5IP7 K;  3HOU K;  5IYB K;  4A3E K;  4Q5S A;  5C4J C;  3GTJ C;  4A3F K;  3M4O C;  1I6H C;  2E2H C;  5D4D A;  4A3M C;  1SMY A;  3M3Y C;  3S15 K;  2R7Z K;  3RZO C;  4A3I K;  2NVQ C;  4LLG A;  1TWH C;  4Y52 C;  2B63 K;  2VUM K;  4BXX K;  2NVX C;  1K83 K;  4A3J K;  5C4X C; 
#chains in the Genus database with same CATH topology
 3MML B;  1R9T C;  4A3G C;  1SFO K;  1I50 C;  2Y0S D;  5IP7 C;  4Y7N C;  2ZFZ A;  3GEH A;  3S17 C;  2YU9 A;  1YNN A;  5C4J K;  1TWA A;  4PAA A;  4MEY A;  4XSX A;  1IS1 A;  1EI6 A;  2R93 K;  2PMZ L;  4AYB L;  3GDZ A;  4FM9 A;  3S2D K;  4A3L C;  4A3M K;  3S15 C;  3Q3Q A;  5L46 A;  3PO3 C;  3GTM C;  1ZVU A;  4BBS C;  3HOV C;  1KQ4 A;  3CQZ C;  4A3E C;  3WOD A;  1TWG A;  1XPP A;  4LK0 A;  3S1M C;  3N0C A;  1J6V A;  1IW7 A;  1EQR A;  1VH2 A;  3GTK K;  1ISE A;  4BBR K;  4PAB A;  4C3I K;  3GTP A;  2JA6 K;  4BY1 K;  4Q4Z A;  2E2I C;  5C4X K;  3HOW K;  1JVI A;  5JVO A;  1VLO A;  2BE5 A;  2PA8 L;  2WAQ D;  3AH5 A;  4YFN A;  1DD5 A;  5IOR A;  1WIH A;  1F93 A;  1R9T A;  2JA8 K;  4RMF A;  3IPJ A;  3RZD K;  1VRQ C;  5IOT A;  2Y0S L;  4MQ9 A;  2W7V A;  1YNJ A;  1WQG A;  1TWF K;  4KAR A;  2PA8 D;  4XSZ A;  5IOQ A;  4A3J C;  1I3Q C;  4Y52 K;  4QJV A;  2Y3P A;  3QX3 A;  5FLM K;  5IP9 C;  3T02 A;  2JA5 C;  4P5B A;  2PPB A;  4KB4 A;  2VUM A;  3GTM K;  4BY7 K;  1USM A;  4C3H C;  3N0B A;  3CQZ A;  4KAS A;  2NVY A;  3LPX A;  3CQZ K;  1XXA A;  5EGH A;  3S14 K;  3GTM A;  3N3Y A;  2RGR A;  1DCO A;  3GTP C;  1DCP A;  5M3M K;  4C2M C;  4O2D A;  3AQO A;  5IP7 K;  4GTB A;  5C4J C;  2XCR B;  4KB2 A;  1G51 A;  4ILD A;  3GTJ A;  1ZBS A;  5CJ9 A;  1SMY A;  4A3M C;  3S15 K;  1DCH A;  1ZQ1 C;  2NVQ C;  2B63 K;  4A3J K;  1AB4 A;  2A68 A;  3TFJ A;  5CHP A;  2YU9 K;  5FLM C;  1TWH K;  4BXX C;  1I50 A;  3A8I A;  1PJ6 A;  1F7V A;  4A3I C;  1Y1V A;  4NOI A;  5IOS A;  2NVX K;  2NVX A;  3DXJ A;  3GSI A;  1PJ7 A;  1YX2 A;  1I50 K;  1SFO C;  4KMU A;  1F7U A;  3BP8 C;  4MEX A;  3HOU C;  2R92 K;  4BBR C;  3S17 K;  4BLA A;  2WB1 L;  4KAT A;  1VGX A;  1O26 A;  1USO A;  4A3K C;  4XLP A;  4LOW A;  1VJE A;  2V6S A;  4BKW A;  3G4A A;  2PMZ D;  4AYB D;  5IP9 K;  3H3V D;  1B4B A;  1EK8 A;  3PO2 C;  1TWF C;  3BUE A;  4DDQ A;  3EQL A;  1R9T K;  1Y1W K;  5IYD K;  1INN A;  5FJ8 K;  3I4M C;  4X6A K;  1XXC A;  4YFX A;  2KWA A;  2GSU A;  4A93 C;  4KN4 A;  1GE9 A;  3S16 K;  2R92 A;  1J6W A;  3HOW C;  3GTP K;  2JA6 C;  4A3F C;  3ERE D;  3SZZ A;  4OIN A;  2WB1 D;  2JA8 C;  1TWG K;  4QJV B;  3HOX K;  1O2A A;  4G0U A;  4C3J K;  2R92 C;  5TMC A;  1TWC C;  2E2J K;  2FQO A;  4G7O A;  4KM8 A;  3I4N C;  4YG2 A;  4WJ4 A;  3LAP A;  2R93 A;  4LQY A;  4GTC A;  1YCL A;  2R7Z C;  3A8K A;  5M5Y K;  3GTO C;  1TWA K;  1B4A A;  1TWC A;  5C3E C;  4C3I C;  3S1N K;  3NUH A;  4P5A A;  2CFA B;  4JK1 A;  4KAW X;  3S1R K;  1ZYR A;  3H3V L;  4GT9 A;  1X31 C;  3AD8 C;  4OIO A;  5TMF A;  3HOU K;  1XZQ B;  1O27 A;  3H0G A;  4BLB A;  1F9N A;  3CAG A;  5TJ3 A;  1I6H C;  2E2H C;  2RH6 A;  1WQF A;  4WJ3 M;  4LLG A;  4Y52 C;  2VUM K;  2NVT C;  3PO3 K;  2P5M A;  3HOV K;  5JFE A;  2PHC B;  2JH3 A;  1WSR A;  1IL2 A;  1XXB A;  4XLN A;  2A6E A;  1Y1V C;  3I4M K;  4X6A C;  1JQW A;  2YU9 C;  3S14 C;  1WOR A;  2B63 A;  3S16 C;  1WQH A;  1TWA C;  2GSN A;  1O2F B;  4ZH4 A;  3AD7 C;  3RZO K;  3GTO A;  3AD9 C;  1JOE A;  5IYC C;  1WCM K;  4KC6 A;  4LR2 A;  1IBA A;  3G4C A;  2E2H A;  1I3Q K;  2E2H K;  3I4N K;  3H0G C;  3JST A;  5C44 C;  3FOE A;  1O24 A;  3FHZ A;  4XCH A;  2GSO A;  3A8J A;  3GTG A;  4GZY A;  3PO2 K;  3GTO K;  5IYB C;  4A3C C;  1TWC K;  1I6V A;  3GTQ C;  3S2H C;  1BJT A;  3S1N C;  4A3D K;  3S1R C;  4QIW L;  3GTJ K;  1EFW A;  4BBS K;  5IYD C;  3M4O K;  4P9S A;  3VA7 A;  1HQM A;  4AH6 A;  3GTL C;  3FKI K;  2CFA A;  2A69 A;  4G7Z A;  3HOY K;  3GEI A;  4G0W A;  3GEE A;  2O5I A;  2NVY C;  3ADA C;  1K83 A;  1C0A A;  4G0V A;  1HI9 A;  4GTL A;  3GTG K;  2VUM C;  4C3J C;  2R7Z A;  3RZD C;  2E2J C;  1IE0 A;  1Y1W C;  3OEP A;  3K7A K;  3H0G K;  5C44 K;  1Y1V K;  4YFK A;  2R93 C;  1TWH A;  2O5J A;  1BS2 A;  4M1X A;  4A3L K;  5IYB K;  4FZB A;  4A3F K;  4KMA A;  2FQT A;  1IQ0 A;  3M3Y C;  4GTA A;  4C45 A;  3RZO C;  3LAJ A;  1O29 A;  1WOP A;  4GTE A;  4KDD A;  2V6U A;  2E2I A;  4QIW D;  3SZY A;  4A3K K;  4LK1 A;  4GTD A;  4BY1 C;  5M3F K;  1I6H K;  2P8T A;  5IYC K;  2CW0 A;  1O28 A;  5M5W K;  4KN7 A;  4WIL A;  1WCM C;  1SFO A;  3TTG A;  1L0W A;  2ZUF A;  3BP3 A;  4OIQ A;  1V5V A;  3T00 A;  1K83 C;  3HOZ C;  4A3B K;  3L4J A;  3S1Q K;  3GTQ K;  3S0X A;  2NVQ K;  1ZXO A;  1BGW A;  1XZP B;  3S1M K;  4A3G K;  1WOO A;  1Y1W A;  2EBB A;  2JA7 C;  3FKI A;  4C3H K;  1XZQ A;  5M5X K;  1TWF A;  4Y7N K;  4GFQ A;  4OIR A;  4LJZ A;  1EH1 A;  2NVT K;  3ORE A;  3S2D C;  5HL8 A;  2D6F C;  1BDF A;  3HOY C;  4OIP A;  3GTG C;  4KMD A;  2JA6 A;  3GTQ A;  2NVY K;  3TFI A;  1RU0 A;  2JA5 K;  1PJ5 A;  1WSV A;  4GTF A;  3K7A C;  5C3E K;  3GTK A;  1I3Q A;  3L4K A;  2GAH C;  3HOZ K;  3HXA A;  1XZP A;  1WCM A;  2B63 C;  4A3D C;  3HKZ D;  2JA5 A;  4BY7 C;  1UV7 A;  1J98 A;  3M3Y K;  1O25 A;  2E2I K;  3GTK C;  3S1Q C;  2WAQ L;  4A93 K;  3GTL K;  2JA7 A;  4C2M K;  2JA7 K;  3FKI C;  3AQP A;  3HKZ L;  3GTL A;  2V6T A;  4J3N A;  4G7H A;  2A6H A;  5E68 A;  4A3B C;  1TWG C;  3HOX C;  4A3C K;  4KM9 A;  3V4G A;  3TFH A;  3FOF A;  3S2H K;  5EGE A;  4A3E K;  4Q5S A;  1J6X A;  2ZUE A;  3OPF A;  3GTJ C;  3M4O C;  3T01 A;  4KMH A;  1WOS A;  2XCO A;  3GIR A;  2XCQ A;  5D4D A;  1O2B A;  2R7Z K;  2GAG C;  4A3I K;  1TWH C;  4BXX K;  2NVX C;  1K83 K;  5C4X C; 
#chains in the Genus database with same CATH homology
 4QIW D;  2A68 A;  1R9T C;  4A3K K;  2NVT C;  4LK1 A;  3PO3 K;  4BY1 C;  5M3F K;  4A3G C;  1SFO K;  1I50 C;  2Y0S D;  2YU9 K;  3HOV K;  5IYC K;  1I6H K;  5FLM C;  1TWH K;  4BXX C;  2CW0 A;  5IP7 C;  5M5W K;  4Y7N C;  3S17 C;  4A3I C;  4KN7 A;  4NOI A;  2NVX K;  4XLN A;  1WCM C;  2A6E A;  1Y1V C;  3DXJ A;  1YNN A;  3I4M K;  4X6A C;  5C4J K;  1SFO C;  1I50 K;  2YU9 C;  3S14 C;  4OIQ A;  4KMU A;  4MEY A;  4XSX A;  4MEX A;  3HOU C;  3S16 C;  2R92 K;  4BBR C;  1K83 C;  3HOZ C;  1TWA C;  4A3B K;  3S17 K;  3S1Q K;  3GTQ K;  4ZH4 A;  2PMZ L;  4AYB L;  2R93 K;  2NVQ K;  3RZO K;  2WB1 L;  3S2D K;  4A3L C;  4A3M K;  3S15 C;  3S1M K;  4A3K C;  3PO3 C;  3GTM C;  4XLP A;  4BBS C;  3HOV C;  4A3G K;  3CQZ C;  5IYC C;  2JA7 C;  1WCM K;  4A3E C;  3WOD A;  4LK0 A;  1XPP A;  2PMZ D;  4AYB D;  4C3H K;  3S1M C;  5IP9 K;  5M5X K;  4Y7N K;  3H3V D;  4OIR A;  1IW7 A;  1I3Q K;  4LJZ A;  2E2H K;  3PO2 C;  1TWF C;  3GTK K;  3I4N K;  3H0G C;  5C44 C;  4BBR K;  3EQL A;  1R9T K;  1Y1W K;  4C3I K;  2NVT K;  2JA6 K;  5FJ8 K;  4BY1 K;  5IYD K;  4Q4Z A;  2E2I C;  3S2D C;  4GZY A;  5C4X K;  3PO2 K;  3I4M C;  4X6A K;  3GTO K;  3HOW K;  5IYB C;  1BDF A;  1TWC K;  1I6V A;  2BE5 A;  2PA8 L;  2WAQ D;  4YFX A;  4YFN A;  4OIP A;  3GTG C;  3GTQ C;  3HOY C;  3S2H C;  4A93 C;  4KN4 A;  3S16 K;  3S1N C;  4A3D K;  2NVY K;  3S1R C;  2JA8 K;  4QIW L;  3GTJ K;  3RZD K;  3GTP K;  3HOW C;  4BBS K;  5IYD C;  4A3F C;  2JA6 C;  2Y0S L;  2JA5 K;  3M4O K;  5C3E K;  4A3C C;  3K7A C;  4MQ9 A;  4OIN A;  1YNJ A;  1TWF K;  1HQM A;  2PA8 D;  4XSZ A;  4A3J C;  3HOZ K;  2WB1 D;  2JA8 C;  1TWG K;  1I3Q C;  4QJV B;  3HOX K;  2B63 C;  4Y52 K;  4QJV A;  3GTL C;  4A3D C;  3FKI K;  3HKZ D;  4C3J K;  5TMC A;  5FLM K;  2R92 C;  4BY7 C;  5IP9 C;  3M3Y K;  2A69 A;  4G7Z A;  1TWC C;  3HOY K;  2E2J K;  2JA5 C;  2PPB A;  2E2I K;  3GTK C;  3I4N C;  4G7O A;  2O5I A;  4YG2 A;  2NVY C;  3GTM K;  4BY7 K;  3S1Q C;  2R7Z C;  2WAQ L;  4A93 K;  3GTL K;  3GTG K;  2VUM C;  4C2M K;  3CQZ K;  3FKI C;  2JA7 K;  3HKZ L;  5M5Y K;  3GTO C;  3RZD C;  1TWA K;  2E2J C;  3S14 K;  5C3E C;  4G7H A;  1Y1W C;  3S1N K;  2A6H A;  3K7A K;  4JK1 A;  3H0G K;  5C44 K;  3S1R K;  1Y1V K;  1ZYR A;  4YFK A;  3GTP C;  1TWG C;  3HOX C;  3H3V L;  4A3B C;  4A3C K;  2R93 C;  5M3M K;  3S2H K;  2O5J A;  4A3L K;  4OIO A;  5TMF A;  5IP7 K;  3HOU K;  5IYB K;  4A3E K;  4Q5S A;  5C4J C;  3GTJ C;  4A3F K;  3M4O C;  1I6H C;  2E2H C;  5D4D A;  4A3M C;  1SMY A;  3M3Y C;  3S15 K;  2R7Z K;  3RZO C;  4A3I K;  2NVQ C;  4LLG A;  1TWH C;  4Y52 C;  2B63 K;  2VUM K;  4BXX K;  2NVX C;  1K83 K;  4A3J K;  5C4X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...