4AYEC

Structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 1 e283ae304a mutant
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
243
structure length
243
Chain Sequence
GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAAKGSYSLGIFGGKAQEVAGSAAVKTVNGIRHIGLAAKQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT FACTOR H
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 243
sequence length 243
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4ayeC02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ayeC01
2KC0A 4O4XA 3VE2A 4O49A 3UAQA 2W80C 4O4UA 5T5FA 3VE1A 2Y7SA 3PQUA 3PQSA 3V8UA 1YS5A 3HOEA 2W81C 4AYMC 4QQ1A 4AYNA 4O3ZA 4O3WA 5EE2A 4Z3TA 4AYDC 2YPVA 4AYEC 4U9CA 4AYID 3HOLA 2KDYA 4O3YA 2LFUA 4O3XB 3KVDD
chains in the Genus database with same CATH superfamily
3IXAA 4XP1L 1QNZL 3VWKA 4YSPA 2KQMA 2YXMA 3LKNA 5J3HC 3MRCB 4DO6A 3AA6B 2BVTA 2NZ9D 4N5UA 3UBXB 5EU3B 4MNGE 4KI5E 5ETUB 2FAUA 4C56A 3KPLB 3FC8A 2J1KA 2VSMB 2WN3A 4XCYA 4ELKB 5JOEA 4S1RL 3BO8B 3VGAC 3OAUH 5BNXD 4H5SA 4UB0L 3FQXA 1EEZB 4Y88A 4JFZH 2AANA 3SBWC 1X5ZA 1IZKA 3G7TA 3U1PA 4QHLA 1CGXA 5GRWA 1BG1A 3HOLA 4JMXA 2E4TA 4ODTL 4PJIF 4E5XG 4FULA 1CE1L 3IJEA 4LOEA 4Y1SA 3T77A 5KYNA 1IU1A 3W9EB 5BQ7A 4XPGL 4IHOA 3CZFB 4FNLL 4X6CB 3FU6A 5EWIH 4Y1AA 1EEYB 5HBBA 1N2RB 2E4FA 2J8UE 3EJTA 3N85H 4P8QA 5DLLA 5C0RL 2VDNB 5DEZA 4FTVE 4EUPB 4ZOBA 2Q20A 2IADB 3I6LD 32C2B 2V2XB 3WO4B 5FW8A 2J20A 2RD0A 5F88A 4XBGB 2BXYA 4FG6C 1A3RH 1MW0A 1UD6A 4I3SH 2B14A 3T8XA 3NCJL 4MHHG 2VMDA 3NCEB 3WJJC 3P9MA 5CD3B 4CC1A 1CMOA 1XB8A 4FZ8H 1HOCB 4PJ9A 5EZIH 1N67A 2O30A 5EN2B 1TQCB 3R4RA 3LRSA 1GGYA 4QAWA 4ZW7A 3U6RB 4U7KA 1E6JH 3MCKA 3QQ9D 4L4TD 5I6LA 1XO8A 2O93L 3ZE2B 5IB4A 5L2JA 2EXWC 4XMXA 1WUZA 2CK2A 4OLZH 5JOPD 1N6QL 4MMZA 1C1EL 3IDIA 3IDJA 2W91A 1BBDL 4DZBB 4KTYA 4M1CC 3UPRB 2QLVB 3LSOA 4U1MB 4PJ8A 2V9RA 1EGJH 5E00B 4QRPD 4UINH 4QTHB 1FNGB 4Y4HB 4KMTH 4U1IB 2VZTA 1CIUA 5DZLA 5JQ6L 1AS7A 3IF1A 2B4CL 2EDQA 4MB5A 2Y3NA 5EUKA 1LWHA 4NNYA 2CE6A 3KWWA 4OLWH 3KVDD 3EYQD 4ZJ9A 4ZOAA 4HKZB 4NZJA 1MCFA 3ZKMC 4Q9BA 4MCZA 2R29H 4XVTL 5E4IA 3S8WA 3M8OL 1LEGA 1ZT7B 3F12B 4HAGA 3CVCA 4QY8B 2Z35B 3CDZB 4E1SA 5AVVB 4LCYA 2WO2B 4FFVD 4ZD3L 4PLOB 2VM3A 5B39B 2A83A 2R2CA 5ID0B 3FL7A 2KLRA 3QORA 1WWAX 1ZVSA 1ICTA 4XPHH 5TF0A 3F8UB 3ZR5A 5HGBA 5CIPH 2NQCA 4NUJA 4WI9A 4PJEB 1ZEAH 2VW7A 3SYOA 1NM4A 2JCCF 3MCYA 4XCFL 4ABUA 4P2OD 4N3TA 2HFFA 4J3OH 3KLHC 3SZ6A 3FCSA 2KXPA 1TTCA 1U3JA 3KYKL 1ZE3H 4P57B 5D71L 5FUCC 1HQ4A 5HHXL 2J1XA 1MDAA 4G9FA 4GAFB 1QRNE 4NQSB 5GGQL 4FFWC 2CIKB 1RHHB 2DN7A 5C6WH 2J88H 4ODVH 4DIXA 3WS3B 1C12A 1WGVA 4WI2A 3TL5A 3FTGA 2VISA 5DUBA 1AG0A 3KCPB 2JJSC 4NI6A 4YHZH 1G7PB 1SN0A 4LHQB 4EOWL 4KJPC 2E7MA 3IN0A 3BP7A 2C1PA 3QZPA 5FS5A 2GW5A 2ZYIA 1MAML 3GXFA 3DRTA 4L5FL 3QDMD 4Y8DC 3F04A 1IAIL 2B8OT 4WV1C 5FF6B 3TN0B 2WBJD 3BLPX 1YN7B 3L3IB 4HPYH 4A6YA 5C6TL 5JXAH 2QKIC 1LVEA 4OGZA 1R1CA 5EBWA 2XV0A 1O6SA 3HW9A 2HVBA 3HMXL 3TBBA 1J9QA 4NQCB 2ATAA 1UJ3A 4XXDA 1KV7A 1TQVA 4K5LA 4AMWA 3QUXB 3ARFD 4LLWB 4YDJA 3TV3L 3O3DB 1AD0B 3K74B 4LQ1A 2XTJD 1QA9B 1U8OB 1SHMA 4UDTA 3ASNB 4FQHB 3OHMB 2EDYA 5ES4B 4XN8A 4GRMB 1USQA 3RNKA 3JTTA 1T2QL 3RWEB 2H0JA 4GEIA 5KSAC 4M8UA 5IEKA 2DBLL 1MHHB 2VDPH 2MCMA 1JYVA 4KK6D 4LFHG 1CF8H 3IAPA 4JHZA 2VR8A 2ZUQB 4XCCL 4NKDB 1TDQA 1IBHA 3AFLA 4X80H 2ZZUT 3SKOA 3VSQA 1XR8B 3HAEA 4DP6X 3CBRA 1IV8A 1L9RA 1OTUC 1SM3H 1MAKA 4Y2DD 4G8EB 4BH7B 1Q9FA 1Z5LA 4PR7A 3C2AL 3D12B 1RZGA 3F7RA 3D18B 4ELMA 1VFBB 3GJEA 2BOBA 5CAYB 4XB8A 4YHNA 1U3HD 5FO7B 5C9JA 1FYTD 3A4DA 2MPVA 3T6XA 4BDVA 1J5DA 4LF3A 3RX5A 3NABH 4DQOL 2JLLA 1RJZB 1QWNA 3GB7A 1IGCL 1NGPL 1BZ9A 3BI9X 3O4LD 2FGWH 4BA8A 4HOXA 5BW7A 4G7SB 1MCBA 2CO2A 4YE4H 2WNWA 2D0FA 3OAWA 3LKOB 4F9LA 1ZMYA 3WKMH 3MXVH 4OFIA 1MEXL 3P4LA 4LSRL 1U95A 1VAHA 1G9MH 4MS8D 3ARQA 5I76A 3EYSL 2ZKYA 2NUPA 2G30A 3DVNA 1DVFA 3GMOA 2LFUA 4KQ4L 2X6UA 3H6AA 1S46A 3O41B 2AABL 1M2VA 3B8SA 3VH8G 3HR5B 1FIGH 1I9RH 2D0HA 4M5SA 5DD5L 2FR4B 1JNJA 1X6NA 3JYCA 1QATA 4TNGA 4KY2A 5INDA 4DTGH 5T1KA 3QHFH 4LPCA 3MO1A 4EBQL 1DDTA 3TEXA 4HJ0C 3CMGA 4HF5H 3D09A 5ICYB 1BEYL 5DVNA 1MFDH 1G6RB 4J27A 4E9YA 2RCSL 1YJDC 1F5WA 4U6HB 5LN8A 2RMNA 4B0MB 1GAFH 1RZIA 4O3YA 4FKHA 4D7BA 3IVKB 4K9EC 2R89A 4BK8A 5KANI 3ARUA 4WO4B 5CD5D 1BPLB 1MFVA 5HGHA 2GJRA 4JKNA 2L7EA 4OT1L 4YK4C 4ZTPH 3DTXA 3ZIYA 3IGKA 1HWWA 5SV3A 1TETL 2UUDH 1DQIA 4WI4A 1J5OH 1G1CA 1K9TA 1OSZA 4QDGA 5LXGH 4WFGE 1U2HA 1IJNA 4A7VA 2UY7A 1GSMA 4UT6H 3ARRA 2WKGA 5EE2A 3ZRCC 1QUPA 3AMKA 2PWDA 3GUFA 4KKCC 4D7PA 3U7YL 4D9RD 5T33L 3D33A 3KR3H 3Q8EA 2WTRA 4HJGA 1XCXA 1YRKA 1K6QL 1AGBA 2IGFH 1CDHA 5DLMH 4F57L 1I7ZA 3VCLB 2AJXH 4HPHA 3EH5B 5GSRA 4DW2L 3ZOAA 3SCMC 5FHAH 4FDWA 3OHXB 2B16A 4AJWA 1A8ZA 4UT9A 4WY7L 4XPBH 5EC1B 3U9UB 1NAMH 1AO7E 3N9GL 4Y5YA 3SKJL 1XGQB 2EEBA 1IM9A 1JPGB 2KZ7A 1LXMA 4K3EL 3ELAT 5BQDA 5JUEH 2YGNA 4HLEA 1KIQA 2ICWJ 3LQZA 5LCVA 2XJKA 3B6SB 4MDJB 3S36X 4OJCA 4ODUA 5F1NB 4EZKA 1NKOA 4AYGA 5DJAA 4HKJA 2ZF8A 3G3LA 5DHEA 2DYRB 4P5RA 1TO4A 1QJ8A 2W9EH 1D6EB 1NC4A 4KVCL 1XGPB 5CEZL 2R4SH 3WJMA 4WU5A 4P48A 4J2XA 3M46A 4I88A 4NQXB 1PPIA 4K2UL 3BKYH 4IRZL 4PCTA 2OJZL 3F58L 3LMJL 3UOAB 2PYED 2TRHA 1RURH 3VI4E 1VPOH 2A9NL 3ES6A 3FO0H 3NFSL 5DJCA 2VXTL 5L6YL 4BQBA 4C4KO 6FABL 1ACZA 1KNOA 4OJDH 4JFFB 4MQ7A 4AK2A 4JPIA 2BWIA 4KZDL 3GSRA 3ME0A 4DEWA 1RUAH 2C9UA 4JO1L 4W70A 2FWOA 4UAHA 2PP9A 2F58H 4A7SA 5GRVK 5IR1A 5I1HH 3H2QA 2E7CA 3BUYA 5D7LA 5DEFA 1MWAA 2DQEL 1MSPA 3EYVA 1GMEA 3RVUD 5GJTH 3MV9A 4HKXA 5FCUH 3RL2B 1TCMA 2EZ0D 3BGMB 1WFMA 3BKJH 2DIJA 4LHJB 1JRHH 4N6RA 5LNGA 5FW6A 1UD3A 2GJJA 3DSFL 1FVDB 2RAMA 4NB7A 4G5ZH 3V7AG 2OQJA 3P4OA 3FT1A 4IIQA 3T0DA 2IBGA 5TE7L 1P1ZB 4OFVA 4ES9A 1KCSL 5DXWA 2OSWA 3L08A 2XZAH 3K2UL 5BS0A 3K80A 1TEGA 2L7QA 4QUOA 4DUWA 5EN3A 3V0EA 3V8UA 5D93B 1NFDE 3VGDA 4ZNEA 2QGCA 1J88A 2ZJSH 5ANHA 5E2UH 5JOFA 3A23A 5HDBE 2WLZA 2IH1A 4HC1L 1XDTT 3JZYA 3LZFL 4ERSH 3FU3A 3MFFB 1NEPA 2VW4A 5DVKA 4HX1B 5AL0A 1NCWL 2R4PA 1WAAE 4OGXL 5F7BA 2ZG3A 4Y19B 5EBMB 3T1FA 3Q2VA 2A74C 3RY6C 2Q8BH 3W38A 3QWQB 3OD3A 3GZOA 4PV1C 4JO3L 1R34A 1KC5H 2HAZA 3DGGA 1TTBA 5GRJL 1MCKA 1DBKL 3FS9A 5FUCE 3O2DA 3U7WL 3FRPG 1WFOA 1H5BB 1N26A 5J57B 2OTUA 3GXIA 5K33A 1G7JA 1PQZA 2OMUA 4YH6A 3BQUB 2P5ED 3LQMA 4DZ8B 4B9FA 4F8TA 3U36A 1A7OL 3H9SE 2F7IA 5KAIO 1CUOA 4BA0A 1YNTA 3MLXL 1NUFA 3MR9B 3JWDL 4G1EA 4U0QB 2VRKA 5KN5A 3DBSA 5EZJB 4ONGH 5I28A 4YDVB 1D5ZB 3GMRA 2VZSA 4RLBA 5ESAA 3CX5J 3L7FA 3QNZA 1G9EA 1GZHC 2VMEA 2BRRH 2YAHA 2I07A 2YRZA 4TVUA 5JIDA 3E80A 3HC3L 2XG4A 4QOKA 4XNMB 1UD5A 3UTSA 3LNFA 3ZBMA 2BNRB 1NCDL 3MUGB 3VXPB 4L0PB 3U7AA 4RGOH 1AG6A 2MQ3A 4PREA 3G5XA 5DMJB 4XP5L 1VESA 2CMRL 4C4VB 4P99A 5BVJA 5JLZA 2IG2L 3LH2L 1YPZF 4NM4L 3Q6GL 4HMCA 4IJ3C 4OZHA 4OZIF 2IDSA 4UAOC 3RGVD 1R3KA 4P2CG 4WJ5B 3WMQA 1M6OA 2VMFA 1MJUH 5GZNA 4QQ1A 4Q0XH 4AX3A 3I75B 1IQDB 1NMBL 1RJLA 5LAXA 1IKNC 3EGXA 5AZ2L 1I7RA 3SZDA 4UQ9A 2P24A 1I9EA 3PDOB 1OZTG 5F1SA 3JV4A 3SE3A 1BVKB 1F90L 5DSCA 2HX8A 5EA0H 4KJQD 4KTGA 2E7DA 2JK5A 3HBGA 4OLXL 3T65B 4MQXC 2YPLD 3WTWA 4UT7H 4PUXA 5ICZA 3AT9A 4LARL 1CGSL 3VD9A 3WFBH 5IM7A 1EK3A 4Y9FA 4K3HA 5IROC 3D3VB 4K71B 4PS8A 2JXMB 2AQTA 4TN9A 3DXAD 3D07A 5BXFA 4P2YA 1I4FA 4AQ1A 2AJYH 5KAQG 4PJXF 1M7IB 2WQAA 5JHBA 2ADJB 3K6IA 3WY1A 4PW3A 1T5WA 2DLFL 1TZAA 3U79A 5CGTA 5C0DA 2YOAA 4M93B 5B5EO 4JFHE 4GW4A 1U93A 3UAFA 4O51B 1F56A 2DI7A 3LKRA 5CZVH 4IRSD 1U8QA 2Z65C 4NSKA 3VFWA 4AUYA 5LWYL 4FOZA 3NCYS 4CVZB 4PRHB 5HYJE 3STLB 2XZQL 1CCZA 3D2UD 3SJVD 4BSWA 3ULVL 4V1DB 1WFUA 1SJHB 3QEQA 4J3OC 1ZE3C 4LEOA 1RZKL 4Y2LA 4MCYB 2GUYA 4IK7A 1S78D 1BIHA 3ABZA 2YSSB 1G7HB 4X7TA 5BUGA 3WTVA 3GMNA 5JPMA 2ICCA 1YNKL 1NH6A 1QLRB 3B34A 1YMMA 3J8F7 3KWXA 4H88H 4PTUA 3EBGA 3H8NA 4TVPE 4XMPL 3V6ZA 5HYEA 1D9KB 25C8H 1LNUA 2ICEA 3A6CL 2GJPA 5TE4L 1GIGH 5F71A 1MY5A 3TNNA 4YXLH 3AXIA 4WKZA 1OSEA 2DQTH 3VRJB 5K9JL 5E8PB 5EU6A 4A2DA 1KN4L 3W2DL 4X4YA 2F53B 1F45A 3R7RA 5ABZA 5DJ6A 2IDQA 4FG2A 3VFPA 5KSBB 2VR6A 1KJVB 1XD0A 2O6PA 5EU4A 4AQZA 4P49A 1QR1A 2UYLA 4F80A 2YAEA 2YRLA 1FFNB 3UGUA 1BAWA 2K3HA 1KB5L 5J6HB 4L8CA 1MFCL 4L3EE 2CD0A 3BUPA 3ULVD 4AGPA 4MA8H 3T0EA 3HZVA 4OFQA 5F7EH 5K93A 4XWOC 4F2MB 1VZIA 4S0TD 1S9YA 1F4YH 4PLKC 2PTTA 3VRIB 3NDZE 3QDGE 1N4XH 2A6KA 4JFED 2AK1H 4QHMA 4TPRH 1QG3A 2YQ3A 5I6KA 4JQVC 1OAZL 3T20A 2NNXA 1RD6A 2N01B 1RMFL 3LNEA 4PGDB 3SDAB 3SGDI 1II4E 4L1DA 5AYTA 1J1PL 2BHZA 2YEZA 4BE5A 4F7PA 3O6KL 1G4RA 2YD7A 2VCOA 3C6EA 2A9AA 3B9KD 1EFXA 5JIMA 3BD3A 4LIQL 1L9NA 3LD8C 5DDHB 3FMGL 1OANA 1Y6MR 1XWVA 2VTFA 3P3RA 3EOTL 3IFNH 4NKMA 2JKLA 4O02A 4OCXH 4Q14A 4I1RA 4UIMB 2WANA 4UOW1 4O3WA 3KLAA 4OY9A 5C0AE 3ZDXE 4X5PA 2QJDA 3TM6A 2VL4A 4W6XB 5FYLH 4RRPA 1XQ4A 2Z8RA 2A5UA 5CEXA 4HXAL 1CLCA 3FHQA 3K71A 4NGHL 2CO7A 3IDNA 3VXSD 5DHXB 2HJLB 3GFUA 1GOGA 2OJEB 2Z7ZA 5D70L 4MD4A 5FX3A 4UILH 4LSQL 3M45A 5C0BD 1RIHH 1OP3K 2A99A 3JZ7A 3N0PB 1TZGL 5DURD 1DJXA 2EIMB 3EJRA 3BEWB 2N1TE 1MRDH 4OGAD 4CVXA 1BYNA 1W0VA 1TKWB 1E54A 1MELA 4N2BA 1PZAA 4HIEA 1XSKA 4PGCB 3DROB 4J6RH 4JGNA 2R0WL 2GJ6D 2DQUL 4RFNC 4N2HA 1BZDA 3U30B 4GAYB 2FJUB 5HHOB 1U91B 1K4CA 2RBLA 3GNML 2MOQA 1T1ZA 2R59A 3NRQA 4APQD 4XMKH 1EMTH 8PAZA 1ONQB 3D0VA 2Q7YA 3QIUD 4W9KC 1NCAL 2CUMA 4HGWA 4XX1E 4Y9CA 4S1SH 1UG9A 1T22B 4UNTA 3FBQA 5T1LA 1A3LL 5DHVH 2IPKB 1MCWM 5KYWA 5EU5B 4LNRB 4QWWC 5AZEH 2DWSA 2G5BA 3HE7C 3OQ3B 2FL5A 3MROB 4I89A 4I8DA 4LKCB 1I8IB 4HUWA 3D7PA 3LH9A 1RVFH 1FF5A 2VDRB 2X38A 4KRPC 4ODSH 5FV1L 2WO3B 3JWOC 3OSKA 4PIBA 4XB3A 3WFEL 4M9PA 3D1MC 3M17A 4XCNB 2N1KA 4DWHA 3HS0B 2ICWA 3JT0A 4JR9H 4EN3C 4LSEA 1XZWA 4G6KH 3SDXB 1TPXC 5DJ0B 5EBLB 3GHEH 5E8OB 5F7WC 5E1AA 3SDYL 3UDWA 3KMDA 3VXTB 5I0ZA 5K59F 4ETQA 1ZANL 3RVXC 4AENB 4ZODA 4K3CA 1X5YA 3RBGA 1FA4A 5EO9A 1FZKA 4QRQB 1NGWB 1Y1DA 3BVUA 2FWUA 1OAQH 4O00A 2EE6A 4HMEA 4I0PC 5ICXB 3L3KA 1ORSB 4P59L 3DOSB 2UWEB 2I5YH 3L1OH 4AXWA 4G80A 4Q4IA 1LK3L 2AVFA 1J5HA 3E6FB 3MV7B 2ZCLH 4JRYB 2RACA 1O9VA 4F9PA 1ZS2A 2FJHB 4Z5RA 2VOTA 4I2XA 3L6FA 4HFWA 3BE1H 4BBWA 1SFHA 1KZQA 2D03L 2HZHA 4YBLC 5IQ9A 1V3JA 2E9IA 4HP5A 2LU7A 5EOCL 2PRNA 3SY9A 4GBXB 5G3AA 1A7NL 3I2CL 4FS0A 1TVHB 3WOVA 4CSPA 3GS7A 4F7EB 3SDCB 5B3JE 4KRNA 3JTSA 3OMAB 3BIKA 1NDMB 2G3ZA 4JKWA 5CJQH 2XWZA 3ZQ9A 5H35A 3C8DA 3IN2A 1F86A 1M7UA 4JRXA 4HIHB 4XMWA 3S3BB 1NLDH 1UM6L 2NY3D 3ETBJ 1J9SA 1L6PA 3ARDD 4LVNC 1WV7T 5FDWB 4NAJA 3UJIH 1W16A 3IMRA 5CSZA 4AITA 2O61A 1MLBB 2NX5E 3QUYB 4XP6L 2W5PA 3LN4A 3INUH 1GSKA 4I18B 3D85A 4P9HC 4LMQI 4AQ8C 4GSDH 1NBZA 2SEBB 4AYDC 4JFZL 2VR9A 4WUUA 2WKOF 4L23A 4U9CA 2HJFA 3NMEA 1JNLH 2BP3A 4IOFC 4L1HA 3T6VA 5L9DH 2YWZA 1U8MA 5D5MA 1DEEA 3TZVC 3VU1A 2EADA 3G04B 1S7QB 3GBMH 3CE1A 2QQKH 1EUUA 1P5VA 3F7YB 3KPRB 1D5BB 15C8H 1HHHA 3N85L 2NY7H 5CBEA 5I1AA 1IC5H 1MREL 1V7ML 2MCG1 5CKAA 1SXBA 5JDSB 4MNQB 2XWJB 1A3RL 5DUMH 3QPKA 1EUTA 4M5YH 4I3SL 2EKJA 2IMNA 2VLKD 2FCBA 5A2FA 1AS8A 4FZ8L 2F5AL 5EZIL 5A2CA 5HYSB 5EZOL 4W81A 1PZCA 4N8VB 2VJ0A 5JTWA 2DAVA 2BOCA 1A6VH 1E6JL 3AABA 3MYZA 1D7DA 2GBUA 1NANI 4YHPB 1J11A 4L18A 5I1CH 1H3VA 1MVUB 3TPKA 1G7QB 2RH0A 1MUJA 4OLZL 3BPLB 4G42A 2PPCA 4NUGH 4XMVA 4NQEA 4POZC 3VNYA 4QXUH 2CO4A 2NW2B 2V7NA 2DQHH 1EGJL 3WBDA 4UINL 5DR5H 4KMTL 3WN5A 5D7IA 2FJGB 2HN7A 4WIQA 3FNKA 1PY0A 3IGAB 5LJYH 4OLWL 4G6FB 3OR6A 5IFHH 5TDOA 1WS7A 2CLRB 5I6OA 1PDKB 1JGLH 3QIWD 3AAZA 2DLGA 4PJ9C 3QO0A 5HTSA 2WYHA 1G1KA 2R29L 5TDPA 3C60B 3V55A 3RFZA 3OLEA 5L0QC 2O72A 3S8FB 2Q7NA 5AG9A 5EF0A 3M1BA 4R90L 1CD0A 1PCSA 1Z7JA 3ZKND 5I2IB 2BY0A 3N44F 3MQIA 2X1XR 4I3RH 2WLHA 3UG4A 1S5HA 5D1ZB 4MRCA 4MMZC 3UYOD 4HWUA 3T0VA 1GFNA 3KPSB 2AF2A 4KUCF 3MI6A 4PJ8C 5D2LA 1UXSA 3QB7C 3GSQA 3DVGB 4ZO8A 1PG7X 4Q56A 3MRNB 2ZTBA 4KPHH 5ENWB 2KQNA 1GW6A 4BFIB 3F7PC 1BOGA 3POXA 2ICES 3LPGA 3PNRB 4OF0A 2R0ZH 4UTAA 5IVXA 2NZIA 2NDFA 2D3LA 3W9DB 4AEHL 4XC1H 4ODVL 2MNWA 4JANB 1TYEB 5F9WC 1XHHA 1GC1C 2WCPA 3G6JA 4XBPB 5B8CA 2AZUA 1JYWA 2QVFB 1DFBH 4MDRA 3CQQA 4MZ2A 1ID2A 4N25A 5E7BA 5GGUA 3QORC 4GKOA 2O6DA 5CWSB 4JL1A 4AKPA 1TFPA 2HUEA 2Z7YA 4XAKD 4N2FA 4FKEA 1FVCA 1PLAA 3HW7A 4OCYH 4MXQC 4HPYL 2V7HB 5AOKA 4I9XA 2OYKA 5C0NC 3REWB 3EAKA 4O9HH 4GG8B 3MRBB 3HHMA 1Q90A 4Q4EA 2WLIA 2RQ8A 4GP5B 4JM2A 4C83B 3EG9A 4PB0H 4KXAA 4NQTA 5SWSE 3P3TA 3CFKB 2AAAA 2PP8A 3FKUS 4PI2A 3PF2A 4X6DE 5D4QA 5E6IA 3T71A 2DM2A 2LHAA 1RIVL 3MRDA 1HZLA 5ITBH 1YEIH 4QO1B 5F97E 3VFUA 3KL0A 1NKGA 2ESVD 3OZLA 4JDTH 3THMH 2VN4A 1TT6A 3D08A 3FQUA 3PGCA 2VDPL 4O2CA 2HVKB 2ZCKH 1CF8L 2C7UA 3FTZA 3MLUL 4WK0B 5EO0A 3TBTA 4CAGA 1T89A 4B9KC 5JO5A 4ZBJA 4X80L 5F2FA 4D3CH 3P0GB 4A7GA 1SYVA 1M6UA 3D4ZA 4Y8AA 1ZHYA 1SM3L 4HBQA 3UU2A 1F3JB 3MACH 3MRCA 1UJ3C 3AA6A 2E9WA 3UBXA 1ZTXH 5EU3A 4RSYA 5ETUA 3KPLA 1R24B 3FFCE 4NNPH 1CDBA 2VNCA 5E8NB 1PGRB 3BO8A 3BAWA 4QR7A 1JGUH 3MUZ1 4H13C 3AADB 4D9LH 4F15B 5IHHA 2CBMA 2VLJB 2NY1C 3OAYK 3N55A 3KM2A 1EEZA 3FW6A 1CI5A 1AXTH 4YE4L 3T3PE 4IMLB 4JX0A 4XWOD 4PLKD 4Z18A 4YLCA 4GKNB 4JN2B 1PZDA 3W9EA 3WKML 1FZOB 1Q9LB 3CZFA 3MXVL 4X6CA 2FQGA 3PQYD 1EEYA 4M7JH 4PWKA 4J4PC 1N2RA 5JDJA 1G9ML 3ALPA 2FHCA 3STZB 2NXZC 5I66B 3UBHA 2AGJL 3VFRB 4W9FC 4RMVA 4EUPA 4TRPH 1XAKA 2IADA 2K4TA 32C2A 5I0XA 1UURA 1QMUA 2V2XA 4WWPA 1I9RL 5HYIA 3O3BB 3FO1B 3QAZB 4UWQB 4XBGA 2C4XA 4V2CB 4GKSB 4DTGL 5K39B 2KS0A 5CD3A 2KZ1B 1ZIAA 3QHFL 1HOCA 5EN2A 3QJFB 5BW7C 3O0EA 3CX2A 4HF5L 4XB7A 3T2LA 1JGDB 3F6LA 1MFDL 4B50A 1DE4B 3T3MB 5G26A 4LRIC 4F9LC 5CXPA 1EJOL 1HAWA 3QK0A 3PWPD 2VLMD 2LLLA 4DZBA 5J11B 3X1BA 3UPRA 4K3BA 1TJIH 3DX1A 4U1MA 1DVFC 4OUUB 5E00A 2KT6A 4N1HB 4ZTPL 1AJ7H 4QTHA 1FNGA 4Y4HA 5D2LF 3GSXB 5EIIG 4U1IA 5LBVA 2FBRA 1F4AA 2Y6SC 5LN4A 3ULSB 3VFVB 4DAGH 2VLLB 4H8PA 4YS4A 1DBBH 3C6LD 4PRID 1JPTH 5DCCA 1J5OL 2H1PH 2LLNA 1CYGA 3SYPA 5LXGL 3PFQA 2VZUA 1PX8A 4R2GD 2A6DB 3NSJA 2JMRA 5EEYA 4GXUN 1NDTA 2L8AA 4HKZA 5IZ7A 3B1TA 1E4WH 2OXHB 2O1AA 4I85A 3EGDB 2IGFL 4LASL 3ESUF 3QPQC 4PG2C 5DLML 2AJXL 4L3AA 1LYQA 3F12A 1ZT7A 2C9XA 1HESA 1FORL 4QY8A 2Z35A 3CDZA 5FHAL 1RSYA 5K5YA 4L4TB 5B39A 1QSZA 5ID0A 3V5HB 4H1LG 4IDJH 3UBGA 4XNDA 5A2BA 5EOTB 4K3JH 3CLEL 2WQ8A 4L3FA 4G6MH 1DO5A 3S88H 1MCCA 2JELH 4HIXH 4GG6E 2R88A 4U1HB 1WITA 5JUEL 4PJEA 5H4ZA 3LNHA 5FAAA 4MD5B 3EJYD 4IM8A 4ANVA 4P57A 4B9PA 1X5GA 2XA8H 1UHVA 4NQSA 4NQQA 1MN4A 2R4SL 2CIKA 1RHHA 1PYWB 2FLBT 3CU7A 5A2KH 2OMNA 1WAEA 1RU9H 1B9ZA 3ZUNC 4OGYH 3UAQA 2PXYA 4X9BA 3KCPA 2WKLA 1JWSB 5KVDH 4IMKC 3LPPA 3TTYA 2W60B 1CFBA 1G7PA 3GLDA 1IGTB 1VPOL 3PJSB 1BYOA 4FI6A 4ZS6C 5GGTA 1RZJC 1VFAB 1O6TA 4EN3D 1LJMA 4Y5YC 1L9PA 1P69B 1NCJA 3WSQH 4EQ2A 2ZCHH 1ESOA 2Y1YA 1GY2A 3LEXB 3NYKA 5GHWL 4C56E 3QFJE 3TN0A 1A9BB 3TP4A 1YN7A 3RVXD 2P26A 2EEDA 3U0TB 4TLSA 1RUAL 1MCOL 1UKTA 1CZ8L 4P2OB 4N2DA 2WOBA 4NQCA 2IPUG 2X5PA 5I1HL 5BRQA 4MA1C 3QUXA 4LLWA 3O3DA 1KG0B 1AD0A 1QA9A 1U8OA 4N68A 5E1GA 4AVIA 3QCUH 5H37G 1C5BH 4PTTB 4FQHA 3BKJL 1VJSA 4Y1AE 3FT2B 3HMWH 2W59A 4GRMA 4RNRB 1FL5B 4TQIA 2QQNH 3RWEA 3K19A 4G5ZL 3L3JB 1LO3H 4GFXA 5IW6B 1MHHA 4IW4C 2G60L 3HPJB 3K46A 3POQA 4NKDA 1ZKAA 2B1HH 3QDMB 3AY2A 2GEQA 4EI5D 2WBJB 3W3BA 2XZAL 1FGNH 4BH7A 3VTAA 4G8EA 5I5MA 2EIEA 4X4XB 4KNQA 1TVBB 4AFKA 2BSTB 3NJTA 2ZJSL 5E2UL 4LCVA 5JR1L 1P5UB 1VFBA 3ARFB 4P4KC 3VY9X 2J6EA 2X88A 2XTJB 4LAQL 4LU5H 5FO7A 3RWDA 1OM3H 4ZMLA 2RFXB 2ZXCA 3DPBA 1C08B 1RJZA 1U9KA 4BFNA 4KKAC 2LU3A 1MH5B 2WAQA 2X4UB 4KKQA 4M5ZH 4Q6YA 4W9CC 1KTJA 3ECQA 3UTPD 2Y1ZA 1IAKB 1HXKA 2DRUA 4IIQC 1G94A 4G2AA 3LKOA 1KC5L 1U30A 2OJ1A 3WEMA 5AOMA 3MNZB 1OAUH 3B9AA 5A3IC 1QWHA 3DIDA 5JQHC 4LGRB 3HG3A 2EIKB 4QRRE 4ZSOB 4NOFA 4ALAH 4Y2DB 3KS0J 4PH8A 3O41A 5CCKH 1KYOK 4TYUA 2VSCA 3HR5A 4YDNA 3TA3D 3QFJD 3MNDA 3PGDB 1O75A 5I1IH 2FR4A 2ITFA 1U3HB 1U4EA 1FYTB 2XBZA 2F1EA 4WHYH 3O4LB 1Q9KB 2NDGA 2BC4B 1AI1H 2IPTH 1PNDA 5ICYA 1BJMA 2LT9A 1G6RA 2BRRL 2CZNA 1IGMH 1H3GA 5HPOA 2QSQA 1FAKT 1PL3A 1THAA 2G4GA 3L9EA 4U6HA 2VXQH 2PTUA 5GGSA 1OOAA 4AZ8A 4J3WA 1D5XB 3PL6A 3DETD 3IVKA 4POUB 5K1NA 3TH2T 4DT2A 4ZMTA 4G9FE 2HKAA 4XC3H 3ZL4H 1INDH 4NRYB 5HY9A 4PVMA 4F24A 3VD7A 1I85C 2JJTA 4H0IA 5F0JB 1WWBX 1XGYL 1BT9A 1P84K 2C3WA 3HHRB 4YDZA 5JQIB 2KYIA 1UFUA 3WI5A 5A6LA 5I82A 3L5XH 1JWUB 4G7YH 4K3DH 2HRHA 2Y69B 2J6WA 3VCLA 1ZDSA 2XJLA 3NTCH 4AKMA 3DUUB 3MRKB 3OHXA 5BVPH 3JWNG 1JZ3A 3D2TA 1BV8A 4JREC 3V0AC 5EC1A 1AOZA 2CBQA 5EA0L 1IKFH 1CDGA 3SGDH 1XGQA 4RFEB 2JIXD 3JQOB 1KXHA 1JPGA 4ENZA 3BWUC 1F1AA 5CILH 2O5XH 3SB3A 2RALA 3B6SA 4MDJA 3WFBL 1DN2A 3WL9B 3EDJA 2KPWA 4WFFE 4QRRD 1KIUB 4U0RC 1D6EA 1QI3A 1XGPA 1L7TL 5JYLA 3KL3A 2OMBA 3IK2A 3D9AH 3IDXH 2CHZA 2G0LA 4NQXA 5A2JH 1ZJBA 2AJYL 2ZUUA 3QUMH 4PWIA 4R4ND 3TBVB 3L4UA 5FEBA 4HA1A 3RY5A 3ZZSA 3FUFA 4GCQA 1NGYB 4JFFA 5E4AA 1QLEB 4P3CH 4ELME 3CZKA 2D9QB 3GLZA 3ZT6A 3O0LA 3S2CA 2IH3B 1LD9B 1OE1A 5J1TC 5FA3B 2ZFGA 2P1YA 3EUUA 5F7YC 1DHKA 4EKJA 1H8OA 1JXDA 2HRPL 3SBQA 1FCCA 1PIGA 2VXUH 2AQ3A 1DANU 3RL2A 5KAFO 4FJZA 2YARA 3BGMA 1R19A 3FU5A 3GPEA 3FTSA 1E9QB 4AQ1C 1RIUH 25C8L 4ZMQA 2PYEB 4ZYKB 1GIGL 2IVFC 2WB1A 4OCSH 4YXLL 4KTEL 2OW7A 4B9JA 5I19H 5IOKA 7PRNA 2FQEA 1E5YA 4HYTB 4LPWA 1P1ZA 3D39D 2DQDH 3SE6A 4Y16D 4TNEA 3IGLA 4YXHH 4NEHB 1UATA 4X6BB 4ZFFB 5F21B 4UANA 3EHBC 3S5LG 5DMIH 3PDDA 2VUOA 3IPEA 5CGMA 3U48A 2X4RB 4UZUA 3MFFA 5JPMC 1IQWH 3QHZL 4OBRA 5L4JA 5F7EL 4I1NB 4HX1A 5FGCE 1F4YL 4U31A 5CHNB 5K9KA 2AV7B 3FTWA 1KJ2H 1N4XL 5EBMA 4Y19A 5EO1B 1KWGA 1R5VB 3AXHA 3BW9A 3FFOA 3SO3B 2ICEC 2YLHA 3B5HA 3GMMB 2WBKA 4TPRL 5IMOB 2BIPA 1WIPA 2YGQA 1CC3A 1MCJA 2FX8H 4ABWA 4HISA 4J4PD 3L5WB 2XETA 4ANXA 1H5BA 3MTRA 2NXZD 3II3A 2CALA 3MODH 4ICXA 1OP5H 5H94A 3OGOE 4DGVH 3BQUA 4PS7A 3A21A 2JH2A 4DZ8A 1M56B 4HUKB 4UMSA 2W81C 3FYEB 4OCXL 3RNQA 3V0FA 1JOIA 3T0EC 5EZJA 3KBPA 5FYJH 1FO0A 1D5ZA 1CG9B 1QI5A 1U0QA 5FYLL 1AIFB 2P44B 3PPEA 1JGEB 3C9NB 4ZZFA 2IGLA 4LVOB 4Z77B 1NIDA 1A6ZB 2WXJA 5EH1A 3QI9D 4GXUM 2AAVA 4FI7A 3A4AA 2FX9H 4UILL 4XNMA 2I25N 1ETJA 2FH8A 1RIHL 2BNRA 1MFBH 3MUGA 2Z1PA 1D7CA 3LB6C 1OT4A 2UUDK 4RWHA 4H26B 1A9EB 3AA7B 2P5EB 5ADXK 3F5WB 4U1SA 1SUJA 4HWEL 5JXEA 4C4VA 3RWCB 3Q43A 3V4PH 3L95B 4J6RL 1H8LA 2AXFB 2PW2B 4WJ5A 4TOYH 3CFMA 2XE3A 1JXKA 3I75A 1IQDA 2ZF9A 2AXGB 5AD0B 5E08L 2XN9B 3QC6X 1EHXA 1OGAD 4XMKL 1EMTL 1MAJA 1MFEH 3PDOA 4N90E 5AW2B 4S1SL 2A9MH 4OAWB 1BVKA 4QXWA 2C5DC 3DSNB 5FYLD 2Y5TB 3LY6A 3NFPB 2BRQA 2KBGA 3P0YH 2C9QA 5AZEL 3BCFA 3DV4B 5D7LE 1I1YB 4DPAX 4XBEH 3DJZA 3MV9E 4NN5C 1TFHA 2JKXA 1GKOA 1RVFL 1MIML 4KVNH 1MCRA 1TQTA 2DL9A 2YGOA 4ODSL 4LRNL 5FM5O 4HUCA 2YXWA 4OBSA 3CVDA 3K5RA 1A5FH 1NPJA 3BPOC 1YYLL 3D3VA 4F8OA 4E9TA 3VDBA 1R9FA 5CR8A 2JXMA 3RGVB 4WTWA 4JR9L 1NANH 4JFYB 1ZD6A 2DBJA 3HPLB 4PJHB 4JRLA 4X0KB 5JPNB 5LAPA 4Z3HA 4OSUL 1M7IA 1EZLA 5BS0E 2ADJA 4YHKH 2ZQKA 5MHSE 1ADQL 3AU1B 4FESA 1P7KB 4KDTA 4LFHD 2R7EB 3CDGB 3EH1A 1JZGA 2BPBA 4ZNEE 2NUTB 2X27X 2D7OA 4FL4C 1Q38A 2Z7UA 3OJVC 4O51A 5FWRA 5JHLA 1JHKL 2N4IA 2YPLB 4CVZA 2WWNA 4PRHA 3D30A 3STLA 4GFTB 1YUKB 1KGCE 1MNUL 3L1OL 1DLHB 1UJTA 3IDGB 1SJHA 4V1DA 4H40A 4RISL 5E70A 1MCLA 4JM4H 5DJDB 1LWRA 4MCYA 2UXFA 4HOMA 4NO3B 2PLTA 3BE1L 2AEQH 2YSSA 1G7HA 4KXCA 1E6OL 2JB6B 5IMMB 1R5IB 3DXAB 1HXYB 3ELQA 1QLRA 3FUDA 3NQKA 2CHWA 1DJHA 5HDOA 3GKWH 3UDWC 5CJQL 4CSTA 3QYMA 3SKMB 2NY6D 4YSEA 3ENEA 5JW3H 4JVPA 1A66A 4ZMNA 5IBLC 1HXMB 4EF3A 3VRJA 5E8PA 2HWZL 5TFSL 4CC0A 2C9AA 5LGKA 2J72A 3UJIL 4IRSB 4U6VH 2F53A 1UXLA 2QKIB 3F7QA 4NT6B 4GXVH 5KSBA 4IGBD 1KJVA 4HWBA 3V6OC 3D2UB 3SJVB 1EANA 1KXVC 3INUL 1FFNA 3UZEC 4OW6A 3X17A 3KGTA 3SN6N 3DURB 5JIHA 3UZQB 3EOYG 4XNZC 1BQRA 1JNLL 2R8AA 2XQYA 2YD0A 5L9DL 4F2MA 5J89A 4A2MA 4QOKE 3PHQB 1HZHL 4FQ1H 3VRIA 3UTSE 5AFUL 3SDDB 1BQUA 1EO7A 3GBML 2QQKL 15C8L 3NK4A 4AEIH 3VW3H 3B1UA 3FZUD 2CLVB 2J1YA 1T1XB 3L2NA 3KG5A 1T66D 1IC5L 5FOBA 3SDAA 3FOMA 4GW1B 4PGDA 4TVSa 5A3ID 3S8GB 2CR0A 3BN9D 5AOJA 3EDEA 4D8PB 4OZHE 2H4EA 3SYAA 1EH9A 4M5YL 4I7ZC 4KWUA 4DKTA 3WGVB 4MA7H 4Z95H 3L9YA 4UM9D 5FV2A 3G5VA 2GAZB 2BSCA 4U4BA 3GI8L 2BP0B 5DDHA 3REVB 2ODJA 2D8KA 4D2NA 1A6VL 1G6RH 2CO6B 1F4XH 4PY8I 4UIMA 5EFIB 3EUDA 1O5DT 5I1CL 1QOKA 1RPQA 1UWGH 5DVPA 2O5ZH 3GSNH 3QUZD 5E6ZA 4HJSA 5F0LB 3BH8B 4QYAA 3BGFB 3OKKB 4JFEB 4JLRB 1JXGA 5E4EB 1HHGB 1N18A 3TNMB 5L4MA 1AXSB 1FG9C 2EXYC 4QXUL 1E43A 3CHOA 1OCZB 2DQHL 4RWYH 2R27A 5DR5L 4P23D 1A4AA 2OJEA 1XCQB 3H9HB 1L9SA 4LL1A 1B88A 2WWKO 2WHVA 3HE6D 5KVGH 4PJFB 1HI6B 1HS6A 4ALAC 3B9KB 3J7HA 4YE0A 1JGLL 2A9CA 1KTDB 5H37H 4AC2A 1C8QA 2OZ4H 1QPXA 4FAAB 2B15A 2VDQH 5FGSA 1DBJH 1P1VA 2CLZA 2ZAIA 4NXSA 3DROA 4HHGA 4PGCA 1FL3A 1P4IH 3PWVA 1HH6B 3QBTB 5JNYB 3MZTA 5EUOB 1JZ5A 2NLJB 2VO8A 3G6AB 3B2XA 4GAYA 1CBVL 1KB5B 1U91A 2F1TA 3RWIB 2H8PB 3CXFA 2XLLA 2GC4C 1ONQA 3C5ZD 1L9TA 5IBUB 3QEQE 3SDDD 3VXSB 1T22A 4KPHL 4LPTA 2IPKA 2DWYA 1U3ZA 3GMLB 5IVXB 2WXGA 5EU5A 3LV3B 4LSTL 2R0ZL 4LNRA 5C0BB 4PY7B 3F83A 5A7BA 4MASA 3UGXA 3MROA 1HEZB 3KCWA 5DURB 6TAAA 4LKCA 1I8IA 3IB4A 2X9YA 4LQFH 4XC1L 2WN2A 4Z7UB 4FG0A 1Q1PA 1YMME 1KF9B 3SOTA 4X83A 2YHGA 4XZ4A 3TWCL 2YD2A 3Q5TA 1ASOA 1Y1UA 2BIIA 5E0FA 1JNNH 3V6FB 2R51A 5LBGA 3A67L 4XCNA 3ZKXB 1WZLA 2GJ6B 3HS0A 5EU6E 1AR1D 4MWFB 1GGUA 3SDXA 4R26H 3GZQA 5C86A 4OCYL 3SE8L 3VXTA 4K8RH 4APQB 1YEJL 1MCHA 2R1YB 4XH2B 3AUVA 2NCEA 3QA3B 2CDFB 3QIUB 4G43B 4YC2B 4AENA 1LE9B 3BVTA 2QSTA 2NY0C 5GS0H 1I1RA 1ZTXE 4UOZA 4BH8B 4QRQA 4QCIB 1NGWA 2WWMD 4PB0L 5F9AC 1XIWD 3T0EE 1ORSA 4S1QH 2OV0A 3E6FA 3MV7A 5B8CC 4JRYA 5ITBL 1UH2A 1YEIL 2FJHA 3ARGC 3VXRE 5C0JB 2ITCB 3THML 1ZLEA 2F8VA 4Y7OC 5AFAA 1U8NB 2HT2C 3AB0C 5HI4D 2ZCKL 4GBXA 5ESQB 2WVVA 2HTKC 3SDCA 4F7EA 3QG7H 3E8UL 4D3CL 1NDMA 2OPCA 1OPGH 4HIHA 4N0UE 3AQDA 3VG9B 3ZDXB 3S9DB 3FPXA 5LKNA 3RU8H 3S3JA 4MGXA 1MHCB 5FDWA 5IGXH 4BSVB 3LOWA 3EH2A 3BDYL 4JM2C 5IMKB 2CUIA 4KDWA 4NNPL 1MLBA 3AA1B 2OMZB 1N70A 1KYAA 1JDCA 4OIAA 3QUYA 3VDCA 1JGUL 4NLAA 5B38B 1AZNA 4B5ZA 2PR4L 4I18A 1QABA 1JZEA 3AU0A 2KZBA 2JKTM 3MMEB 4N0RA 3VJ6B 4FERA 3LEYH 2OK0H 1AXTL 1A64A 4IS6B 4K7PY 4DQAA 5I1GH 4D64A 1NCUA 3JWNH 5D1XD 1KUMA 3DPDA 1T1WB 3KWUA 5C1MB 1MXDA 5DD0H 1T89C 2QADC 3EYUH 3G04A 4RX4A 1S7QA 5JHDD 4DEPB 3MLZH 4M7JL 3KPRA 4CGUB 1D5BA 4LSHA 1FLRH 4U1KB 5TQ2L 4OCWH 4ZX3A 1S8DB 3MUHL 3P4MB 2JJWA 2NY3B 1NINA 3VSVA 4TRPL 5JDSA 3QEUB 4MNQA 3ARDB 2XWJA 5EZLB 3RIAF 4H8HA 3WKNA 4H8QA 4Z7OF 2GCYB 4GO9A 3QGVA 1HILB 3RUGB 1U36A 2F9BT 4P2AA 4AV0A 1DCLA 2ZWKA 2Z92B 2ZWZA 5GGRY 5CF3A 2VXSH 3ARYA 5HYSA 4GMSL 1COBA 4Y4FD 2J21A 4GQ9H 3BD4A 4N8VA 2NYKA 1H19A 2YEVB 2GKIA 3U9WA 2V5MA 5HXMA 3WDHA 4NQUA 3RJDA 4HZAA 4FXKB 4YHPA 1DTUA 4GRWF 1EVTC 1MVUA 2GE4A 3TIDA 2JI2A 1G7QA 4IKIA 3VXRD 1F8TH 3DIVA 4A2FA 4TUUA 4CA4A 3ESPA 1P7QD 4PS3A 4NC2B 3V0WH 3M6DA 1TJIL 2NW2A 1T1LA 3LQAL 5F8QC 1AJ7L 3UO1L 4KK5D 4DAGL 2FJGA 5I8CB 1ZLUH 3WO4C 1TITA 3QFDB 4QD2E 3P11H 1JTPA 1AP2B 2H1PL 1QVOB 2IOMA 3IGAA 3X3FH 2OYMA 5DC4B 4G6JH 4LVHB 1ACCA 1HSAB 2CLRA 1BBJB 1PDKA 3DX7B 3G5ZB 2VLKB 2X87A 2ALWA 1TQCC 3C60A 5MEND 2EDWA 3AM8C 3O4OB 2WYTA 5T3ZH 1JPFB 3GJFK 4XNUH 4MVBC 3WFDH 5I2IA 4GIAA 5F7AA 4R97B 1DFXA 4WHTA 4N2CA 3WTXA 1UD4A 4ISVB 5D1ZA 4OFYA 3KLKA 4A04A 4K3JL 1IGJA 4G6ML 3KPSA 2JELL 4HIXL 4KHTL 5DWUH 4KFMA 1GS8A 4ZPTB 3QUKB 4ZFGH 1HYSC 1CDYA 2QGEA 4Y4HC 1BXVA 3QIBD 5ENWA 3KH4A 3MRNA 4P5SA 1FP5A 4PN6A 4BFIA 5J7CC 4Z7QB 4I2XE 4JGJA 4QPEA 1DQML 1G7LB 2V9TA 2YQBA 2FNBA 2EIZB 3W9DA 2VYRE 3K0WA 2DYPD 4JANA 4OF3A 5HHQB 5HYQB 1RU9L 3QIWB 2FD6H 3FK3A 4OGYL 4G8FB 3IGFA 3BJ91 5KVDL 4IJ3B 3EO0B 1XF1A 4JRXE 4ODBD 4UAOB 2R2EA 4DUVA 3WEOA 3OMIB 4FZMA 1XB3A 1I8UA 3N5AA 4OLYH 2Z8VC 5CWSA 3WSQL 2ZUXA 3BPCB 2G75B 2Z6FA 1H8SA 2ZCHL 1M05B 2ZXEB 3ABGA 3CK0H 3D69B 4MJ4A 2P47B 5JHLH 1BP3B 2DDQH 3N1MC 2V7HA 4AIOA 2JKJA 4RZCB 4U1LA 4YMPA 5GS2H 1DQDH 2J5LB 3ATFA 3W11D 5EEUA 3REWA 5AVUB 1IAII 4GG8A 3H7BB 3LX9A 3MRBA 3RWHB 1QJ9A 1H9VA 1BXAA 4WUUE 2WQWA 3K6DA 4C83A 1U92B 4HT1H 4QT5B 1BXWA 5DMGD 3NIGE 5GRZA 3GXUB 3BP6B 3CFKA 3OSVA 3WG7B 4B5EA 4D94A 1HHKA 4XPFH 3DC0A 5D5ME 3V0IA 2BS71 5L7XL 2VR4A 3DKHA 4NZRL 3HMWL 5I8KL 4IBWA 4QO1A 4QXVA 1X44A 2QQNL 4JFTA 4LEBA 2ILLA 5AKTA 1LO3L 3KVPA 2YD5A 5KBMA 4ZNCD 4XPAL 2B1HL 5LNEA 2Y25A 4O3XB 5FKAB 3TN0C 4JFQB 5BZXA 3KZ8A 1KJ3L 3B2UC 2FYYB 2QQLL 4FFZH 1QPPA 2Q9OA 1HQRB 2VGLM 1F3JA 4ZTEA 3SE4C 1LO5B 3HOEA 3CSFA 5CIPB 3VD2A 2F1VA 2FB4H 1YY8B 1XAUA 3QUXC 5KVEE 4NAMA 4X6FB 1TQSA 5JZ7C 3QDJE 1A14H 5E8NA 4LU5L 5F3HA 1BQSA 4Y4KD 4KZ0A 1OM3L 2VLJA 2OAAA 2EDJA 1T0OA 4NQEE 4X7CC 1V10A 3SQBB 2ESVB 3QVAA 1KWKA 5CJ8A 3NIDB 1EFQA 1QAWA 3HG0A 4XMZA 2R9HC 5AFUK 4NUQA 2XA3A 3MNVB 2WXPA 5D7IE 2C8NA 4GO8A 1XGUB 4JN2A 2BZDA 2XIBA 5AOZA 1FZOA 1Q9LA 1OAUL 4M7KH 1EBAA 2H0EA 4UQ3B 4Z7VF 3LK2B 5ELIA 3WEXB 5DC2A 3U4KA 1UWFA 2V5RA 3STZA 5F7MC 5DU7A 1HCYA 4MQSB 3VFRA 4L29B 2D73A 1QFWM 4LSIA 1CYWA 5CCKL 4G82A 1JFQH 4I1PA 4D0DB 3O3BA 5HDQH 1U8CB 4MCNA 3VQ2C 3ULUC 3JBG7 4GKSA 5K39A 3OQRA 3VFGL 4UTBA 4OTXH 1NIBA 2BNQD 2VQUA 2YXVA 3ZR6A 4XZUB 3BKMH 2XYBA 3L4XA 3RGBA 1CLYH 2EINB 1AI1L 2ADGB 3L4WA 1JGDA 3FCUB 2AK4D 1DE4A 1IGML 3N1GC 4U1NB 5DEJA 3QXUA 2QGDA 5E8DH 1X9QA 4XR8C 4ZS7H 4DETA 2VXQL 5L8KB 5KYXB 3JVGA 2YD9A 3QJTB 3O81A 5I23A 3GPSA 2YWYA 2H2PD 2EXYD 3PUCA 5DZNA 3H4FA 3PQYB 3OWRA 2VDPB 1AKJD 4FQIL 5DRWB 4XC3L 2OTWB 4OUUA 1INDL 1F4HA 3ULSA 3G6JE 1A6TB 4ZW8A 2VLLA 4KKZA 1GKEA 4PJGB 3BDXA 1D3CA 2XU9A 4WI5A 3ZUCA 1I3RB 2WQVA 3GK8H 3LRGA 2A6DA 2B2XH 1IBFA 2N59A 1T16A 4G7YL 4K3DL 3ETTA 1I3GH 2R15A 1TIUA 2OXHA 3OKMB 1J8HD 2AI0H 2YA1A 3EGDA 3WIAA 5C8JB 4UOW0 1F1DA 1OCWH 1J1OH 3I9GH 2MTAA 3PGFH 3PABB 5A40E 4U49A 5BVPL 1N5AB 4MJ5B 3RGHA 3V5HA 1GS7A 1IKFL 5F7LB 3PWPB 2QV4A 4YVUA 2F7OA 5EOTA 2QTVA 2WQXA 4XMUA 4WO4C 4U1HA 2NNFA 2O5XL 4MXVF 4BD4A 2GC7C 3B7YA 4MD5A 4QRPA 3QYCA 4HBCH 2JJTC 4JCWA 4XI5D 3TS8A 4IBZA 1P4BH 3OMZA 2GITB 3C6LB 4PRIB 3VYOA 5EBGA 2X6MA 4NKQB 3N43F 3QH3B 4I3GA 4R2GB 4MNHB 1PYWA 2AEPL 5CM1A 1KFAH 3DHUA 3IDXL 4ZK8A 4EZMA 1JWSA 1X4YA 2ZYSA 3QUML 2NR6A 2PPDA 3FN9A 1NEZG 1QSFD 2NW3B 4ENED 3MRPB 1IGTA 3PJSA 3OHXC 3RDTC 1MOEA 4YWGH 4RFNB 4K5NA 1VFAA 5DMYA 1BECA 1LMIA 4IOSD 2XX0A 4RMSA 5KVFH 4MMXB 1FHGA 5D6DA 4P3CL 4JO4H 4W93A 3W81A 3PQUA 5KJRH 1A9BA 1H3PH 1B4TA 3DO7B 1J7VR 4A2LA 2OSYA 4PV9B 3U0TA 4B27A 3IBEA 2ZNXA 2NY0D 4JHVA 1N8OE 3ZQXA 1YUHB 2FATH 2XVKA 1HOEA 5HPMB 2QLYA 2RJMA 2XZZA 1KG0A 2BM3A 4LPXA 5BOJA 4LOUC 4DN3H 2AXJA 3EO9H 3MNWB 1H6UA 3MRGB 4X6CE 5IHZB 5FK9B 4DO4A 3EOBB 1RIUL 4Q9RL 4RNRA 2NCMA 1U33A 2PORA 1FL5A 1GA2A 2H1LM 4TQPA 3L3JA 4JDVB 4OCSL 1N0LB 1BQ5A 5CZRA 3HPJA 4AKOA 4EN3B 5ABDE 2A0LD 2GFBB 2BK8A 3JT2A 3QDMA 2DQDL 4K8RC 4YHLH 5DD3H 4HSAC 3WEBA 3BWAB 3MYJB 3L3DB 2WBJA 4PLJC 3BFWA 4YXHL 4I9WE 1E0OB 2K0LA 3BS0A 4J3TA 5DMIL 4X4XA 2JKWA 2BSTA 1MCEA 3BH9B 5F6IB 2AJ3A 1P5UA 4NPKA 3ARFA 1F0LA 3ZE2E 1IQWL 3ARWA 5FYJE 1I82A 2XE1A 2G2NA 2O5NA 4OQTH 2D9CA 4P3DA 2AEIT 3JVFC 4CKVX 2RFXA 5E56A 2WLLB 1KJ2L 2MJWA 5ACZB 1C08A 1OB1B 1MQ8A 4A68A 2X4UA 3ETSA 4LCCC 1QEXA 5ISZD 1S7WA 1WP6A 4X7SH 3WNOA 4M7ZB 1XH1A 1IAKA 4QTFA 1MM4A 3TEUA 4XOCA 4HXBH 3WCYA 2WQRA 1CR9H 3MNZA 2KKQA 1J48A 2WZ6A 5AUMB 5IY5B 4NNXB 4EI5B 5E9DD 3H55A 4NZ8A 1FAIL 3T0AA 4ZSOA 3UERA 4DJMA 4JCLA 5JIIA 3MODL 1JF1B 5E03A 4Y2DA 4DGVL 5D93C 1VKXB 2YUWA 5D5DA 3PGDA 4M8QB 3WNLA 2X9WA 1U3HA 3IRCA 1FYTA 3PS6A 2CRMA 2XNAB 5F72S 1H6TA 5IHLB 4MX7B 3S35L 3FHEA 3O4LA 1Q9KA 2J56A 1GZPB 1KIPB 1HVXA 2BC4A 5A2AA 3ZSSA 4AY0A 4PJEE 1XD1A 2VDOL 1EXUB 2G2RB 4AIZB 5B7MA 3ZLQC 4Z7NF 4URKA 1XXDC 4JEGB 4XTRC 4XHJC 4GKZB 4PJDF 1D5XA 3T04D 2FX9L 3OL2A 4BCZA 1H5BC 4X9GA 4YHYB 4RJWA 3EBIA 1GMIA 3P1VA 2Z1KA 5E23A 1KGWA 3AT8A 1NWOA 3QYNA 4IBUA 1ACYH 1USZA 2YKLL 2E86A 4PU2A 4NRYA 3EFDH 3FUHA 3LAFA 3BQUC 4OCLC 3UAJC 3NSGA 3OPZH 4HK0B 3TA3B 3DJSA 4G83A 3D6GA 2CBOA 3V4PL 5TH2B 4OIBA 5IREA 3HR6A 1EV2E 2B7DT 1SPDA 2DOCA 4TOYL 2ADYA 1UB5B 3BOVA 4U4IA 5SWZD 3SKUD 1JPSH 5DEGA 2EUWA 5I73B 5DMKB 2VE6B 1LP9B 3CN2A 2Y7LA 4WSKA 5AVYB 4KI5F 3FAXA 5IB5B 5T1DH 1MFEL 3MRKA 5I0YA 3K4AA 5FLUA 2HMIC 2A9ML 4NQCE 1ZIBA 1EJ6A 1QBBA 1LMKA 4N5EC 2MKLC 4XE0A 1VZGA 4RFEA 5E2VH 1U8LB 2CHDA 3P0YL 3LHPH 3FF7A 4OFPA 4IOIB 4XBEL 5HJGA 3SO5A 1U8JB 1E7VA 4PBVC 3SPCA 1LGVA 4KVNL 1HZKA 1BFSA 3IFOB 4U1JB 2O6FA 2GYSA 3WL9A 4WFEE 5I17B 1V5JA 5E6SB 2FO4B 1A5FL 2CKBH 1KIUA 2YAPA 5ITFB 2J8UF 3R06B 3LCYA 4KK8C 3E0GA 5E2WH 4NYLB 1MQKH 4UNVA 3UTZB 1T6BX 1KYUA 4YHKL 2QTKA 2V33A 3P54A 1PU0A 2WXOA 3HLKA 4OZGB 4JY4B 1NGYA 2HG5B 4FNUA 3ZDYB 1OTTC 3S4SB 1SXCA 2JIXB 4NC1C 3P69A 1S7SB 3ULUE 4IKKA 2FDBP 3DX8B 3TWYA 2A73B 2X2IA 3GDBA 2IH3A 1LD9A 3PPSA 5FA3A 5GSVB 4JM4L 4X8XA 4KRAA 1BREA 2AEQL 2DM3A 4OZFG 1KGXA 3NPSB 4WW2B 4QRRB 5AAPA 4K71C 3OF6D 4FE9A 3QCTH 2WLNA 4C69X 4WK2B 1E9QA 1Z32X 2IDTA 3GKWL 4Q8BA 5F7FA 3ARED 4OD2B 4PHZA 5JW3L 3GBEA 2PYEA 3AUWB 4Q7DA 1NCHA 2B20A 1BXXA 4KDTC 4TLUA 2HFGL 5DUPH 1NLBH 4M93C 4DGUA 3LS4H 4FT6A 3DV6B 5F3BB 3QZOA 4HAFA 4R4BB 3AQXA 4NUMA 4A7UA 3LRHA 4U6VL 3B2UD 4M02A 1I7TB 1FFQA 4KJWD 4GXVL 1OARH 1R17A 4PJ7B 2X44D 4X6BA 4ZFFA 5BJTB 2I26N 2HG0A 5TJWK 5FLVA 2P46B 2XWRA 1XCWA 3MGOB 4XNAA 2Q5BA 4S0HA 3SHSA 5LLIC 1AY1H 4LSPH 4Z6AT 4PGJA 5DK2B 2X4RA 3MOAH 4MA3B 3BSHA 3GRBA 1XGTB 3QQ4B 2XQ0A 4XOAA 1KCBA 5HHNB 1J9CT 5CHNA 4FQ1L 2AV7A 2R8SH 4G70B 5EO1A 1A4KB 2OA9A 1R5VA 1D9KC 2HFEB 3AROA 4X99A 5IMOA 3GMMA 4AEIL 1ZT4B 4BQCA 4YSSA 4YX2H 3VW3L 2YD3A 4E5XB 1KXQA 4B7IA 2JJUA 3B43A 5D7KE 1HWHB 3FSWA 4HIPA 3D39B 2JQMA 3AS3A 3L5WA 3QZBA 1U3NA 3K2KA 4Y16B 3UPCA 1IM3D 4Y2NA 4MA7L 4Z95L 4TUJB 5G4NA 4NBYB 3MGAA 1AO7A 3N42F 5HVGB 1T4KB 2BHYA 1WT5A 5EOCJ 2WC7A 4JKMA 4C4BA 1WH0A 2XG5B 3COOA 2XN1A 3EBHA 5AVWB 2R56H 2B3RA 4GCSA 1YY9C 1YDPA 5DJXB 3WN6A 2PETA 2XOTA 2O5ZL 3GSNL 1CG9A 1AIFA 5HSFA 1O9ZA 1JGEA 3C9NA 4Z77A 2WJ5A 1A6ZA 2AP2A 2VN3A 4RWYL 5B1CA 2MMXA 3SDAC 4ES8A 1MJ8H 3AW5A 2E7LA 3VACA 5I8OH 3GZKA 1SJMA 4HJJH 4X4ZA 1W0YT 1JVOA 1JCKA 5BV7H 1F1GA 2ZOOA 3N50A 2DIEA 4WEBH 1YECL 5DC0A 5KVGL 1QNZH 3QSKB 4MBRA 4OCNC 3Q9QA 4H26A 1A9EA 4PP1C 1E90A 3AA7A 2ZNWA 3SODB 2MNUA 2E76C 3F5WA 5MEQB 3ZHFA 2OZ4L 4MZ3A 2P52A 4ZUVB 4YJZL 4AE1A 3RWCA 3VM5A 4ANKA 1DBJL 3L95A 4EKXA 3DVFA 1P4IL 1KPUB 1KTCA 2AQNA 2PW2A 3VSTA 1RUQH 3SIKA 3LKQB 3S34L 4O3ZA 4JFFE 4UNIA 2R2BA 5AD0A 2AXGA 4HC1A 2F0CA 4TSCH 1GY1A 3UG3A 4OM0H 4EQ3A 4BHUI 1FC1A 2FHFA 3QI9B 3QZMA 4OAWA 4XPGH 3TBSB 1KYOJ 3DSNA 2Y5TA 4U7MA 4E41D 3NFPA 3DMMC 3FUIA 3DV4A 3NJMA 1I1YA 1QBLL 4DP4X 3RILA 3PHOB 4MAYD 1ETA1 2A9BA 4LQFL 3F85A 4NO0B 4KITB 2CDEB 4HS6B 1OAJA 4EI6B 1JNNL 2XIIA 4GCPA 4KO9A 3LJ3A 3RGVA 3L3GB 4H20L 3IFPB 2Y7QB 4GIOA 3U30C 4E36A 3BD5A 3HPLA 4R26L 4X0KA 1UZGA 2L7UA 2Z93B 4PEEA 3RDTD 1OGAB 1P6AB 4AOFA 3AU1A 1P7KA 5T5FA 2R7EA 3CDGA 2NUTA 5F6HI 5GS0L 1V54B 2O6EA 2BCKB 3CQFA 3MLPA 1T3FB 3RBHA 1BOYA 1NC2D 1P84J 4JE4B 2XPYA 2YPLA 4DGWC 5I1DB 2XI9A 2XVBA 5JQ6H 1CLOH 1BQKA 1DLHA 1SUHA 1XEUA 3IDGA 2JV6A 4A67A 3T6WA 2M06A 5DJDA 3APNA 4QTIL 3CFIC 4NO3A 2ZWYA 3IS0X 5IWLA 1HYRC 3BC9A 1OE2A 5IMMA 1R5IA 3A6BH 5DZVA 2ADFH 3QULB 4DCQB 3DXAA 4ODHH 1HXYA 4XVTH 2WLKA 4Y0GA 3L3HB 2DTMH 1R6VA 3QG7L 2JJSA 4R84A 4AKQA 1IE5A 3SKMA 2CUAA 1X5FA 1MJ7H 1G7MB 4GAJL 1OPGL 3FFDB 1HXMA 5M95B 1IKOP 4EN2A 1DJGA 2H1XA 4HUMB 4K8RD 4XHQA 5IGXL 3HJEA 3MLTB 3FSZA 3H0TB 4IRSA 4N26A 4PLJD 1WF5A 3C2SA 4LLDB 3KWTA 2QKIA 4BIKA 4NT6A 2B59B 3MJWA 4WKXA 3UACA 5GS0D 3D2UA 3I50L 5F96L 3SJVA 4NI3A 4UV7H 2NSMA 3KYKH 1A7PH 5D71H 5FFOA 4QJ4B 4WUKH 1LQBC 1RK1B 5I75B 3NSFA 3DURA 2DWDB 4A7QA 5FO9B 1YEEL 3LEYL 3QPXL 4FN0A 5DFAA 5GGQH 3UZQA 1HE7A 2OK0L 2F54E 1ILSA 3MJGX 4GBXC 3LPWA 3PHQA 2X4QB 4F33B 3SDDA 2MQCA 2BNRE 2R1WB 2XFXB 3MLZL 4W9EC 2LTQC 4EOWH 2NY6B 1OF0A 1FLRL 2CLVA 3AXLB 1T1XA 1HIML 3AITA 3QRLA 1MAMH 4GW1A 2DYSB 2KPNA 4JPWL 3HNTL 1OCRB 3KXFD 1OGPA 4PRBB 4D8PA 1QD0A 2A6IB 3DX4A 3GIVB 2OCFD 1Q72H 3GIZH 3O45B 1NGXB 2YAMA 3T5WA 3DI3B 3QUYC 3VI4F 2GT9B 2DKUA 1ET7A 2MPAH 2GAZA 3HMXH 3NEEA 4IGBB 2WXRA 4GIPD 1ZY9A 3VH8B 4I18C 1OVZA 5T3ZE 3I02B 2BP0A 4KKNA 3HNVH 3REVA 5E8EB 1G9NL 3C6SB 4U3XA 1MHEB 3LXBA 4XBMA 4GQ9L 3HTLX 3GSOB 2FECI 4M48L 3HZYB 3NUKA 4AJ0A 2QQQA 2CO6A 5EFIA 1Z9SB 3ATBA 2ALAA 4P2QD 2NOYA 4R4FH 3VI3B 1F8TL 3BH8A 4JLRA 1T2QH 1J12A 1BCIA 3CN1A 4JFEA 1HHGA 3LN5B 4NC1E 4OF7A 4QRFA 3TNMA 1AXSA 3V0WL 5IB1B 3KWVA 2DZEA 4P06A 4XTRD 4XCCH 4BRVA 2EXTA 1XCQA 5F9DC 4ORGB 3R0NA 3H9HA 2K45A 1NBYB 3LZLA 1FBIL 3D3VE 3T8MA 3X3FL 5KYUB 5HI5C 1UM4H 4X9YA 3WIHL 4G6JL 1HI6A 4PJFA 3B9KA 1PS3A 1QI4A 2FRGP 4UM9B 4X5WB 4BEIA 3MXWL 1KTDA 2E9JA 4EJ1C 1Z9PA 4M00A 3QJQB 4RZKA 1N3NB 4KC3B 4XNUL 4JB9H 3NG5A 2DJ4A 3D06A 4H0LC 2F8XC 3WFDL 2FYVA 1HH6A 5DYFA 1R3JB 2CIIB 5JNYA 5EUOA 3EJZD 1DJYA 2NQ3A 4WO0A 2NLJA 4JKPH 4RSVA 3BPLC 1KB5A 3QUZB 1NFDF 4HJTA 3RWIA 4TXVB 3VG0L 2H8PA 4X98B 4PRHE 4G8AC 1XZ0B 5DWUL 5HDBF 4XNQA 2F54D 1BF5A 4FOMA 5I0DA 2AC0A 3CWGA 4ZFGL 4QYOB 1XVSA 4V1DE 4Q97A 2WUBH 3VXSA 4P23B 4I0CC 3SPIA 3T08A 1DVUA 1MEXH 4AE0A 3GMLA 1TSHA 3CFEB 1P9MC 4FRWA 1WAAF 1CDUA 3LV3A 4O4YH 3V95A 3ZTEA 5C0BA 4PY7A 1WG3A 3RTQC 3EYSH 2FT7A 4GPVA 1GJUA 1BWWA 1HEZA 3HE6B 3QS2A 4J3VA 2EYTB 4FA8A 1OTSD 1M2OA 4N4YB 3C60C 4S2SB 3TPUB 3KEDA 2P3YA 3V4LA 2DEWX 2WK2A 3H54A 2V3DA 3V6FA 2IEPA 4M6OL 3RTLA 2EYRB 5K1VA 4U3HA 1Z6JT 4YHMH 1QP1A 2GJ6A 3HB3D 3HI5H 4LBEB 3HN5A 4MWFA 4OLYL 5D1ZC 1FC2D 1S3KL 1YEWA 3MJ8B 3HUJB 2F53E 3CK0L 3VU2A 1BEYH 1KT2B 2X2HA 2DDQL 1TYRA 4PJAB 4HSQA 4APQA 1FUNA 1PCXA 3QXVA 4C59B 5KSBE 2R1YA 4XH2A 1I31A 3NVQA 2Y0SA 3C5ZB 3QA3A 1DQDL 2CDFA 3QIUA 4G43A 4WWNA 1LE9A 3ZK0A 1KGIA 2CXGA 2PKDA 4BH8A 4FABH 2ZD0A 4QCIA 2XPZA 3K4DA 1PIFA 3HC4L 4OT1H 2BW4A 3WKYA 4F2ME 4XPFL 4K0OA 1PKQB 4Z9KB 2EUVA 1T04A 1CIDA 1HU8A 4WGWB 1PEZA 1CWVA 5E2TH 2YQGA 4JAMB 4GT7A 5C0JA 4BXSV 2BXZA 2ITCA 4H25B 4UF7C 3BVNB 3AQZA 2MIZA 1U8NA 1VFUA 3U7YH 4HULB 5T33H 2VMJA 4HH8A 7PCYA 2Y2WA 5ESQA 1AR1B 2YQ2A 4ZRGA 4A39A 1KULA 5I15H 2WXIA 4ZTOH 5HI3D 1JGIA 2EQDA 4UT9L 3U6XS 3M88A 2BVUA 4FFZL 3Q2CA 4BHUA 4F20A 4J2QA 1WEJL 1E65A 1I3UA 4LCUB 1OSMA 5AW0B 4ZAKD 4DOHB 1MHCA 2KLSA 4BSVA 3BLBA 1U3YA 5IMKA 3K2MC 5GS2D 2WSDA 1XIWB 3PP3K 3AA1A 2OMZA 2R69H 1A14L 1X4XA 2QDWA 5CZXD 4AGOA 4JQXA 5B38A 3S98A 3FUMA 3Q1EA 4ODWB 4OR1A 4GQPH 1MCPH 4B95C 4GEJA 4Y5XC 1HJBC 3VJ6A 1F3DH 4N2LA 5CEZH 4F5CA 4IS6A 2VIRB 2M07A 2I32A 1JZ6A 3J07A 4GF4A 3WLBB 1T1WA 3CFCH 3D4GA 1IC4H 2MHLA 2VRAA 2CGRH 2YMOA 4IRZH 3TO2B 4Z7WB 5B3SB 1LDPH 4LLQB 2M83A 4M6AA 1GYCA 2A9NH 1DUYB 1XF4B 4U1KA 3VX0A 3NFSH 5L6YH 2Y7OA 3U0WH 1S8DA 1HEHC 3P4MA 6FABH 4FMSA 2X2UA 1A22B 2ADIB 3QEUA 1E28A 3ARDA 3GD1C 3HNSH 5EZLA 4ATWA 1JFQL 2GCYA 5HDQL 1HILA 2CSPA 4WEEA 3RUGA 3WFHB 2ZG1A 1CXIA 5J1SC 2Z92A 4OTXL 5HHOE 4WNSA 2AXTO 3KJ4B 4YNYB 3BKML 2WNKA 1J0HA 3E1ZA 3TT3H 5BPPA 1MWAL 1KCKA 1SOQA 5GGRB 2DQEH 1TZIB 1ZS8B 4FKKA 2JKSA 3US9A 5HYFA 2RHEA 3JSSA 4XVOA 4Z3EA 2WZ5A 3CFNA 4ZS7L 4FXKA 2Q6WB 4Y5VB 3L4ZA 1BVZA 1DANT 2Z4QB 4NKOA 5D1XB 3FQRB 5CBAB 3DSFH 5A7EA 5JHDB 2A74A 3E7JA 4X4KA 1GGBH 3FT3B 4X0NA 4OZ4B 5JDPA 2ZOLB 4ZW6A 1FYHB 4PRPD 3MZGB 3QXDB 1RUPH 1CICD 3HZKB 1JDAA 2IPUK 1QLFB 2VN6A 4N8CH 4V33A 5I8CA 3CHPA 1ECZA 2NZ9C 3QFDA 5C7ZA 5KEZA 1AP2A 3SPGA 1XF2B 1QVOA 4UTCA 3QAZC 5GZOD 3K2UH 1YSOA 4OZFH 4AI7A 4CILA 1QFHA 2B2XL 1UACL 1HSAA 1BBJA 3DX7A 3G5ZA 5T8IA 2VLKA 3SDXE 1I3GL 3B3IB 4WQOA 4F93B 5KS9F 4FHKA 1C9SA 2AI0L 4HCIA 1JPFA 4Y4FB 1OCWL 1J1OL 3I9GL 3PGFL 4BZ2H 1UA3A 3LTVA 1L9MA 1PHOA 1HN1A 4HEPA 5KVFE 4R0LB 3JVGC 4E0RB 4NDMB 2ITEA 3VXRB 2ZUVA 5J11C 3CHXA 1P7QB 3D52A 4ZPTA 3V4UH 3QUKA 2XXCB 2UWEE 2CJ3A 1PJ9A 3FTUA 4JPSA 5ILTH 1DBKH 1G43A 4A1RA 1RHFA 3MV7E 4HBCL 2DQGH 4JRYE 4S1DD 3DMMD 4UOQA 1P4BL 3U7WH 4BE6A 1DZ0A 1S9WA 2MTPA 5BV7C 1G7LA 4ONHB 5J13B 4KR4A 1I53A 2WXLA 3QG6B 4DK5A 1LHZA 2EIZA 2VABB 4ZFOL 5IJCC 3BLKA 3IJ9A 3V0HA 1NIFA 1KFAL 5HYQA 1QYGL 5HHQA 4GSQA 4G8FA 3VWJD 5MENB 1IRAY 4JJ5B 3QRGH 3QQ9C 4YWGL 5B22A 5E5UB 3WENA 4YZFE 1EXHA 1RFDH 3BPCA 2D2CC 2G75A 4B3EA 3HN8A 1M05A 4JO4L 3D69A 1S9XB 2IOIA 3QC5X 4PJCB 2DMHA 1N12A 3FUEA 4RZCA 2AQQA 5IYUA 3K3QA 1KTBA 3TYFB 1TCRB 2OW6A 7FABL 2FATL 3QIBB 3EDKA 1M1XB 2YC1B 3H7BA 3RWHA 3I74A 4N2MA 1NCDH 1OPOA 1U92A 3NCCB 4JPVH 1UWEH 1EGJA 3CSBA 3EYQC 1JZ8A 3QJUB 3BP6A 4WFHD 3FYIB 4LLYB 2D3JA 2P42B 4DN3L 2BVOB 2DYPB 3EO9L 4JHBA 3GSWB 4NX0A 1N9PA 4KXZI 5HGDB 5ACLA 2IG2H 4NM4H 1JV2B 3IETB 1JV5B 3UTTD 4Q58C 5DF0A 1GRWA 4FFVC 2W8CA 1KTRL 2R29A 4XRCB 3K8LA 4MNQE 4N2EA 5DD3L 1JWMB 3S96B 4YHLL 1VADB 1M3JA 4JFQA 1K4DB 2O4VA 1D5RA 3UMNA 2HPOA 2FYYA 3IS1X 1FNAA 1B0RB 1UYWH 2ISDA 3NIFB 4C4UA 1HQRA 3Q8FA 4P2OC 3V9CA 2DMKA 1LO5A 5CIPA 1SEQH 1UZ6E 1YY8A 2NY5L 4ZMAT 4ZW3A 4BGDA 4X6FA 1QACA 3PWJB 4PP2B 3ZE0B 2VZVA 2B4CC 2YFOA 3QZNA 3VB9A 3S48A 2E9GA 3CZEA 5I1LB 1G84A 3SQBA 2ESVA 5KS9B 3T6QC 3EKCA 4NQDD 1MCDA 3MNVA 2H32H 2LFGA 1XGUA 2BFGA 3EBAA 1CR9L 5E79O 1IEHA 2WCGA 3APDA 4UQ3A 4UYQA 3T0WA 3LK2A 5GZND 2WBJC 3WEXA 2DLFH 4KXBA 3LDBB 4L9LB 5DZJA 1HJCA 2PN5A 3O3AB 1IILE 2Z4TA 3IM1A 5FYKL 1N8ZA 3IDYB 4L29A 4HJIA 3K4ZA 5B66O 4J5VA 4D0DA 1P5UC 3ARFC 1SOSA 1E3FA 2NTFB 1YEGH 3HKFA 4GAGL 1U8CA 3SZKC 2XTJC 3RJQB 5LGJB 1AS6A 5ECJE 4Y4KB 1RZKH 4DO5A 5H8DA 4XZUA 3ZTNL 1DR9A 3KPSE 3O6MH 5T5NF 3O3EB 2ADGA 1CTMA 1FPTH 1HXTA 1CGWA 2DWEA 4U1NA 4YN3A 4KK6C 1R3IH 5KYXA 2FJSA 4JFXB 4XMPH 5FXCH 5D7SL 1H15B 2APXA 4OLVH 2DI9A 3PWLB 3PQYA 4IYKA 3FPYA 5DRWA 2OTWA 1ACYL 3B3BA 2R23B 3HS9A 4Q2ZB 5K9JH 1ZLUK 2X9KA 3EFDL 3MRFB 3OPZL 1A6TA 1RL1A 2HKFH 3W2DH 1JK8B 5B3JF 4PJGA 2RIKA 5HI5D 2WJQA 1I3RA 4HQQH 1IO4C 1WLHA 4YVNA 3N1PC 4AYID 2EABA 4L2YA 5FYKD 1ZGLB 4QI3A 1NCOA 4GNKB 1Q0YH 4G72B 4N9OB 2BNQB 2ZWNA 3OKMA 3ET9F 4OD1H 4M5TA 1NMCB 1JPSL 3B7TA 3CPLB 3E2HB 3QDHA 3WNMA 3OAYH 1MFCH 5C8JA 4C47A 3PABA 4WRLA 2I7SA 3DTUB 5T1DL 1IIKA 2AK4B 1N5AA 4MJ5A 1KIRB 3D05A 3ZO0A 3RVVD 5IW3A 3CSYB 2EILB 5E2VL 3PWPA 2X89D 2OR9H 4EAEA 2F68X 4JDZB 3LHPL 4DN4H 5L8LB 3R7QA 4MS8C 1E3ZA 1AKJB 4AMKH 4F58H 1RMFH 1BFOB 4NWTL 3SYQA 1UADC 2VERA 1W2KT 4LSDA 1ZHWA 3RTQD 3C6LA 2KUTA 3WTTA 2W0KA 3F6IA 1BZ7B 2CKBL 1UT2A 4BUQA 4MNHA 2WINB 4O4UA 2VW6A 3SYSA 5E2WL 3TFKD 4RGMB 3EOTH 1MQKL 1J8HB 2FZ3B 5DRNB 5ALCH 4FFTA 1WYJA 2VC2H 2NW3A 4YSUA 3MRPA 3GTNA 2HTLD 1WFJA 1J8RA 1UVQB 3ZO9A 1A6UH 3LNIA 5E94B 4MMXA 5KYYB 3PRZA 4JGUA 2B9AA 3NFNB 3WNKA 3VTMA 2VERN 1U4FA 1FQ9C 2YUXA 5CD5C 1CFVH 3DO7A 4PV9A 4OIIL 3F65A 4MS6A 3US0A 3OZKA 5A16B 4FMVA 5DS8B 1YUHA 2BMKB 4G8GD 2VLJE 1E2WA 4LSQH 1KFGA 4M56A 5HPMA 1T7ZA 2LAGB 1TZGH 1DJWA 3MVSA 5C3TA 1CB4A 1KZYA 1KB9K 4YBQD 1F11B 4J6IA 3QR1A 1V7NH 4J3OF 3MRGA 4DKEL 5IHZA 1AZBA 2QSCH 5FK9A 3EOBA 5D7JD 5IV2B 5SWQB 1QSFB 1P4UA 2ZP8A 3CZGA 2GSGB 1U8KB 4JDVA 5DUPL 2SODB 1N0LA 3MX0B 2HLEB 4EN3A 4J28A 3LS4L 2R39A 3F01A 2GFBA 2TAAA 2VR7A 4ORZC 4OD3H 2QPEB 3WI9A 3AWFA 2IWFA 5B7FA 3ATDA 3BWAA 3MYJA 3L3DA 4AW7A 4PR5B 3T0XA 3ZDZB 2NT1A 2Y06H 1NAMA 2VDLL 2NY0B 4HJ1A 1A3LH 5FOBB 3G6DH 4HVBA 3ORJA 3IJ7A 1RZPA 4W6WB 3BZEB 2WUCH 3BH9A 4U6TA 1H9DA 1E42A 3PJNA 1EBPA 3PHSA 4KKPA 5MEOB 4LEEA 1IGYB 3MOAL 1OWRM 4GO6B 3T3ME 1MZYA 1NFAA 4P5MB 3ZZQA 3TO4D 5JORB 3F00A 2WLLA 4F2FA 2R8SL 5ACZA 2LLGA 3WFEH 1OB1A 2VZOA 1QRKA 3LRMA 5KJ4A 3UGEA 2J12B 4PJBB 2OI9B 4NPYB 3FCTB 3I6LE 3I3DA 3QUMB 3HCVB 5AUMA 3PRNA 4NNXA 4EI5A 2W94A 4X8CA 4L4VD 1JF1A 1JE6A 3B9VA 4QRAA 3Q3GB 1BD2B 3PGSA 1U41A 2GHWB 2OL3H 2XXMB 1VKXA 4W9LC 4FX5A 2EDBA 2DWTA 4M8QA 3QT2A 3KPQB 3FTVA 4L4TE 2D0GA 3FO9B 4K94H 3RVUC 2XNAA 3RE0A 2EZ0C 4A37A 5JOPE 5C0FB 1UM5H 3PUUA 5F0PB 3SO3C 1GZPA 1KIPA 4F3FB 4LLUB 5ISZB 2F2HA 1EXUA 2CA3A 1VENA 2G2RA 4AIZA 1UOLA 3I2CH 3IFLH 1A1NB 1MJ8L 4D5UA 3DX3A 3Q01A 3TZVA 4N58A 4GKZA 4X6DF 4DP1X 3CVBA 4D8OA 5I8OL 3H42L 4HJJL 3LVEA 3VXUD 3OTTA 3QXTA 2ZX8A 3SE9L 3N0AA 4WEBL 5E9DB 4KUCD 1UM6H 2FLMA 1YYCA 3U4AA 4HK0A 4JFDD 4JE0A 4LHUG 3TA3A 3ZZ1A 1WT5C 1BIIB 2Z7WA 2WNGA 2FT6A 2QSVA 3NJLA 3QFJA 5C09D 4X50A 4UOJA 1IEBB 2XVGA 2WJ7A 4XP6H 5TH2A 2CDGB 4XO4A 1RUQL 1NDGB 1UB5A 1CFSB 4PSRA 2H9GB 4TSCL 4CN1A 1BVOA 5DMKA 1LP9A 3IJHB 2VLRB 5IB5A 2JKNA 4LVOC 4NQVB 4OM0L 2ZKMX 3WE6B 1KJ2B 3EJSA 2E7LC 4AV4A 1OAXH 2H2SD 3FXIC 3U2SB 4C4KT 1U8LA 1N10A 4IOIA 4JO2H 3T8VA 4WHDA 3L4VA 1U8JA 4HUXB 1MREH 1V7MH 3T3PF 1P7BA 1PJWA 2J4WH 2LE9A 4KX8A 1KB3A 4C55A 3IFOA 4U1JA 5EZPA 1NIEA 2AKRB 3TEYA 1XR9A 5I17A 2YRBA 4H8WL 1FIEA 3V5KB 2FO4A 2WXQA 2AV1B 4M7LT 1D2OA 1MNNA 1EO5A 5EOQH 4MB1A 2PTVA 1YN6B 2V8MA 4RESB 3R06A 5ITFA 3ARXA 4XO5A 2F5AH 2N7SA 4WW1A 4F7MB 3N1QC 1XBRA 2APWA 3QDME 5EZOH 3UFIA 3CMOL 4MB4A 4NYLA 5SWZB 3TVMD 3UTZA 2P45B 3DX9A 4LAJH 1W80A 1WC7B 4L9DA 3TBCA 5L2KB 1ZTMA 4FLQA 2RB8A 3VX1A 4OZGA 4JY4A 2Y0HA 1JGVH 2HG5A 2OMWB 2JIXA 1TNMA 3H3PL 2VDOB 3MBED 2XTJE 4EIZC 3AWGA 1S7SA 2H3NB 4HUUB 4Y9EA 3QWOB 5ECGA 1HL9A 1VGKB 2BVYA 1PSKH 2J73A 1IUZA 1CLOL 2A73A 3DX8A 2JQAA 2WNXA 5CO1A 5G39A 4R7XA 3WNJA 3KHQA 2A6JB 5GSVA 3LVTA 4TLKA 2V6HA 3EADA 3NPZB 3ZMRA 3WELA 1NZRA 3E38A 4WW2A 1JK9B 4Z0BH 5FYJU 5IG7B 4QRRA 2PCYA 1QUNB 1QSED 3MRLB 3RGVC 3DRQB 3A6BL 4FQPA 2ADFL 4R7VA 1BX2B 1KY6A 4ODHL 3CFJB 4R6UA 5F7NC 2ARJB 1DQQB 5JPNC 2DTML 3V4PB 2ZT9C 4J23A 3I9IA 4L1LA 4ZDHB 1AACA 4OD2A 4GRWH 3JWDC 4R90H 4ZSOE 3TESA 1MJ7L 2FUQA 3HC2A 2K9UA 4L5FE 4KJYA 1X4ZA 2CK0H 1SZNA 3DV6A 5F3BA 2APFA 3FN3A 4KJQC 4UQEA 2HPTA 2UV3A 3MLSH 3OX8A 3FB6B 2C3VB 1I7TA 1S9KC 4CC4A 4ZQTA 1FYTE 2W65B 4PJ7A 5BJTA 3GQFA 5T1MB