4AYEC

Structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 1 e283ae304a mutant
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
243
structure length
243
Chain Sequence
GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAAKGSYSLGIFGGKAQEVAGSAAVKTVNGIRHIGLAAKQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT FACTOR H
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 243
sequence length 243
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4ayeC02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ayeC01
2KDYA 5EE2A 4O49A 4O3YA 3UAQA 3HOLA 4AYDC 4O4UA 4O3ZA 2W81C 3VE1A 4O3WA 1YS5A 3PQUA 2KC0A 4O3XB 3V8UA 4AYMC 2W80C 4AYID 3KVDD 2Y7SA 2YPVA 4AYEC 4AYNA 4O4XA 5T5FA 4QQ1A 3VE2A 2LFUA 3HOEA 3PQSA 4Z3TA 4U9CA
chains in the Genus database with same CATH superfamily
2C26A 3L3DB 3IN2A 4HLZH 4PR7A 4WI4A 2VDLL 3APCA 3GTTA 5E6YA 1N4XH 4N4YB 4AUYA 1NGQH 1QA9A 1URIA 1Z7JA 1FVDB 2LAAA 3L4YA 4X8CA 4G7YH 2ADFL 3WO4C 2ODJA 2XTRA 1MI5B 2EVIA 3GXNA 4B41A 8FABB 3HBQA 4V1DD 3HN8A 3WHE1 1E5AA 4YE0A 1P7BA 2XUWA 3T2NH 3FCUB 4AMXA 4KVPA 1L9SA 2DMBA 1RUAL 3KW7A 4DP0X 5I6KA 3MRNA 4JZOA 4EIGB 3FU3A 1WE5A 3EIFA 3OF6D 2QVFB 3HG1D 4R96A 5EMYA 2FJSA 4XNMB 1A7OH 4NAMA 4PRBA 1N64L 1N59A 3WL9B 3VE1A 4N75A 1T7VA 3OSVA 4ZMZA 2E8ZA 1N5YL 4N2NA 4A2FA 1SDDB 1PEZA 5CGYD 1EAOA 2EKSB 3DJTA 4BZ2A 3RWEA 1B4JL 1MW1A 4N3UA 1UUSA 1OSPH 5F7YC 2Z34A 2BP0A 4KZDH 1RUML 3FT4A 1H3PH 2YKLH 4GIPD 4GFTB 4ZXBA 3KLLA 4UAOB 2WWOA 1UXSB 5E94B 5C0EA 4XGZA 2WOYA 4ZTOH 3U30C 1QLEH 5JW4N 1E4KA 4H8WC 1C12B 3KXFB 4HULB 1MCPH 4BUHA 3V52H 4HK3J 5BO0D 1D5ZB 2JNZA 3SOTA 3CDZA 4A6YH 3DXAE 1HZHH 2GJZB 5EULV 1MCQA 1ZT4B 3NIFF 2XWZA 2IANA 1FFOB 2A9ML 3TCTA 1U8CA 3BZEB 1U3HD 4X4XA 1YEDB 4NFCA 3CSYB 3U79A 1A4BA 4XNAA 5DL6A 4NO0D 3WFHA 1TVHA 1I7UB 4LCWB 5IVZB 5JHLH 3G3LA 2C4FU 3MRBA 2Y0HA 2NDGA 3W56A 1IQDA 3T65A 1E6JH 1NOAA 4G9FD 4NZTL 3O3BB 1UJTA 2YQBA 2I26N 2J6EL 1WZ1L 2LLGA 4FG6D 4OLZL 1NL0L 3TBWB 3JWDC 4L3AA 1UB5B 3CZKA 3MLSL 5I6NA 2AJZA 4FZ8H 1RCYA 1PKQE 3HUJE 2RB8A 4X9BA 3H56A 3P0GB 3TA4D 3UTTE 2JJWA 2ROYA 1QYGH 2YQGA 3CZUB 3AWGA 1AZZC 1JHTB 2A74C 4JLRA 3Q5YA 2OL3L 2HFTA 3EJUA 1IUZA 1NLDL 4OLYH 1I1YA 5GGSB 1KT2A 2PTUA 1OALA 1A0QL 1ACYH 3HRZA 4YHMH 1P53A 1FNSL 1YVLA 3WKML 4Y8AA 3ARBD 4M4RA 3Q5TA 1NAMB 1JRHI 3BVUA 4DK6A 3BLKA 2FEDC 3ULVD 4LCIL 2DM7A 1YNKL 2AV1B 4N8VG 4JO1H 4KJQD 1TTBA 3V0DA 3MZTA 3LH8A 1ITCA 3UTQB 4XNXH 2AJVL 5B8CC 3LK2A 4H8UA 4NB7A 3S8WA 2OK0L 1WIPA 2VDQL 3LQZB 4Y19B 1H3TA 1NSNL 2IALB 1YUHA 2ZZUT 1A3QA 3WS3B 4JG5A 4XXDB 1M3IA 1SEQH 3IXTB 3QDMB 3REWA 5MI0C 4ZAKA 5J9PB 4PV9B 5DLLA 4P2RE 2YRZA 3UBXA 1HQ4A 2PYEE 5BRPA 1XTMA 1JI2A 4FZMA 1MDAA 2AXTO 1J8KA 4DPRA 5IQLA 3CK0H 2VQUA 5F7DB 4IKNA 3IJSA 3ARXA 3CN4A 5KSVA 2DQIL 4MX7B 3RL1B 3HOGA 4I48A 4ZMQA 1UKTA 2Y7SA 1XIWC 5FR3A 2P8LB 1FF5A 3P69A 4N0YL 2CDFB 5GJSH 2Y69B 1KN4L 5DD5L 2JJTC 1JGUL 4KDWA 1IC0A 3MNMA 4R3SB 4Y9FA 5C7XL 1ZTXE 4JHZA 5GISH 2NYKA 1ILUA 2G0LA 3GHPA 4JCWA 5E70A 3L4XA 1ZV5A 3PAVA 4IRSB 1BDYA 1FGVH 4WTQA 3T8XA 1KYOJ 4DJMA 2LU7A 4MQ7B 4UM9B 1KB5A 1ZT1A 3FAXA 1DTUA 5FYKE 4FFWC 3TL5A 3RTQB 5BXFB 5B39G 4F9LC 1SUHA 1HHKB 4PRDA 5DD0L 4Q4IA 5KW9H 5CLZA 2XKNA 5AUMA 1L0XA 2HX7A 1TYEB 5JIMA 4TRPH 3NVQA 3GSOA 1MHEB 2V3DA 3ZT7A 2O61A 1CQKA 2BNQA 4NM8H 4RJXA 4WIQA 5ETUB 1DUZB 4D94A 4NRZA 1O75A 3EJTA 5IB1B 1KPVB 1D5XA 2DIJA 1XF5A 2ENPA 4OM1L 1SEBA 3IS1X 1KJVA 3KWWB 4N28A 3RURA 1JCVA 2ITCB 3OLGA 2NY1D 2H1XA 4NYLB 3IPEA 4A2GA 3CQPA 3E1F1 4YBLC 3GSWA 3HRPA 4AENA 1CFBA 4WEEA 3L5JA 2X4QA 1EHNA 3ARYA 1NGWA 4HWZA 5C86A 2VLRE 4G7QB 4MJ6B 2G0KA 4CC4A 3BSZL 3LEVH 4AK2A 4NKOA 4XI5C 2J72A 1SXCA 4AMKL 4AUUA 4YE4H 1F4YH 3E8UL 4B9KC 1KFAH 1NAMH 4KXAA 5HD8D 2B20A 4PRID 2WBKA 2CCVA 3KLAB 1VFUA 2BZDA 2VZVA 3KAAA 3GSNL 1NINA 1A7QH 1XH2A 1RZIA 3AXHA 3RGVC 3ZE0F 1VEPA 4IJ3B 4OCSH 1OSZB 1RFDH 5K9KB 3C5ZD 3G5XB 4MMYA 2GSMB 4XMTA 4PRHE 3EOYG 1NMBH 2C3WA 3NSJA 2H6OA 4AV0A 1HL9A 1G43A 3OZKA 1Q0XH 2NY7H 4I1PA 1IEAB 5DGRA 3DV4A 4JHAH 1RK0B 4PVLA 5CZXC 1EMTL 3DIDA 4ELKB 4GAJH 3DMMB 1XZ0A 4O3ZA 2Q76B 4O9HL 4ZOCA 4K9EH 1ASPA 2E7MA 5J7CC 4G5ZL 3INOA 3V5DA 2W9LA 3ARUA 1NMCB 2NX5D 3D3VD 5T1MA 3PGCA 3RRQA 5I30H 4NKIH 1CL7L 2Z93B 1DQJB 3SPVA 5E4AA 3ASOB 1JF1B 3WIAA 4F15B 1F58H 1GSKA 4KKZA 2XWRA 2YA1A 4LP4A 3II2A 3D1MC 2YGPA 3PJSA 4M1DH 2AFNA 4NQSB 1L3WA 1BWWA 4UMGA 3S48A 3VJ6B 4ENZA 5JW4Q 2ITDB 4QRSA 1PBYA 1AGEB 3QRAA 1W91A 3CX2A 3H53A 1TJIL 2PR9A 1DSFH 3IJEA 3K6FA 3O2VH 4N1EA 1AAJA 1KBGL 4QRQA 4MJIB 5HHMB 4AC2A 4DKEL 5IGXL 3CZJA 4KO9A 2XFXB 3SZ6A 4OT1H 3K4ZA 3LPGA 2H2PC 5E9DA 2VC2B 5DURD 4W70A 4A2MA 4AYEC 3D34A 2VXUL 4P57B 5C8JA 1LNUA 1V7NH 4I3SL 5I8KH 3TZGA 2APXA 4HWBA 5ADXK 4DTGL 3GGWB 3MBED 4UU9A 3SCMA 3GUFA 2CE6A 3N06B 2DIEA 3G08B 3S5LG 1EXUB 1N18A 1XGZA 2O6FA 1T03L 1N8ZB 1XR8A 2ITFA 2NUPB 5H94A 3PAYA 3VWKC 5FO9B 2R23B 3VXRB 1RZGB 4OZHA 1OSYA 1KELH 3CFTA 2EEDA 1C08A 3Q48A 4L8DB 3KDMB 4WHTA 6PCYA 2R4OA 4XWGL 3DX7B 1AHMA 4QEGA 4M61A 2ZUSA 2R1XB 4DFIA 4R4BB 2WLIA 3R0MA 1AY1L 4E2OA 4U9CA 2FX8H 3R7RA 3K6NA 1JXFA 4X6DA 3TA3D 3MCYA 1U3ZA 4M8UA 4OLWL 5FPIA 3LS4H 2W9DL 4EI5D 1JUFB 2BNQE 1ZHKB 1AOHA 4H20L 2VUKA 1EH9A 3AMLA 1CGSL 4LIQL 4LOUC 3UAEA 3UTSA 2FT8A 5AOKA 4M1GH 2WBXA 4YHZH 5TD4A 1K8IB 2VIRB 1HAWA 1RZPA 4H13C 4YDMA 4BCYA 3QQ3A 4UV4L 2CALA 2EH7H 4B9FA 3EH1A 4OD3L 4OGXH 4UTBH 4KROB 3N1GC 4I7ZC 1D5IH 2FJHA 3MUY1 3QS3A 1UASA 3QUZC 4GT7A 4MMXC 4OGQC 4QF1A 4TV3A 1UOWA 3O6FB 5HY9A 5C09A 3IU4L 4GRLD 4XN7A 4ZPVA 1DJXA 1T1YB 1TYJA 4NC1C 2X3BA 4OFPA 2WXQA 1GTNA 2YRPA 1XGPA 4BFEA 2I9LA 3NSYA 4BZ1L 3D8MA 3S3CB 3VGGA 1RK1B 3BYYA 3QXTA 5CU9A 5IB2A 1U91A 4MSWB 1YRKA 5G39A 3DSNB 2CRYA 5AYQA 2ZSWA 1BLIA 2H0FA 4A7GA 4G3YH 1A5FH 1NC4A 4LHUD 4JRWA 4ODTH 3OR7B 3E80A 5BOJA 2X89D 3OHXA 2QPEB 1F6AB 5PAZA 3ZYIA 2XVLA 3CCHB 5DDHA 5I71C 3D2UD 3BHBB 3D4ZA 1MXDA 2R8SH 4JJHA 3HG0A 3D30A 3RKDC 1KLUA 2JKXA 1IZNB 4RGMC 1BAGA 2VC2H 4TVSa 1QNZH 5D5DA 1YEIL 5BZZA 5DS8A 3X13B 2Z0BA 3QCTH 4WUUE 2FGRA 2WMPA 3FUDA 1SXSA 3A21A 1NGZB 2WO3B 3LEYH 4PW3A 3F58L 3UOAB 5AAWA 1E4HA 4LGRB 1AJ7H 2R15A 3OLEA 4P5RA 2BWIA 3GZKA 1DYZA 3TPUB 3B83A 3H55A 2WINB 2HWZL 1Q9KA 3FRPA 2AJXH 2BSRB 3HHSA 3PHOB 5E95B 1PX3A 3WN5B 4CBZA 1U92A 5DUBB 3P4NB 4ZQKA 3WSQH 4DQAA 3HA0A 5AZ2H 4P04A 4QXUL 4NQCB 3U4EA 4YDZA 5CJ8A 5EC2B 1CFSB 2XCMC 1HXYA 3IM1A 2E47A 2Y36H 4LNRB 2RR3A 1G7HB 3EADA 1G0YR 3OHMB 4YSEA 2F53B 1I3RA 1ZV2A 2PMZA 5E1GA 5DZVA 1P4UA 4IK7A 3PHAA 3EJCA 1J0KA 4M6NL 4QRTB 1CF1A 4OJFL 3MLYH 1DVFB 3C60C 3I02B 3BZFB 2HT4C 4GRWB 5MHSE 1QTPA 4FQQA 1PL3A 2Y23A 1SYSB 4ZUSB 2CXKA 2A6IA 2C3VB 3HLAB 3OF6A 5F8RC 1W6LA 1O5DT 1QZNA 1JNHB 4JFHE 5F7NC 2J4WH 1FAKT 3NMEA 3PGFL 2QHRL 3GMRA 4G42A 1NIDA 1TPXB 1NEZB 4N2GA 5ICXB 1CGTA 3ME0A 2P48B 3CNKA 2OZ4L 4EAEA 5JHAA 1NC2B 1QNIA 2FJGB 2IQAB 1FDLH 2VLLB 2VL5A 3DTDA 3HI5L 2NW3A 3MLWL 3EXJA 4MMZC 3EO9H 2HT2C 3QFDA 5D7JB 1AE6H 1ZVSA 1E9PB 3KCPB 1KJ2A 1U8MB 2G4GA 5C08B 3V4PA 3INUL 3NBNA 4PWEA 2J8OA 4G8GE 3V8OA 3BH4A 1N68A 3Q8EA 2Y7QA 5LBSH 1E7VA 5D96C 3A23A 2EEBA 4PY8I 1NBVH 4YHKL 3RIFK 5HJGA 1NCUA 3K2MC 3D6GA 2QQKH 2NNRA 4PJBB 1L6PA 3PJLA 1FSKB 1YEHH 2ZX6A 3JT0A 4K2UL 2PWGA 4EJ1C 3SHSA 2H32B 4NDMA 1EZVY 3OZ9L 2NY6C 5T33L 2DMKA 2JH2A 3QHTC 2RAMA 2BSDA 1FPTH 3D0VB 3UTSE 4F3FB 1ZLEA 1F4WH 2WWKO 2GK0B 4Q9RL 1ZHBB 3TT3H 2X4OA 3W11C 1VEMA 3KYNA 1CFNB 3QPQC 1KEML 4L37B 5C07D 3NIFB 4RNRA 2R69H 5D1QD 4L4VE 2D0FA 1S7XA 5F70A 1K3ZA 3W5NA 4ZXBC 2JE8A 5C09E 1SJEA 2K45A 3GHEH 2ZUVA 5KVFH 1BQLH 3KNBB 1R3LA 5TPWL 3VXSA 5I1AA 3B8YA 3DVFA 1E4KC 2P26A 1VENA 2VN6A 5IHLB 1AMYA 3TEXA 3D08A 3RU8H 3PAZA 4HLJA 1LE5B 2HT3C 4FJYA 2L7EA 3DUSB 3GXDA 3AVEA 5DHVB 4ZI8A 4OCRH 3WFCL 3BPCA 2B59B 3JWDL 3TIDA 4GAGH 4JFED 1TLMA 4Z7NE 4UQCA 4OZIB 4G7SB 3ARBA 3VXUB 4K71B 2CHZA 2G30A 3BUIA 3VA2C 2C1OB 3FS9A 1NWPA 1Y1DA 4V33A 1NGXA 1OAYH 4OIIL 5IFAH 5K59E 4XBMA 4EIZC 1THQA 1V05A 1ODUA 3APMA 2UY6B 1BMGA 1M2OA 3TIEA 2WXJA 4XXWA 1NUNB 4KK9C 4PMEA 1Q4NX 4Z78A 1OSMA 1AQDB 4K3JH 4R4FH 3ZBMA 4S1QL 4HG4J 5FF6A 2GAZB 4NWTL 5E2TH 4Y88A 4GSRA 4GKSB 1BZ9B 5HVHC 2WGNB 3BISA 3D4YA 2EIJB 3VB8A 3BMVA 1R0AL 2AEWA 4LRIA 1AG6A 4NUGL 3V4UH 1RPUA 4WW1A 5DZAA 3ZDXE 3LNFA 2YUWA 2DWEB 2YC1A 1IMHC 1MCOH 3VXOB 1OEZW 2WKOA 3SDCD 3KYMB 5BJTB 2WANA 4X9YA 3HRZC 1CE6B 4NZDA 4YZFF 1XSJA 4WEBL 2M83A 2DJMA 5KYUB 4CGUB 3CXHK 3IFOB 2P46B 3BP7B 3NSXA 1DVQA 2O6CA 2R0WH 3H9HB 1TZGL 3P3YA 1HIMH 2AK4D 3CLWA 5K93A 3LZFL 1OB1B 1WT5A 2YSSA 4PU2A 2ORBL 2H32H 4JCLA 2R4RH 3VFTA 5LDSA 5DQJB 1SVZA 5IW6B 4P5TD 5INCB 3VG9B 4OFYD 1MLCA 2W5PA 4PJ7F 4PUBH 4ZAKC 4ZTEA 1CU4L 2DQHH 3NRQA 2VDKB 1GGIH 5KZCD 1ODAA 1ECYA 1GHFL 4HGKC 2LT9A 1ZHLB 1CXLA 2APSA 1HHIA 5IJBC 3K80A 7PRNA 2XQBL 3FJTA 3ZRFC 2ADGB 3LN5B 4JVPA 1A6ZB 2O5YH 4YXKH 2CO2A 3VRLF 5IJDC 2XVGA 5TDOB 3NTCL 3RB7A 4LBEB 3G5VB 1M56B 1XH3B 1AS6A 4ELMA 3CIAA 5KWYC 1ZSDB 5B38B 4N2MA 4HEPG 4XMWA 5HDBE 5BRQA 1WBZB 3NFSL 1OP5H 4QXVA 5DHVH 2FRGP 4CW1B 5A40E 1OGAE 4QKTA 5KS9A 1U0QA 5JDSA 1AH1A 5CN2A 4PJIF 4RLBA 4GMTL 4TTGA 4IJTA 4GRMB 4KGLA 4UNUA 4FQXA 2LQRA 4WI0A 3FPYA 1TJMA 1B3IA 3F6JA 5DJYA 3QIUD 4B60A 1L7TH 2P5WB 3CU1A 3H0TB 2VRQA 5DK3A 4NZFA 1L0PA 5TDNA 4TUUA 1IC4H 4ZOBA 4DW2H 3BUYB 1CGYA 1KBBA 2W65B 4P46D 3CVIL 1BXXA 1JGDB 5HHQB 4BFGA 3C09C 3LZLA 1K4DB 4LSUL 3DOHA 5F3HA 5A1AA 3HE6B 2OP4H 1NANH 4OI9A 4N8CL 4P99A 1QWUA 4DO6A 4XVTH 1TQBC 2EYTA 3QEQA 3ZDWA 2AMGA 3HMWH 2HJFB 5K1VA 1YS5A 1WZMA 4CC4C 3PORA 1ED3B 1S7UA 1UZ8A 4OBRA 4DVRL 4YK4B 5JR1L 4R5VA 2ZJSH 1YMMB 4GUPB 4PJ8D 2KZBA 1Z9SB 5FHBH 1LXMA 4BFBD 5JW3L 1JZ7A 1I1FB 4F37K 4TTDC 3D18A 3HE7D 3VCLA 2D8KA 4MVBC 4ORGA 1A7PH 3GLZA 4O4YH 4XWOD 3QG7H 4XMLH 3EOTL 4JFXA 3TBTA 4JRXD 2VDKH 4OF6A 5D1ZB 4Z95H 4ZS6C 5I9QB 1SYVB 3W1ZA 3O2DA 4JKMA 1OOWA 2L7UA 2JCCF 5HYJD 5SX4I 1ZVNA 4U6HA 4UINL 4I18B 1BZOA 2HJLB 5D7LE 4DN3H 1OD9A 3T8MA 3NCEB 3LKNB 2KZ7A 2YOCA 5GSVA 5HYSA 3CFQA 4BKLB 3FK3A 4FNUA 2EDNA 3B9KD 3DX8A 3WDIA 5IMMA 3O4OB 3NA4A 3PQYB 4G83A 5F97E 4PRPB 3BKYH 4FSPA 2BVOB 2VLKD 5IIEB 4RGOH 2FO1A 1F00I 3VI4B 1LO0H 3IGKA 2X2YA 4RAUA 3IDMA 3STZB 5DO2C 3TO4D 2NXZD 2VMDA 5AW5B 1WV7T 2AEPL 1XT5A 3WIHL 3FO0L 3OKMB 3UJJL 4YQXL 4J3OC 4DGIH 3O9WB 2VMEA 1F5WA 1KTKE 1XR9A 2YPLA 3SSGA 4IRJB 1XB3A 4UOQA 3I3EA 1DUYA 2FEJA 3IB4A 1RMFH 4MNQB 3PIQA 4FHBD 1INQA 3AG2B 3V7AE 1GA2A 1I4FA 3MNDA 1AP2B 4PI2A 3CV5A 4XB7A 4G6AC 3TA3A 3SO5A 2EDTA 4QRRA 4KK8C 4UB0H 4LGSB 2OAAA 3HNTL 1MJ8H 5AW9B 3MV8B 4KMLB 5ADPH 1P69B 5FM4A 3EFOA 4GLRH 3PABB 1REIA 4XNKA 4FFYA 4X8JB 2ZUYA 4Y9BA 5I82A 3T3PF 4NNXB 3WUZA 4TPRH 3SCMC 1YPZA 3NABL 1JMZA 5EFIA 1WK0A 2Y0KA 1W8OA 4IKIA 1T66D 2X53A 5KYYA 1G7JB 3B7SA 3H54A 2VDPB 3KZIO 1AGBB 3QUKB 5E8EB 5ECGA 2DH2A 4CVZA 1E65A 3SN6N 3FUKA 1QBMH 3SDYL 3BDYH 3DO4A 3WXWH 1IE5A 2A73B 2KH2B 4GRLA 4JM0A 4NPJA 2YWZA 5J1AB 3DGCR 4XN2A 4CGTA 3FQWB 4CU7A 1RUPH 2F1AA 1UJ3A 2NRDA 5E8OA 4FQIL 5EF1A 1H5BB 2VABA 2UZYA 5KS9E 3GZPA 4JO3H 4PLJD 5DZPA 1XAUA 3FB8A 4IRZH 1L5GA 4E42A 2X41A 4PLKD 3AAZB 3PU7A 4CSPA 1P1ZB 5E6SB 3ALWA 2HTKD 3MA7A 4HDIB 4ZK8A 2VLRD 2X89A 1UM4L 1IX2A 3L7EA 2JWYA 2YRBA 4XNQA 1WFTA 5F7BA 2PP8A 1S7VB 3LNHA 2Z35A 5K9QG 3D2UA 1U58B 2R2EA 1V3JA 3SPGA 2DD8H 2FH8A 2MNJB 4J3TA 3U1SH 4LSQH 3FHAA 1CT8A 3FB6B 3T1WA 1BECA 3H2WA 2X88A 5CAYB 5MEQA 3C5SB 5AB1A 1I7RA 4X7SH 4C56A 1MNNA 1KIRA 1N6VA 3K2IA 3QEQE 4S0SD 4P2YA 1G9MH 3OXSB 1GOHA 2AF2A 4DH2A 3N40F 4Y16B 3EYOB 4APQB 3VXNA 4G5AA 2XWDA 4KV5F 3NZUA 4RAHA 4Q8BA 5ESVA 5BO1H 5K39B 4I5BB 4Z7QE 1QSVA 1CBVL 3VGBA 4ABQA 2IDSA 1H8OA 2UZXB 1VGKB 3GSRB 4L1BA 1PF3A 1FNLA 1VACB 1UD3A 4I0CC 4PP2B 4TUJA 3MYJA 4RA3A 3VXMB 3OHXC 5ADOH 3C5JA 1TETL 1KXHA 5LNEA 4PG9B 5C0DB 2Q7YA 3OKLB 3AU1A 3QUXD 1S9WB 3DYMA 1AQHA 4M5ZL 3HC0A 1FNFA 1UWXH 4R4ND 4RWHA 5BVPH 1AD0A 1U8HB 5E8PB 1Z6JT 2CLZB 1GJIA 4QYAA 4OKVA 5LXGH 3QYMA 4TNEA 4I8DA 5D93C 3L3HA 2Y7MA 4S0TD 5AAWC 5E2UH 3N0AA 5JO5A 4AXWA 2ZIDA 3QNYB 4UQ3A 1E2WA 4OF5A 3FT0A 1CR9H 2JV6A 3ARGA 3DIFB 1MI5D 3QRGL 1DDHA 2VDPH 4PHXA 1J5OL 3CD4A 2KT6A 4WFGD 3DI3B 4ETQA 1F1AA 4GAFB 5C2BH 4K5LA 2HG5B 3LY6A 1MVFA 2A3TA 3WEAA 1LO3H 2YD6A 3H4HA 3LPOA 3N1QC 3ARVA 4OB5L 4XOCA 4GMSH 2V9TA 4BSJA 2PTVA 2GBUA 3ZDZE 5FLVA 2DQTL 4X6CA 4W81A 4YLQT 1G6RL 1K72A 4UQDA 1A3RH 1YO4A 5F3FA 3I3DA 1GGTA 3HBGA 4BHUI 1KZYA 2YPLE 4HIHA 4LSTL 3GIZH 1F90L 1MF2H 4PJCB 3PV7A 3LH2L 1UFUA 1JDCA 3AGVA 3L9RA 5D9SB 2Q3ZA 3WHXA 4O4XA 2YD4A 2X28A 3OB0K 5BRZE 3P30H 3DSFH 3B6SA 1ERNA 5MENB 2OMWA 3PDGA 4ADIA 5G5DB 1TJHL 3BKML 4C47A 1OANA 1ZTXL 2ZG2A 1BAFH 5JHMA 3MRQB 1G7QA 3ZTNL 2F5AL 1B2WL 3BIAX 4ZTPH 2AVGA 4GO8A 1PZAA 4JRYE 4QO1A 3VRIA 4AGMA 3BRZA 5FYKL 1YPZE 3FO2B 2BOCA 3V6ZA 3KXFD 4EDXB 1ZLUH 3CLFL 3AC0A 3KE0A 2ATAA 1BZQK 1ETJA 2XN0A 5CD3B 5DJXB 4X83A 2WBWB 3BEVA 1NAKL 3JWOH 3L17A 3WEXB 3WBDA 1RSFA 2PUQT 4OV5B 1JGEB 2AXGB 3SYPA 1RLBA 3ZZLA 1MFDH 1UURA 4H1LG 3QO1A 1KEGH 3LZPA 4XTRC 1WZKA 1VCBC 5GGTA 4OZGB 2KMWA 2WXPA 3GIVA 4JG0H 2YMTA 4LCWD 3U4BL 4XMVA 3VMOA 3GMQB 3WXVL 2KXPB 1R9FA 1WGVA 4LPXA 2AKRA 4BZ2L 3VFGH 3VACA 3FQUA 2M8XA 2VB5A 2ZWZA 3R4RA 4FX5A 3ZXAC 2EC9U 4JFEA 1CBJA 1QI5A 4O2FA 3O3EA 3DX1A 4K8RH 5EBMB 5D71H 4OM0L 1SVBA 3LKRB 2GT9A 2N59A 5T5NG 2GITA 4Z5RB 3LVEA 3K0WA 4G6KL 2H0PA 3CIQA 1MJJB 3EYVA 4OQ1A 2YD9A 2CJUL 5L6YH 4MAUH 2H6UA 1HN1A 2J56A 4AQ1A 2PORA 2GIXA 2OJEB 4C56E 2WVPA 1QBLH 2NW2A 3O8XB 3A6CH 3IS0X 4AVHA 1CD1A 3U9UB 2X4UA 4KUZH 4XNZC 4K4KA 4QHLA 3EO0B 4KJWD 2C3HA 5E6IB 2IBBA 1PS3A 3F3HA 1YECH 4XO3A 3WLBB 1ZIBA 1VAHA 3I2CL 4N26A 4PJFA 3SDCA 4FKKA 4G8EB 3ZKXB 3DC0A 2XE2A 3RWDA 3QDMD 1YLBB 3FQ1A 4X5WA 2QJDA 1ORMA 1DEEA 4N2BA 5I26A 5KAQF 3ARBC 2E8YA 1MFVA 4XMKL 1G94A 4KQ4H 4XPTL 4YHLL 3QK0A 3WFBH 2DIBA 1YNTB 3RNQA 1J88A 1AQKH 1E6OL 5A6MA 1O9VA 1SN2A 1T0MB 4X7DC 2VCOA 5DMYA 4ISVB 3HS0A 2OMYB 3SPIA 1YYLL 2P43B 4Z77B 1LQSR 4J8RA 3BUDA 3HZMB 3LD8C 4H25A 4KUCF 5EUOF 4AGPA 5ELIA 2YGOA 4LRIC 2EH8L 3G5ZB 1RIUL 4IRSD 3BP5B 1J8SA 4ODBD 4DCQB 3NCJH 4WV1A 1C8PA 2XQYA 4UM9D 1KLGA 2BCKB 3RTQD 2MQCA 1I1AD 1BXAA 4NERA 4DQOH 5KTEL 3VVWA 1BQHA 1IT9H 3MN8A 1BAWA 1L9QA 2P28B 1S78C 3CVCA 3S4SB 1E5UI 2CJSA 5E0QA 3TOPA 5IG7B 4M1CC 5I1LA 3POQA 4N87A 4ZD3H 4I89A 2Z7UA 3QDGE 4YHYC 1P4LB 2JTYA 4Y4KB 3WUWA 2VNCA 3S96A 3JVGA 1W0WB 4PJDA 5FEBA 2DRUA 4HKXA 1NCAL 1WT5C 5FKPB 4JFOB 5C9KA 2CGZA 1KJMA 3QG6A 4W9FC 5IW1A 4XCFL 2AXHA 1B0RA 4LPWA 3EH3B 5GS2H 3HAEH 3VAEA 5EN2B 5IB4A 3PP4H 5GRVK 3VH8A 3LZNA 4IM8A 4XCNB 4Q4EA 1HHHB 3LHPH 4KKLC 3S0PA 2R0KH 1RUQL 4NJAL 1JTPA 1DJYA 3M86A 3F12A 3MBXH 3U9WA 1UTDA 3POCA 3QQDA 2BPBA 4UT9A 1FORH 2CPCA 4KX7A 1AS8A 4I13B 4PSPA 4OQTL 2YA0A 1R4XA 4RFOL 1F42A 1KSRA 3ARRA 3NEEA 2PLTA 2JI3A 3O6KH 3CFCL 3FQ4A 3H42L 3QH3B 1KCVL 3O6LH 3P73B 3W9EB 3MRMA 1JV2B 1DR9A 4XMPH 4BRJA 2GFBA 4X9IA 1HXMB 3R0NA 4PLOB 5CEXB 3J8F7 2RFXB 5I16B 2FTAA 4Z7VF 1MDTA 4PJ8A 2XXGA 4HCFA 1MREH 4JM2B 4JPKL 1NMAH 5HI3D 3DPBA 5HD8C 3NCMA 5C9JB 3OMIB 2ZCKL 2C9QA 4FQXC 4MA3A 3HE7A 5KSAB 3FYIB 2GSGA 1T7ZA 1SJXA 4HOWA 2CKNA 2Z64C 3DMMD 4TSAH 1E8WA 3L4ZA 4MNGE 4XC1L 3DGGB 4XVJH 5EO1A 2R88A 4JRXA 4M62H 1CO1A 2V0AA 3MCLH 4WJG3 6CGTA 3AREA 2G9KA 4N9GB 3ZKND 5ID0B 2FLBT 1E5ZA 1NLBL 2QKIB 3CFEB 1NCNA 5HYJA 3F5WB 1OP9A 3LPWA 1JHKH 3KJ4B 3A6BL 4HMEA 3SPHA 1J0IA 2KL6A 2Z92B 4JFDE 4NS0A 4AIEA 3EYQC 3ESOA 2BIOA 1U8IA 1BXUA 3EAKA 3U0WL 3SDDC 4HS3B 2OSLB 3UCRA 1IAKB 2X09A 1MFCL 1KENL 5I1HH 1KC5L 1YY9C 2EO1A 4NO2B 5H35B 2UZPA 2HA1A 1ET5A 2VLKA 1EV2E 3UBGA 4C4VA 1MCHA 1QO3B 2I69A 2VMJA 4WZ9A 2OXGA 5DQ9A 3WNNA 3TO4A 4JKKA 3S88H 2HLFC 4JZJB 3RJQB 2K78A 3NZ8A 5E03A 2PWHA 1SN5A 2Y6SD 2HLAA 3GXPA 3S36H 1FLRH 5DHEA 1MY7A 1VADB 2WD0A 2YIHA 3IDJA 1OQOA 3U0TA 5FGCB 1OZTG 4KY1L 1YSOA 2X2JA 1FFNA 4BD4A 3MOAH 3W9DB 4ZFGL 3KMDA 4YHPB 3I84A 1IKOP 1Y18A 2C1PA 5EBWB 5ALBH 1OT4A 4TLKA 4XBPA 1BVKA 2CK2A 2AEIT 2F1CX 3DV6A 4MYWB 3T3MB 1SDYA 4JZNB 3TZVA 3FO1A 1UXWA 5SWSA 4GG6F 1YN6A 1IM9D 3U82B 4C4BA 3RVXD 1WA1X 2J73A 1KMGA 2X0VA 3WIFB 3VXRD 3F2LA 4IKJA 3DVGA 2Y0LA 1CYWA 1GGCL 1BD2A 2CIKA 1IARB 1CQYA 3N41B 1K85A 4LXFA 5GGVY 1IM3B 3CH1A 2LGNA 5IBUB 2UUDH 4LSRL 4KVCL 5FO7A 5BQ7A 2FATH 5D72H 3FUMA 2Z8SA 4QXGL 5L2JA 4O3WA 3ARFB 4OUUA 1CK0H 2X4PB 5ERWA 5I1JL 2C3GA 3L4UA 3OJDB 3RWCA 3DVNA 2VZUA 4FMFA 3SB3A 1FFPA 4Y5VA 3RFRA 3WY3A 4PJDE 1P7QB 4O02L 1FI8C 5F7UA 2DL9A 2WQUA 3T09A 1T2QH 2MRYA 3UMTA 4EQ2A 5CR8A 4ODHH 1HILA 2XA8L 2WGXA 3W2DL 3FTXA 3RY6A 2ZUQB 5KBLA 4ZUTB 1JD7A 3O6FD 2ETWA 1HH6A 4YPGB 4RZCB 1GFOA 1AG0A 1ZLVK 2LLNA 5LGJA 1OGAD 4U1MA 3V7MA 4LEEA 2VZ1A 2GYSA 2ZAIA 3PDOB 4JBSA 3EJSA 4P9MH 4X9HA 3QE5A 2FWOA 5F6IB 2PABA 3KW8A 4NJ9H 1YMHB 4LL9A 1NPNA 1G7MB 4P5MA 5C0RL 3GBNL 1TFHA 2EYSA 4FQ2L 5F89B 2CU9A 2BP8B 4FLHA 2KZWA 4GRLC 5JTWA 4A6YA 5KVDL 3SGDI 4M5YH 1UJ3C 4LCUA 1AO7B 3EOAA 3A6OA 3K2KA 1AGDB 3NP4A 4RH4A 2HCZX 4ZO8A 1TQUA 4EQ3A 4YFDB 5FM5M 2X7LA 1AYOA 1MCSA 1SHWA 2X12A 3LNGA 2ROXA 3N44F 4Q2ZA 1W0VB 5KSBB 3WEBA 4GINA 4GOSA 4RLCA 1DSWA 1XGQA 2KI6A 4HXBL 4JDVA 4ODSL 1OQXA 3ZKQD 3LOWA 4HD5A 4AQ8C 2FBOJ 3V2AR 1JBJA 1SJHA 4HGMA 2GBAA 3ZDYF 1Q94A 3WY2A 5E00B 2UZIL 1I8LA 3PNRB 1FG2A 4APXA 4DUWA 2BHFA 2SODB 4X0KA 1KZQA 3SBWA 5CSZA 2EE3A 4NQCD 1C5CL 1HXTA 1T7XA 3L3DA 5TH2B 4P23A 1A6PA 3ULUE 1J05B 3O45B 4FQHB 1QSFB 2NYYC 3PF2A 2A83B 1FVDA 5IKCA 2F53D 1PCSA 1OAZH 5IHWA 1MI5A 5DMGC 4NRXB 1IBBA 2AQTA 4QQ1A 1FNGB 1I8MB 2ZSVB 3QR2A 3MRGB 1DVFD 1CFTA 1XV8A 3I75B 4FMVA 2G75A 1HQRB 4GW1A 4KX8A 5AZEL 3BAIA 3A4EA 4HFWB 2G5BB 2WUBH 2X4SA 5KAFO 2VDOL 4PSRA 4P2OB 4GW4A 4JQIL 4XNMA 2QQNL 5CLYA 2LFGA 4PGBB 3TV3H 2MKWA 3T2QA 4F8LA 4XZ4A 3CDGB 4PRNB 1NC2D 4DEUA 4ONGH 4AT6B 3EFFA 2IQ9H 3G5YA 3SE9H 2EKSA 4H40A 4GBXA 4PWHA 2IV9A 4IDJH 3DX4A 2DQCH 5SWSE 2QFPA 4O49A 2FX9L 1DLFH 3MJ9H 4QD2E 5CCKH 3BVTA 1SHSA 1K4CB 5IFHH 3ARGC 4ZMXA 1HH9A 5G55A 3V5HA 2XY2A 1UXSA 2YEQA 4N85A 4A67A 4F1ZA 3K71B 4JG1L 3DTXA 2Z8RA 3KXFA 4PJEF 4ZMYA 1BD2E 2JELH 5LG6A 2XWTB 4IOSD 4UWQB 1D5ZA 4FP8H 1ZLWK 2V5YA 4WJ5B 5EF3A 1VHPA 1NFDB 4KKNA 5E1QA 5F0PB 1FFOA 1BVNT 4X4MA 4BXVA 1OB0A 3K81A 1E3FA 3T20A 4NBZB 1YEDA 1HXXA 2OTUB 3CSYA 1DL7H 4EIBA 3L7FB 1CZ8L 4G6ML 1FFQA 3MR9B 4GYBA 4JFPB 4LCWA 3MTXA 3WYRA 2A77L 4IQHA 3FDWA 4LKCB 4FZLA 4KK5C 3CSGA 2W0KA 3PQUA 3O3BA 3D52A 2AEQL 5DJ8A 5EZOH 2A7BA 2W07B 3WKPA 4EOWH 5IJCC 4XP4L 3HW7A 1F56A 2R0LL 1R33A 1N6UA 1UB5A 1CGUA 2PCPB 2CGRL 1NCIA 4WI9A 1DBAL 1C16B 3CPUA 4CADB 4JL1A 1R3JA 1WJ3A 4AQEB 4GQZA 2OMZA 4GQ9L 3C8DA 1NBCA 3RHWF 5IUCA 2CDEB 3GNML 3L3KB 2B0SH 5KVEL 2Y7LA 4X4YA 1MIMH 3RTLA 5KJRH 1ADQH 4W6WB 2TSAA 3KM2A 3WFEL 5JXAH 3HS9A 4LL1A 3VXUD 2NQCA 2X0WA 2ZYSA 3FTGA 4XO8A 1JGVL 2IADB 5DC2A 1AR1C 5E2WH 2AV1A 3SO3C 1TTAA 4RA0C 3UTQA 4NO3B 3CN2A 4JRLA 4E68A 2YFOA 4HP5A 1ZLSH 5HYQB 2PTTB 4Y19A 4QR7A 3S2AA 3QUYB 3EXLA 3WS3A 4OJDH 4XXDA 1MEXH 3QDMA 3FO9B 3IXTA 1BSIA 3N1MC 5J9PA 1I9RL 4PV9A 3CZFA 1HOCB 4PGEB 2X6AA 4MDJB 4Y7OC 3SJVA 1SY6L 1EO7A 1TDQA 4KXZI 3KPQA 2WLNA 3BWAB 1QZ1A 3MCG1 4MX7A 2R89A 1K9TA 2BNUA 4XAWH 5AVQB 2UWEA 2HG0A 3BJ91 4YBQC 2CDFA 3JCUO 2Y3NA 2EE2A 4NM4H 1TTFA 3ULVL 5ILTL 3HNVL 4AW4A 2W81C 4Y9CA 2D7TL 4PJ9D 3DOSB 3SY0B 5IESH 3FL7A 4IRSA 4PB9H 4MQ7A 2CKBH 1LQBC 4QTFA 1QRNE 1TJGL 4LESA 3ELAT 5I23A 5BXFA 2NPLX 2C9VA 5IVXA 1O6VA 1HHKA 1H0DB 3C6LB 4XP6H 2V17L 3K19A 3L4TA 4KOBA 5GGQH 5J8OA 2EACA 1U8NB 2P7TB 4EI0A 2PNDA 3UO1H 1IBGH 1OT2A 1KYFA 1JK8B 3GI8H 2VR7A 2X4NB 5G2NA 1LP9F 2H6PB 1OZUA 4ONFL 5ETUA 4BCZA 1RPKA 1UA7A 4B6ZA 5IB1A 2DV6A 1KPVA 1IGML 2H1LM 5F1NB 3MRLB 1GYCA 2EVHA 5DMKB 2DJUA 4U0RB 2XJLA 1DBML 3HI6H 3HS0C 1YDPB 3KWWA 4KJYB 4FA8A 1EZUA 5BUGA 1IJNA 1MG2C 2ITCA 1MNUL 3MLZL 4NYLA 2J6WA 3QHFL 4MXWL 5EU4A 4LARH 5L8JB 1NDTA 2DAVA 3QR1A 5IBTL 5SWZB 3TEZA 1JD9A 1UD2A 1JPST 4U3SB 1KDIA 1IAIH 1CF8L 2X6CA 2P1YA 3GRWH 4D9RD 4Z7OF 1SM3L 1ZA6A 3BUQA 4MJ6A 4JKPL 5ISZA 1KXTB 5JHDA 5KBDA 2EUXA 3NA9L 1BCIA 3W0WE 2QVKA 3IYLW 1CDYA 4F8NA 1AYRA 1YEJL 3QW9A 4R26L 5IHBA 4WJKB 2GUOB 3T0DA 3MFFB 2L4OA 5CGBA 4JPVH 3T0BA 5EA0H 4OGZA 3V10A 2ZKHL 3A3YB 3D0LA 1ND0B 1XD0A 3K6DA 3KLAA 3VGHA 2CHDA 1I85A 5I8OH 2Q7AA 1D2OA 4JRYD 3X3GH 4YHNB 3JVGC 2L7QA 4JL2A 5GHWH 2P5WD 5C0AB 4LAQL 1KCSL 1JPTL 4MAYA 2YAOA 5IMLB 2E74C 3F7LA 4GG8A 3VDBA 5K9KA 1M7DB 4FYQA 4NLHA 1OOAA 5GIRA 4TUKL 1XH1A 1IGTB 3PJNA 1TSRA 1LJMA 1IEAA 4I2XE 3UYRH 3HE6D 3QI9B 4Z3GA 5H37G 4M6OH 1HDMB 1RK0A 1SN0A 1TVDA 2QADC 5JMRA 1KIUB 1PD6A 4WY7L 5CP3A 4ELKA 1MIEH 3BIKA 4ZFQA 3JYCA 4UTBA 1JVLA 1XF4A 3VTTA 3EHBC 4Z7VB 4ZS7L 4H7VA 3SKOA 3LN9A 2P24B 3DHUA 1ES0B 1ASQA 1MUJA 3MFGB 1YJDH 2QDWA 1VLXA 4EZMA 4J3XA 3OGCB 1T80A 4PCYA 3FULA 3IF1B 1D9KD 1XB8A 3BZ4A 1YQVL 5IB3B 4AEIL 1I7ZB 1JDAA 1RHHB 4HC1L 3OKYA 1DQJA 4JHWH 5EU6D 2G5RA 1JF1A 3EFDL 3NIGF 2N1KA 4Y2DA 3JTTB 1TZIB 5D7IE 1PZ5B 4MDIB 4PCSA 4WW2B 2XZAL 2LVCA 4XP1H 3QIWC 3VJ6A 1XO8A 4OZHF 4B5ZA 2IGLA 2ITDA 4HJ1A 1AGEA 4JGJA 4XZUB 1MCBA 5HJBA 1GS7A 2ZPKH 4YSRA 5EWIH 3ZGIA 1KFGA 1SLVA 1XGYL 4MJIA 3GXMA 4U6YB 4Y19E 2HMID 4Z7WB 3H7BA 3QQXA 5KVMC 3HE7C 4H0HB 4X6DF 5D7KE 3AM8A 1FLTX 2HFFB 1G7IB 1QFUL 3ZL2A 3MRHB 1E5CA 3SJVE 4XCYA 3L4CA 1MCWM 2HFGH 3MV9E 1P4IH 1T1ZB 2NZ9D 5FYLE 4O4UA 3HFMH 1PSKL 3HFFA 4PRPD 2G3ZA 2WCSA 3AREC 3G08A 2IWFA 1EO8H 1XFPA 4NPKA 1R5IA 1EXUA 2XV3A 2F6AA 2Z91B 3ULUC 2UWEE 2B16A 4DESA 5E4EC 4ODXA 2GJ6E 2NUPA 4EXPX 1A2YA 2R2HB 3FZUD 3D25B 5FO9A 2WZ5A 3O9WD 2R23A 3D39B 3RI5F 1KCUL 3BUPA 5EDXA 3LK3B 4BUMX 1D7CA 4IRJD 4L8DA 3KDMA 3IRPX 4ZFZA 3DX7A 3ATAA 4PS8A 4MNQD 3L3OB 5IVXE 1G84A 4R4BA 5I5IA 2P49B 1UQSB 3MJ8B 1RZJH 1KBPA 3AS0A 5D1XD 3O2DL 5D2LF 3NIDF 5F44A 4K5NA 2NXZC 4K55A 2VKXA 2X9WA 1GFPA 4K3DL 4ZQTA 2AQ2A 2BK8A 4AG4L 4OLVL 1T3FA 3T6ZA 1JUFA 4LRNH 3RIAK 1ZHKA 3GINA 3MV8D 2NZIA 4J3OG 2WP3O 4FMKA 4N8VB 4LQFL 3M17B 1XF2B 2BS9A 4D0BA 4Q14A 3D0AA 4DAGH 1JV5B 3SOBL 4PIRF 2VIRA 3NFNA 4TNGA 3CC1A 3HJ0A 2VZ3A 4OI8A 3CN3A 5IHZB 3GZOA 3TZVC 3QS2A 4NNYB 4UT6H 1FH5H 2XYCA 2XU9A 5TF1H 3WFDL 4PREA 3AW5A 2JJSC 2AABL 3OPZH 2VQTA 4AJWA 2WVVB 5CUSH 5EU7E 4M7LH 5DHXB 5EIIB 1T1YA 3QHZL 5ISZE 1UM6H 1A9BB 1VGEL 2WBJB 5JHDE 4JPWL 3NCCB 5DI8B 2CAKA 1HYSC 5HHOB 1T6BX 1VZIA 3ROOB 1RK1A 5J3HC 3TBVA 3ZIMA 3BAKA 3DSNA 4L29B 4RGNB 5DD1H 5I0VA 4L0PB 1TNNA 2QKSA 3QISA 1ZK9A 4JDZB 4UQ2A 3EJYD 3Q2CA 2ILLA 3OR7A 2KERA 3FU7B 4KRNA 4UV7L 3O0LA 2NZ1A 4QOKE 2WSPA 3S37L 1SXNA 3CCHA 3QWRD 2BSSB 3PV6B 5AVXB 5AEAA 3TP4A 5B39B 1JZ4A 3UPAA 3ZL4L 4LLDA 4UI2A 1ONQA 4PLJC 4GNKB 3VB9A 3RY6C 3HZVA 2V4LA 1MXGA 1FZMB 4L1DA 5FOBA 5AW7B 2HTKC 3BQUB 5JZ7C 1UOKA 2IV8A 3M8OH 4Q56A 2EECA 2J5LC 3F7PC 1H6EA 2YAHA 3ZOAA 4XN4A 3MKGA 5IF0B 1C1EL 5A3ID 4APQD 1A64A 2BSRA 4TOYL 1E40A 2Y5EA 4DP4X 3PHOA 5F7HA 5AOJA 1DN0B 2LE9A 4K7PX 4QRAA 3P4NA 1PY9A 5CZVL 1OAXH 4XNUL 4NQCA 1WAAE 2DYRB 5EC2A 4HUXB 1JWSA 2YQ2A 1CFSA 1T89A 2DLFL 2DMCA 4LNRA 4W9JC 1BQUA 1G7HA 2WUCH 3VXMD 2F53A 5AW2B 2ZOLB 1EGJA 1DJHA 1OWWA 4FKEA 2MPAH 4O5LL 3VWJB 4QRTA 1XL4A 2X6VA 3IFNH 4AGQA 1AIZA 4DO5A 4HAKA 2K0RA 4B3VA 3I02A 4YDIH 4K8RD 2YQ3A 4WTWA 4NPYA 3SKUD 4JFZH 4LSDA 3FT3B 5I1KL 4KU1A 4JFDD 2D0GA 5JXEA 1GYUA 3HEIB 4ACPA 5ID1B 4J27A 4LDEB 2MNWA 4XHJC 4EO5A 5J12C 3WJJA 1Y6MR 3FQXB 5ICXA 2E27L 1I8LC 4JJ5B 4JO8A 5E56A 1NC2A 5AFUL 2FJGA 2IQAA 2XJKA 1U95B 3C2AH 1WFIA 3EO1A 4TULL 3SBWC 4FABH 4WTZG 1CGXA 4P23C 2BS8A 5D7JA 4DGVL 5JW4M 5FV1L 1UWFA 3KCPA 3ZE1E 4WSJA 3T2OA 1U8MA 4ZPTB 5C08A 4CBPA 1MW0A 2MEJB 1KTLB 5GPRA 5FYJH 4J39A 2R4LA 4B0MM 4WLCA 4BGLA 4KQ3H 4OCYL 3TBBA 4N5UA 1F4XL 2J25A 4PJ6A 1A1NB 1EUUA 4HIIA 3ESUF 5EOCJ 4OFKA 3QJVB 3L3JB 4YX2H 4X8GA 1U8JB 2Y22A 2ICWB 3A5VA 3D9AL 5MEND 2XN9B 3BEWB 5DA0B 4R7XA 1A6AB 1J18A 1BZ7B 3V95A 1GGBL 2H32A 5E5MB 3PUUA 5MP6H 2DWXA 2ZP8A 3SE8H 4F7CA 1KGCE 4WGWB 2CIIB 3ULVF 2Y7NA 7TAAA 1A4JB 1NIEA 4L4TD 2FH6A 5T3XE 1NBZB 1XDTT 1ZHBA 4IBQA 4GBXC 3PNWB 5AKRA 1CE1L 3EJRA 5T1KD 2ITEA 2NY4D 1CFNA 1YN7B 4L37A 3H2QA 4JFUA 1CG9B 4XVUD 5DFTA 3UC0L 1Q1PA 5F1OB 3KNBA 4PJXB 5I8CA 3IGAA 3AAEA 1U3JA 2VR8A 1TO4A 1F2QA 1H3GA 2B77A 3HN3A 1EJFA 4N1CA 4TLSA 3C75A 1RP8A 2WSDA 3HB3C 3HCVA 1OLZA 2QSQA 2NDFA 2JKRM 3P9MB 3S5LB 1U8KB 2FX7L 3P4MB 2KQNA 3C8KB 3GTNA 1LE5A 3KPRE 3BW9A 4QJ5B 4X8XA 5DHVA 3DUSA 3EJJX 5JDJA 4HUKB 1A7NH 5HHPB 2B59A 4MBRA 2ZUXA 3IE9A 5GS2D 2F74B 4AVIA 2AI0L 3OKDB 4XBEL 3D2TA 3RPKA 3VXUA 4I88A 5J6GB 3QXAB 2C1OA 4HXAH 1DQDH 3O41B 3ZMNA 1J5HA 4AE1A 3SZDA 1A14H 4FTVA 2XG5B 2UY6A 3CXDH 3VFMB 4MJJA 2QFRA 5FV2A 2MWCA 1IGJB 4XRCB 5L9DH 3EOBB 3SD5A 5C0IB 1ROWA 1OF0A 3UYPB 4GI6A 2GAZA 2CGYA 3EYUL 1KPUB 3GRBA 4K3EL 2MCMA 3L1OL 3MOBH 4OLXL 4FXGA 3S35X 5GGTL 1U8LB 1IRAY 1OW0A 5DJ0B 3W3BA 3AA7A 3CH8A 4G1MB 3W37A 2IH3B 3C2SA 4X98B 3GHBH 5EG6C 5E6ID 3KYKL 2VR5A 1JZDC 4MQSB 3VXOA 4ALAL 3KYMA 5FUCE 2J12B 2HUEA 1CE6A 1L9NA 4OTXL 3VA6A 3MO1B 4POZD 3K74B 5LQBL 2E6JA 5KYUA 4MXQD 1EERB 2CCLA 3BVVA 3IFOA 3HN5A 4KKAD 5FFOA 4AL8C 3IDXH 4JPQA 1A6VH 3WTSA 3N9GH 1A9EB 3H9HA 4ELMF 4KJWC 3N3EA 4LHQB 3CWGA 5GQBA 4AYBA 1OB1A 2FQDA 3QUML 2FSEA 2AXFB 2WXRA 4E9LA 2BC4B 5M95B 5DQJA 3ARZA 1DJZA 3VFWA 3VXTB 3UPRB 5IW6A 2DOCA 1PW3A 5INCA 4M7JL 1I3GL 4NKMB 1EX0A 4TVPE 2VXVH 5AW1B 2I60H 1OAKH 2GC7C 2WJQA 3ZHLA 5FA3B 4ONOA 4G7VL 4BXSV 4ANKA 3D06A 1OE2A 2A4ZA 1N6QL 4RDQG 1X5GA 3HZ3A 5DTFA 2OR7A 2GY7B 4EI6B 1LEGB 2NYZA 1K5NB 4KZEH 4FQLH 1PNCA 4QHPA 3E6FB 3LN5A 5GXBB 1RL1A 1A6ZA 2CQVA 2F5BL 1S7SA 5CIPB 1OP3K 1MJ7L 2QEJA 3T0EA 5F9AC 5TDOA 2O6DA 5BPPA 5E1AB 4EKJA 1FBIH 1FZJA 2Z65C 4FRXA 1OHZA 5FAAA 1DDTA 1LK3H 3G5VA 4LT7A 1WEJH 4Y4KD 4P5KA 4MCYB 3BESR 4WI2A 4YFEA 5K9JH 4QTIH 1MH5A 3C87A 4OCWL 1WBZA 3MNWA 5IUSA 1BVOA 1XEUA 1NEZG 4MQXC 3BN3B 1CFQB 5E51A 1OWRM 2EUZA 4JJOA 3TN0A 4M43L 4IS6A 4YHOH 2Q86B 4U6TA 2J88H 3S8GB 5IEHB 5BCAA 2A9BA 1OCZB 3QR0A 2ARJB 2OCCB 2H41A 4Z7OB 2XTJE 4X80L 4A2EA 5CCHE 2LU5A 3H0TA 3CX5K 3IGLA 4Z7UB 2FZ3B 2MCPH 2BXYA 4EF3A 4L5FL 1UD4A 3PLYA 3QORB 3V7AG 4U4IA 5ADXL 4CMMB 1KUMA 5G26A 2W65A 2BSTB 4HOZA 1JGDA 4OGAD 5HHQA 1HKFA 3NIFE 4JNXA 1K4DA 1YG9A 2K6ZA 2B2XL 4HQQL 1DBKH 1MFAL 4S1RL 2G9HB 5EU7C 4AGOA 3KWTA 2IGTA 3DI2B 4B3EA 4P59H 4P2QA 3GM0A 4BK4A 3N42B 1ED3A 1FVEA 2GBTA 2R0ZL 2HB0A 3MUZ1 4A2HA 3K3QA 3QSKB 2GEQA 4DKAA 1KYUA 4OF0A 1DFXA 1PQZB 1QW8A 4P3DB 1YMMA 4GUPA 4D9QE 1MFUA 3B9AA 4Z3TA 4HH9B 4JM2D 1BZ8A 2OTPA 3P3RA 4N5EC 1I1FA 1GFMA 1OAUH 2WJ5A 5KSAD 1I85C 4KPHL 4WCYH 1TFPA 1LDPH 4KRPC 1M3JA 1AMXA 5D2NB 1YEGH 5IMOB 1ZJAA 1YNLH 1HXUA 4IJ3C 4MAYC 4OUOA 2ICCA 5EO0B 1N3NB 2PKDA 2HTLC 2ED7A 4I0PB 4FTVE 2R9HD 4S1DC 4PVBA 4WGKA 1NJ9B 1II4E 3HC2A 4ZBJA 3VFOB 5HVWA 5D1ZA 4PR5A 1QACA 3RUGB 1SYVA 5DJAB 4JKNA 5EEZA 5FIEA 3ECUA 4ERSL 5FW7A 3LKNA 1RZ7L 2HXAA 2EYRB 2CNYA 2R7EB 4BKLA 2PR4L 5CIPH 2WIIB 4P9HC 1EVUA 3PQYA 4DKTA 4TL5A 1NMCC 1RVFL 4PRPA 2R29H 2BVOA 5IIEA 4HUMB 4QY8B 1GCFA 3VI4A 2YD5A 1T1WB 3ZLQC 5GTIO 5DJCB 3ILDA 5ABZA 4Y2DC 5EOQH 4JW3A 3OKMA 4MA8L 4MGXA 3NCBB 5GGVH 3BUBA 3QZNA 4JN2B 5GJTH 3A4AA 1BM3H 3EGDB 1SLUA 2XNAB 1WCBB 1LM8V 3RPBA 3BVXA 3UJTL 4EBQL 1G9NL 1YQ2A 3KJ6L 5EEXA 5DL5A 3IAGC 2QGBA 3QCVL 2ZOKB 2K6YA 4X5XA 2VSKB 4ZRGA 7FABL 3AABA 5TE6H 1NQBA 2EZ0C 1UM5H 3HC4H 3MV8A 4LFHG 4OLEA 2RD0A 3BH9B 3PABA 4FKHA 3HLKA 3EZ8A 4X8JA 5CINH 4PTTA 3BRDA 4NNXA 4NQEB 1I9IL 1N0XL 1WA0X 4HKJA 5GRXG 3I6LD 1G7JA 3E7JA 5DEZA 5CJQL 3CBJB 2BDNL 3QUKA 1QI4A 4KH9A 4P4KB 3T0EE 3OBAA 4Y1SA 5CEZE 1CDJA 1GW6A 3ARFD 2WNXA 5BVJB 2UXGA 3VM5A 5J1AA 4HPYL 2Y7OA 1HEZB 1ZY9A 2YD7A 3LZOA 1TNMA 4ZOEA 3FQWA 4MLSA 1IILE 1UGKA 2P5EA 1P7QD 5DJDA 5F7LB 4E41B 2P52A 2LW3A 3MNVA 3UL4A 1X9QA 3MODL 2FE0A 5EOCL 1H5BA 3U0PB 2ALWA 2Y25A 5L88L 3MOQA 1IFHL 2F8OA 3NJMA 4FG2A 4MJ5B 4N0FB 2VAAB 1N64H 4HCIA 1GFNA 3K7UA 4JREB 3GMPA 4KXBA 1GMIA 2CWRA 2DPKA 2DQGL 3OMAB 4X7FC 4X6BB 4Z7AA 2IDUA 4S1SH 1P1ZA 1WO2A 4PWJA 4HDIA 1N5YH 5TE4H 1OK0A 3MLRH 2G4EA 1ZANH 1HTYA 3RAJL 1N4XL 1NGQL 2ENYA 4RL9A 1RURH 2ZCLH 4G7YL 3OJ2C 5AYTA 4GAYB 5B38G 1IZKA 3GLAA 3CVHH 1RUMH 2OX5A 4XPAH 1M53A 4FNLH 1CICB 4FRWA 1NCCH 3CX5J 1E27B 4KROC 3LAFA 3T2NL 3C5SA 2FGWL 4GXVL 4XNYH 4AUIA 3OXSA 2DMGA 2VOTA 5F7KC 4WWPA 5D4JA 4YFLF 4Y16A 3S98A 3FQRB 4P2QE 3ZE0E 4APQA 1Z5YD 1NFIB 3JWNE 1AO7D 4C69X 5GRZA 3IJYA 3VMPA 4V1DB 5I75C 6FABH 5GS1B 1JFHA 5K39A 4I5BA 1UA6H 4GEJA 5DC4B 3OAYH 2UZXA 3GSRA 1F8TH 1VGKA 4E5XG 1R3HB 2Z31D 3B56A 1JXKA 5I5RA 3Q43A 4IKLA 1QD0A 5F0JB 3HG1B 4X6CF 3VXMA 3TURA 1T21A 2NXYB 2YLKA 3F8UB 4FLRA 1MAKA 1INDH 3VFPB 1R24B 1H8SA 3HG2A 4JEGB 5C0DA 4ANWA 4ETYA 2W60B 1H3PL 2YKLL 2X1OA 4PJHB 1S9WA 5ESQA 2J6EH 3Q8BA 3VD0A 3IDNB 4JHVA 1A8ZA 5ALCH 2NR6D 1U8HA 5E8PA 4ZTOL 1H19A 1QLEL 2CLZA 3GK8H 3T6WA 2XBZA 2OMBA 3L81A 1F97A 1MCPL 3V52L 4N90D 1FL6B 3KS0H 2EVFA 3II3A 2AITA 4N0UB 4OU3A 1QSFD 4U1IA 3QNYA 4PS3A 4A6YL 4DF9A 3BD4A 3ZO0A 3QZMA 1IL1B 5MEOB 3ZE2B 1GY2A 4Y5XB 3RBSA 2Z4QA 2BVUA 1QWHA 1A0QH 2HG5A 3WKMH 5FUCC 5T5FH 3KG5A 2XWCA 5JHLL 2OL3A 1X5MA 1T89C 1JZ8A 5BV7B 4BK8A 1E6JL 1FNEB 3G6JB 3OR6B 4ZFFB 4YXLH 4F2MB 1N67A 4IOIB 4P2OD 4TQHA 3T77A 1XGTA 3H85A 1U3HB 4LEXH 1T20A 5F9WC 3WDJA 4WVRA 4HKZB 2OK0H 4RX4D 5A6IA 1COBA 2XZQH 5ABDE 2BOLA 4NO0B 4PJCA 4FZ8L 3GBMH 5DEJA 4PJAB 4PJ5E 1LO4H 5CBAB 5D9SA 3L5WB 1QYGL 1S7WA 4G9FB 2XRAH 3BD3A 3HG5A 3TJPA 1WRFA 5ICYB 1TVBB 5MENA 5DXWA 5JXEC 4YSDA 5DZJA 3WJMB 5G5DA 5BS0B 4ENEC 4OLYL 1CN4A 4ODUA 1ZGLP 1NPJA 1DQQB 4W9ZA 3MRQA 3KYOA 3PWJB 1ACYL 3WJJC 4YHML 1TPXC 3F84A 4WI3A 3CFNA 5HGBB 1ZPUA 4NI3A 3FO2A 2YD3A 4NOFA 1GGUA 4BUGA 4MHHG 4PB0L 4F57H 5FW6A 1KWKA 1KN4H 3M7FB 1WP6A 1JGUH 5C7XH 4XOBA 1EEZB 2ZCHH 4JO1L 2F54E 5D7JC 5DJXA 5CD3A 1HI6B 3JTSB 4PD4J 2H3NA 4IMKA 3WEXA 1UH2A 2D3JA 4JG9A 3FT1A 5BOZG 4OV5A 1JGEA 2AXGA 3KLKA 3DX2A 1X5FA 5B5EO 2CO7B 1SEQL 1K3IA 2EXYC 1HHGA 2P5EE 4GI8A 4OZGA 1FJ1B 2QVIA 1WWWX 5F9JB 2J1NA 3F00A 3PRZA 1NIBA 5EOTB 3ULAB 3VTMA 1AD9B 2IG2H 3D07A 3EJZC 2BNRB 1F3DH 2AEOA 4PJFF 4IKKA 1MQKH 3BAWA 3IMTA 5FYJU 5IEKA 1IGIH 5AALA 2VR9A 4X2UA 4YEFA 4LVOC 2VGLM 3FH5A 1X5AA 3DROA 1NIAA 4IIQA 5GJSL 5EBMA 1NCWH 2ZXWB 2KYIA 3LKRA 1H8LA 5IW3A 2C7UB 5EO9A 3FOLA 4Z5RA 3TJHD 2IXQA 4JY4B 4R97B 3JTYA 2DYPA 3I6GA 1F13A 1SMAA 4R8WL 2J8UF 2OJEA 5KYXB 5KW9L 2I07A 1U8QA 2PO6A 3FB7B 3O8XA 1RJYB 3OG6B 4TRPL 4XH2A 2CUAA 3U2SB 3MV7E 2NY5H 3NESA 3LQAC 5BV7H 3OWEA 3EO0A 1OGTB 5E6IA 3IBEA 1MOEA 4IGBC 4LSPH 3BSZA 2R2BB 3WLBA 1JHLL 1QFOA 3ZSTA 7PAZA 5FECB 2H3XC 4G8EA 3QUYD 2WN2A 4N2FA 4UDTB 4YFLI 5LCVH 3DRTB 5HYFA 5IT2H 3NJXA 1BREA 3ILQD 1FHGA 1WS8A 4GP8B 3JVFC 1ZHZA 3FN3A 4MNHB 3VZTX 4N2CA 3GSNA 1MHCA 1YNTA 4WFHD 4N0CD 4UNTA 5I0YA 5E6ZA 1FZOB 1T0MA 1TZHB 4NI6A 2FLRT 1TCRB 4GKLA 4L3CB 4LOEA 1M6OB 4M8QB 5JOPE 4XHQA 3TXAA 3WI4A 4DETA 4MCMA 5A2KH 3MVSA 2OMYA 2JQYA 3LEVL 4L48A 4OIBA 4AMWA 3U36A 3K6SB 2B4CH 4UANA 4Z77A 4YE4L 1F4YL 1Y6NR 2ERJB 1KFAL 1NAML 4FXGC 1WITA 3OAUH 4PJGB 1GPOH 1XMEB 1MHPH 1OW0C 1LEIA 3HC3H 5GRJH 4K5OA 5TK2A 3BKJH 4BELD 3BP5A 3UC2A 3CXFA 4LP5A 4FXKB 3I74A 2XKUA 1CL7H 1A7QL 5HYIA 2BCKA 2MQ0A 1H6UA 3GMLB 3ZU8A 3C6LD 4OCSL 3CHRA 1TIUA 1RFDL 2X4TB 5I76B 4YAQB 3ZKMD 4XO4A 1SHMA 1WF5A 4PRIB 1PG7X 3N50A 4WO4C 1NMBL 4E9YA 1I1CA 2FQEA 2LLLA 3KL3A 5E6RB 5IK3A 4Y4KA 2NY7L 2DKMA 3M1CA 4DSYA 4H8PA 5DYOB 4GAJL 5FKPA 2ARJQ 2GJPA 3P77B 1FGNH 3C5ZB 4RBPH 5EN2A 1MSPA 3VG9C 4I3SH 4LSSL 2ERVA 1ZJBA 4FJZA 3ABZA 4HWEL 4XCNA 4EZKA 3VG0H 5CR1A 1C7SA 2GTQA 1VKXB 3UTPE 2N3JA 5I30L 1FA4A 2IDTA 3DK0A 4NKIL 2AK1H 3AT8A 3ROLB 1BV8A 5HTSA 4A7SA 1MFNA 3A47A 1NCGA 4XN8A 3N1PC 4R2GB 3SZVA 4Y5YA 3WJLC 4M1DL 3OKEB 3VI3B 2HH0L 2WQXA 2NX5B 4XX1E 3T0EC 3O2VL 2K1MA 4ODVH 3X3FL 1DSFL 3LDBC 3P73A 2CO1A 1X4XA 4G72B 4FHJA 4FQCH 1JV2A 3V5KB 3BO8B 2CR3A 4OT1L 1HXMA 2MHAB 1U6AH 2AQRA 1M1XB 3I6SA 1AY1H 5C0AD 5CEXA 4L18A 3GJFH 3SDAB 4EZLA 3ESPA 1V7NL 4OLWH 3KBFA 3OKKB 1CTOA 2Y2WA 5I8KL 5KANG 3TN0C 2EDRA 2WYIA 4GS7C 4J8QA 3GTVA 3U1PA 4JM2A 4YVUA 5HI4D 4JN1H 5C9JA 3I3BA 1BF5A 4K94H 1FZKA 1IEBA 3VZUX 1X5ZA 2VR6A 3KLQA 4Z76B 1XCXA 3P2TA 3QI9D 5KSAA 5C0CB 2V6HA 1M57B 5GS0C 4S11A 2QSVA 3WO4B 4KHXL 5KVGH 1QTSA 2CM6A 2H9GB 4N25A 4YDVB 2YS4A 3VFNA 3G7GA 4UV4H 5DR5H 4X6EB 3IFLH 1F45A 3BAEH 1E9QB 2FVNA 4O51B 2EE9A 1AHWB 3DGGA 3MBEB 4B9PA 4HJGA 4QAMB 1AQMA 1E9OA 1KELL 3TLRA 1CD8A 3NRPA 4LHJB 1Q9FA 4N9GA 4WAFA 4MJ2A 3CFEA 2QKIA 3PXJA 5IQ9B 3F5WA 1A7BA 5CBEA 1KACB 1U9KA 2YRLA 1JWUB 2FX8L 2Z92A 3BDBA 4QNPF 4KFMA 5C0ND 3UAJD 4AWJC 5FB8A 3BN9C 2Q6WB 4HS3A 2OSLA 1QOKA 3HAEG 3LS4L 4KJPC 1ESOA 1OPOA 3JWNC 1KOAA 4ZX3A 4YK4C 3QJFB 3Q8FA 3PWUA 4NO2A 4IIZA 2E9WA 5H35A 3LRMA 3NPZB 1G1OA 4M1GL 4X6FB 4BZ1A 4YHZL 1JZ6A 2JCCA 4JZJA 2FO4A 3V8CA 1XCQB 1R75A 2FECL 2BZ7A 3VNYA 2EH7L 4H1LB 4EI5B 1AVAA 1X44A 3M1BB 3MPCA 2AW2A 4UTBL 5TF0A 4NT6A 5HDOA 1YEIH 3U30B 4P9HL 2Q3XA 2XXCB 1ZWIB 2N4IA 4WKZB 4YHPA 5EBWA 1T7YA 1FC2D 5I9QC 3QIBA 5D1ZC 3BAXA 4HJSA 3SQRA 2HRPL 3ARTA 4KC3B 4RMQA 4XAKD 4JZNA 3LNDA 4PVMA 4YZFE 2GBVA 2VDNB 1HE8A 3EUDA 5E79O 2FAUA 5FGSA 2BERA 2I27N 5KEZA 2ZLDA 4MXVF 2JKNA 1P6WA 1VZGA 3QARA 4G3YL 1A5FL 3MU3A 5DS2A 4QXUH 1MN4A 4ODTL 3WEMA 4E9TA 4I4WA 4WU5B 4WFFE 5DQDH 3ZT5A 1R17A 3QRBA 4DEPB 1IM3A 1Q0YH 1GJWA 2OBGA 2R8SL 5AOLA 4PJ7E 4FA6A 2BWDA 5LB1A 2VC2L 1QNZL 4M6NH 2H1PH 4W6XB 3QCTL 4OJFH 4FNPA 3CTTA 1D5RA 3FUFA 3LEYL 1QSEB 3OJDA 4ZODA 3EBHA 5J11B 1P7QA 4F7EB 1J8HA 2A74B 3V4VB 3ELQA 1YYML 3VRLE 2AJXL 4FQPA 5CGMA 4M9PA 1P84K 3PGFH 5EHFA 3VGFA 4RISH 3AAAA 1V7MH 2C5DC 5AZ2L 3WSQL 3K8MA 4DKDC 2XZZA 3NFPB 2XSKA 4ZUTA 5F88B 3S4SG 3RVWD 4RZCA 2Y36L 4GQQA 2WBJD 3EGSB 3CG8A 5KJ4A 3SGEI 1BGXH 3PDOA 3ZR5A 4ZUUB 2K70A 5FYJD 5HHOD 3QRFM 5EZIH 2DQMA 4I77H 4GSDL 4E9VA 3INUH 3W57A 3BSGA 3MLYL 4PJIE 1SPDA 1EAQA 3ULSA 4FULA 4O3YA 3D51A 5MI0B 2FSDA 3NN8B 5F89A 2UY7B 3Q44A 2BP8A 5TGBB 3RA7H 4HMDA 1ZMYA 5D6DA 3ZW3A 4NSKB 4L8SA 2ADIA 1O6TA 2J4WL 1AGDA 1H5BC 4FS0A 2XPYA 5IBLC 2MQGA 2ZF8A 5C6PB 3K5RA 1J1PL 5KJ7E 2FEEL 2FT7A 3NQKA 4H1LH 1JZHA 1MRDH 5KSBA 1W0VA 5B1BB 2WIMA 1XIWB 1FDLL 5IQMA 3Q0HA 2X70B 3NJVA 3EO9L 4MZ3A 4H8WH 1CJYA 4ZSOA 4KY2A 5JQHC 4D5UA 1CDBA 1AE6L 4BZYA 1BLNA 4Y2NA 4F9PA 2VSMB 5IR1B 3K91A 3KR3H 1M1SA 1KLFA 1MVUB 3MRPB 3ZPDA 3BCFA 4LIQE 2IWEA 2VDNH 3X12B 3ZR6A 2NR6A 4L3EB 1EDQA 3L16A 3GT6A 1U2CA 2LTQB 2Q9OA 1FYTE 2NT0A 4JGNA 2DQDH 4GAAA 4LLYB 3O2WL 1JVKA 4YJZL 1NBVL 5JQIB 3MBWB 1YEFH 2A83A 4HCRH 1QP1A 1A66A 2QQKL 3JWOC 4Y16C 4YGAB 1NGYB 2BINA 1J9CT 1AI1H 1YEHL 4IYKA 4NRXA 3SDXB 4L2YA 1FNGA 5AB2A 1I8MA 2ZSVA 4JY6B 4NXKA 3MRGA 3B2XA 3JWDH 1FPTL 3I75A 1F4WL 4LKXB 1HQRA 3LSOA 3SBQA 1XB6A 1HE7A 3Q1SH 2JCCE 2IEPA 1F0LA 4HFWA 4YVNA 2IPUK 2YMOA 5IROA 1FHNA 5C6TL 4UOW0 4HPHA 1T5WB 4N24A 3O3AA 4LLVB 2R69L 4IBLT 1UEMA 2W0FB 3BPNC 5J56B 3RGBA 3CDGA 4QRPD 2OTWB 3GHEL 1RUKL 4PRNA 4J6RH 5KVFL 1BQLL 2J1WA 3V0VA 4HS6B 2R51A 4KVNH 4AZ8A 3H7LA 3T1FB 1JFQL 4AM0B 1R19A 3RY5A 4GSUA 3WKNA 5DS1A 3L1FA 5AL0A 2ATKA 3CU7A 1QSZA 3KGRA 1PZBA 2FL5A 4FCHA 5D7HA 2Q1EA 1K4CA 3FYEB 4NOBA 1YY8B 1EGJL 4OCRL 3RGVB 4GAGL 1WFNA 3T71A 3KHOA 2FK9A 3GB7A 4N2IA 5GZNA 2MNUA 2X9YA 3KPSE 5LUMA 4OCMC 3QPKA 1X4YA 3EDEA 3UFIA 2J4UP 2XWTA 4DZBA 2P4AB 1OAYL 1QFWH 1JZJA 1H15B 1DBJH 1WGOA 1DZ0A 1VPOH 2DF3A 5EZJB 3V9EA 1UYWH 1KBWA 2F58H 2OMVB 3AADB 1NFDA 4TVPL 2XN9D 3AACA 2YPVH 2WJ7A 2A6KB 4PMFA 2ZOUA 1QLRB 4K3JL 4PG2A 3AITA 3GSUB 1UZGA 3L7FA 3T3PE 5E2VH 1J8HE 3WE6B 3MR9A 2DN7A 4JFPA 2FJUB 2VLJB 3B2MA 4DPBX 5B22A 2AJUH 4LKCA 1GIGH 1S8DB 3V4UL 1CTNA 4L2LA 1H3UA 2LU4A 5E5LA 3J7HA 1OCWL 5LKNA 3I6KB 2D9CA 2M26A 3AQXA 4MD5B 3VX0A 2ED9A 2W07A 3OKNB 2QT6A 3QUMB 3P3SA 5E8NB 4XB3A 1GHFH 5IBUG 2N56A 3B8SA 3F7YA 2PCPA 4P05A 1ET8A 2XQBH 1JZIA 2VXQH 5AVWB 1C16A 4CADA 1HKLH 4AQEA 4JFFB 1ZHTA 1L4IA 4FZNA 2AJSH 2R0WL 4NQDB 2B3IA 3GRWA 5EU3B 1HVXA 1PZ2A 4IMKC 3I50L 3QNXA 2CDEA 3ZJAA 3L3KA 3MLVL 3BZ5A 4ATTA 1WDAA 4OCNC 4P0DA 4W9IC 4HEMA 3HMXH 2IPKB 2R4RL 3VUAA 1YEEH 5K1JA 3KGSA 3LRLA 1AGCB 4PUBL 4KKRA 3VFVA 5LVEA 3A2SX 2DQHL 5I28A 4KFZC 1GGIL 2PF6A 3L45A 4O2CA 2AK4B 2WLKA 2RQEA 5HYQA 4AZLA 3X14B 4AGNA 3T6VA 2YPKB 1U3NA 4CC1A 1DLHA 3LJ3A 4L1SA 3FO9A 2J8UB 3VNZA 2LOEA 1BM7A 2O5YL 4FFVC 4ZSOE 4YXKL 1C9SA 1GH7A 3CFBA 4IIQC 3QFJE 3VWKB 1HOCA 4R90H 1TEFA 4PGEA 4MDJA 3RDTD 4LLQA 1EXHA 3CVIH 4KV5E 4F7PA 4LSUH 3BWAA 1CLYH 4NZRH 3D5OF 3L8QA 1FO0B 3MAWA 2WXGA 4NZ8A 3BT0A 4Y2OB 4HX1A 3BSHA 2PRNA 2PO6C 3QNFA 4DVRH 1SJMA 1C5DB 4DGYH 3O8XC 5D7EA 4IBVA 1RJLA 3LKQB 3DOSA 1QEWB 2NNFA 2V5RA 3QO0B 5CHNB 5E6IC 3B3IA 3ECBB 3FYXA 1T5XB 1JZFA 1L7TL 4WFEE 4EE2A 3DBXB 2P8PA 4FL4C 1CDHA 4AK1A 1H0DA 1CPUA 3C6LA 2P8MB 3ARWA 3ZKXC 2D3VA 1IC4L 2NNAA 4X0NA 3OJMB 2P7TA 4MMXB 4BSWB 3MLUH 2H45A 1UKSA 5D6CB 5EUOA 4YO0B 4KTEH 2X4NA 4TF4A 3MRKB 2H6PA 3WS6A 2OP4L 3VM7A 2KQMA 1FFTB 4XVTL 3HMWL 1BT9A 2ZICA 5F1NA 3MRLA 3X1GA 5DMKA 4C58B 2KDGA 1YDPA 3DXAB 4X5LA 2FGZA 4AYNA 4FLQA 2RCSH 3L3GB 4P46B 1ZHYA 2WLMA 2ZJSL 7CGTA 1KJ3H 5FHBL 1VA9A 5SWZA 2GTZB 2OMNA 4U3SA 4RRPG 2JQMA 2XETA 3TPKA 2XX1A 3VFRA 3PPEA 3TVMD 3BE1H 1TLKA 3WLWD 4AOFA 5I71B 5KN5B 3V9FA 1A7PL 1T22B 4O4YL 4XBGA 3FFCA 3NG5A 5C97A 1CWVA 4RGMB 3QG7L 3WIHH 4MKMA 2GUOA 3F65A 3MFFA 4XMLL 1Q0EA 4YQXH 1F02I 2AP2A 4RBPK 2J7LA 4U7SA 4ZW8A 1E4XH 4QWWD 4RESB 4JFVA 2VDKL 1JN6B 1ND0A 2CUMA 2Y0SA 3CC5B 3KPOA 2IAMD 4Z95L 1OTSD 1PTZA 3R7QA 1PKQB 3HUJB 4TQEL 4N1HB 2XKSA 2ZNWA 4YHNA 5HGHB 4N0RA 4CDGC 1U41A 4JHUA 3UTTB 3BH8B 1E43A 1V3LA 5L2KE 1U4EA 5GSRB 4LSEA 3UU2A 2A6DB 4L9LA 5EORL 1AANA 1DQLL 2Z0UA 3QORD 4KI5D 3H9SD 5JORA 3SZKC 1VRSA 1AR2A 3N04A 4PEEA 1IGTA 3BKYL 2JXMA 5DMIH 4RGOL 1T0NA 3C9NB 1HDMA 4QLRA 1M7IB 4LQ1A 4MA7H 1KIUA 2DTSA 4GUCA 1N5AA 3B2UD 1P4BL 4OY9A 1FO0H 1X7QB 3MXWL 1JMXA 4L8BB 2ZX7A 4NQQA 1XBRA 1LO5A 4Z7VA 35C8H 4DGIL 4Y5YC 1EEYB 3GJFK 1ES0A 1RK7A 5CD5C 4KHTH 1P9MA 1ZT7A 3SDYH 1JPSH 2B9AA 3OGCA 1TQVA 1OM3H 1RMFL 3IF1A 3R8BB 5IB3A 1QVOA 1I7ZA 1RHHA 1BIIB 4HEME 3AXLB 4P2RB 3UAJA 3JTTA 2DLEA 1TZIA 4Z0BH 2ED6A 5ITFB 1PZ5A 1EUTA 1GSMA 2G2PA 3J2PA 4MDIA 4WW2A 2BSED 4K07A 4GFXA 4N2LA 2HJKB 4PYHA 5LDUA 1WUZA 2N01B 4N6RB 1A6TB 2E6QA 3BPOB 4TPRL 1NDMB 1XMWA 3ORJA 5KSAC 3ZTEA 2MKLC 2IBGA 2HFFA 2AJYH 1G7IA 3A4FA 1QAWA 2Y06H 3MRHA 3Q3GA 4AV4A 1EAPA 5HHNB 5F1SA 3SBPA 1QBML 3BDYL 3WXWL 1P0SE 3OWRA 3II1A 1MFBH 5INDB 1D5BB 5IFJB 1RUPL 3DKHA 3JQOB 3MRNB 4JZOB 5DCCA 2QKIC 5HGDB 2Z91A 1LWHA 3ASWA 3LXBA 2HP4A 5EH1A 3OGOE 1Q9LA 1X5IA 4JY5H 3D69A 4JO3L 3GFUA 1WFJA 1ZA3B 2R2HA 3RVVD 3A22A 2NY6B 4IRZL 5IOPB 1NM9A 5FWRA 3D39A 5ACLA 1JYWA 2HVKB 2MJWA 1E90A 5JOPD 4D7BA 2YXVA 2JKLA 2QQLH 4L1LA 3B43A 4YGVB 4NN7B 3L3OA 3RWEB 5FHAH 3MJ8A 1UQSA 4MRBA 4MFHA 3P2BA 4JZJC 2DD8L 3U1SL 3T2LA 1L9OA 4OZ4B 1INEL 4GG6A 5D7SH 4LSQL 1T4WA 5EUOE 3KHQA 1KULA 5CLWA 1OAQH 3LS5L 1EA9C 4XGZB 2VLRB 1ETZB 2EDQA 3FSWA 4X7SL 1XF2A 5PCYA 1JVOA 1G9ML 4N9OB 2OA9A 4HJEA 4NQED 1KY7A 4DEWA 4IW4C 3QIBC 3CDZB 2APVA 3GS4A 1I75A 2W9EL 4WI5A 5FUOH 4UIKL 1IZJA 4NIKB 4YUEH 5IHZA 2DKSA 5AOMA 4YSQA 4OIAA 3QRGH 2NY0D 4P4KD 2EADA 2WWMD 4NNYA 1NICA 5C0CE 5BO1L 4E0RB 1U8CB 5SWZE 4X4XB 3TFKC 4S2SB 3L5XH 3WAKA 2WVVA 5DFVC 4XT1C 1JDDA 4NAQA 1J9QA 1A9BA 2DEWX 4KMQA 4YS4A 3U48A 4E41D 1V3KA 5ADOL 5DI8A 4TYUA 3T65B 3FFCE 2DQTH 1T4KA 2H5UA 4FNRA 4EUPG 4PRHB 2BFVH 3RGHA 5FDWB 2EIMB 2FECI 4L29A 1L9MA 3GS0A 5C0GB 3ZUCA 4ZMWA 1LL1A 2W88A 2ENQA 5HHVH 5HVHB 5LXGL 3MJ6A 3UX9B 5CWSB 1AOZA 3QULB 5BUAA 3FU7A 1OE3A 4HOMA 2OI9C 2PXYD 2YR3A 1WWAX 3LV3B 5E2UL 3RZCA 2PCFA 4AZUA 3ES6A 2A0LD 4DFHA 2XPZA 3SPCA 2BSSA 5CS7A 1CR9L 3FFDB 3PWPE 1AXIB 5B39A 2HLEB 4PGCA 1PEWA 2VDPL 1ZTXH 2V8MA 4JDEB 4BV1A 4G71B 1CICD 3FN9A 5JUEH 3HRZB 1FZMA 5C2BL 4GRWF 2ZUQC 4R84A 3DJRA 5AG9A 1B88A 1KYOK 3VYNA 3BQUA 4M00A 5FYKH 1LO3L 4GMSL 5GGUB 2OFQA 5IF0A 2RALA 1PYWA 1A3RL 4TNWF 5LAPA 4Z7VE 4G8FB 1DN0A 1SFDA 3B2VH 3FSZA 5F6IC 2R1WB 4UBDD 1DANT 1MF2L 1YUHB 3V0JA 3WG7B 2Z7YA 4TMPA 4HUXA 3RWHB 4ZAKB 5DVMA 4LLMB 4FF9A 3ARDB 3UBXB 3U4BH 3P30L 3T0SA 2H4EA 3DSFL 3MMEA 5D6DC 4DZ8A 2NXYD 4L8SC 1NCTA 3ETTA 3U1QA 5K5YA 2KS0A 2ZOLA 4JDTL 2J8HA 4G43B 2B5IC 1BAFL 4OIFA 3VWJA 2BX5A 2LAGB 2F8XC 5KSVB 1WSST 3ZHKA 4ZTPL 5CZRA 5SX5K 2OJZH 3FT3A 4YSAA 3OB8A 4OM0H 5TDPB 3RX5A 4PJBF 4AM0Q 1SRDA 3JWOL 4G2AA 5ID1A 4CVUA 1N10A 5HI5D 4WEUD 4HFUH 4Q58C 3FQXA 1KB5B 4HAFA 4W9HC 1BMWA 1MFDL 2CJUH 2QVMA 3HKFA 3JUYA 4M03A 4NC1E 1U95A 2NR6C 2XWXA 2HRHA 1KB9J 1KEGL 5I73C 2ODHA 2YXMA 1S6NA 3GO1L 4TQIA 4M8VA 5AW3B 4JG0L 2EXWD 2GW5A 2X44D 3KH3A 1UH4A 2O61B 3VFGL 1AZRA 2J44A 3Q6GH 3QPXH 1UACL 4ZPTA 3S3JA 1KTLA 4HPOH 3SYSA 3WGUB 1A02N 3ABMB 4RETB 1Z3GH 4R5TA 2OXHA 1BVLB 1F86A 2FEEI 3GJEB 4GPVA 4NEHB 1A1NA 1DN2A 3SY9A 4K8RL 1KJVB 2R83A 3FTYA 1QR1B 4C8XA 4R0LA 3F85A 2OMTA 2JQAA 1JZ5A 2WKLA 2ICWA 3CSTA 3U4KA 3VD1A 4GG6E 1Q9GA 4AENB 5IROC 1EBAA 1UA3A 3U25A 4ZNEA 5GZOD 1A6AA 5BS0D 1BVNP 1MCIA 1BZ7A 4FFZH 5E5MA 2A99A 4Y1AE 4ZDHB 1CMOA 4OZIF 4U1LB 2B1AH 2CK0L 4W9KC 5L6YL 2FBJH 1JZ3A 4G82A 2XFGB 5DJ6A 4NKDA 2CIIA 5CSGA 3N2JA 4NKOB 1A4JA 1GZQB 1QBLL 3NYKA 5B66O 4PJEA 1NBZA 3A6CL 3ATEA 3RB5A 5ACMA 1TCMA 3PNWA 4KUZL 4OJYA 1M9SA 4IU3B 4WWID 4NIYE 4MB1A 2ZXDA 1YN7A 1L9RA 4Z3EA 1YECL 5CO1A 2FUQA 2E3VA 1CG9A 1RIVH 1MAMH 5JIHA 4PJXA 1ZOXA 5HSFA 3HBZA 1I9JH 2VISB 5GZNC 4LZKA 5FDYA 4KQ4L 4MMYB 5AOZA 1MRFH 4KAQL 3S5LA 1LD9B 3P9MA 3WFBL 1U8KA 4WUUB 2BNRD 3OQRA 3C8KA 1AQKL 5H4ZA 4LB8A 3CHOA 4RGNE 4D2NA 1BJ8A 3QEGH 1OCCB 3KPTA 1GY1A 3MREB 4EDWH 4NHUA 2F74A 3LRGA 3OKDA 4PY7B 2C9RA 3OXRB 4PG2C 5FUZH 5IOKA 3IE4A 1DO6A