4AYEC

Structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 1 e283ae304a mutant
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
243
structure length
243
Chain Sequence
GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAAKGSYSLGIFGGKAQEVAGSAAVKTVNGIRHIGLAAKQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords COMPLEMENT FACTOR H
total genus 55
structure length 243
sequence length 243
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4ayeC02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ayeC01
3KVDD 4O3WA 3PQUA 4O4XA 4AYDC 2LFUA 4QQ1A 5EE2A 3V8UA 4O4UA 4U9CA 2W81C 3VE2A 5T5FA 2YPVA 4AYNA 3VE1A 3HOEA 3HOLA 2KC0A 4O3YA 2KDYA 4AYEC 4O3XB 2W80C 4AYMC 2Y7SA 4Z3TA 3PQSA 3UAQA 4O49A 1YS5A 4AYID 4O3ZA
chains in the Genus database with same CATH superfamily
1C12A 4QXGH 4WW2C 2OZ4A 5IB2B 1UM4H 3CCHB 2DI8A 2EDDA 4LCYA 4LSTH 2BIPA 1CVRA 3DMMC 1LK2A 3ORJA 1CU4H 1TLMA 1KZYA 2E7BA 1CDUA 2Y22A 3QEHB 2X53A 3IDYC 3HC3H 3TA3C 2DLTA 5I1KH 2FYYA 3IM1A 4NNXB 4X5LA 5HHOD 4HETA 2A6IA 4LP8A 5MEOB 2X41A 3D2UB 3VGEA 3QXTA 3THMH 5F9AC 3LZFL 4L1TA 3WE6A 3DJTA 3G5VA 4GW4A 4ZQKB 5F8RC 2OMWA 3S5YA 1DBBL 4X4XB 4JHBA 4JFDE 4KKPA 4F2FA 4U1GC 4B50A 2A9NL 1HHIA 2WVPA 2GJ6D 1C08B 4OI7A 4XP1L 4QRUB 4HWUA 2V3DA 3MRKA 1LEIB 2OW6A 2QZQA 1C8PA 2F1CX 4G70B 4YDIH 3SPHA 4UB0H 1BXXA 1V3MA 3CGTA 4NZUH 4EIUA 1IC4L 2ZWNA 3MOBL 4WO4A 1H5BB 1E2WA 2LAGB 3UYPB 4RFOL 4ESKA 1E9PB 2LFEA 1R3HA 1J8RA 4XVOA 2VXQL 2B20A 4X99B 4QAWA 1CBJA 1I8IA 2NY3B 4Y4FB 4K3JL 5BXFB 1I3RA 1MW3A 4G7YH 4UMGA 4CBZA 1EXHA 3OMZA 4XWGH 1CF8H 3MYJB 3SOBH 4XXCA 3MRFB 2RD0A 2ITEA 5AW6B 3QIBD 3ZSTA 1QSFE 5DHVB 1R3HB 1R4XA 2OS7A 2RFXB 2X12A 3ALPA 3HBGA 2WLLA 4M8RA 2Y5TA 2MOVA 3QUYD 4XMLL 1M7IA 3RWDA 3HE7C 4YAQB 1JPTL 3JT0A 1KBWA 5F1IB 3L9RB 5AW2B 1DTUA 3CD4A 3LD8B 4YBQD 3D3VE 3CIQA 3W56A 2EYSA 5C08D 3FQYA 4NQCB 3ZZSA 5CILH 3EW3B 3MBEB 1AZUA 1XCTA 1JN6A 1YEFH 5FA3A 4BZ2H 1KB5A 1RPKA 3D7PA 3SDAC 1OK8A 1EJOL 5TQ0H 5DHYA 2D3VA 4PJGF 5AYUL 2PN5A 1J05B 2XXMB 3QRCA 1Q4NX 2IH1B 3K91A 1YNTA 2B9BA 3KYNA 3RL1B 4F7PB 3F83A 3N43B 2HVKA 4DOHE 5IR1B 2CNZA 4YL9A 1TMCB 1ZLWK 3U36B 2ZSWB 4HLZH 4BH8A 2D2CC 1RZFL 3VDBA 3JV6B 4ZAKD 5C0IA 1KBKA 3VH8G 3EIFA 2FJHB 1SLVA 4GNKB 3OXSB 4KZ0A 2AQRA 3V6FA 4AKPA 1OTTD 1BXAA 1FFOB 2IH9A 5CUSL 4S11A 4NQVA 4U3HA 5DYFA 3FU8A 3HE7A 2YEZB 4UDTB 3OJ2C 2B39A 5BRPA 3V6OE 1J5IA 2ED7A 5L2KB 2HKHH 3HB3C 3H1ZA 1WISA 2Y2WA 3GSOB 5C0ND 2IXQA 3J07A 4L5FE 1WZLA 4K2UL 1MHPH 2VCOA 1NAKH 4AQZA 1L6PA 2BNUA 5HDBF 1XAUA 2R23A 4AY0A 3BIAX 5D4IA 3G5VB 4XPAH 4ZQKA 5H8DA 2CHNA 4YC2B 4LCCB 1NIDA 3FQXA 3ARSA 1IJNA 2Q7YB 5IMKA 3Q13A 2ZWYA 4U1KA 1UZ6F 2BH0A 2XFXB 4P2RE 3MVSA 1ZHKA 4CGTA 1BPLB 3VD9A 4LP5A 4QXGL 3KWWA 1F97A 4H0HB 3ROLB 2YPVH 4LSEA 1N59B 2Y36H 3VG0H 1ED3B 5CGYD 3ESOA 3UZVA 3MHZA 3LKSB 4HALA 5DVLA 3PWJA 4KDVA 5AAPA 5KBNC 1BFVH 4N0UB 3HZYA 3RWIB 3NCBB 4LVEA 1XAKA 3CN1A 3GJEA 5C0NC 5JLZB 1F4AA 5KSAC 3JWDC 4JR9H 5ALCL 2DMBA 3HB3D 2R56L 3HUJA 2F15A 1UM6H 5HDLA 4CC1A 5CCKH 1ILSA 4KNQA 3N0PB 1RJZB 1TVHA 3L1EA 2EH7L 3FFCA 3BWUF 3CFBA 5BUPA 3QZOA 5ANME 4LGPB 2D9CA 2VABA 4WTXA 3AXIA 3EH1A 1XB3A 3U7YH 4KH9A 2XV6B 3JV0A 5EN2A 1OF2B 4X6CB 2VGLM 2CIIB 5I8KL 1N5AB 1CPUA 1HILB 4BFNA 4Z95L 1TYEB 2RTTA 3SGJA 3ARQA 5I6KA 1KTCA 2CPUA 4JO5A 4XWOD 4WEEA 5B38G 4RISH 4JE0A 1LO2L 1FRGL 4YSCA 5TTRA 4GI8A 2WZ0A 4FQXA 3UTPD 2JI1A 2DWTA 3KR3L 4HIJB 1OAKL 1B90A 1DN0B 1MXGA 4CGUB 1HEJC 3ZTEA 4L1DA 3OKYA 3DYMA 3H2WA 3CUPB 1JRHI 1SUJA 1TVBB 4LSSL 5ALBL 1OM3L 4V11A 3SDAD 1OHQA 3HG5A 1D6EA 2IDFA 2CRIA 2VLKE 2APVA 3LZOA 2OL3H 5ID0A 2GG1A 4ZAKA 1A6VH 1QFWH 1TOXA 2A5UA 4O58H 4PGCA 4MB5A 3LK42 4KRMB 4YBQC 5FGBA 1EAJA 4FGMA 5DEFB 1CCZA 2OX5B 1RJYB 3KXFD 4AQ1C 5GZNC 3MPCA 3HE7D 3KW7A 4LAJH 3VCLA 3QUYC 2KBGA 1EJFA 5DFVD 4O4YH 1KCSH 1UXSA 4U1JB 4BQ6A 4A7VA 4L8BA 1HHIB 2XX0A 5ANMB 2WYIA 3BFQG 3VXUD 3X14B 4L4TE 3ZIMA 2N7SA 3T6VA 1M71A 4FG4A 2EUWA 4M6OL 3AGVA 1T83C 1D5ZB 1GGIL 3SJVE 2EDLA 3C6LC 4PJGE 1MIML 4X6CE 1LEIA 4WHDA 5AWNH 1DVYA 1N64L 3GLZA 3IRZA 4L8SC 1XV8A 2D0FA 5JOPE 1NFAA 3HHSB 2NY1B 4NSKB 2F6AA 2J4WH 3PAZA 2IO5A 3QEQD 3BPOC 4D9LL 1WZ1H 2B5IC 1G6RL 1MG3C 2DPKA 2X0UA 4KQ3L 1LP9F 1XF2A 4MJJA 3V4UL 3GK8H 4DCQA 3BWZA 5K1JA 4ZDHA 1IKNC 1C5CL 4EUPB 1KJ2H 1UWGL 1ZIAA 3D34A 1BEYL 1HN1A 5FM4A 1NICA 5T3ZD 5ERWA 1G1CA 3QDMD 3L3JA 4TPRL 2A3TA 4K2UH 3SDCD 5I71C 4QDGA 1U91B 2AJYL 5JIHA 3MUGA 3KWUA 2VRQA 5L2KE 1OPGH 1BZ8A 4WV1C 3WS3B 6CGTA 2CUHA 4XR8C 2ICEB 3BPCB 4AK1A 2M2DA 1F3DH 4JFEB 5IWLA 1R17A 1KXVC 3IKKA 1OF0A 2HRLA 4Y1AD 1C1EL 1NSNH 2ZP0T 4B0MB 4P2OD 4XPFH 1FBIH 4ODTL 4X2UA 4A6YL 3C2AL 3OG4B 3GSVB 4FHKA 1BQKA 1OK0A 5LBGA 4Z1PA 4TOYH 2ZWKA 3DMMD 1EHXA 1RJLB 4OSUL 2CGZA 2HZHA 2YMTA 2EDXA 2GITA 2NY2B 3MREB 3FN3A 1RUAH 3AAAB 2MQ3A 5DQDH 5JHLH 2EE9A 1E9OB 2IBZY 1CDHA 4I5BA 1XSKA 2WJRA 1R0AH 2OMXA 2WWMD 1JNHA 4JPVH 2DZEA 2ZG1A 3MV8D 5E4OA 3TFBA 3CPLB 2YFOA 4WWNA 5FFOA 1C8QA 1S78D 4DGIL 1KG0B 1KCUL 3WHXB 5FECA 3DARA 3INOA 3VSTA 7PRNA 1UGNA 2XHNA 3QORA 4Z7VF 3ETBJ 3M6DA 1AD9A 3VH8A 4G43B 1HH9B 3H9SB 3B9KB 4UTBL 4ZUWB 4YSQA 5I1AA 2FEJA 4F7TB 3MTXA 1MCPL 5JYLA 5D1QB 2AJUL 1PRNA 2PNDA 4B9YA 4AW7A 3MLVH 3SKNA 2AEPL 3VXUA 3OPZH 4DKAA 5L4MA 3EDJA 4K3EH 5EBMA 4FL4C 4JFBA 3D12B 3GMNB 2YAQA 3BVWA 2DKUA 4UAOC 2R88A 4ZSOB 3LKQA 2VR7A 4XNZC 3VXTA 1A4JA 2AXWA 3MRNA 4AIOA 5JTWA 2XA3A 2VQ1B 4IBYA 1BQHB 1ZHBB 4UYPA 2PCYA 1ECZA 1HJCA 3DHUA 4XPHL 4UB0L 5FKPA 5I0XA 3I3EA 3ZKND 5ESVB 2H3XC 2I60L 2XA8L 5J13C 1QEWA 2Z93A 5DQDL 3OAUH 3HG3A 1KGJA 4ZO7A 1WCBB 3MUY1 1MCDA 2X6MA 3RVUC 4FQIH 1ECYA 5IKCA 2ETWA 3EO9H 2WN3A 4LB8A 3OR7A 1MHHB 2NZIA 5LVEA 4AYFB 3NJHA 3C87A 2WBKA 2YGNA 4RAHA 1NFKA 1EJ6A 2K0LA 4RVBA 3KDMB 2ZG2A 2Y7NA 2N56A 2NX5D 1QFOA 2VDNL 4U2ZA 3SDCA 3FFOA 2AV7A 3B3BA 4CSTA 3H0TA 4ODBD 5BS0E 1GS7A 2LU4A 4UB6O 5IT2H 2BY2A 2FWOA 2RA1A 2Y0LA 3QH3A 1YG9A 4PJEE 4XVJH 1KIPA 1DSFL 5SWZB 4FFYA 4HAKA 5GGQH 1HQ4B 3HZVA 4W68A 2XXGA 4U3SB 3S3PA 2Z64C 5F9WB 4GBXB 3RVXD 1AXSA 1TZHB 2VC2B 4HG4K 5GRUH 3ESUF 4GAYA 3LYRA 4KY2A 4YO0A 3S4SB 3RX9A 3T65A 1NKRA 4CNIB 5EF1A 1IO4C 1RH8A 4DIXA 1PX8A 3P0YH 4AUYA 1S7RB 4B5ZA 2X2JA 1KPUB 3C12A 2AQPA 4JPIB 4F7MB 3HAEH 3UL4A 4W6WB 5GS3A 3NCJL 2IADA 5KJ4A 1UD8A 1BGXH 1YEWA 2R15A 3P40A 4EQ2A 4D9QD 3KAAA 3OC8A 2BPBA 4QCIB 3CDZA 3RDTA 3RGHA 2XFXA 2HLAA 3OXSA 3VGFA 2DWYA 3UMTA 3CZEA 3RP1A 4IRJB 1M1SA 2BY0A 2WAQA 1E6JL 4LBEB 4X9BA 3BAKA 3VSVA 3CX2A 3MCLH 4ELMA 1DJWA 1YRKA 5MEQB 4K8RL 1Z3GH 2ZQKA 3DWTA 4BCYA 3OG6B 2NUPA 3UBGA 3TT3H 3O2VL 1OZTG 4PS3A 1UENA 4CU6A 1A8JH 3SCMC 1ZV2A 4NC2B 1U8QA 3FU7A 3TJHC 1MFVA 1L7TH 5IQNA 2FLMA 2BSCA 2DB8A 5ISZE 3Q2NA 1HESA 3JWOC 3WFDH 1CFNB 4HEME 5C0RH 5FO9A 3F58H 4PI0A 3RUGA 5FO8B 4DK6A 3FU5A 1N59A 3VDAA 5B1KA 1TU2B 1R9FA 5F1IA 2AAVA 3O41B 4RA3A 2B5IB 2W8CA 5IQ9A 3VXNA 2EC8A 3ZR6A 3MUHL 4Q6KA 1I1AB 4LHJB 3B6SB 3DXAB 3IXAA 5B21A 2YK1L 2ZKMX 1NJ9A 2NSXA 3SKUD 1RVFH 1JF5A 2EIJB 4Y2DC 5TFSL 3MV9A 1MQ8A 4IBQA 4EI5B 4D8PA 1HQRA 1DLFL 4LSRL 1Z9SA 1M7DB 5K5YA 1JK8A 2PYEB 3CE1A 1WK0A 3V6ZA 1CQKA 5JXAL 1T03H 5A43C 1WSST 1A7RH 2ADFL 1NLDH 2W91A 5HYQA 3BIBX 3MRLB 3BKCH 2NX5A 3ME0A 3PG2A 2DEWX 2DLIA 4ZAKB 1ZTXE 1QSEA 2HA1A 3UAJD 2ZCHL 2QBWA 4HXBL 3M1OA 1IZJA 1AGBA 2OJZL 1DBML 2K78A 3L17A 3PWLA 4YPGB 2DQTL 5DHXB 1PTZA 2IALB 4PJAB 1TZ8A 5A2KH 2WQSA 5E2TL 3U7WL 2FUQA 5D70L 2FNBA 1AHWC 1RD6A 2Q7AA 4ZMAT 5ACZA 4PG2A 3QUXC 5ADPL 3IKCA 4WTWA 4A2EA 2CKBA 1I85C 3Q01A 2COQA 5K9OA 1CLCA 1G0YR 2OMZB 4N0UA 4PJXF 4PTUA 3RWIA 3VG0L 2YPVL 1GL4B 4GBXA 5TJWK 2HT4C 2Y72A 1EFQA 5GHWL 3WNMA 4WKXA 3WHXA 1B6UA 4K7PH 2K3HA 1U21A 2BW5A 3SKMB 4PJ8B 4CA4A 5GQBA 4Q97A 3MRKB 1FE8L 3TIEB 3I2CH 4JFDA 2Q7YA 3R4RA 5AUMB 4E9VA 4AKRB 4P9HC 5C3TA 5GTHO 3TJEH 3RWHA 5EO9B 1QLEH 4NZTH 2XG6A 1RUKH 2Z4TA 3JWNE 2V2WA 4J7RA 2E7CA 1SYVB 2J1WA 3L1OL 2ZUWA 3KLSA 3TL5A 1GJWA 3U2SA 3OAWA 1Z2KA 3U1QA 3DVGB 4J4PD 6TAAA 4N0FA 4OIFA 2AJ3A 5C09D 5AUMA 2FO8A 4FZNA 5JXED 4R0LB 4R26L 1J9RA 1OP9A 1UM5H 3HPLA 3NFPB 4IGBC 5INDA 5KYYB 5FF6B 5FUCC 1TJGL 3VI3F 4LLAA 4QO1B 3EYQD 4ZUSA 3DO7A 1KIQB 4P4KB 2EILB 1KTJA 5J0BA 1QLEL 1YPZE 4NZTL 3JWNG 5E79O 5C0AB 1U3YA 4XPTH 3D39E 4DZBA 2VDRL 4QRFA 3IE4A 4LCCC 1G7PB 1S7RA 2ENPA 2JIXA 1PQZB 2Q86B 1A14H 3V52H 2GVYA 3V10A 3UGEA 1OP5K 3STLA 2XWBA 3I6LD 2WZAA 1KY7A 2PW1A 5BUGA 2D3JA 5DGQA 2VXUL 5T3ZH 3SPGA 1PKOA 1EAPA 4JB9L 4OT1L 1U8NB 3E80A 4PRDA 2KDGA 1UKTA 4Y4KD 3BZ4A 1OE3A 2Y1YA 4ZUTA 4JJ5A 3FCGA 4PS8A 2R69L 2FX7L 2I5YL 2VITB 4ODVL 3GJFH 2NZ9C 1LNUB 2YAPA 5CEYA 5TH2B 5KW9L 1UD5A 1BLNA 4PRDB 5C8JB 1KLGB 5GRYA 4Z78B 3I9GH 2WC7A 3NZSA 2MCMA 4RA0C 1A6AA 1K4DB 1CR9H 2UYLB 3L3GA 4P9MH 4UM9D 4K3JH 2OMVB 1KDJA 1KNOB 1TQBB 1WFIA 1XX9C 5TD4A 3RIFK 1UB5A 5HVGB 3CCHA 1B9ZA 4DAGH 4N2LA 5CIPA 3FYXA 4N9GB 3FHAA 2PKDA 1OIOA 5GS2H 1SOXA 5B4MC 3E9UA 3UPRA 3A24A 4C69X 5IM7B 5FDYA 4IHOB 5TE7H 4JFFE 4RWHA 3Q0HA 5J1AA 4FXGC 3U2JA 4P2QE 5ID1B 3B9EA 5IROC 2P8MA 4MNHA 2ZUXA 3VFMB 1HWGB 1PD6A 5LAPA 3DGGA 4F7KA 3NQKA 5KBKA 2J8HA 3MLZL 1V7NH 2EDYA 3V0GA 5DR5L 4NUJA 2AXGB 5T1JA 5GRXG 2EIEA 2R1YA 4O00A 3UBXG 5ESAB 4FZ8L 4P2QD 4UTCA 2VH5H 3JWOL 2E59A 4X4XA 4J4PA 1G7IA 4CADB 2JJTA 3DGGB 4JCMA 3T77B 4NPYA 4C58B 1L7TL 4F57L 1W9XA 1WFUA 3D0LB 3LRLA 1X6NA 2F53B 3NIDE 4O2EB 5T3XL 1K9TA 4KK6D 3MLRH 1I4FB 3RLSA 3EJPA 1SMOA 5BOPA 1QBLH 4WSGA 1JNHB 3N0AA 4JPQA 4Y1SA 1IBFA 1PZ2A 3LN5A 4AWJC 2D2OA 1XGRB 4PJCB 3NJGA 4I2XA 5KTEL 1HXUA 1W72B 3PWPD 3B7SA 1QPPA 1AQHA 3AGWA 1LK2B 1N26A 2P5PA 1E6JH 3CBRA 3S36L 5ITBH 1YLBB 2DI9A 3N9GL 4H8WL 2GTWA 4ICXA 1MM5A 3TT1L 2W81C 4LCWB 4P5TA 3N41F 1GGCL 4E41D 5EC2B 2AJXH 3GI9H 4XCEA 1YEGL 5EU4A 1BGXL 2X2YA 3UERA 1HE8A 3BISA 3GXUB 1X7QA 2YSSB 2GHZA 4HWZB 3D0VB 1JD7A 3QJUB 1JZJA 2CXKA 5F0MB 2ADYA 5KYUA 5MEPA 2LTQB 3L9RA 3VXTB 1GFNA 4LBAA 3G6AB 2EUVA 4HS3A 4NZFA 4L3EA 2Z91A 3QHTC 1I1YA 5E5UB 1FIGH 5GGQL 2BOCA 3DETC 4XMUA 4FQCH 3HC0A 2F8VA 2YAFA 3BSZA 2AFNA 4K5OA 3B9KD 3U46A 4E9WA 1H8LA 1NUGA 4N0UE 1TJHH 4TV3A 5SX4I 1DQDL 1TO4A 2R29L 3R7QA 3RBGA 2WO4A 2OK0H 4GSDH 3ZYZA 1A7NH 4GCPA 1F58L 2HTLC 2XETA 1GZPB 5HGGS 3B37A 5E9NA 3HKZA 1XR9A 4WDIA 2XN9B 5BZZA 3O11B 3VQMA 2R0KH 4AH2A 4BH8B 5KS9E 3RWGA 5DMJB 5BRZA 1FC1A 2AEWA 1PD0A 5J3HD 4ZI8A 1MWOA 1USQA 4JO3H 4QRUA 1S7SB 3QJVB 3T4YB 3W57A 5FOJA 4JX0A 1JHLL 4MDIB 1GCFA 1D3CA 4BSVA 1KELL 4MQSB 1BWMA 1QI3A 1R3KB 3CZLA 4YGVB 1A9EB 4S1SL 2K0RA 1MJUL 3DOSA 2DEYX 2AKRA 1MI5D 1IARB 4BFEA 1Y1DA 1GOHA 3ARFC 3MBEA 4KV5E 3M7OA 5FGCB 1MRFH 4M4RB 3BKML 3I9AA 3Q2VA 5IMMB 4S0HA 2VDPB 5KBDA 5E94A 4O4UA 1NC4B 5L4IA 4CBPA 1KJVA 3HG1B 3KDMA 2HFFB 3LHAA 2WB7A 2QQNL 1F90L 4LAQH 4NPJA 3M86A 4B5EA 5HHOA 4UNTA 2RFXA 4JB9H 4IDJH 2OYKA 1N70A 4AEEA 4ECNA 1VB9A 3DUUB 4LASL 1WGVA 4Z3EA 3MRCA 1CYXA 1MCIA 2VSDA 2O72A 4M1CD 4K94C 5CN1A 1UJ3B 3VTTA 3GIZL 2QLVB 3AZUA 3QC6X 2OJ1A 5CLXA 3S3DB 3QAZC 5CP7B 1L7IH 2RGSA 4TOYL 4X6BB 3R0MA 1GZHC 3KBHE 3B2DC 4PJAF 2ESVD 4LLDB 2KL6A 4PGBA 2WCPA 5CGBA 4Q8BA 2H2PD 3VA6A 5GRZA 2A73B 4HULB 3MXWL 4HJ0C 4G6AD 3HJ0A 1WVZA 1TETL 1CI5A 4NZDA 1WH0A 4MS8D 4BXVA 1FL5A 4U1MB 4FYTA 1OTUC 1RIVL 2C3VA 2BRRH 3O3DA 3MRGB 1R1CA 5D96C 4YHNB 1R24B 3SKJH 4XPFL 4P2QB 1CG9B 3FRUA 1E6OL 2HSIA 3PQUA 1A1NA 3N6YA 4HKBA 3B9KA 1NCDL 1A6ZA 3WUZA 5KS9B 3HTLX 3KBFA 2ZE0A 4HV8A 1CLZL 2NY3D 4XBMA 2B1HL 4N3UA 3DV6A 4EDWH 1N67A 3D85D 3V4LA 1PNDA 2YFNA 5J11C 3NTCL 1XEUA 1ACZA 4WI0A 3FQNA 3GZPA 4W70A 1EXGA 4AJVA 5HHQA 5JQ6L 3BZEB 2WQAA 1BFOB 1J9TA 3LIUA 4LESA 1H3PL 1PSKH 4ZMWA 5GRWA 3PNRB 4HWBH 3GK8L 3LH2L 4KK8C 2LTQC 1CFBA 4KRNA 3ZKSD 3BUQA 3P11H 4MA3A 4NKDA 4R2GB 3QWNA 4WWKA 3OGCA 5HHPA 1XO8A 4KMQA 2XWBB 1J5OL 4QTFA 1MVFA 2P8LA 1SF3A 1G0DA 1SY6A 4ODHL 4GRLB 4NZRH 2ZX9A 1N7MH 3T2OA 3VZUX 1WS8A 4N59A 1R33A 1RU9H 6PRNA 1JVKA 2CDEB 4LSQH 1N8OE 1N5YL 4X7SH 3CN3A 1DEDA 4Q6IC 3TO4D 3WMQA 3ULVF 4QO1A 4ZUSB 2WV3A 1EUTA 2WLMA 1XCXA 2WTOA 3FFDB 2PRNA 4TYUA 3P30H 4IRJD 3L6FB 4EDXA 1I7ZA 2BVEA 3GHEL 5DMKA 3SZKC 1NMCC 4FNUA 4PWIA 1T7YA 4NM8H 3PXHA 3MKGA 5DF0A 2ZWSA 3AA1B 3IEAA 3WI9A 3NCCB 4G72B 1A6VL 1QFWL 3PWVA 3X3FH 4O51B 3AM8C 3POCA 3WY1A 1NBZA 4GAYB 4LVHB 1AXSB 4XBPB 4YDNA 2B3RA 4PMEA 2Q76A 1RHHB 1HTYA 5BW7C 4A1RA 4PJXB 3GKZA 3QK0A 2XPGA 1K72A 2QVIA 2VO5A 1EO8H 4HWBA 3H9ZA 2AV7B 5TGBB 1LO2H 4WJ5B 4JNXA 1EEYA 1RUPL 1D5XB 1Z5HA 3DZMA 3GD1C 4NFDA 3H9YA 3E3QE 4V1DD 3TBSB 3ZT7A 2CO1A 2PXYD 3VXPB 5HI3D 4FL4B 2R39A 4DH2A 1ZXKA 4K94L 3WU1A 3BD5A 3WN5B 1BXVA 4XP4H 3C5ZB 4P99A 3RGBA 5MENB 1VZIA 5CIPB 5JORA 4LSIA 3G6JB 3N3EA 1EIBA 2V5SA 4K8RH 4G76A 4QRPA 4LDLB 3ROLA 3IJYA 4V1DE 5CCKL 4OF7A 3LK2A 4GIOA 4P5KA 5E6ZA 3ULVE 3MFFA 1N7ML 2ED9A 4UV4H 3Q7JA 3A6CH 3CH1B 1QBAA 2V7HA 1NGQL 3SE6A 4YHLH 2MH4A 3IMSA 5I73B 4PSRA 3HNVL 1BXUA 2L7QA 4ONGL 4OD3H 1REIA 2DIEA 3OZLA 4PWGA 5JIPA 5B1BB 2B77A 1RZJH 4FFVC 4GXFA 1IEBB 1HL4A 3Q9QA 4KDTA 4PN6A 5D7LB 4JK0D 1JF6A 2PWDA 3FT3A 3WEBA 1I9IH 5E5MB 4XCFL 1S9KC 3VYOA 5DC2A 4P57A 3RWFA 4R4FH 1KCWA 4BK8A 1Q9LA 2HKHL 2KHAA 4MJHA 4QHMB 4P2RA 5IFHL 3HHMA 4JKWA 2F7QA 5HHME 2YD9A 3FN0L 2VLJB 3LD8C 2FSDA 1ZD6A 3GZQA 2RALA 3KMDA 4AMWA 1E9QB 3STLB 3J2PA 1CXLA 5CUSH 4MFHA 3DPBA 2XBZA 3FT3B 4NM4H 3WLBB 3WNIA 1Q9OB 3FUIA 2HJKA 1GMIA 1DDTA 1OB0A 3DRQA 4B9IA 3KD4A 3MRGA 4LKXB 1MCWW 3VMNA 4F9PC 1Q9KA 1OLZA 3G9AB 3SYQA 5HGHB 3POUA 3DJ9A 4F80A 1E40A 3GMPB 1SXZA 2DYPA 1A6WL 4IBSA 2R2BB 2BOBB 1KB9K 3KXFA 2VUOA 2IWKA 5K9QG 3F7YA 4KI5F 4CU7A 2UY6A 2VQ4A 3KWVA 4MQTB 2ZWZA 1QYGL 3D4ZA 1FLRH 4PJDB 2XYBA 4M61A 2J8UE 2P5WB 1A6WH 2BP8A 3SHSA 3K6FA 4LDOB 2W59A 1NEZG 3RVWC 4P07A 4Y0GA 1MZYA 1MCBA 2WUCH 1WD8A 4OF5A 5F7FA 5HHMD 3AS2A 3RNQB 4POZC 4FQEA 2WXFA 3EJYC 3US0A 3P9LB 3GBEA 3EHBB 5E8NB 3ILPA 4UV7L 4JPSA 5HJGA 4ZUVA 4PB9L 3QEQA 3GSQB 5AVRB 4MVBD 4ZXBC 2Q8AL 4K7PY 1YEFL 2HX9A 5DL5A 2HRPH 2VDOL 4BZ2L 2PXYA 2YAHA 1VEPA 3NIGB 3RVTC 3HMXH 2XE2A 1Y0LA 3DSFL 4NDMB 1CDGA 3BGMA 1OO2A 4X8JB 2PF6A 5IJDC 2A2QT 5IESL 4QRPD 1KBGL 2R2EA 4PP1C 3TA3B 4QF1B 2F8XC 1TEGA 3QZWB 4M3HA 4HJTA 2F54B 4G2AA 4LARH 3NRQA 3TYGH 5T5FA 4LOUC 4NAMA 2BIOA 3ZQ9A 2O93L 3P0GB 1P4IL 4EDXB 1N4XH 3MJ8B 2YLHA 4L0PB 3DX1A 3POHA 2Y06L 4J3OF 2BWQA 1I85A 2AQ3A 4L3CB 5EZJA 1NC2D 3SPCA 2BIQA 3P73B 4PRAB 4PV8A 4NP9A 1QLRB 2BHUA 4Z77A 3NZ8B 3U4BL 3V5KB 3GB7A 4TQ8A 3L3HA 1FNGB 3ZMNA 3ARPA 3GM0A 4P2RD 1QRND 1NIFA 4X6BA 4XO3A 1LDPL 2DWDB 4YDIL 5FM5M 4UM9B 2SEBA 5F1NA 4ZFFB 2X4RA 3EDDA 1A7NL 1XGZA 5EEXA 2CLZA 3IRCA 3GHBL 3QFDA 5KVFH 3DXAD 5I1JH 1TPXB 6FABH 3E3QC 1IRAY 4MZIA 4XNUH 5LDSA 2A9NH 5CJQL 5DJZB 1S3RA 2F68X 4MNQE 4BFOA 3T65B 1HHHA 1PLGH 4HIHA 4F8TA 3AG1B 5A40E 2MQGA 4MX7B 1BWWA 5EF0A 4B9KC 1MJ7H 3DBXA 4N2EA 1ZE3C 3OKMB 4MJID 4YXKH 4JFFA 1I9RL 3IJSA 3FH5A 1MJ8L 1AOZA 3DXAE 1MSPA 4F20A 4TM9A 4LHQB 4D0BA 5EO0B 5D2NA 2YARA 2D03H 2DYPD 4P4RB 3RL1A 4F7PA 3P2DA 1DUZA 1FWXA 3KHQA 3VXUE 1TTRA 1QRKA 3IMUA 4OLYH 1MI5B 4RETB 4J8RA 3S3SA 1U58A 4R97B 5C9JB 1R3KA 1AD9B 1RXLA 4WCYH 1TVDA 3D69A 1H6FA 1FO0B 4CN6A 3MJWA 3ZE0B 2BNRB 1CGWA 4J2XA 1QOKA 2IMMA 5BS0D 4WFHD 5HYQB 1N18A 2J4WL 4KVPA 4I0KA 3KYKL 3SZ6A 1NL0H 1HL8A 4H88L 3DVFA 4NQXB 2EDTA 2C1PB 3QXAB 1DVTA 1FFTB 5FDWB 3ULSA 3GLDA 3O11A 2WTRB 4ZTOH 3STBA 3ULUC 3V0WH 5KTEH 3FTZA 3ZDYF 4PY8J 1ADQA 1DSYA 1A0QL 4M6OH 4J8QA 4WJKB 1IILE 2LV4A 5LN8A 2LU5A 3ETSA 5JQIB 3PGUA 1M1XB 4XCYA 3ENEA 4BKLA 1AD0A 4GSQA 2I5YH 2R69H 1F02I 1F4XH 1YQVH 4JM4H 4XPBL 4RZCA 3WE1A 4YDKL 2YEQA 5LGJB 4UNIA 1G5GA 5K93A 1XCQB 3POXA 1MUJA 1JGDA 3OKNA 1WZKA 1LO4L 2EDJA 2AQSA 2NW2B 4FHJA 5CLTA 5I1EL 3HOLA 1IAIM 1UWFA 2A9CA 4HIPA 2WAHA 1QO3B 1WITA 1KWGA 1IVTA 4XP9L 1NC2A 2FGWH 4BDVA 1KG0A 2JELL 1OQXA 3SDCB 1WIPA 2EABA 4MQXD 3O2DL 5FAAA 3RTQC 3RTQD 3SN6N 4HUVA 4U1LA 3OXRA 2MRYA 4MWFB 4NAQA 1HEZB 1IU1A 1FZJA 3T0BA 3HR6A 2DH3A 5EOCJ 4PJEA 5D5MB 5AAMC 2KPNA 5LNEA 1A6ZB 1CLYH 2KT6A 1Q0EA 3X1EA 1JPEA 5MENE 1LJMA 1MFNA 1RP8A 2BDNL 5AG8A 1J8HB 2E7MA 4FQJH 3JV4A 1O5DT 2OULB 3BUIA 5T3ZE 4JPIA 4ZPTB 1ZA6A 3L1OH 4M6ML 1U8PB 3QIUB 1ZDSA 4DQAA 4LVHC 1E8WA 8FABB 1BQHA 4L05A 4G6KL 4OAWB 4XOBA 1AZVA 2PP8A 2VDKB 3FB6B 1WZMA 4I2XB 2IPUG 2QFPA 4NQSB 1BOYA 2V9QA 3WXVL 1B4TA 3T8XB 3DURA 2I25N 4MXQD 4PJGB 1DVQA 1F13A 4AQEB 3ULUD 5G5DA 4ZXBA 4NNPL 3JWNC 1NMBH 2Q0ZX 3PGDA 2EVJA 1GKEA 2G0LA 3RTQB 5HDRA 4X4ME 4GRWH 2K6ZA 4YDLC 4UM8B 5E8NA 1BJ1H 4AYMC 4HD9A 3FN9A 3VFNB 1F90H 4LAQL 4OQTL 2WXLA 4NYLA 1ETZA 1UB6A 5HHQB 1SMDA 4ODXB 5HHXL 3VAEA 1BG1A 2BMKB 2K4WA 1LO5B 5KN5A 1C9SA 4G6KH 3AA0B 4LGSB 1NINA 3ZZ1A 1PFCA 5C92A 5C0CD 1DBMH 1R5VB 1RK1B 5F7DB 4JM2A 1XF4B 1ESOA 3G5YB 4HOZA 1I1AD 1P7KB 3MCKA 4OZFA 3OLDA 4MA8H 3GUTB 3E6HB 3KPRE 5H2BB 2KZ7A 3QB7C 2AXJA 2BDNH 4TUKL 5CINL 3Q8BA 3FCSB 1A9EA 3DPDA 2OV0A 4FNLH 4P8QA 4ADJA 5DTFB 1ZSDA 1G9ML 2ODIA 3OSKA 4JDEB 1D5XA 1JGVL 5HYIA 5HVFB 3ULUE 5IW3A 3QHZH 1P4TA 2EEFA 3UCRA 2E9BA 3EZ8A 3RWJA 3VD0A 4DGVL 1FFPB 3KEHA 3NH7L 5AZEL 1GHFL 3B43A 2EKSA 4M43L 4Z76B 3FFDA 5KJRH 2F5AH 3HC4L 1UKQA 1RZ8B 2L7JA 4HBCH 3SE3A 5JHLA 1E27A 5MI0C 3VWKA 1RZIA 1ZK5A 3GRBA 3HW7A 4WU5B 3WIHA 1HVXA 5BMFH 4PJ5E 2CO3A 4PG9A 4JVWA 5B3NA 3ME0B 1FE8H 3HPJB 2X1XR 3M45A 5FA3B 4X9FA 2L3BA 4M61B 1FSKB 3N40P 4HSCX 5D1ZC 5INCA 3TZVC 5E6IA 1F45A 3O2DA 3D87B 1QO3A 3GEWB 4N8CL 4U2YA 3MRHB 3QO1A 4RGNB 5FHAL 3WS6C 5D71H 4XMTA 3PHQA 5J6HB 2B2XH 3T0SA 4GBXD 3LRSA 4JDTL 2Y2XA 3OB0K 4WTZA 1PG7W 2Y5TB 1ZTXH 5C0CB 1HSBA 2NSMA 3UC0H 3ISRA 3P77B 2NQCA 2JLLA 2HFFA 2ZYHA 4PP1D 4EBQL 3FO2B 4A6YA 5H4ZA 2VNCA 5J6HA 1F00I 2ZJSH 1KENH 1INDL 1WEJL 3ZHLA 5FO9B 3F12A 5DJYA 2XSKA 3GWJA 5C6TH 1IE4A 1CF8L 1RURH 2CO6A 3O4LD 2FVNA 4N90E 5E1AA 3RVTD 2W95A 3PAUA 1AQ8A 2X1WL 5DZ9A 2GK0A 3HVDA 7FABH 3F3HA 3V9EA 5DMYA 2EIMB 1YJDC 3UTSE 2R0WL 1QFWM 4FXLA 1TQSA 4WCYL 2FH8A 4GG6F 2R8SL 3LNEA 3QNZB 1Q9KB 3MLXL 4XH2B 5D7JB 4O2CB 3FTSA 3WFEL 3C6LA 1UZGA 3GDCA 1CZ8L 4X6DB 3RVWD 3DVGA 1XGUB 5DGRA 3VFPB 1I1FA 2OTUB 4RMWA 5DZAA 3SPIA 4MAYC 2WW8A 1BF2A 1ZHKB 3PFUA 1W16A 2ICWI 2PCPB 3M17B 3T3ME 4B9FA 2X1PA 5IW6B 4J3OH 3VXSD 1YAIA 4ALAH 1E8ZA 1LGVA 3TONA 2C9VA 3X13B 1S9VA 1YDPA 2ZXGA 4JM2D 1U8IB 4PBWD 3WIAA 1P5VA 2CHZA 2CBPA 3WFDL 2X09A 5C0RL 3LSOA 1NCTA 3KGUA 3T2NL 3VFUA 2KZ1B 4ZT1A 3THML 2ITCB 4RDQG 1I1FB 4ALAL 1F41A 3CZNA 2GBAA 3PF1A 3ZRFC 2VJXA 3KPPA 2DIAA 4RAUB 3CVHL 4JFSA 4ZUVB 3LXCA 3OZ9L 2EVGA 2DLGA 1ZHWA 1QFUH 3GSQA 4MX7A 4I3SL 4Q6IA 4N9OB 3K2IA 4F37F 3QPQC 4NQCD 4BFKA 2Q3XA 4WEUD 5CZXD 3NCMA 2A0LD 4QRBA 2DQDH 1IAII 1RUQH 2XQYK 3GS4A 4X5QA 4L8BB 3X14A 3ML9A 3NDYE 2YUXA 4ZK8A 4NLHA 2DMKA 5JZ7D 3UZEC 1FPTH 1CICD 5FO2A 4C56B 4IQHA 4F7EA 4TNVF 3DURB 4PJGA 1GR7A 5BZXA 3SPJA 1PD1A 4FLRA 4N5EC 2L8AA 4PCYA 3UAFA 2R2BA 1TJIH 4M7JL 5I19H 4BQCA 3EOBB 3HE6D 2EDQA 5CF3A 5E6ID 2AEOA 1NBZB 3BPNC 4MLIA 5HVHB 5I66A 2CA3A 1PY4A 4JO2H 4NB7A 5E6RB 3TNMA 3NJLA 4FYRA 2OSLA 4TMPA 4U6XA 1I8KB 3KPLA 1DFBH 4DEUA 5F2FA 4PAZA 4L23A 1M05B 2H47C 2YKKA 3CVHA 4DEWA 3II1A 4DK3A 1G7LA 1M7UA 2WXNA 2BLFA 3WDHA 1HS6A 3GBDA 4HPYH 2OP4H 2NYKA 5IVXF 3ZXAC 5SWSA 1A66A 4KJQC 2CQVA 3CSGA 2HT2C 4AKMA 4NT6A 5I1LA 2J7LA 2OMYB 5T3ZL 4LKCB 5I2IB 1KTDA 1MLCB 2UZPA 1XEDA 2X28A 4B9PA 4L29A 1B2YA 1FV1A 4X6FA 3PDOB 4UZUA 2JTDA 1VFMA 1TQWA 2UV3A 4O51A 5T5NF 4OB5L 1UXSB 4U1JA 5KANI 4KJPC 4LCVA 5DHVA 2X4PA 5HGBA 2OMFA 3L45A 3KLKA 3KPMB 3PQYE 4TTDC 4Y5YA 1WO2A 2Q86A 1QLFB 1SXSA 3G3LA 1EEQA 2R0LL 3G08B 4GQQA 4CVZB 5A2JH 4QRRA 2YPLE 2P4AB 1M6OA 3E7JA 9CGTA 1LK3L 1LWRA 5F0LB 5C7ZA 1T89C 2CLRA 5IG7A 3CH1A 1QASA 3GPEA 1TJGH 3ZL4H 5GRJH 4TUJB 2TSBA 3PJSB 4NBXB 2C9AA 3BEVA 1JGVH 4H1LA 5ADXL 2WWKO 5G38A 1DQLL 2P28B 3NN8B 4HJJL 4PJFA 5F7UA 5MP6L 4J39A 1ORQA 3ZE2B 2OZ4L 1RSYA 1YYLL 3RWCB 3UJIL 3HN3A 1NBQA 1O7DE 5GGVY 3ZKQD 5JW3H 3NA4A 1J0KA 1ED3A 4PUBL 4Q89A 5GGSY 4MA8L 4EI5C 2QKIB 4XAWL 3AREC 5HHVL 1RZKH 3MLPA 2F08A 3C5ZA 1VA9A 3DX2A 1AR1B 3V5DB 2K3TA 4PW9A 3Q1SH 5ELIA 2D7NA 2YJLA 3NACH 2LABA 3BVDB 3KJ6H 5TE6L 4QHUB 1UH3A 3EUDA 3O41A 2W38A 3V0HA 2ZUSA 3ZE0E 2BCKA 3EGDA 1MFEH 3CFEB 3ARFA 3MBEC 1NC2B 2E75C 4P2CG 3BZEA 5DI8B 2BNRA 3CFBB 5B39B 5LG1A 5HYEA 3O6FD 2QHRL 3TASA 5EU4B 1C7SA 4OD2B 1LE5B 2YBRA 1GFQA 1CICA 2DTSA 3HE7B 4UOW1 4ODSL 3LB6C 1I75A 4ENED 1MRCH 4Z7WB 2FBJL 2WO2B 1KT2A 5G3AA 2EE3A 1T1XB 4HUWB 1OCWH 3ZDZE 1OGTB 1HHKA 4AGLA 4E36A 1NFDA 4KK8D 3UX9B 4AZ8A 3OHMB 3L9BA 4LPWA 1HXYA 2VN7A 4XNZB 1AD0B 2JKLA 5ENWA 5KYWB 4KROB 4FMFA 4F7EB 4HOMA 4LLVA 2K8QA 2WQXA 1QEWB 5IGXH 3GKWH 3PWLB 3LN4A 1AGBB 2G9KA 3C8DA 5FO7A 4XRCA 3P9LA 4FN0A 5BRZD 1DQQA 4AV4A 4Z18A 1TT6A 1XF5A 5HJDA 4MAUH 2BNQB 3IU4H 5SV4A 3QI9C 5AVUB 2H26B 5F7DA 1NGYA 5CBEB 3AU0A 2XXCB 1TEYA 4HC1L 3MLWL 1RUPH 3MXVL 5AAWC 8CGTA 3IXTA 2OXHB 3HZKB 4O5LL 1PLBA 3F7YB 2W65A 2AXTO 4I89A 4WO4C 1G6RB 1UFGA 4FG6D 1QI4A 4KOCA 4KTYA 4W9EC 5DJXA 2DMCA 5K33A 2AVFA 2W0FA 3DI3B 1MW0A 4ETQA 4GW4B 43CAA 4XC1L 5TK4A 2K6WA 3O81A 4KRPD 5GGRY 4AT6B 5FIEA 4JFDB 1BVNP 1U3NA 4MDJB 4DP1X 1C5CH 2H2PC 2FCBA 1QUNB 1KCRH 1WTLA 2OAAA 2DDQL 5DWUH 2FJGA 5GXBB 4JKKA 1QFPA 5F7EH 4JLRA 3WHE1 1LXMA 1X7SA 1PY9A 1QX1A 1LYQA 4GKNB 5FYKL 3BX7C 1GS8A 2B16A 5E8DL 5LBSA 4YDKH 4U1SA 5K9KB 1UT2A 4L9LA 4M48H 4BUHA 1QABA 4WU7A 4JDZB 4NDMA 1HDMA 4PV9A 4P3CL 1CMOA 3NIDB 4WUUB 5D55A 5IFJA 2ZOLA 4MCZB 5FWQA 5F1NB 4ZFFA 5HJBA 4TULL 5DK0A 5FA4A 1AKJD 4M3JA 1UHVA 1SEBB 1LE9A 1IT9H 1D5MB 1BQRA 1HL9A 3G6AA 3APCA 1WCQA 1CFQB 4RFNC 3ARFD 5LG6A 4GLRI 3AG4B 2YPLD 3OAZH 3UO8B 2JVUA 3BRGC 3BAEH 4AI7A 5E8DH 2ZYIA 5D1ZB 3TZVB 1IEAB 3JWNH 4HKZB 5DFAA 2HX8A 3B3IA 4PMFA 1BLIA 2YC1B 3BRYA 1LLAA 1O9ZA 3T0ED 2WHVA 2VXVH 5L6YH 4Q9RH 5JUEL 1ZPLA 1EZUA 1J0HA 3PHQB 5DYOA 1N6QL 4N4YB 1OM3H 1BVKB 3DX7B 3E2HC 2CKBH 1VGKA 5GS1A 3L16A 4YX2L 1G9NL 2I85A 3AABA 2H8PB 5DJ0B 3ML8A 4MKMA 3WDIA 1EGJL 4JVPA 1J05A 4Z7WA 5IQ9B 2MTPA 2XE3A 2P9RA 5GSVB 4GRLC 5A1AA 3LQMA 2GBUA 4A66A 2BP5M 2CD0A 4IMKC 1RPUA 4N3TA 5HY9B 1BVKA 3DX7A 3VWJC 2O6DA 3SEPA 5TDOB 1EAQA 3CIAA 1E50A 2ZCZA 4XN9A 4NQEE 6FABL 1VENA 4UWQB 2AK1L 4FQ2L 2XPGB 4EAEA 5BQ7B 5AKTA 3PE9A 4LFHD 2NXYD 1RIUH 3ULAB 3V6OA 4PJFF 3NMEA 1R3LA 5DZLA 4UQ3B 4PYHA 2PCXA 5KSUA 3BDYH 4W9CC 5ISZA 3S3BB 4NQEB 5D2LE 1TETH 2VL5A 3RA7H 1ZHNA 4PJDA 3MR9B 1U30A 3BFOA 3QO0B 2B4CL 2WB1A 3WY4A 3IRPX 2XN9D 3FAWA 4ABVA 5EZOL 2KLRA 4OQ1A 4P4KD 4Z7VB 3GSUB 5ALCH 5EOCL 3O8XA 4MRCA 4MAYB 4BFGA 1S7TA 4XMKH 4ZFZB 3Q5TA 3BVTA 3OZKA 1QUPA 3HMWH 4H8UA 1JZHA 4BFIA 1XL6A 2CK0H 2WXOA 2YRLA 3P3RA 1F4WL 4BZ1L 1E3XA 2VZUA 3CQFA 1MN4A 5BRZE 5KAQG 1SVCP 4Z3HA 1WZAA 2H32H 3V55A 5C2BL 2H3NB 4KO9A 1UYWH 2KKQA 4RLBA 3VFRA 3MV9B 4JJOA 5F9JA 4CC4C 3BH8B 1MFAL 2IWVA 5TE6H 1NEUA 1XHHA 2WO3B 3AITA 5L2JB 1AKJA 3LZRA 1A9BA 3LQZA 5EBWB 2FZ3B 4K9JA 5I16B 4KGLA 3D2UD 5DJ2A 5I6XC 1NFIA 5DEGA 3L95B 3S34L 3K6SB 3RUGB 3RKPA 2DMGA 3L3IA 1MREL 3AQYA 4MBRA 4WI0B 1ZGLM 2FR4B 4ISVA 1RJZA 2DQGH 1DVFC 2QTEA 5GS2D 1T0PB 4HH9B 2OMXB 5I16A 4FZEH 2Z35B 4UILL 4Z77B 5KSVA 3G04A 2KQNA 3HG4A 4HSAC 1ZVSB 2WUBH 4UV7H 2XIBA 2WLZA 5C0FB 1ZVYA 4NFCA 4P3DA 1VPOH 4PGDB 5JW3L 1CJYA 1MPAL 3O9WB 1RZQA 3VI3A 4N86A 2DL2A 2AJZA 3K7UA 3QJQB 4FMKA 4ELKB 1PX3A 1BVOA 1B0GA 3DWOX 2AF2A 4GI6A 4J1UB 4UU9A 5AYUH 2CPCA 5HPOA 1S5IL 1IAIL 2X4TB 3BKYL 1FGNL 3O6FB 5EU6E 3L2MA 1U8HB 4K7FA 3BCDA 4NJAH 4LSUH 1AHWA 2VXSH 1OAUL 4OCNC 5J1TC 2XV2A 3HNTH 4QUOA 4HPYL 3VD4A 4ODUB 5ACMA 4ZFQA 3OKDA 2ZSVB 3PXLA 1CGSH 3KXFE 3QG6B 4H44C 4E9YA 4G1MB 4ES8A 3QEQB 4NZJA 2WJ7A 1SLXA 4XTRD 3VQ1C 2ESVB 3QAQA 2GJRA 3PHOB 3RFZA 3L3DA 3BP4B 2IAMA 2XN9A 5I1GH 1ICTA 4LPYA 4BM7A 1J1XL 2NDGA 1ZMYA 3FUFA 3O8XD 2WZPA 1QP1A 5I19L 2PPFA 4Q58C 2XWZA 4KY1L 1ORMA 5FK9A 1PL3A 1ADWA 4H8WH 4LL9A 4I8DA 2VT0A 4OUUB 3CBJB 1ETA1 1WS7A 3IVKA 5BZWB 5AWNL 3T6QC 5HDOA 4YR6A 4NPKA 3ZU8A 3GSUA 2VDKH 4BHUA 3S3CB 4BHUI 5ICXB 3U30C 1NMAL 3GMQA 3CZUB 4KFMA 2JJSC 4XMKL 3FTUA 3VA2C 4PP2A 3L2LA 1WBYB 4Z78A 2QSCH 5J1SC 3OV6A 4JG1H 4XTRC 2J6EH 5IMOA 2BRQA 5CEZD 1VDGA 4ZW3A 3W81A 2H1PL 4LP4A 2LU7A 3ZDZB 3NCYS 1HQ4A 3HZVB 2XDHA 4GY4A 3OMAB 3O3EB 3PWNA 3BIKB 1W0YT 1U8MB 4P4RA 1G7JB 2ADIA 3F05A 3MODL 1DBBH 3RQ3A 3KPMA 1SUHA 3Q6FB 1ZT7A 3F8UB 3QJZA 4GO6B 1JGLL 1S9YB 2CAKA 3O9WC 3QWRA 4R4NC 2EEAA 3BAJA 4DO4A 1UJ3C 3IN2A 3DSNB 3QCUL 1PAMA 3ECUA 4MMZB 1QQDA 4JN2A 4MCYB 4ZTPH 2RACA 3ZO0A 1UWEL 4JFPB 3LQZB 3GEFA 4NJ9L 5EBWA 2Z8VC 4GXVH 3KBEA 4LIQL 2XZCL 3KG5A 3HB3B 4AQAA 3T3MF 2OXHA 2QTKA 2LAAA 5CR1A 5L2KA 3LMJL 1IGIH 2C4FT 1AYOA 1PQZA 3UCQA 4RRPA 3W9EA 4QTHB 1RULL 3MLXH 3F7PC 4EI6A 5A2IH 5E6IB 1OP3K 3T4AB 2GFBB 1X5MA 4QXVA 2EIZB 4JANB 1MRDH 7FABL 1DVFD 3D08A 3PWUA 2HT4D 3S7GA 3OJVC 1CG9A 3GINA 5FHBL 4L0ZA 4B60A 2ITDA 3QHFH 3EDEA 4X6DA 5FKAA 3QYNA 4GCSA 1WEJH 5HDQL 5CFHA 3DO3A 4PRID 4ZUUB 5FUOL 1S7XA 5AVXB 3NIFE 3WNKA 1MY7A 4HFWB 2J6EA 4NQEA 3BI9X 2D7PA 5FGCE 3CFKA 1AR1D 5GS0L 2RCSL 2V2WB 3UC0L 4GQ9H 4C4KT 1SYVA 4JRWA 1QHQA 2NNAA 4NWUH 1BYOA 5TDNA 4FSOA 5C9KA 1HH9A 4ZUWA 2Y2TA 3H3PL 2HJFA 4TS6A 1WBXB 3DXAA 3IXAB 4ZUUA 3S2AA 4QRTB 2P1YA 4P9HH 4G8GA 2JJSA 2X05A 3DIFA 5GGTA 2WZPD 4OM1H 2JKNA 1BVNT 4X7TA 3JTTB 3WSQL 3S96B 2W94A 2ZOKB 3GSRB 2PORA 5JR1H 2JQAA 5T5FH 3JWDH 1OSMA 4IU3A 4X98A 4JFFD 4MSWA 2QPEB 3CUPA 5I9QB 4O49A 2J56A 3ARBD 1VAHA 4PBXA 4Y2DD 2QGDA 3E1ZA 3M17A 2WBJB 4P4KC 5E1GA 5DJXB 4NGHL 5ACZB 4DZBB 4AE0A 1JRHH 1E8YA 1IFHH 1Y6MR 2WOBA 4UT6H 3QJFB 5BMFL 5L8KB 2D8KA 5E9DE 2PYFB 4XVSL 4RFNB 4AGQA 2FGQX 4WHTA 1VF5C 3LEYL 2BRRL 3CQPA 4KOBA 1T1YB 3KGTA 4AKOA 4WIQA 1RMFH 3FMGH 3RWEA 3RX8A 1UXWB 2EJ1A 4HH8A 5JDJA 1EEUA 5AB2A 4FESA 5EH1A 2F0CA 4KPHL 4QHKJ 2YZ8A 1JWMB 2EACA 3VWJD 1XF3A 3V0EA 4LIQE 4R3SB 4EE2A 5EOQL 1EZSA 4HHGA 3O3EA 2Z1PA 4OH2A 2VLKB 4AM0B 1AHKA 4CUCA 2VISA 1D5BA 7PAZA 1M71B 5HJ3B 2VB5A 4Z7UA 5EO1B 1MLCA 2RB8A 2OMWB 4JVUA 2W0KA 4OLXH 4PRNA 3ZW3A 1DBJH 4WUUD 4K7PL 5I2IA 4ONFH 4FS0A 1SJMA 4ZS7H 1NKOA 1T5WB 3CC1A 2EVHA 2CZNA 5F0JB 1T4KA 2XZAL 2VQTA 3QZMA 2ZX8A 4J3UA 2ICWA 5K39B 1DVFA 5F44A 2PTTB 3AREB 2BSDA 2AAAA 4X5WB 4JGUA 1JYNA 3GIZH 4NFBA 5H94A 1XH1A 5CJ8A 4QOKB 4PWKA 2FIRT 2AJVL 4BKTC 4C56D 2HX7A 2CO2A 2WLLB 3RUGE 4D9RE 5L9DL 5EZLA 2WBWB 1ZHZA 2DQFB 4G59C 3H2PA 5T5NG 4G6ML 3T6XA 5IW1A 2YNKA 5E1AB 1SXAA 3CVBA 3DGCR 4G7YL 2VSKB 2XLLA 4ZMYA 2PR4L 1OALA 4ELMB 1ZJBA 5IWLC 2W1NA 1PJWA 4I3RL 1S7WA 1MRFL 1UTDA 2HFEA 4JO3L 4WSKA 5IVNA 5HY9A 3U0PB 5AYQA 1T03L 2Y0HA 4NUMA 4S1SH 5LUMA 2XT1B 2ZUTA 2DWXA 4LLQA 2EYRA 2L4OA 3NG5A 5IHHA 1F6AA 3X1FA 2CLRB 2KYIA 2OZ4H 1PPIA 2YLKA 3OKEB 1BAGA 2HFEB 1YEJL 3LK3A 2JJUA 3T0XA 3Q44A 2QVKA 4XMXA 3O6LH 4GXUM 3RVUD 3LV3A 4JW3A 5ECGA 4PM1A 3MR9A 3QO0A 4P3DB 3QNYA 5IF0B 1GFPA 1FVEA 5J8OA 4HDIB 3B3IB 1JPSL 2Z7ZA 2W07B 4UQAA 4YFDB 2GB2A 4IU3B 2IANE 1KT2B 3TEWA 4GSDL 1FIGL 1R3LB 1E4XI 1W80A 3AMLA 3IDNB 2ZCLL 3DRQB 3EAKA 5I6MA 3BPNB 4KZEL 4XAKD 3WNJA 3QCVH 2WXIA 3U9UA 3QI9D 4A2FA 5F1KC 3B1TA 4JZNA 3SJVA 3VGBA 4G3YH 4KGJA 3MNVB 4LSPL 1EA9C 1KMGA 3EGDB 1UG9A 2NLJB 2Z3FA 3T24A 1A0QH 2AQTA 3LRHA 5DD3L 2R1XB 5F89A 5C09B 4NO0B 3U25A 3IMBA 3OSVA 1UQSB 5IM7A 4P48A 3RNKB 4P3WA 4KTEL 1KIRA 4NCC2 3M8OH 4U1IA 2GHWB 5L0QB 5TDPA 1QEXA 2FHCA 1H3UA 4IGBB 4QLRA 3KPRB 4YLCA 2O30A 1HAUA 3PGCA 4MXVE 1HINH 4E2OA 1MVUA 3KWWB 4JKNA 3NIGF 4W4OC 1I7RB 1JDAA 1S78C 3EOYG 3FTXA 3FUNA 3OR6A 4KUZL 3EDKA 1GGCH 3SBWA 5DC4B 5J13B 3M8OL 2XQBH 3K6NA 2X3AA 3P0YL 3O6FC 4KXBA 3P4NA 5C08B 3PUCA 2HKFH 1BSIA 3MRMB 3KPRA 4FQXC 2X7LA 5CZVH 4FQQB 4AIZA 1W0VA 1U42A 2XG5A 3VWKD 5F7YC 2OMBA 3I50H 1ZLSH 3NESA 3VRJA 3AY2A 5EU5B 1D7CA 4B9GA 2K7PA 3CVDA 4WI9A 5CLZA 4B96A 1LM8V 2X42A 3BPLC 3N40F 1E5YA 3H4FA 1AQKH 4FRTA 4A63A 2F1VA 3TBWB 4WU7B 1N3NA 1O6VA 1UD6A 2CGRL 2LLGA 3BVUA 3WKQA 3ARED 3PQSA 4EI5D 5IW6A 1J8HE 3TURA 4WUUE 1ZT7B 4Z7OF 4M5YH 2VH5L 3IF1B 2WQ8A 4OZGB 2E7DA 4HGWB 4L3FA 3WOVA 1D5IH 1B6DA 3VU2A 4MMXB 2X2UA 3APNA 5IQOA 3MRDA 4ADGA 4U4BA 2CBQA 4OVVA 5DR5H 5IBTL 3U4BH 5CZVL 3BP5A 3MLTA 3MLZH 1SYSB 5AW4B 2OSXA 3QUMB 3SDDA 1B2WH 3INUH 1NUFA 2VQUA 2XA8H 5DDHB 1J1OL 3DDGA 4AVIA 3D30A 2IOIA 3QDJE 4MNGE 5HYSA 2C5DC 4FLHA 1ID2A 2NY5L 2NY2D 5MHSD 3UADA 2Z35A 3PL6C 5AW7B 5HYSG 2E4TA 3UAQA 5JW5B 3T1WA 4JFED 2OKMA 2A6JA 3IBOA 3P0VL 4FNQA 3A0OA 5BQDA 2MCPH 5FW8A 3PABB 2VSCA 3F12B 3BPCA 1KBGH 1R34A 2MSPA 4ODVH 5IESH 1RZJC 1O5PA 5HD8D 1DEEB 1BZDA 1TQCC 4YN3A 4NCC1 4JFZH 1KJ2A 1F0LA 2CHXA 5FYJH 1P4IH 5HXMA 3I9GL 2JCWA 3UTTB 4E5XB 2B59A 1CLVA 3BVNB 4GFTB 4GOSA 5F7KC 4BFFA 2G5BA 4X4YA 1DUZB 5I1DA 5BNXD 3WJLA 2X2HA 4JFOA 5AFUK 5DS2A 1PLAA 2IOOA 1EAOA 4H5SB 3U0WL 3V8OA 3R06B 1N68A 2HG5B 1JNLH 3P4MB 3QNXA 2FX7H 5IB3B 3VXMA 1XDTT 4OZFG 4R96B 5DD0L 5IEKB 5E00A 4M4PA 3FL7A 1F3JA 2VLRE 1NJ9B 3HE6C 4DQOL 1E4WL 1DANU 1U2CA 3MLYH 1GXEA 2PCPA 5FECB 3PU7A 3WFHB 1MDAA 3JTTA 1AFVL 2PWEA 2Y1AA 1E5ZA 2AGJL 3VXOB 1V54B 4NO0D 3US9A 2ZPKH 1UB5B 2XRAH 3ELAT 3TJPA 1S7XB 1X3DA 4P06A 2CR6A 5CZXC 1JZEA 4Y5YB 3QPQD 4UINL 3T0AA 3HRZA 4ODTH 3AWGA 3VXUB 2R83A 4JO1H 5FYKE 1K6QL 4QT5A 4XWOC 1DQIA 1CGVA 1TJMA 3LKPA 1GY1A 3W82A 35C8L 1OV8A 4HWEH 5JIDA 2GFBA 3K6IA 4L18A 1IBGL 1L5GA 2EXWD 4NQDE 2IPKB 5JIQA 1CD0A 4WVRA 3KNBA 1H3VA 4NI3A 4RMBA 2Z8WC 4WZ9A 2WWKT 4I3RH 3ZSSA 3TJEL 3MNWA 5D2LA 4F9LA 1Z9NA 5HGAB 1ZV9A 1JF1B 3K4DA 4IBLT 1CDIA 1MAKA 4WTZG 4R5VA 4YEEA 4FQLH 4PJHF 2VMJA 3OJDA 4KNTA 2FZ3A 3FN0H 4H13C 4FQ1H 1DJIA 5KBPA 5IMKB 5ABDE 5T1LA 3RPKA 3T4AA 4DN3H 3Q5OA 3DA3A 1PZ5B 5GHWH 3TNMB 3M07A 3HCVA 3TIDB 4OZGA 1UATA 5F6HJ 1KIRB 2DWEA 3UBXI 5HDBE 5TQ2L 3GQFA 3UBXA 4KVNH 2W60B 3LZNA 4O9HH 3NABH 5D6DA 5DA4A 4G42A 5JW4Q 2SODB 4FXTA 4FXKA 2BNQA 1UXWA 3Q8EA 1KBPA 4WI5A 3MLUL 1JV5A 2GY7B 3S96A 2F1EA 5CEZE 1JNNL 5I1LB 4HAGA 2GC4C 1QFWI 3FFCB 3CXDL 3EH4B 5B7MA 1ZA6B 4YLQT 1ZKAA 2PMZA 3TTSA 1KCSL 2X7LB 3MRQB 3RYMA 2APXA 3BSZL 3F2LA 5FM8A 3P9MB 1MFCH 3N91A 1YNKL 2MNUA 3HOEA 3QXDA 2WZ6A 4QRSB 1TZIA 1HQRB 3HBQA 4OGAC 2Z92B 3MRJA 4G8IB 1X5IA 3TBCA 2CALA 2VLMD 2FX8L 1IL1B 3VXMD 1QKZH 5K9JL 2WM0A 2K8MA 4PJ7E 5MI0B 2LE9A 3GZOA 2EH8H 2F1BA 3B2XA 3L4VA 1RVFL 4FFWC 3CU1A 2YK1H 2IWEA 2ZT9C 3FRPB 5HTSA 4ANUA 3FB5A 1KLFB 4HGWA 3NOIA 4K3DH 3GT6A 4XO9A 4QRTA 3UZEA 3FO0L 4NGHH 4P23A 2VQ1A 3V0AC 4IIQB 3O2DH 5JO5B 3BDBA 3DX6B 5D7LD 4JPWH 3SGEI 5FLUA 2BFVL 5D1XB 5E8PB 1NQBA 1OGPA 4L9DA 4ONOA 5I0ZA 4RIRA 3SBWC 3WD5H 4KO5A 3PHSA 4YLBA 3V7AG 4R3SA 4HK0A 4IOIB 1ZWIA 5JOPD 2X10A 3H9SE 1F4YH 2EEBA 3CZSA 2FYVA 3L3HB 4OCYL 2X89A 1U41A 4A39A 3IB4A 3VFSB 1P4LA 4LSHA 1OXYA 4QNPE 2Y24A 1I1AC 3WE6B 1JPGA 3CPUA 1WAAF 5BV7C 2FATL 2EKSB 2RCSH 4GFXA 5DRXA 3ZL1A 4Z8FL 2XCMC 4C4KO 3JYCA 4AENA 3BIKA 3HLKA 4MAYA 4NSKA 1T4KB 3HFML 2E7LA 3QIBC 3RGVC 5C07D 1LQSR 2Y7LA 1KCLA 1Z9MA 5INCB 5I8EA 4NHCL 3LKOB 1VACA 1HWHB 4FC3E 4HG4J 2VDQL 1JAEA 4OJAA 4DP4X 5LXVA 1TZHA 2H7WA 4ODHH 4OD1L 4R4BB 3WJJA 4Q2ZB 1UH2A 4W9KC 3ARBB 6PAZA 1K4CB 5F88B 2KDYA 4IK6A 2E9GA 2IPTH 2BSTA 4WUKH 4MXQC 2Z34A 3B5GA 1U4EA 1P6AB 2VDPL 4L5FH 4M8QA 5PCYA 3VB9A 4LPUA 4PJHE 2YPLB 1ZGLB 4EDWL 3EMNX 3DROA 2ZOOA 4EJ1C 5CSBA 5D93C 3SSGA 2MIZA 3MUGB 1P5UC 3PGFL 4FQ1L 4JRYB 4NJ9H 3H54A 1RV6X 4Z5RB 4DN4H 2D31B 4I85A 4LLMA 4ZW5A 2V9RA 3WYRA 2VDLB 2XG4B 3BXNB 5EHFA 3PWJB 5EORL 4F8LA 1YUHA 4LLYB 5IT2L 2WXKA 1O0VA 1NPUA 1DUYA 1Q72H 3F00A 5BCAA 1CI3M 4XNUL 4ZQTA 3CHPA 1SEQL 2GITB 1IC1A 3QDHA 4QRRE 1JIBA 2J6EL 1ND0A 4G5ZL 2MEJB 2CDFA 3JVFC 4HZLA 1VIWA 4PR5B 1NANI 1KTLA 3B4NA 3U0PA 2HB0A 3JZ7A 5EO9A 1SVBA 5LBVA 4PJXE 3W9DB 4FQIL 3N2JA 2XJLA 3FH7A 3NQIA 3DIDA 2E9WA 1FLTX 2YMXH 3SZVA 4EXPX 2VC2H 5G5DB 4HFUL 3OPUA 4XNBA 3LSOB 3HRPA 4U3XA 3WNPA 1HI6A 2IGFH 5DUPH 4GP8B 5EUOE 4C4VB 4YSSA 2PPDA 4FA6A 3FO9A 4F7CA 3N41B 1IKFL 2EIDA 3WXWH 1IGFH 2IDTA 3TYGL 3TP4A 2AS5M 2WLHA 3RZCA 4HJ1A 4DETA 3QZWG 2V0AA 3QC5X 2Q20A 1HXKA 1FH5L 3MQIA 3B7UX 4I4WB 2NMSA 4HGKC 2JWYA 3MRMA 3GMLB 3IDNA 3MFGB 3PREA 1LO5A 5KN5B 5LJYH 5C0DA 4F91B 1GGBL 1Z7JA 4HPOL 2G5UA 3K8LA 5I1DB 4R7LA 2ZX6A 5IP4A 4FFZH 4IJTA 2G60H 1NAMH 1E5BA 1GYWA 2CH8A 4HCFA 4MB4A 5H37H 5JDPA 1Q8MA 1GAFH 1NGZA 2H0JA 4Y4FC 2ZOKA 3GSRA 1QVOB 2FX9L 5EFIA 4JRLA 1BOGA 2IGTA 4DERA 1BJ1J 5DVMA 2VR8A 1JVLA 4TUUA 3HMWL 1TQTA 1KTRL 3HZKA 3MJ7A 4YXLL 2VLKA 3F7VB 5E1QA 1XBDA 2NY5H 1LMKA 2R89A 4H1LH 4Z6AT 1R0AL 4WGKA 4X6DE 1H6EA 4MQ7B 4KR4A 1AOHA 4FI7A 4ACTA 1C1EH 2XTJE 5TF1L 3NA9H 3ARRA 1AJ7H 1D6VH 2CGYA 2YOAA 4Y2OB 3S37X 3QBTB 4KDWA 5GJSL 2H0EA 3MLSL 3MA9L 5DK0B 2R4RL 4GKNA 4HPHA 1EEZA 2C8NA 2XUWA 3LH9A 4PRPD 2CCWA 2N1KA 3G5ZA 32C2B 4R2GC 2OK0L 2F54A 1D7DA 2F5BL 4JDZA 4K5NA 2VLLA 5EEYA 4QOKA 4OJFH 4Q4EA 5I1IL 1EDHA 4WK2B 2WXMA 1OTSD 1YEIH 1QHOA 3C60A 4KK9D 3DHPA 3VFSA 1XF4A 3G5YA 4UT9A 1X9RA 1JZGA 1V3KA 2WBJD 4LPXA 3W11C 1C7TA 2ATAA 3IVKB 3IWUA 3QRGH 1P69B 2FHFA 5J4MA 4RMRA 2DBJA 5ECJE 2DLEA 3S3JA 2OW7A 4Y9FA 2WWNA 5D1XA 1JXFA 1LP9E 3SYBA 3APDA 3WL9B 4LBEA 2ZUVA 4NHCH 2BNUB 4F58L 1CDBA 1WAAA 3BP4A 4XNLA 3NIFB 5AOZA 3IGUA 3NK4A 4YE4L 2CRYA 4XNMB 4AZLA 1NDGA 3ESPA 1N19A 1U8KB 4LOUD 4G42B 4OF0A 1XH3A 4ONGH 5E8EA 3W0WA 3LPPA 5A3ID 3POQA 1NCOA 3K6SA 4W81A 1N0XL 5AVTB 2HCZX 3H9SD 3MLRL 3MAWA 4WHCA 5KG9B 5EZOH 4PLNC 4ILDA 5DK2B 1GIGL 3PF2A 2PCFB 3DNKA 3QQ3B 3EJQA 4FYQA 1YSOA 2E27H 3VZTX 3DTXA 4GG6E 2AI0L 4JY4A 4UNUA 4YIQB 4PJCA 1FO0H 1UZ8A 3QUZB 3VXRA 1CICB 5SWSE 2C1PA 3QXAA 2ZSWA 1FYTB 4S1DC 2YQBA 5CJXA 3EOAB 5E99H 2EDEA 1GOFA 1Q9OA 3O9WA 2X4SB 4TNFA 2HJKB 1OGTA 3EXJA 3KYNB 3L4CA 5KUMA 2O6PA 4HV8B 1ORSA 3CDYA 2I27N 1FNFA 3UIYA 1Q0YH 2AVGA 4PLJC 3TPUA 2EADA 4B9CA 3SGKC 5BZDB 1BFTA 2W07A 5FGRA 2O5XL 4JFYB 1FORL 1LMIA 2IAMD 1DYZA 2DYSB 5DZJA 2MOQA 3EFOA 4O02A 1YQ2A 3LS5H 3DYOA 1N6QH 1AXTL 3OKDB 5E08L 3S8FB 3QQXA 1F2XK 4IOFC 1B4RA 2J6WA 1OAQH 3I75B 3WI4A 2NNAB 4CJ1A 1YC7A 5L2JA 2C9PA 4MD4B 3SDXB 1PZDA 3V4PB 2FGZA 5E5RB 5E6YA 3SOTA 4YZFF 3ARWA 4WJG3 3CFUA 1KB5L 4PJIE 1VCBC 4UYQA 4WI3A 4N26A 4OZHF 3EBIA 4D2NA 3KLAB 4JFQB 1R5VA 2BY1A 1QTSA 1BFVL 4DWHA 4H2AA 5C6TL 2PXYB 3U83A 1QWUA 4D3CH 3MX0A 4EKXA 5FV1L 1WT5A 1CBVL 2AC0A 1ZT4B 1J8SA 4PVMA 1TTUA 1U6AL 43C9B 5EN3A 2EDRA 3DX4A 3QXDB 4LCUB 1CIDA 3PIQA 4QRSA 5DJDA 1WHOA 4NT6B 2GSGA 1JZ3A 3V52L 4NN5C 1PJ9A 4ODSH 5H94B 4YHKH 2B2XL 3ZUCA 3PLYA 1JUFA 2XWXA 2JNZA 1G7LB 1G9NC 3VFGH 1CFMA 4CNIA 4A7UA 2AABH 1KGCD 5CGTA 4F7CB 3ABLB 3DUSB 2XQYG 3T3PF 2CUIA 1YDPB 3W2DL 3D0AA 5KOMC 3MSPA 3PDDA 1KIPB 1PS3A 1G7HA 1P2CB 1T22B 2ITFA 4BGDA 2VIRA 3NACL 4N2AA 5CMAA 1A2YA 3KS0H 5KJRL 2VISB 4PVNA 2PXYC 4HXAH 3VM5A 3O6KL 3EJZD 4LSVL 4OBSA 1G7HB 1JXGA 1T22A 3ZE1F 5JHDB 5I0DA 5F72S 1XL4A 1AC6A 4BE6A 1AG0A 1WBZB 1RK1A 5EZIH 3G6JA 5CIPH 3LXAA 4MA7H 5JNYA 4KHTH 3UTOA 5LB1A 1JPFB 1PLCA 2CDGA 5HPMA 1M56B 4XMWA 3D1MC 4LCWD 5CR8A 4Y19B 4HIQA 1NBVL 5ACLA 4TNWK 3UP6A 5DJ6B 4D0BB 3A6OA 1WV7T 1HZHL 4JO4L 3ZTNH 2LHAA 1CC3A 4TSBH 4YHKL 4DQOH 2R7EB 1KIUB 2AK4A 3C08H 3NZHH 3VRLE 4CVZA 1NM9A 2X38A 2CR3A 4BRVA 3KYMA 4X7CC 1EJOH 1FAKT 1BM7A 2CIKA 5D70H 1MI5E 2OQJB 3IGAB 3UAAA 2NY7H 1GS6X 1OQOA 2Y0SA 5BRZB 2RQ8A 3PP3H 4LASH 2ZCKL 3SGDI 1PG7H 1OW0A 1NUDA 1A3RH 4GG6A 2OP4L 3PPSA 2P5WD 1NFDF 2CJ3A 2V33A 3DV6B 4R8WL 1RLBA 3F6JA 3FUKA 3NIFF 3DV4A 5BUAA 3RWCA 2GT9A 1HIML 4YZWA 2WSKA 5AOKA 5I8EB 2VDML 4L1BA 5F21B 3UEZA 3VGAB 3GMMA 1HYSD 2WVUA 1RZIB 2QKSA 4L1LA 4WU5A 3ZKMC 4ZFZA 5JHDD 3SYSA 1EEYB 1S7TB 2QV4A 2X4NB 5DS1A 3V6OC 2EZ0C 1DJHA 1CO1A 3F64A 5DUBB 4FNSA 3FONA 3QUZA 4KX8A 2N7AA 3LEXA 3SOBL 1NIEA 4LEBA 3U4KA 5H35B 2IDQA 3NSYA 4KDTC 3UO1H 2FWSA 4NC1C 5CD5C 3QQ4A 2F8IA 2QELA 3C5JA 3PUUA 4K8RD 5IQLA 2CO7A 4LDEB 3VWJA 1LD9A 1SVZA 2CK2A 3BOVA 4I1PA 4PJCF 5IBUB 1YPZA 5D7SL 3LDBC 4LLDA 2NX5B 4RFOH 5JPNB 4NN7C 5KG9A 3EYVA 3S8WA 4FNPA 4P5KB 1NPNA 1SJXA 2A9AA 3SQRA 1MQKL 1T3FA 5AKVA 3SDYL 5DRWB 3V4PH 1A5FL 1NIAA 2EDKA 5C0EA 5TFSH 1L9NA 3IAGC 4TLTA 2NY3C 1AY1L 2XWJB 1B3JA 4HK3J 4B7IA 3LK3B 5CJ5A 4N2KA 2CGRH 4AYSA 2R29H 2HKAA 4ZMNA 3GSNA 4ZTPL 3PXJA 1G9EA 3G6JE 1I8KA 2WMPA 2HTKC 5J6SA 1UOVA 1WIUA 2NR6A 1D5RA 2CO4A 3VI4B 4LLVB 3K8KA 1FL3A 2E7HA 4KK5C 3FUEA 5IEHA 1XGTA 4E41E 1MKFA 4EUPH 4LLUA 4AEFA 1I8LA 1QUNA 2D7OA 2J1KA 1YEDB 2WP3T 4TSCH 4WSJA 1KXTB 4R90H 4N90D 4RMSA 4N6QA 3ESVF 4PCSA 3C60B 1S9VB 1MFUA 1OT4A 1YC8A 4YUEH 3EFDL 4E9XA 5FYJE 3KH3A 4JJHA 4NN6C 5DHMC 1FHNA 3FB7A 3GS7A 4OY9A 4XBGA 4LCWA 3EJJX 5F1OB 5IV2A 4UMSA 4HZ1A 2QL1A 2J12B 3GI9L 2DEXX 1GYCA 2XKUA 2F7OA 5F7NC 4K3CA 3FT2B 1I7TB 2V2TB 2WLKA 2M8XA 4H88H 3OHXB 1I3GL 4I0CC 2PYEA 1YMMB 2QADC 4OKVB 2NTFB 1LTXA 4HZLB 3KLQA 5DRNB 4PY7A 3ZN6A 1I53A 3E38A 1UUSA 2W0LA 1RUQL 4KUCD 1AZRA 1JYWA 3MYZA 1NDMB 1ZPUA 5CHNB 4ZW8A 4MD0A 1BYPA 3WENA 3LKQB 1GGYA 2H32A 1T04A 5L4JA 3VXMB 1ZTXL 5E7BA 4HK0B 4IOIA 2BMKA 1TKWA 1U2HA 2NX5E 4ZJ9A 3DRTA 1PMYA 2VXSL 4MNQD 3QEHA 1PZ3A 5FHAH 5BV7L 1J5CA 1OLLA 2R4RH 5A2BA 2FD6H 3QUZD 3DHMA 4G8FB 5GJSH 3FU7B 3QUGA 4WFGD 3FFCE 4Y5VC 2Q3AA 3EOBA 3SJVD 1J5DA 4RGOL 3SYAA 4LHUG 1Q1JH 4N22A 1N0LA 3DRTB 3L08A 4FQPA 4KMTH 5D8JL 5AKSA 4R7DA 3GBLA 5CFAA 1PZUB 3U36A 3UG4A 2YR3A 2BM3A 2WQWA 3ARDC 2XQYA 2V9TA 3VWKB 5C3LD 4QXWA 3FZUD 4KVCL 4RBPK 2BNQE 2WSPA 3B9KC 3AC0A 4NC1E 4PJIB 2BSRB 4MAZA 2P5EA 3IETA 3EGXA 2BXZA 2MHAB 3CXHK 4NRXA 1WDAA 1CE1L 2Y06H 3EOAA 4NQXA 1KJVB 5DA0B 3U9PH 4XVTH 4V1DB 5AB0A 2IBGA 5DRXB 5EU3A 4Z7WE 2RIKA 5GSVA 3RPIA 1F56A 5I76B 1JHTB 4H1LB 4PJFB 1MCPH 3H53A 3VMOA 3W38A 4I0PD 4YSDA 3KPRD 2G30A 5IOPA 2X9KA 3OF6A 4BFRA 5MEND 3D51A 1FG2B 5FYJD 5K59F 3P4LA 4PJHA 3FT4B 4AEIL 5KAFO 2HJLB 2BXYA 2BFGA 2VDOB 3DSFH 3TA4D 1GZHA 2W60A 5AOLA 4OLZL 4M6AA 2XZAH 3LOWA 1JPST 1TTCA 3MRBA 4PJAA 3MRRB 5A16B 1U36A 2JB6B 2E86A 4N8CH 2NY1D 1CTNA 3HS0C 1FYTA 1VKXB 4QRAA 3VZWX 3FKUS 3HZ3A 4U0RC 4QXUL 1RL1A 1TZAA 3QA3A 1WWBX 1U3JA 3NZHL 4XOCA 5BRQA 2B8OT 2XN1A 3A4DA 2GJJA 4G8AC 4XXWC 5G26A 2WXJA 2BWDA 4XNAA 4FZMA 1H6S1 2YXMA 4QOKE 5G55A 5L8JB 4Z7QB 3Q06A 2DLFL 4D64A 1VADB 1X4YA 3DV4B 5EOQH 3QR0A 2A7BA 2QKIC 3SDDD 1RUAL 5AZEH 4J23A 4PJ8C 4ICWA 1UA6H 3RY6A 3BH4A 1S5HB 1RMFL 2RBLA 2HJFB 3FMGL 3L3OC 4U33A 5EIIG 1X9LA 4KK5D 4Y2LA 2I26N 3HNSH 2YUVA 4QRPE 1ZHYA 1OPFA 4OCSH 1X5GA 2JK5A 4OCWH 1TU2A 5BS0B 4OGQC 3DA4A 3CSFA 2WNXA 4FJZA 4H8QA 5I5MA 1J0JA 4JCLA 2CA4A 3ZTDC 3BSHA 2I9LA 3N1GC 1LL1A 1JWSA 3L7EB 1P7QD 1NFDB 2A6IB 2YD4A 4MYWB 9PCYA 5IROD 2OCCB 3QIWA 1EHLL 1A6TA 4RGND 4YHOH 3ABZA 4FULA 3RIFF 5I6NA 3LZPA 2A9DA 4B0MM 2WLIA 5B4MD 1BVLB 2A6KA 1JRHL 1IM9B 4LPTA 2X3CA 2ZF9A 4JZJC 3BQVA 4OM1L 4L4TA 2GQHA 3D25B 4GUOA 1SXCA 4YHPA 5IVXB 1YY9C 5C0AA 1I9IL 2JKXA 4Y5VA 3TVMC 1IGML 4AL8H 1GFMA 1NGYB 2L7UA 3ZOAA 3R7RA 4IK7A 1WZ1L 3VI4A 1M7IB 2EZ0D 1XF3B 3KYMB 2OR9H 3WXVH 4KRLB 4KROD 2D7QA 4HUUA 4LRIC 2NQDA 2XPYA 3F6IA 5IVXE 1F6FB 2NZ9D 2JB5L 1A6UH 3FSWA 2Y3NA 4PJ9C 4KI5D 4UOQA 3FRPA 1S7UA 3QDGB 2IQAA 2NUTB 3F6LA 2J1XA 1FQ9C 5I18H 3T6ZA 4Z0BH 3D5OF 4X5RA 2QPDB 2Y9RT 1SNRA 3V9FA 2F61A 2QQLH 1CE6B 2GBTA 3AT8A 5ALBH 3TYFB 3ABGA 3WD5L 3HWBA 1K3IA 2K70A 3HAEB 4ZO6A 1LO0L 3HRZB 5E95B 1AH1A 1DANT 1DL7H 5LNGA 3R8QA 3NPZB 2O4VA 3GS0A 3FO1B 2XC8A 3VGHA 1UEMA 1BF8A 5KVMC 3GGWA 3T8MA 1ZT4A 3L7FB 3VYPA 4Y2DB 5I28A 3C6SB 1XTMA 4PJBB 2WIIB 1NCGA 4ZMOA 2EP6A 5T1LD 1XGQB 5A7BA 4DUXA 4N9GA 4G82A 4XGZB 5HHNB 3A6BH 2PP9A 4F8QA 4EOWL 4HISA 4AGOA 1HSBB 4FTVE 2OFQA 1CYGA 4IGBD 1X5FA 4YSAA 1U0QA 4YEFA 5JDSA 3G6JF 3ARUA 3ZE2E 2A1WL 4A7GA 5CEZL 4KKAD 4LVNC 1HNFA 1T80A 3GSOA 2V3FA 4JFEE 4UT6A 2MNWA 25C8H 4X4KA 4YL4A 2VR5A 1TYRA 2PPCA 1RK7A 4HA1A 3K71A 2MHAA 5FPIA 3QZPA 1M9WA 3MJ9A 5E99L 1FVCB 2GSIB 3GHBH 5KVFL 4NO2A 1FL5B 1JGLH 5I8OL 4PR5A 4ZOAA 5ESQB 1P7QA 2Z9TA 2H5UA 1FFOA 4L4VD 15C8H 4U1LB 1T1LA 3B5TA 4MBOA 3BD4A 1RU9L 3IDYB 3RBHA 1AS8A 1DQJA 1MCJA 1RJYA 2PWGA 3MN8A 4RSYA 4BA0A 1N0XH 3I3DA 4W9HC 3NIDF 5FFGA 1UXLA 1NDGB 3E2HB 4K5MA 5DZPA 3CFCH 4KKNA 4U1NA 5DTFA 4X80H 4JRFA 2B7DT 4L4TD 1X5HA 4LLWB 1IC7H 1UZ6E 3CN2A 3ES6B 1TTAA 1E9QA 1BMZA 1F1DA 3QJXA 4G7VL 2GT9B 4JG9A 4LLMB 5E9DD 3FXIC 2AITA 4I48A 3MV8B 2VN5A 2WLIB 3IFLL 4CL7A 2N4IA 4WO0A 4Z9KB 3GMLA 5AZ2L 1G84A 1BQLH 2P24B 1DQMH 3HN8A 2DM4A 5LLIC 1DLHB 1A9VA 2F53A 4NP4H 2WQRA 5HI4C 1BX2B 5CHNA 3ROOA 4BK5C 4NJAL 4IRSB 5JW4M 1GVIA 3C5SA 4ELME 2AERT 1OGSA 1BBDH 1OZUA 1OD7A 1PLGL 1OM9A 1OW0C 1TF4A 4L4VE 3P69A 3K6OA 3MRRA 5A16A 4OIAA 5KVDH 4PJ5B 4OCWL 3MV7D 4OZGF 3MRIA 5D7IB 3ABMB 1JZDC 1S7QA 3VD5A 4B53A 4GEJA 2E9IA 1IAIH 1SQMA 4ZOBA 2ZX7A 4YXHL 3RNQA 3GMOB 1M57B 3UBFA 5F3BB 3OKNB 3QGVA 4FP8L 2QT6A 3PWUB 4P46D 4D8OA 3D39B 2F1AA 1AFVH 3I74A 2WMPB 1T0MB 1BZEA 4PLJD 2NY0C 4ABWA 1U9KA 1MHCB 1XR8B 3KPQB 3GZKA 4HCRA 2AMGA 2J88H 5CILL 1MCEA 1Y0LB 1E67A 3Q2WA 1PIFA 4HPOH 1M3JA 3FULA 4FQXB 3UG3A 4A68A 3IBEA 4XN4A 5EU6A 3EGSB 3TJHD 5EUOB 5TQ0L 4AOFA 1I1CA 1O75A 1A1MA 3X12B 2R4NA 5D2LF 3I6GA 4HH9A 1BQ5A 1B0RA 1MFAH 2A74A 2QHLA 3QI9B 4J3OD 4NP4L 4K3EL 4U3SA 4XBEL 4KXZI 1A7PH 2P44B 3RAJL 2FIKB 3QPXH 5SWZD 3Q6FA 3REWB 2DQCH 2FWOB 2EE2A 4G9FD 3FB5B 1CDJA 3GRGA 2GSGB 1XSOA 3ISWA 5A3IC 3EH2A 5FA4B 4JQXA 1A65A 3WFBH 4OV5B 1QLRA 1DE4B 3BE1H 4GKZB 3P73A 4PRAA 4JRXB 1PIGA 3DECA 1UYWL 4OAWA 3T09A 4JQIL 1CURA 2R2HB 4N0RA 4MJ6A 4FCHA 2VN6A 4TSBL 1S7SA 5FYLD 4JZJB 4M3KB 1IZKA 1W2KT 5HJ3A 4IKNA 4N74A 1JE6A 1XXDC 4PG2C 3OAYK 5F7MC 3G5ZB 5FVNA 4PUXA 3S2CA 1SN5A 4PFEA 5EOTA 2CJSA 3VXQA 4A6YB 1N0LB 4H0GA 1F2QA 1WT5C 2MPAL 4PBDA 2ICEA 3OLEA 2CDEA 3C2AH 4OZFB 4YHYB 4KK9C 2A73A 4UAOB 5D5MF 1OTSC 4KMTL 5D8JH 4PPTA 4R96A 2WJ5A 4XP1H 3SQBB 3QNXB 3HUJF 2CCVA 3DX0A 1A7BA 25C8L 3AA0A 5I75B 1NCCH 3CFDB 4R2GD 1NBYB 2AANA