4AYEC

Structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 1 e283ae304a mutant
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
243
structure length
243
Chain Sequence
GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAAKGSYSLGIFGGKAQEVAGSAAVKTVNGIRHIGLAAKQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords COMPLEMENT FACTOR H
total genus 55
structure length 243
sequence length 243
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4ayeC02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ayeC01
2LFUA 4AYNA 2Y7SA 3HOLA 2KC0A 3UAQA 4O3XB 4U9CA 4AYEC 4Z3TA 3VE1A 4QQ1A 3HOEA 3V8UA 2KDYA 4O3ZA 4AYMC 2W80C 4O4XA 5EE2A 1YS5A 4O4UA 4AYID 3KVDD 3PQSA 4O3YA 2W81C 4AYDC 3VE2A 3PQUA 4O49A 5T5FA 4O3WA 2YPVA
chains in the Genus database with same CATH superfamily
1BMZA 2ICES 1FORH 5HJ3B 1O5PA 1IAII 1OE3A 3MJ9A 2E56A 5HYQB 1VIWA 1KYOJ 2FK9A 5I1EL 1NCJA 1VENA 2KYIA 3C6EA 3JWOC 5A6LA 4NO0A 2NRDA 3BP5B 1E4WL 5EA0H 1KCUH 3AACA 4MASA 5IESL 5JDSB 1JYVA 3EYSH 5GRXG 3G08B 1KCVH 1A0QL 2NY4B 4FKHA 3ARGC 4LSQL 3IRPX 3PWPA 1NEPA 2CR3A 2A3TA 3FU9A 2H1LM 3ABLB 3X12B 4JFBA 2OTUB 1CFQA 4WW2B 2PPAA 3RGBA 4M5SA 2R4NA 4R7LA 3TM6A 3D18A 3KYMA 2NY2D 1AXSA 4FL4B 1KPVB 1T2QH 2FATH 2OXHB 4XMKH 5HHMD 5K9QG 5JHLL 2ZZUT 1AKJD 1N6QH 2BVOA 2F54D 4L2YA 2B1HH 3QH3B 4P46C 5BRZE 1RZKL 4P5SA 2ZPKH 2HRGA 3OHXB 4AJYV 2W1NA 1WYJA 2QQKL 3SHSA 1OCCB 2Z8WC 4WKXA 5IUCA 1PF3A 1MVFA 2NSQA 2GSIB 4G9FD 3D09A 4HGMA 4LVHC 3I6KA 4YDMA 1Z3GH 5LCVH 1DJWA 4GAAA 2J1KA 5ABAA 5J1TC 1UTDA 3WJMA 5GISL 3AA0A 4YDNA 3IFPA 2XTJD 5I8OL 4OCSL 5JUEH 2HFEA 5DJDB 5E8EB 4BH8A 1CBVH 1AQ8A 3MR9B 4X6FA 2FJGB 3SGJC 2ZF9A 1IQWH 4N0RA 4P05A 1SDAB 4MAUH 5E4IA 5EZJA 3TEUA 3ULUE 1AE6H 5J0BA 1RHFA 5D1ZC 4K94L 2WC7A 2VDML 3ME0A 2L7QA 1GZQA 5JORA 1PZBA 4ONGH 4Q9RL 5FM8A 3O2WL 3P40A 4X5XA 1RUML 1U58A 5IQOA 4IMLA 4D9QD 2F0CA 5EU6B 3US0A 1GTNA 3T71A 1QJ9A 4UT6L 2WW8A 1W72H 5EFIA 4XNZC 1CYGA 2E7MA 4FA6A 3EDDA 1KGWA 5KZCD 5IJCC 5D7LE 2X44D 1PZ5A 4GXUM 1ZSDA 1F5WA 3V6OE 1CGVA 3I6GA 5FYJE 1NLBL 1QWUA 2KPWA 5D7IE 4LCWE 5IMMA 3QQ4A 3FH5A 1D5XB 4NP4H 4IBUA 4I2XB 3VRIB 4QTIL 2X87A 2NNXA 2NY2C 3PU7A 2G3MA 3KPQA 3QPQD 4HQQL 5CINL 3K7UA 2ZTBA 3F12B 3TCXA 3QFDA 3N43B 4FG6D 5J3HD 4F5CE 2IALB 8CGTA 1CTNA 3DX6B 1QLFB 1UCTA 2H4EA 4UDTA 1UD5A 3FSWA 4L9LA 5C7XL 4YBQC 4I9WE 3VXUB 2FYYA 1O5DT 4PQXA 1JF6A 1OCWH 4QRRB 4XHJD 5D7SH 3CGTA 3WEBA 3LK2B 2EECA 2ZG1A 3F6IA 3QEQA 1IO4C 5EE2A 4RGNB 4Q4EA 2C3VB 4K7PH 1AH1A 1DUZA 1IFHH 1RUPL 3EBGA 4RH4A 1WG3A 4MMXB 4UCFA 3HI1B 4RWYL 2ZWSA 4QY8A 5EIIG 4WEUD 1YN6B 4R97B 5JW4N 1MXGA 1PZSA 1QACA 2XN9B 4NZFA 5CMAA 3UZEA 3HZYB 1OP5K 3ULVL 4Z0BL 2XN1A 1EVTC 1NIBA 1GC1C 2YHGA 3QQDB 1EUTA 4U1MA 3D33A 2VLLB 1FO0L 2ERJB 3RZCB 1HQRA 3UYRL 5BXFA 2YARA 2EUZA 3JYBA 5I66A 1YEKH 3KBFA 1CDHA 1JFHA 3GMOA 4DUWA 1J10A 4P8QA 2QLYA 2VDLB 4P2QD 1TPXB 1CCZA 1L9QA 3T0ED 1AY1H 3CVHH 4Z76A 2NTSP 1E4XL 1TXKA 2AXJA 1B4RA 4YDIL 2BNQB 2J55A 4MA7H 5IIEB 3L45A 3CPLB 1ED3B 1GZPA 3WKML 3GMNA 3OXRA 1WUNT 4U6HA 2DL2A 2X38A 4FTVA 3VI3A 1QATA 1E9QA 3I9GL 5GRWA 2WKOA 1A7NH 3DOSB 3LRHA 4HBCH 3NSGA 4FG4A 3H4HA 2BC4A 4Y9BA 5AKSA 1TZOA 3U0PB 1CLYL 1IGCH 1T7WA 3EJYD 5ADXL 4LPWA 1DANT 5JHLA 1MWAH 2R29A 2R0WL 1DCEA 4XNUH 4ADJA 1F11B 1OPFA 5DD5H 4BH7B 1M4KA 1EFQA 3BHBB 2YAHA 3ZRSA 1EO8L 2VRAA 2XE3A 1G9MH 3U4AA 3ARDD 1HYSC 4D65A 1PD1A 3DYOA 3TEZA 3RVXC 3ZY7A 3MRQB 4HIXL 4LLUA 1ZA3A 1CGSH 4M7LH 1QAWA 2B1AL 2VQ1A 5C09E 2WXHA 4YHKH 1CE1H 3AAAA 3QJRB 2OMVB 1WCBB 3SSGA 4ZMAT 2L3BA 3EYOA 3QDJB 2A6DA 3MRHA 4DO5A 1PIGA 2KLSA 4DGVL 3REVB 5ITFA 5KSAD 1ZE3H 2W95A 2GI7A 1THAA 3NA9L 2VAJA 1HTYA 3NSJA 2JELH 4OSUL 3GPSA 4C69X 1BFOB 1IC1A 5B5EO 2P3YA 3ARYA 5F3BA 1ID5I 1FAKT 3FU7A 1QLRB 1TEGA 3H55A 1ET5A 2XG5B 3MUZ1 1SDDB 4J8RB 2BXYA 4KJQC 2H3NA 4FABL 3EG9A 2ZAIA 2EUVA 1IT9L 1XX9C 3QS2A 1LK2A 2X4PA 3QIUB 1UWEL 4IOIB 4GT0A 5EU7C 2CHWA 2W9DH 3AABA 5CUSH 5GGRY 4GP8B 5DJZB 4ONFH 3O2VH 2EDMA 5L0QC 4LOVA 1J1PL 2XOTA 5ANMA 1NFDB 4MDJB 1IFGA 2BOCB 4IDLA 3ULVE 2DN7A 2XT1B 1TQVA 3E1ZA 4PRID 5HYIA 2OZ4L 5HHNB 5H2BA 4GXFA 1K3ZA 1RMFL 2IWEA 5GGUB 3RTQA 4G80B 4PR7A 1MFBL 2EC8A 3SQOH 4OJYA 1B4JH 2GK0A 4I0PB 4IBLT 2CXGA 2PETA 1P4LA 1FGVH 2AP2A 2DH3A 4F8OA 4RMSA 4NZTL 2J12B 3E8UH 2J20A 1EEQA 3AUWB 1XGUA 3ARDC 4GXVL 3LN9A 4ZW3A 3UABA 1J8HD 4GG8B 4R9HA 3GSNA 3WEXA 4PLJC 2CKBB 4XMLH 5DRNB 5F89A 1A5FH 1PYWA 2KL6A 2EXYD 1ETJA 1V7NL 2R56L 4LCCB 4FP8H 3HC4H 3RGHA 1A66A 5TQ2L 2ZXWB 4NNYB 2OAAA 4GAJL 2X4UB 1NCOA 1T5WA 4TUKH 3L3JB 1VFAB 35C8H 3ARFC 1GPOH 1P4BL 1QQDA 4OD2A 3MACL 1T1ZB 3KJ4C 2RGSA 4P9MH 4L3AA 1S46A 1F1GA 2AC0A 5F72S 4UV4H 1CFQB 3RE0A 5GGSY 2CK0H 2VSMB 1RZPA 3IDNB 2CLRA 3KPMA 3O8XD 2EVHA 4Y1AB 1NC4A 5IFHL 2NX5A 4YDVB 3VFOB 2LFEA 4PCYA 1XCTB 1DJSA 1KJVB 1NCCH 3L4CA 1R19A 4KUCD 4OCLC 4AGOA 4OKVA 4ODBD 3GSWA 1L3WA 1CGYA 1Q90A 4NBXB 2F53B 2ZKMX 1X5IA 1BX2A 4X98B 3NIDF 4L2LA 2Y36H 3FONB 4Y5VC 3WO3B 2BWQA 5EU3A 4N22A 3MCG1 3MLTA 3T0VA 1M71B 2XU9A 4BE6A 2KZKA 1KEMH 3D3VD 2AABH 2X4OB 2JIXB 1I85A 3GYRA 5AWNH 3U6RB 1XXDC 4N2FA 4R2GC 5IZ7A 4AIEA 2UZIL 4R4ND 1ZVSB 1HJCA 1WHPA 3FO1A 3QZLA 1I1RA 1HI6A 4LARH 4KJWD 5IEHA 1DQQA 4GXUN 1M05A 3HRZB 4AGNA 4PUBH 1YQ2A 1P4TA 2V4LA 2P8PB 1F6FB 4P5MB 5EZJB 4DCQB 3LS4H 3DYPA 3ZE0E 1RIVL 1MPAL 4D8OA 3QORD 3PV6B 1D3CA 5GTHO 1OTSC 3LEVH 1FRGL 2J8UE 4BZYA 2IVFC 3HN5A 4XHJC 5DJ8A 1KBVA 1GAFL 4DZ8A 1XH3A 2DWEB 2X41A 3B2UC 4TQ8A 3RFRA 3I2CL 5C0BD 3S36L 5GRVK 4WHCA 4XTRD 4HIHA 4DZBA 1T0OA 2IBZY 3DV6A 3DDFA 1U8IB 2UVFA 4FRTA 3N55A 4MD0B 2BY2A 4PJHF 4YXKL 1CYXA 4BWTA 4MD5A 5EORH 3BRFA 3RB5A 3Q6GH 4ZUUA 3T6VA 4K3DL 2Z34A 2BCMA 3D69B 4UZUA 2HLFC 4YE4L 2F19H 1HHJA 4ZUVB 3K71A 2LLNA 5MI0C 1GGCL 5AVUB 2PWHA 5H8DA 3KZ8A 3PXLA 2UWEA 2GSIA 3G5VB 5EU4B 2FGZA 3PHSA 4HS3A 2BSEA 3FFCB 1UOWA 1KEGL 1VGEL 4KPHH 4E5XB 3DX6A 3AREA 1OM9A 4BBWA 5GTIO 2X7LB 3O8XA 2NYYD 4OZHF 1FWXA 4JM2B 2ADJB 1U3HB 3DV4A 2AJZB 3Q5TA 1OLZA 3FT4B 4KVCL 5EDXA 5IB5B 4CU8A 1K6QH 1IAIL 2VLKE 3MA7B 4E9VA 1RUKL 5C0JA 2TRHA 1U8CB 3QNZB 3V9CA 5CEZE 4QOKE 1MXDA 1A64A 2GUOB 2WVVB 1INQB 1Q9WB 5IB4B 2WYTA 2A2QT 5IUSA 3V0AC 3AA7A 2QT6A 1AKPA 1OSYA 1QNZH 3HAEH 3MUGB 2ZNXA 4OVVA 2FLBT 4UWQB 4RAVA 1SLWA 1NFDE 2ESVB 1MRCL 3PL6C 4R4FL 3RWGA 1MSPA 3OGCB 3N40F 4J3WA 1Z2KA 1FE8L 4ES9A 2UZYA 5E6IC 2RIKA 1WZMA 1BZEA 2VYRE 3L1OH 1ZGLP 3BUTA 4X6CA 1MRDH 1LO0H 1TTGA 1BF8A 2D7MA 4XNMA 3IJEA 3KDPB 1E9PB 4L8DA 1MVYA 3VSUA 1JRHL 2YRLA 3MLVL 4WNQA 3T9WA 5CSBA 2F7IA 3TIDB 5TISO 4GBXB 5C08E 1YO4A 1U92A 3GT6A 1KELL 1V3LA 4DGIH 3VM5A 3EW3B 3BAJA 4G6FD 3BJ91 5IBLD 2IMMA 2KDGA 4FF9A 5A2LH 5IHBA 4LPXA 5DMIH 3A2SX 5IIEA 1AS7A 1WZLA 3GJFA 4POZC 2EYTA 2CIIB 2IV8A 4KO9A 1RP9A 4H25B 3KBHE 2YC1B 5J11B 4UB0H 1KTKE 4JE4B 3HPLB 4ZS6C 3TOPA 4ZUSB 1G0XA 3HMWH 2AANA 1NCNA 1VACA 4MA8H 1CDCA 5EBWB 4Y2DD 3UO1L 4G76A 4JFDD 2BLFA 3PDGA 3PORA 4X50A 4GFTB 4Y2DC 3WJMB 1LNUA 3HKZA 1IEHA 4JK0D 2F2HA 1ODUA 4DKEH 2VDRB 4ZFOL 2P43B 4QRQB 5AW1B 3JXAA 3HHSB 4ZFZB 1I4FA 2WJ7A 2K6ZA 1XMEB 4UBDC 3V52L 5I1AA 4GI6A 1KC5H 3LYRA 3HUJA 4FKKA 2X6UA 4X9GA 4P57A 1YY9C 5JO5B 1E3ZA 4JRYE 1MCSA 1UD8A 2VOTA 4H8WL 4WI3A 3W39B 3PGFH 2NZ1A 4QDGA 3K2UL 3MCKA 3MKKA 1T20B 5DRWA 4XCCH 3OSKA 3WIFA 4IRSD 3BH4A 2FRGP 3EIFA 2O6DA 1BMGA 1JHKL 1NGQH 1T5KA 4U6XB 1IZKA 1G7LA 4FTVE 2WZ6A 4YSOA 2FO8A 4XVJL 2XN9D 3QWQB 3CK0H 2JCCB 3O0RL 4IRSC 2EEBA 5LB1A 2JQZA 4E5XG 3GRGA 3M1BA 1JXFA 2Z64C 2AAAA 4WEBH 1QLRA 3V6FA 1C1EL 1E4JA 1MFNA 3DJTA 3L3DB 1RAMA 1KPUB 1YMME 2NY3D 3R06B 4L4TE 4QIRA 4Z95H 4Y1TA 3LB6D 1N4XH 2CA4A 2Z35A 3KS0J 1T83C 2EDFA 1RIHH 4JRFA 4M62L 3QIUA 3OSVA 3PHAA 1IC4L 4N0FB 4CC4C 4P2QB 3SPHA 2KBGA 1MFDL 1WFTA 3AMLA 3ECBB 3IU3B 5CS7A 2ZUQC 3E2HC 4L9LB 5ANHA 1KENL 2AJSH 4QXTB 4Y2NA 4O51A 3QIWD 3MUUA 1NWPA 3PNRB 3BIKB 4FG6C 2C1PA 3ILPB 5K1VA 4B27A 1JFQH 1RLWA 3G5YA 4JM2D 3FTGB 3MGTB 2ZAGA 3LRLA 4KKLC 3TPKA 4RGMB 1JUFA 5BO0D 3MROA 2ENYA 4AQ8A 4Q6IC 4D0CA 1KN4L 1KGXA 2Y2YA 3HBQA 3DXAE 4ATWA 4D0BB 3N1FC 4JQIL 2XACC 4CC0A 2WB1A 5LN4A 3ENEA 4MLIA 3JWNC 1ES0A 1A0QH 4JX0A 3ZYOA 1O75A 2BK8A 3WFHB 1CXFA 2MKWA 4HKJA 4JN2A 2ICCA 3HBZA 4U1MB 1MFAL 2KXPA 4PJ9D 4F93B 3T8XB 3FRPG 1QWHA 2IGFL 1GGYA 5K9JL 2PO6B 1LD9B 2ZOOA 2FWSA 4RFOL 4J1UB 5ID0B 2G75A 4DP9X 1JDCA 2NXZC 3OAUL 2GG1A 2IH1A 3UJIL 2BP0B 1KJ2H 5HTSA 2XWDA 4F57L 3DROB 5BVJA 5A2AA 3MRRB 1OPGL 3CMGA 3LKRA 4XVOA 1NKOA 4K7FA 4G2AA 3FN9A 1DHKA 3T6ZA 1DEDA 4AL8C 4AUUA 3F05A 3ZKXB 1UGKA 1AR1D 3G6JF 4LLYA 2RFXB 4GW1B 1THQA 3SKOB 2AEOA 4CVUA 3O4LA 4Q74A 2CRYA 3I3EA 1MCNA 3FO0H 4X7SH 4NZ8A 1GOFA 4GUPA 4I5BB 1HHGB 2DB8A 3WO4B 2XTJE 1KPRB 5IOKA 1FCCA 3DIFB 4K2UL 2EDEA 1JL8A 1XH0A 3CMOH 4W70A 1KGJA 1N64H 3KLHD 3ZDZB 3BN9D 2PYFB 2AJVH 3ISYA 4DGYH 4OF3A 2PN5A 1USZA 2OR8A 4MAUL 1FAIH 4NCC1 1XGUB 3NMEA 3RDJA 4BFGA 3PGSA 4DGUA 1ROCA 4OI9A 3QI9A 2XHNA 2CKBA 1BQLL 2O6CA 5IEKA 4N20A 3QJZA 2YPVL 4ZW5A 4F7TA 4WFFD 4MJIA 1W0VB 1XF1A 3FT3A 1ZVSA 5HI4D 3G6JA 3U1SH 2F08A 3IMBA 2JCWA 5DEGA 1S7VA 1SLVA 5EUOA 3WGUB 4E9RA 4ZPTB 3BGFB 5CSZA 4YPJA 1OGPA 1CDIA 5DSCB 4XCYB 2AQNA 3UZVB 3BP7B 1IKNC 1QVOA 3O9WB 4F91B 4M7JH 5KBDA 5CU9A 2A4CA 3BQUB 1DQKA 1IGIL 1LDPH 4XNDA 5I75B 3CZKA 4WTQA 3LY6A 1DSYA 2EAEA 3MTRA 4IOFC 4G6MH 3NTCH 2A9CA 1NCWH 3RWDA 1KDIA 4DO6A 2HFFA 2W60B 3MBXL 3FO2A 5IKCB 4MA3A 3CLFH 2PW2B 4HX1A 3QCUL 5LBSL 5E5UB 4RZCA 3OX8A 3NJTA 3VFMB 3PWVA 2AXFB 1UOLA 5C6TH 1NPNA 3B7RL 3EFFB 5TFSL 5K39B 2XWZA 1H6TA 4EQ2A 4BA0A 4FA7B 5C7XH 5I5IA 3EBHA 1QFUL 3MAWA 1A2YB 2GBTA 3Q1EA 1S5IL 2VN5A 1M71A 2EJ1A 2Y2TA 4N2IA 4Q14A 4TOYH 3DX8B 4NT6B 4QTFA 1AAJA 4EKJA 1CDJA 2K4AA 3ZZLA 4Y4KA 4BV1A 1MH5A 4J28A 3HZVA 4O4YL 4QHUA 5E0QA 2Y6SC 5ISZE 5C09B 4W4OC 3A67L 3NFSL 4OZFB 3HE7D 5HGDA 4HK0B 1LO4H 2WLLA 3T0SA 4K3JH 3O8XB 3QIWB 4WW2F 3OKEB 5CEXB 4FQLH 4JFED 4O4UA 1ZLUK 3UBXB 4QF1A 3F58L 4LCUB 3SPVA 4L8CB 4OLXL 1G94A 2J6EL 2Z6FA 5ICXA 2F5AH 3VE2A 3SZVA 2QFPA 5TGBA 2WLJA 2FE0A 1E50A 3K6OA 2BNQD 5FK9B 2B0SL 3P73B 1BFTA 1ZANH 5D5DA 1I75A 2XJLA 2Y9RT 5I0YA 4DKAA 2WN2A 4NNYA 1CXEA 5DJ2B 3GEFA 3MGOA 4G42A 4WKZA 5IOPA 4PV8B 5GGVY 5TF1H 5DFWH 4U2YA 3UADA 4B97A 1KYDA 5JQ6H 2GJZA 3VX1A 1CG9B 2FD6H 3HJEA 3K2IA 5B39G 2X05A 5I17A 2OXGA 2G2NA 4HWZB 5E6YA 3JVGC 3VFVA 1QLFA 1R5VA 4PJ5D 4YN3A 1MCKA 4UOW1 4N8PA 4L4JA 1L9MA 2OR7A 5HVGB 1A9VA 2YEZB 4PRPD 4L3CB 4B9GA 2BS71 1S7XB 5E5MA 4Z7OB 2V17L 3NPSB 3OKKB 4JQVA 4P2AA 2BVYA 2VLKA 1VFBB 4ORZC 1TJHL 4UYQA 3EXJA 5IJKC 1KJVA 1TJXA 4JZOA 3DBXA 1DUZB 4EOWL 2XXMB 3SYSA 4AZLA 5DJ0B 4B5EA 3OAYH 3FT4A 5D9SB 3V4PB 3BKYH 2CIIA 4KHTL 1C16A 2DZEA 4ZUSA 1YEGH 3C6SB 4JPSA 5E94A 2VXSL 3LNFA 3HZYA 1KIQB 5FKPA 4YZFE 2V8LA 4EO5A 4EI5B 2M1KA 1GY2A 3B2PA 4PY7A 3WTSA 4RDBA 5K33A 1DBBL 3GNMH 4NFBA 4KWUA 5DUJA 4YSDA 4G8EA 5D1QC 3CV5A 3EJUA 3W57A 4Z5RA 5HGAB 3QG7L 5G39A 4QCIB 4V11A 4PGDB 2VDNL 4JY5H 3A22A 3ZE2E 4BFOA 5T1LD 2CBPA 4G5AA 1M05B 2HKHL 1A7QL 5ELIA 4I3RL 4WFED 4M6OL 1GZQB 2KI6A 1DL7L 1FFTB 3J7HA 3LDBC 4M5ZH 2E27H 3MCLL 4XE0A 4R2GD 3VI4A 4Y8DC 2AF2A 4CADB 2O26U 1WRFA 2EH7H 1MFCL 3DVIA 3TWCL 1KV3A 1FFOB 5I1GL 2X4RB 2O4EA 5HYJA 1AG0A 2Z4QA 5IW6A 1OK8A 2XBDA 4M8UA 2CQVA 5EFIB 3WSQL 2QDVA 1Q1JL 4D9QE 3EH1A 1PSKH 2CMRH 2Y07L 4OUOA 3EOAB 2ADFH 1KGIA 4J7RA 3WIFB 1AO7D 3T4AC 3GP6A 4G8GB 3BZFB 2B08A 3AQXA 4N75A 1J86A 1ZHNA 1NMBH 2NY0B 5E2VL 4GJTB 3IMUA 1PDKA 3U36A 5B3JE 1I7UA 3BMVA 1ETZA 5EEXA 4YNYA 3O4LD 2ZSWB 1VGKA 1VESA 1GJUA 3P69A 3UX9B 4XMPH 4DP5X 2M26A 2VISB 3MV11 4XP9H 5HYJE 5I73C 2KZBA 1OZUA 4WK0B 1AGCB 1BH3A 3CDYA 4EI6B 3J8F7 4UU9A 1RZGB 4Z0XB 3BVNA 3QUXD 4MNGA 5J5EA 4E5XA 1F4HA 5I6PA 1T0MA 1YMMD 1ZMYA 2N0MA 2NXZD 3LK2A 1OQXA 4A63A 4JGJA 4E41E 4D5UA 2NW2B 4FNQA 4NZTH 3C75A 5IQMA 1JD9A 3MJ8A 3VXUE 5AAPA 2X2UA 3PUUA 4NUMA 3S35H 1EX0A 3AA1B 3M8OL 4ODXB 4JFYB 3EAKA 2OMFA 5J13C 1MCWW 2VZ3A 1JK9A 4TLKA 1UHVA 1UM4L 4Z3GA 3IT8D 3DDGA 3LH8A 2Y22A 1GGIH 2QKIB 3U9PH 4D0BA 4LF3A 1UCBH 3D3VE 3OD3A 2HWZL 2P5PA 2CH8A 2VLLA 4JFDB 2M07A 5CGTA 2V3FA 1HQRB 3TCTA 4U0RB 4R8WL 4QXGL 3U7WH 4TTGA 1VCBC 2VKWA 1DVFD 4E9YA 2Q87A 5AL8A 4FMVA 1C08A 2AEIT 4PS4H 5DHMC 2X4PB 5A16B 2G60L 4PJCE 5LNDA 2W88A 1ZT7A 3R06A 5HDBE 4BFBD 4B9IA 3WS3A 5D4JA 3TBBA 3DUSA 4HLEA 5DA4A 5T1LA 1X4XA 3BI9X 5I9QC 4ZFGH 1COBA 3QDMA 2ZCKH 4JPKL 5EZLA 3FQWB 4BE5A 4L18A 4PJEA 5PCYA 4YC2B 3QEHB 2QLVB 4FFVC 4H2CA 1S7QA 5AVQB 4ZUTB 1R17A 5BQDA 1H3GA 1QX1A 4JDEB 4NC2B 4OJFH 4WK2B 5D7JD 5JW4R 2JKNA 2GK0B 2YMOA 5D4IA 2JJVA 3K8LA 2V2TB 3G5YB 4I0KA 1U8JA 3MUJA 2DLTA 3UCRA 1QPPA 3K0YA 5HGHA 3NJKA 2Q20A 4NSKA 3FB6B 4EDXA 1ZXQA 4NRZB 2UZIH 4KRAA 4J3OD 3H2QA 3QNXA 4X9YA 5CZVH 4X8GA 5F21B 3GSNB 5IHUH 3M7OA 4HWEH 2ITCB 3L4WA 4NQSA 3QUYC 4OLZL 1CD0A 1T6VN 1VLXA 2ATKB 5LDSA 2YUWA 4QEGA 3FUIA 2OYMA 3OWRA 3IJHB 4LHUA 5EBLB 3LZNA 1QSFA 4UOW0 2Y1ZA 1YNKH 1I9RL 5DJCB 5F8RC 2OS7A 4XXCC 15C8L 4TLTA 2F1VA 3SDDA 4ZAKB 1D2PA 5DEGB 2CO1A 1XGYL 3WIHL 4DOHE 5ID0A 4YL4A 4C58B 3P3TA 2XICA 2WPGA 3BT2L 4P57B 1MJ7H 1M3JA 1BIIB 5KEZA 3QJFA 4AL8H 4ZMLA 4DP1X 2NY7L 2H26B 3HMXH 4KU1A 4QHKJ 4YE4H 5J9PB 2A83A 1L6PA 2JCCE 1ET7A 4JRXE 1G7HB 4K07A 3JV0A 1T4KA 2BS8A 4GYBA 3VA2C 4WJ5A 4AI7A 4MNHA 3F7YB 5T5FH 1G7LB 2RMNA 3VFNA 4J8RA 4FLHA 2IQAB 4LLQA 4YPGB 1H0DA 3HE6A 4JFFE 2H6PA 3OKDA 5CEZD 2NY0D 2K3TA 3SCMC 5TE6H 3WTWA 2BW4A 1II4E 3MXVH 4OLYL 4C56E 3COOA 1KEGH 4M48H 1JGDB 2HT4D 2NZ9D 2FAUA 3ASOB 5GS2D 2PO6D 3LZLA 5SWZD 5DC9B 1MY7A 1SLXA 3CVIH 3DJZA 5EPMB 4KMTL 4L8SB 3TJPA 4M93C 3DI2B 1KB3A 3CFIC 3K4DA 4KK6D 1DBAH 2V3DA 2VE6B 4PG2A 4PR5B 3AAZA 3TESA 1DQQB 4ORGB 2HJLA 2IIJA 2WB7A 4H2AA 5E23A 4BZ2L 3AU1A 2APWA 2YPLE 2NUPA 2PLTA 3CLWA 4TM9A 1KFGA 2D9CA 4W9JC 4NCC2 2BZCA 3OBAA 5E1AB 1HVXA 4F33B 1KIRB 2B8OT 5EOQH 5FUZL 5L88H 3RAJH 4OB5H 1IAMA 3I6LD 4FQXB 3NP3A 3LNHA 4MYPA 5G5DA 3VFUB 2YKKA 2B5IC 3BDYL 1UGNA 3ZUNC 4J2XA 3OJDA 3S5LG 4ERSH 3RLSA 3ULSB 1R3LA 3PPEA 4GNKB 4IU3B 1Q9FA 4TL5A 2FEJA 3SDCC 4HU8A 3EJTA 4OM1L 1GYCA 3H3KA 1CGXA 3RWDB 4DW2H 2IADA 1KACB 3EXLA 3E6FB 1N7ML 1RJLA 2RHEA 1NKGA 3Q5YA 1XAUA 3MGOB 4WKZB 4RJXA 1IM9D 2OLDA 3FT2B 5I8CA 3D6GA 1AG6A 1NBZA 3FFDA 3W3BA 4AMKL 1GFOA 4F8TA 2A73A 4HH9B 2IOMA 1A9BA 3SN6N 4ZNCD 4WHTB 1Z0NA 2Y06H 4AG4L 2E9GA 3Q3GB 4OUUB 3OMIB 2JB6A 2ROYA 5DMKB 3MQIA 3D85A 1ZHWA 4AGLA 4DPBX 1V7ML 3WY1A 2IBZX 1YC8A 4Y16C 1OAYH 4YLBA 4HK0A 5E5MB 4JL1A 4JHAL 4NQXA 2M06A 3RUGB 5GS0D 4WF7A 4YZFF 3EJCA 3G5ZB 1W16A 3BSZA 3S37L 1EHKB 4UB6O 4CN6A 2R2BB 4HHGA 4KROD 5KJ4A 4RIRA 3FCGA 3V9FA 4FQJH 5JPMC 4X4MA 4W9HC 1DVZA 1NBQA 3H42H 1TO4A 2ZKHL 1EAOA 2DQEH 3POQA 4AYNA 1KJ2A 4OKDA 3VSVA 1I8UA 1I85C 2HFGL 1WWCA 2K1MA 2I24N 3KEHA 5B21A 2EE9A 4JFSA 4LEXH 4X5WA 1SOSA 4JM0A 5T1MB 3GGWA 1OO2A 1BXXA 1WAEA 1ZWIA 1SHSA 1T7VA 4M4RA 5IW1B 3CHRA 2FQFA 2GFBA 4GSDH 4Y4FC 3SKUD 1W8NA 2KZ1B 4BGLA 1QLEH 4AW4A 3NRQA 2GEQA 1X5FA 1FPTH 2FWUA 5KZCB 3FQRB 4XXDA 4AE0A 3KPRB 2XZCL 4MJID 4XNMB 2B9BA 4HUXA 4OCYH 1G7JA 2XE1A 2IMNA 1KBGL 3HHRB 1FBIL 3R19A 1BD2E 4H1LG 4EF3A 4A2LA 1FG9C 4LHQB 5DWUL 3OB0K 1R5VB 1ZK5A 4F58H 1U92B 4HMEA 5E6UB 5HYJB 1TZ8A 5D96C 2WYZA 3WNLA 1U8PA 5L9DH 1E30A 4AYEC 1SNRA 5TDNA 4GQ9H 5MHSE 1MZZA 4FZEL 4U6VH 4AQEA 1N4XL 2Z3FA 3N44B 4PP1D 1S3RA 3G7TA 1M7DA 3NFNB 4MA3B 4D94A 5DC4B 5IQLA 3SOBH 2K78A 4Y4HB 4HS8H 4NO0D 3K71B 5SWSE 5J7CC 2IAMC 1SUJA 5F7KC 4EIUA 1QI5A 1OAKH 2LU5A 4LLMB 3DLQR 3NJGA 4FCHA 2X1OA 3QUKB 4YH6A 5FVNA 4LAJH 3S48A 1BVKB 3K19A 4PIRF 5LWYL 5TPWL 1EV2E 1G43A 2CCVA 32C2B 5MENA 3MI6A 1JXGA 4EI5A 1HIMH 1MAML 3O3BB 4AUYA 3CN0A 2X7LA 4WFHD 3V7AG 3C5ZA 5JIQA 4UU9B 2A1WL 5I5MA 5JOPD 3BPCB 5HGDB 1YN7B 3WMPA 4TS6A 2FL5B 1Q9GA 1FYHB 2CLVB 3EJYC 5BRZA 5IB5A 1KB5B 2XTJB 4HV8B 3N1MC 3RHWF 1ADQL 4JJOA 5C0BE 2Z7YA 3B2DC 1ZY9A 2YWYA 3LSOA 4LNVA 3NRFA 1N3NA 2V5MA 2XE5A 3HW7A 2MKLC 2KPNA 4AV4A 3N40P 2VMFA 1JPSL 4ODXA 4K71B 4C54A 1MI5E 3AJ7A 4BKSC 1S7RA 3FC8A 4TUUA 3CLFL 4XCNA 4IRJD 3F7VA 1F4XH 2WLIA 1F45A 4U6XA 2ZFGA 4Z0BH 2ESVA 3ABMB 1FVEB 5AG9A 1INEH 1P7KB 4P5RA 4G5ZH 4WRLA 4AK2A 1A1NB 1QPKA 3EH4B 1YSOA 3TBVB 4GEIA 5E8OA 3NUKA 4OBRA 4DN4L 4XN9A 1TZIB 1TMCB 1DVQA 5IOPB 4WDIB 4LLWB 2FJFB 3KD4A 4KZ0A 3WN5A 2CM5A 1KG0B 4YSPA 1BPVA 3VFRA 4N8UA 4XT1C 4M9OA 1G84A 3KCWA 3DURB 4N5UA 5IESH 1W8EA 3BZEA 3NSFA 2QVFB 4NO5B 1PKOA 2WWNA 4BSVA 1OAZH 3BPNB 5EU5B 1FIEA 1UB5B 1KTRL 1KFAH 3ZUCA 1N68A 4MS8C 2DWDB 1JOIA 2MCPL 4WW1A 3RWFB 4BQBA 1I1AC 4H0HB 3RL1B 4DF9A 4JNXA 1PFOA 2AKRA 3KPOA 4JG0L 4EN2A 2MHLA 2E86A 1AO7B 2P9RA 3RY4A 4PGCB 4WWKB 5IVZA 2ATPB 2LU3A 4NKIL 5JIHA 3KMDA 5FGCB 3RIAF 1E54A 2VRQA 4G6AC 2DOCA 1QR4A 3IRCA 2JCCF 4N0UB 3TA3D 5CD3A 3FSAA 2XJKA 4G71B 4F7PA 3T0EE 3GBEA 2BHUA 4Z5RB 1JGEB 4UNIA 5E99L 1KCLA 2Z93B 4V1DB 5H37H 4PN6A 1J9QA 4TUJA 4QHNB 4APXA 2NNFA 5L2JA 2VC2B 2EICA 4AYID 2APFA 4XPFH 5KYUA 3VSQA 3FUDA 4JFZL 4L0PB 2VXTL 3RVTD 2P44B 3AT9A 1IQWL 2E7BA 1X5AA 1IRAY 3LKRB 2R4OA 4FLSA 4XNYL 1DN0A 1FN4A 3VXSE 4ALAH 3SGKA 3PABA 2IPTH 5JXED 5C0ND 4TVPD 5DUBA 1KY7A 2BZDA 2DF3A 1U95B 1K5NA 5AYUL 5JR1H 2JCCA 2VR8A 2XSKA 1R6VA 3ZL4L 1CFTA 2W38A 4PJFB 3D05A 4R3SB 1Y0LA 1G7IB 1EAQA 4HJGB 3KYNA 4JR9L 3SOTA 1QMUA 1WF5A 4FTVD 4PRIB 2A6KB 5AVZB 4GIPD 1S6NA 2QPSA 5IEKB 1OTTD 5AD0A 5B3JF 3DZMA 1NZRA 2R69L 3QRGL 4YK4C 2AXTO 2CO6A 5J6GB 4MNQD 5CUSL 3EFDH 2P5WD 2Y3NA 3I84A 4P4RA 3UBXI 3O3AA 3CH1B 3PDOA 5HPOA 4BUQA 1MW1A 2WJ5A 4HUUA 3DA0A 2IOOA 3HNSH 3ZVVA 5FO9B 3IFOB 4CDHA 1WDAA 5CSZB 5D8JL 3APFA 1KMGA 3MREB 3QISA 4NPYA 3UG3A 1YECH 2ZUXA 4E2OA 1ZOXA 3TJHC 2X70B 3MJ7A 4YSRA 3VGAC 3ZSTA 4HGWA 5CJOH 4H5SB 5T3ZD 1BIIA 1Z66A 2XZQH 4X6EA 3WU2O 3GUFA 4XMLL 2F54A 4NPKA 4BRJA 5D6DC 2ADYA 2XQBH 3S36X 1XTMA 3VTAA 2XWBA 4XP6H 4FZLA 4GKSA 5GGVL 3QDME 2FD6L 4OSUH 1L4IA 2OP4L 2VH5L 1I7RA 5LCVL 3MV8E 3SYCA 4GKNB 1FI8C 5LXVA 4PVLA 4KXZH 2PYED 4PM1A 1SJEB 4GG6B 1MNUL 3EFOB 2F53D 3QORA 4MMZA 2W9EH 4LEOB 2ROXA 1RPKA 1J05B 2B2XL 1WVZA 1OTUD 2VR9A 4TPRH 2H9GA 2Y4SA 3CVCA 3D9AH 2W9DL 4HH9A 4WGWB 4PB0H 4LZKA 3UYRH 4WK4B 4ONFL 3I85A 4KFMA 3K5SA 4AZUA 4PJHE 4NNPH 4CKQA 2B39A 4LKCA 4YVNA 1X5JA 4PBWD 3FQWA 3ESPA 3UTSD 3CN1A 3M7FB 3KR3L 4HUWA 2AERT 3GDBA 4IOSD 5ICUA 3SIKA 2PPFA 5GGSA 4LAQH 1A9EB 1QKZH 1FFRA 3S3DB 1BGXH 5HGHB 3W0WB 1JV5B 1A7OL 1GFNA 2CUAA 3CDGB 3KBEA 2XWCA 4C8XA 2XXCB 4DO4A 1JZEA 1YDPA 2KZ7A 2AXWA 5DQ9A 1KULA 4C56B 2JKRM 5E79O 1KEML 3Q6FB 4P46D 3WFEH 3GIVB 4R7XA 1LO5B 3U30B 3UC2A 1Z9SA 2VN6A 4AOFA 3TZVC 4PJDE 2IDTA 3MRCB 1GOHA 2WIIA 1KTBA 3IYLW 1NFKA 5ILTH 3TN0B 4KITB 5DJ2A 4FP8L 4NGHL 3IU4L 4M7ZB 1P2CB 3T0AA 3D0LB 5D70L 2APVA 1F3JA 3WSQH 5IP4A 2IGTA 2DYPA 1UOKA 4N2GA 2OXGB 4HWZA 3VFVB 1QVOB 3O9WA 4DPCX 4BFIB 3MV7A 4WHDA 1BF2A 1ETA1 3PDDA 3L1EA 1DSFL 1XIWD 4MZ3A 1HH6A 1T16A 2LTQB 1SBSH 4MCZB 1JP5A 3HG3A 5DJYA 5AKTA 3LK3B 1RZQA 1OF2A 2HFFB 2YD9A 5F1IB 4Q9BA 1SHMA 3DSFL 4Z3HA 3DPBB 2DYPD 3MRGA 2V5YA 3ZKSD 2GABA 4XX1E 1HQ4B 5D9SA 1EXHA 3NA4A 2FX7L 3RWJB 4DGVH 5IVOA 1AMXA 3BGMA 1Y07A 2WBWB 1X9LA 4N8VA 2OYPA 4JPIA 3GMPA 3ZDYB 5BS0A 4P5TA 5IBLC 4J4PD 2WZPD 2HTLD 1MJUL 2AEQH 3B9KB 5EUKB 3LJ3A 3SE9L 1S9WB 4DEPB 1BWWA 5IMLA 1DVXA 4NRXA 5HDOA 1MCOL 3CN2A 3O3BA 1LWHA 4L3EB 2C9UA 1OPOA 4ELME 2CLZB 2JIXD 3QORC 4MMZC 2J56A 5A6MA 5JDSA 3FSZA 2FEDC 3EZ8A 3RWCA 4LDOB 2QADD 2R23A 5DYFA 3UJJL 1JZDC 3T0XA 2GTZB 5DZPA 5IV2A 3TNMA 2OMYB 3UZQB 4FT6A 4MNGE 2QADC 4D9LH 3RVWD 4QYAA 3KL3A 5L2KB 1RVFL 2FX8H 3OXSB 3P73A 4Z7WB 4ZUWA 5EEWA 1T1YB 2NQCA 5IVXB 1QNZL 3VFUA 3L3OB 4X0KA 1KBKA 4YFLF 3UTTB 4CA4A 4LOUC 1OGTB 2YPKA 2WLIB 4JPWH 3VH8G 1RIUH 4HCGA 4N2CA 3BLPX 4LARL 2IG2H 1DUYA 2YMTA 1E5YA 4LOEA 3Q8EA 2DLEA 3CTTA 4Y4HA 1NM4A 1MRDL 2VISA 4RJWA 1TCMA 2VMJA 2PYEB 5CCHE 4AYDC 2C9SA 5FHAL 4JHUA 1HH9A 2XBTA 4UT7L 1RZJC 3WN5B 1G9NH 4FQCH 1T6WA 3IGAA 2EDXA 3S3CB 3E8VA 1SMDA 4LDLB 4LGRB 1UD2A 2E8YA 4M61A 2YOAA 1X5LA 1E6JH 4PJ5E 1XDTT 3H9HB 4Y16A 2V6HA 4N2OA 1F90H 3BZDA 5IT2L 1ICTA 1IGTA 1OIOA 3L95A 3LEYH 4FNSA 4IRZA 1MJ8L 4HFUH 4NQXB 4HHWA 4OLZH 3LSOB 1HFUA 3K81A 3ME0B 4G7RB 2D4FA 1JK9B 3G7GA 1RUKH 2XQ0A 2PXYD 2WSDA 1RQ5A 4BCXA 3B1UA 2OSXA 1ULVA 4I9XA 5LN8A 1ZHBA 3NZSA 5JXAL 3NN8A 1NCCL 5MENE 2VLRE 4Z23A 3O6FC 1BVLA 1R3IL 2IF7A 5HXMA 1PY4A 1Q9OB 3HPJB 2HMID 5DZAA 1FVEA 3UROR 1YNTF 3ZSSA 5EHFA 2XI9A 4HJEA 2Z1KA 2WXOA 2J5LB 1Y18A 1A6ZB 1K2DA 2WBXA 3MZTA 4P23A 2PMZA 4JL2A 2BIOA 2YK1L 3GRBA 3C2AH 3MODL 2IH8A 3SYQA 1D5XA 1GGBH 2MTPA 4NQED 5BW7A 1GVIA 1P6FA 1KG0A 1EO5A 3VA6A 4Z7NE 3GHBL 3FFCE 4DFIA 1EWHA 5B39B 4EDWL 2ITDA 4XC1H 3MNWB 1RZ7L 3M07A 3K2UH 4AKPA 3SQOL 1MHCB 3LS4L 4PCSA 4K3GA 4OH2A 3BZFA 4BSVB 3VXUA 3IDJA 4R4FH 2GJ6D 5K5YA 2P4AB 3ALXA 1NAMH 4IRJB 2GQHA 1F4WH 1UM6H 1EZVY 3HN8A 4R3SA 1E5UI 5D2LA 1RK0A 2PW1B 5EG6C 2XQYK 1U8NB 2X0WA 1PBYA 1XT5A 4HJGA 3RWIB 1F1AA 1NPJA 1DVSA 5F0MB 5E95B 3ILQD 1ZEAH 1AR1C 4E9XA 1G7QA 5J06A 1UADC 1MF2H 4MTMA 1I1YB 4MJ6B 2VRKA 3MRMA 5AYQA 4AXWB 5AFUL 2WVUA 3V0DA 5F9DC 5IB1B 2VDPB 3MMEA 3OJ2C 2IV9A 1G5GA 4XWOC 4JRYD 1ZA6A 4U9CA 1A7PL 4P4RB 4P9ML 3BFQG 2AS5M 3D48R 3ABKB 4IMKA 1IC0A 1JGEA 3F2LA 2FYVA 5I1HL 3RZCA 4PJ0O 1KLGB 1LMKA 4M1CC 1UH3A 2GW5A 2XPGB 2GJRA 4QHNA 4APXB 2RJMA 3LIZH 1SXBA 4NQVB 4WLCA 2Y7QA 3HS0A 3PP4H 3QR0A 4U4BA 1LVEA 3V52H 3M45A 2IFFL 1KC5L 3GSXA 3NJNA 4JO2L 4M7KL 5EULV 1MCPL 3DGCR 3FU3A 2BRRL 3W56A 3BOVA 4HJTA 4V2CB 4AZ8A 3BN3B 1YQVL 1B4TA 1QPXA 3ESOA 5DUML 4ZMWA 1V54B 4HWNA 1U6AH 5ADOL 2UUDH 1LEKB 1ILUA 4BFJA 4P9HC 2UV3A 4J3OF 3RDTD 3P30H 2BVQB 4V1DE 1N0XH 2VDQB 1M53A 5DT1H 2ZJSH 5EU6D 5CN2A 5F3HB 1BAFL 4ZXBC 3T77A 3QDMD 5DWPA 1N8OE 3MRIB 4DSYA 1KTDA 3LQAL 1FFPB 4WV1B 1MM5A 3QFJA 3GMMB 1R9FA 2ZXDA 3S5LB 2YSSA 3MNVB 2H9GB 3AAZB 3KEDA 4X8JB 3IF1B 3ZZSA 3WI9A 1NDMA 3MLUH 5EIQA 3ZE0B 1Z5LB 4YHYC 1P5UC 2F8OA 5DZLA 1P53A 4ALAC 4FXKB 4WCYL 3CK0L 3O0RH 1DVFA 4QRUA 3DHMA 3RJDA 4R7DA 3VMPA 1FLRL 2ZKHH 3RL1A 1FNFA 3Q06A 4L4VB 4MX7A 3UTQA 3PRNA 2WQAA 5AG8A 3PAZA 1AO7A 3ECUA 4WFHE 3SDCD 3CQFA 2AJYH 2CR0A 5IQ9B 4PFEA 1HWGB 4N9OB 4WENB 4YAQA 5G5DB 1A4CA 4QRSB 3STLB 4ZMTA 1FPTL 4H5SA 4ZMQA 4N59A 1AC6A 4K9EH 1JZJA 3UTPD 5CLYA 3B6SA 1BVNT 2F54B 3HMWL 3MRPB 4FFZA 4UI2A 3VVWA 4DOHB 1D5MA 4Y89A 4KO7A 2WUCH 4GO6B 1BYNA 1GHFL 3GKWL 5JW4Q 3L9RB 1T1ZA 3OR6A 4MQTB 3FMGH 5CLZA 2DQTH 2VSDA 2CUHA 4JZJA 2B4CH 1J05A 1QSEB 3VQ1C 1SY6A 4IGBC 2A83B 1U0QA 3SOBL 3ZZ1A 4FYQA 3VWJA 3ISRA 4NO2A 2K3HA 3DRQB 5FXCH 4OFDA 4ZNEA 1K5NB 2A74C 5IFJA 2NX5B 5BOPA 4YDVA 1ZHTA 3ARFD 2F5BH 2IQAA 3L3GA 4L5FH 2D7QA 4UINH 1FZOA 4MDIA 4YPGA 3IDUA 1ZGLB 5D7LD 4O3ZA 3O6LH 4OTXL 4HIEB 5HHQB 5FV2A 3SPJA 4XVTL 1ZK9A 5E6ZA 4FZ8L 4XN7A 4CW1A 2ZUTA 4ZW8A 1G9MC 5SX4I 1KJ2B 3C5OA 4F57H 3QXDB 4OU3A 1JGUL 2JB5L 2Z0UA 2R0LL 2E4FA 3X14A 1KB9J 2KH2B 3BAKA 3A47A 3L1OL 4MHHI 1MFEH 3KL0A 4GRLC 3U4EA 4H44C 4M8QB 3VFSA 4NUPA 1E4WH 5EA0L 3P3RA 1IKFL 4LMQI 5HDWA 4DAGL 3C60A 2EP6A 4QLRA 1NMCC 3BUYA 3N06B 4KXBA 2UX7A 3W82A 4OLXH 4KI5D 5MEQB 1BW8A 4OGXL 4XBEL 3DHJA 4YSUA 4ZFOA 3EGXA 4BGDA 4PLKD 2OMYA 2ICWI 5B4MC 1F00I 3OR7B 3ATAA 1CVSC 3QR1A 4HZLA 4XOCA 1PAZA 1IGIH 1LDPL 2YEVB 4JKMA 2XY2A 3ULUF 3BZ5A 3KPSB 1KJ3H 5B4MD 3L3OA 1P7QD 4LVOC 3ZT6A 4F7KA 4EIBA 1E5BA 1BFSA 3BKCL 2BNUB 2O72A 2XWBB 1U8IA 2R69H 4MD0A 3UIZA 1RZJH 2DBLH 3V6ZB 3B7UX 1PD6A 4R97C 5C8JA 1HXXA 2QGCA 1YEJL 2N0KA 4H1LB 5FW7A 4PJ7A 3VVVA 3QUKA 5DQJA 4MAZA 4K3EL 3IM1A 1DDTA 1HHIB 1T7YA 4JVPA 3KWWA 5D1XC 1F3RB 1GL4B 3F7KA 2QHLA 5EWIH 3PF1A 4KTGA 5JZ7C 3IE4A 2WWMD 2X4QA 4IKIA 3VXOB 2N56A 3IGAB 5D8JH 1QBMH 2DV6A 3ZKMC 5KN5A 2Z31B 1V5JA 3OLIA 1BVOA 4NRXB 4PJCF 1NFDA 1FL5B 4MDJA 1MCIA 1FNHA 2VERA 4Q2ZB 2UVEA 1AY1L 4NKIH 1OSZA 2R8AA 2R83A 3L81A 3QIUD 4EUPH 5LGHL 1N3NB 4HSAC 4K8RD 4PD4J 1HN1A 1KLUA 1XCWA 1RJZB 2K8QA 2FGWL 3BAYA 1ML0A 3T0EB 1BZOA 4U1GB 4UZSA 5I6XB 3E38A 1A7RL 5EO9B 4FSOA 4ZMVA 3OWEA 5C86A 1YDPB 4YGAB 1X7SA 3VXRB 5KSBB 4B61A 1I3GL 4ZUWB 3VTMA 3INUL 1F42A 4WEBL 4PP1C 5E8NA 1N70A 1PFCA 5DZJA 1T3FB 3ATEA 5K1NA 3QWOB 4W1TA 3VCLB 3GTNA 1SXSA 5DMGC 2EIZB 5JHLH 3FJTA 1ZLVK 1O6SB 3RNKB 1N5AB 1SQ2N 3T04D 4OV5B 3E3QE 1SN0A 3WNNA 5JLZA 1FFQA 1E67A 3L3JA 3QULB 2FJFA 5C0AE 2AMGA 2DWSA 1CICA 2I69A 3WYRA 1HHJB 1CDYA 4X5PA 1JRHI 3KPPA 4KBPA 3CDZB 1VZGA 4GQRA 1IGML 3X11B 1ZHKA 2P5WB 3KR3H 1R5IA 1JN6B 4FERA 3TH3T 3N0PB 3L9BA 5LAXA 3R1GH 3WKQA 4ETQB 5L2KD 2OL3B 4GS7C 5JTWA 1U8LB 2OSYA 5GIRA 4X6CE 3QUXB 5E4EB 2FQDA 3PE9A 2VLJE 2FX9L 3LRGA 1JZ8A 4NKQB 5MHSD 4HLJA 2H0FA 1ODAA 3RZCD 1E65A 2QQNL 4JFWA 2HX9A 4S0TD 1R3JB 2ADIB 3BGMB 2VDMH 4E42A 4WWKA 1U93A 1TTRA 2AK4E 2GJPA 3PAYA 5D1QD 1I8LA 3QIBB 3MA9L 2XV3A 2X4OA 3SJVB 2ZUSA 3F01A 5BO1L 5K9JH 1S9WA 3Q1SL 4M43H 1WGVA 4D7BA 5IMLB 5KJRH 1WAAA 4HVBA 3BPCA 4F8LA 3O2DL 1M1SA 1Q9LA 4ZJ9A 2AQSA 2V17H 1QFUH 3PWLB 2ED9A 2D31B 3VH8B 4JY5L 4KKAC 3MHZA 5CJOL 2R7EA 1XR9A 3BCDA 1BOGB 4P5MA 1PG7L 4DCQA 3V0EA 1QWNA 1KLGA 2COQA 4UQ2B 1F1DA 4KKCD 4Y5YC 4CILA 3DMMC 2E6PA 3SODB 1S7RB 2YA0A 4UM9A 2YN5A 4OZGA 1JHTB 4YVUA 3ARVA 3MBEB 5T3XL 5KVEE 3VQLA 1L9SA 1UURA 2BIPA 4C83B 1B4JL 4X0KB 1FG2B 3F58H 1J0ZA 3T4YA 2H3XC 4APQA 1JIBA 4NOFA 3DA4A 5F7LB 5FUCE 1TTFA 4IRJA 3GMQB 3VD9A 4KKBD 3RTQD 4O9HL 1TYRA 4HSCX 3U7YL 3ARDB 1R5WA 1OE2A 4DGWC 2PW1A 4FLOA 2B0SH 2NXYC 3WHE1 1VACB 4NN7B 2WOBA 1EJ8A 3CHOA 4JG5A 4LCCC 2I9LB 2DS4A 3LKOB 2YPVH 5EOCJ 4F7EA 3GO1H 4P2OB 3PY9A 4MJ6A 4FA8A 5CBEB 4KR8A 4K5PA 3PDOB 4ZTOH 2X28A 2EILB 5DD5L 2V7NB 3AREB 3ULVF 4P3CL 5I1DB 1TVBA 5LBVA 5IJVA 1G1OA 4UANA 4X6DE 1KGCD 3HS9A 1UQSB 2W65B 1UWXH 2BSED 4PP2A 4X5QA 5F1SA 2C1PB 3AS3A 3ILPA 2A9DA 4R0LB 1NGPL 2FIKA 3VFTA 2W0FA 2GJ6B 2HTKC 1OAUL 4W6XB 5AW7B 4BQCA 1OQOA 4RQQA 4ZAKD 4RMUA 3SKJL 3GSXB 3W39A 3BEVA 3IFLH 5F9OL 5IBUB 3L8QA 4OD3H 4H88L 4QRTB 3IGKA 3QCUH 5HHOD 5LBSH 2LVCA 3ASNB 1H5BA 1PQZA 2DH2A 5DUPL 4X6DF 3FXIC 1RH8A 1UD3A 5CN3A 1A8JH 1I9JL 2A4EA 5DF0A 1YNKL 5HI5C 3FH8A 1KGYE 1YEGL 1F4AA 3IDGA 4RRPM 1EZUA 4P23B 3ZTJG 3UU2A 3U7WL 2PCFB 3EGSA 1OARL 5IGXL 2CUIA 5DRXB 2DM3A 2QQQA 3SYPA 3EUDA 4LPYA 4JHVA 5B1JC 3GLEA 1TLKA 1YMHB 3IJEB 3PQYB 1RULL 4KGLA 4AGMA 3RFZA 1K4CB 3QHZL 5SWZB 2BNRB 4PGJA 5GS2H 2P5WE 2D7TL 4QGYA 2KC0A 1CFTB 3IF1A 4PJFA 5FO2A 1MPAH 3ZZQA 4PYHA 4YSSA 2FH8A 5DRZA 5I19L 1M1XB 5KVFL 4XNLA 4XAWH 4RFNB 4PJDB 5F7DA 3HZMB 3QAZC 2YC1A 4XB7A 5DGQA 2ZYHA 4C59B 2BMKA 3O4OB 2EZ0D 3RDTB 3O45B 5FKAB 3IXAB 4YXKH 3E1F1 5FS5A 4Z7VE 2ITEA 4OCXH 4FEIA 5E7BA 5EORL 5T8IA 3X3FL 4U2ZA 2OMXB 5BZWB 2WXNA 2AK4B 3ULVD 1ES0B 4RVBA 4N2MA 2R0WH 3C09B 5IB1A 3TN0A 1NOLA 4HUUB 4TMPA 5SX5K 5CJBA 1ZA6B 3ORJA 1WS8A 3RA7H 2V9UA 3VO0A 2EC9T 5F7MC 4HULB 4XN5A 1QBAA 3UACA 3NCYS 2XIIA 4FYRA 4MJIB 2VLJB 3RRQA 4B0MM 4J3BA 2X4NB 1DVFC 3NZHH 2QDWA 1A6VL 1SXNA 2HB0A 4PTTA 3VQMA 1OTUC 4MJ2A 5D55A 1AQKH 2VXQH 2Y7QB 3HS0B 3NEOA 4JPWL 2ZCHL 3OR6B 1XL4A 4G8IA 1HH6B 2AITA 5SX4H 4UV4L 5E2WL 2GY5A 5K93A 4EOWH 4GKZA 1RK1B 1L7IL 4PSPA 4G6KH 4FQEA 3L3HA 3HFFA 1S7WA 3U2SB 4AJWA 5KBNC 1EZLA 4YZWA 1WFMA 3PCYA 4MS6A 3BQVA 3L3GB 4YDKL 6CGTA 1IE4A 4GMTH 4TNVF 4XB8A 1UM4H 4BEIA 4R26L 3V6FB 4P2RA 5C8JB 5AZ2H 2PXYB 1ITCA 3D39D 4K3HA 2J25A 2EVJA 3ZQXA 1YEFH 1IZJA 1HHIA 4ZO7A 5E6IB 4X9IA 1LGVA 3WBDA 5AW8B 4DVRL 1PZ2A 4XP1L 4KOCA 4GP5B 1GS7A 4Y4KC 1JNHB 3SQBA 3T09A 3CFMA 3W1ZA 1OOWA 4OF7A 3ELAT 3DO4A 3H9SB 4I7ZC 5CGYD 2J43A 2HJKA 4PMEA 5C09A 2GUYA 1JZFA 4YE0A 4YFEA 2P5EE 3BVXA 2XMXA 1GRWA 1RMFH 5TDOA 1H3VA 1JPGB 3ZJAA 1YQVH 1BMWA 1EHNA 1LP9B 1HCFX 3CHXA 5AENA 3HC3L 3TBTA 5BUGA 1YHPA 2LFGA 3QCVH 3QHFL 2EE0A 4QOKB 3GXPA 1QFWM 3UZVA 4C4VA 3EGXB 3QYCA 4OCRH 1D5IL 2C1OA 4Y9CA 5B3NA 3X12A 3HE7C 1OGTA 1CL7L 4GO9A 2H0JA 4O02L 2CGYA 2EDLA 3QI9C 3N42F 4LSDA 1S9VA 1TJGL 3DWTA 5DFAA 3D0LA 3WFDL 3M46A 1KYFA 1N7MH 3K2MC 4HIIB 1M9SA 3TNNB 5C1MB 1E43A 1NLDH 2ZSVB 2G75B 3X2QB 1V27A 4MB4A 3WY3A 3KWWB 2BSSB 2A9NH 1KWKA 5AYTA 1HL8A 4PJ9B 3RTLA 2BY1A 2NZIA 3I6KB 4WNSA 1NEZB 4FRWA 1F4YH 1U2HA 4ANXA 5LAXB 3LH2H 3PWJB 5DD0L 1R0AH 3FUFA 2VUOA 4GQ9L 1LDSA 2LABA 3ROOA 5LGJA 3D08A 4N0UE 4JZOB 2HT2D 4LCIH 4N8VB 4TVPE 1K6QL 5GPRA 4DTGL 3EYVB 3QXTA 1TNNA 3GLDA 4KDVA 1BZQK 4XVJH 4E42B 3E7JA 3BS0A 1FRGH 4FFYA 4PJIE 4IRSB 2JMRA 4RAUB 1VAHA 3LNGA 4X8CA 3VRLF 1DQML 3RVVD 4YHNB 3D8MA 3KW7A 1SY6H 4JPVH 1FFNA 1N26A 1EZVX 3CLEH 3QEGL 3MXVL 4OLYH 4LVEA 1HOCA 2MQ0A 3V55A 1LE5A 4V33A 5DZVA 2PCXA 4DQAA 5IF0B 3QJXA 4E68A 4G7QB 4MJ4A 1GFQA 5FO7B 5DJAA 5JXEA 4JY4B 3IGUA 3VNZA 2PP8A 4GO8A 2GEEA 4WFFE 4BKLA 2O6FA 1P69B 2DMHA 2NY3B 3ARGB 4U0QB 3TBSB 4M56A 3IVKB 5I71B 3IK2A 1A6WH 2RQEA 3BXNB 2Y72A 3QFJE 4UILH 3VI4E 3VJ6B 5KVGL 1ZAGA 1WZKA 3APDA 1FGNL 2WLMA 3H42L 4AKRA 4U33A 5T1DH 3ARPA 4OZIB 3BQUA 4OZGB 3LEXA 3TFBA 5G26A 4FD0A 2YEZA 3HW9A 4DKFL 1DQLL 4AQZA 4IK6A 2VR4A 5CNHA 3QXVA 2CDGA 1PZDA 2IFGA 4RNRA 5TK2A 2A38A 4Z18A 2OZNA 1KY6A 4UDTB 5FUZH 5JPNC 2QSCL 1VFUA 3LQAH 5EIVA 3VWJC 1D7CA 3OF6D 2X4SA 3LD8B 4PJGA 4U1KA 1NUFA 4ENED 5JXEC 4JVUA 1MUJB 1ZT1B 3ZE1E 3WIIL 4MJHA 2BX5A 5F7UA 2V5SA 2J8UB 3QH3A 1RJYB 1TTUA 2CGRH 3LK41 2FEEL 3DA3A 4YNYB 4KROC 4LB8A 1JNJA 4LVHB 5DC0A 2GSGB 4P04A 5CP3H 1HOEA 1DTUA 2OX5A 2WMPA 3T6QC 3ULUC 4Y9GA 3H4FA 2DMCA 4G9FB 4PBDA 3JTTB 1XR8B 3S8GB 1CZ8H 3GRWH 2R0ZH 1IBGL 1Z9PA 1TVBB 5IJVB 3MRNB 3GSVB 1O0VA 5CZRA 3KWTA 4WAFA 5BRQA 4PP2B 1MRFH 5E9DA 2I9TB 4M3HA 4FFWC 3TXAA 3C5SB 12E8L 7PCYA 2J72A 4AUIA 3FBQA 1REIA 4GMSH 3CUPA 2BP3A 5T5FL 2DQCL 3RIKA 4OGYH 4N1HB 3RVXD 3SE4A 2G5BB 1BQKA 4DHLA 4A2EA 1XEDA 2O5NA 2ZD0A 2WUBH 3H56A 3IETB 3MX0B 4FYTA 4YHOL 3ZDYF 1GJIA 2B7DT 3UAQA 4RZKA 2O61B 4XNZB 3EF7A 1HINL 1KELH 4OZ4B 4G8GA 3QWOA 3VCLA 1L0QA 3FMGL 3S34L 2VDNB 3RNKA 3BWUF 2EH8L 3CSYB 3TT1H 3ARDA 2C9VA 2W07B 4HS6B 1QBML 2H6UA 5CFHA 4MQ7A 4PU2A 1CG9A 1BQ5A 1FFPA 2A9ML 2NY2B 4WV1A 3MRDB 1JPSH 2BY0A 2HRLA 4J3OG 4LSTH 5HHMB 2ODIA 1MCLA 1O6VA 1E8YA 3IFNH 1XF4B 3S5LA 2RR3A 3U1SL 5INDB 1J9TA 5CEZH 1GIGH 2EVGA 4PJ8B 1WAPA 1ID2A 1Z5LA 2FQGA 3DUSB 4JMXA 4KV5F 4W9FC 1OM3H 2MCMA 4GINA 3UZEC 3F04A 2H1PH 2XXFA 5AOKA 2XWTA 4JFXA 4BA8A 3BX7C 3OKKA 3QEHA 1WSST 1EANA 2VM3A 3H53A 2TRYA 3DGGB 3PJNA 3P1VA 4W81A 3U25A 1CK0L 4Q9CA 1XZ0A 3PP3H 3MXWH 4XNQB 4A7SA 4JLRA 4PRPB 2I7OA 3MRMB 4AXWA 3IKCA 2P48B 5JYLA 3EFDL 2Q3AA 4HKXA 2LFUA 3GSOA 4FFVD 2ITCA 1WC7A 1QRNA 1H5BB 3B5TA 3RIFK 3X17A 2EKJA 2VJXA 3IJHA 4LHUB 4LSUL 3TYFA 5IHZB 1BDYA 2ZXBA 5FM5M 2HSIA 2XPGA 1QFOA 4MAYC 3VH8A 3OHMB 1PJWA 4WO4C 4M1DH 2E7DA 4G6JL 1DJHA 2JJTA 1L7TH 1SDDA 4YFLI 2YBRA 4J4PA 2OK0L 5TE4H 3EOTH 3ESMA 2VKXA 1JXKA 2YGOA 2A1WH 2B1OA 3ES6A 2K6WA 3FOMB 4MZIA 4QI3A 5EOTA 3WKPA 5FF6A 1H3WM 4XNYH 3O8XC 4G8IB 5CR1A 1U8HA 2XZQL 4A66A 4LGPB 4TVSa 4XCCL 1L9OA 2K7QA 5AOJA 5IFJB 1DBJL 5DJZA 4HJJL 3DTXA 4KKCC 4NYLB 3L3HB 4HCRL 3QUMB 4QHLA 4X7TB 4GOSA 3HE6C 5KS9F 3RBHA 4JGNA 2V2TA 4FI7A 5ALCL 4LLQB 4GRMB 5H2BB 3KXFD 3MLZH 1NANH 3SBRA 2IQ9H 4AENB 5IVNA 4UM8A 4BZ1H 2Z91B 5FYLH 4DGYL 1LP9E 4PVBA 1CLVA 1AQMA 3MBWA 1E27A 3V8UA 1JCKA 3BWAB 2C3HA 1NDMB 2WVTA 3GFUA 5LGHH 3WEMA 1RZGA 3PQYD 1LLAA 4Z0XA 2KZWA 3U4EB 2ERVA 2FT7A 2WCSA 4FXKA 5EF1A 2HRPH 4M3KB 5KS9E 4FFZL 4A68A 5C07B 5IFAH 1MFAH 4JO3H 5AW5B 4P59H 1XO8A 5T3XH 1FL6A 4NERA 4PRIE 1JJUA 5FFGA 1EAPA 2JI3A 3EYFA 1JZ5A 1YY8A 1FO0A 1SM3H 3BKML 1ETB1 1YYLH 4ZDHB 1CR9H 2QBWA 4Y4FA 3VWKC 5JHAA 3VD1A 2ZOLA 4HH8A 3ALWA 3B2UD 3BH8A 2XTQA 5DURD 2YPVA 2C1OB 4RX4A 3S2CA 1FNGB 3CBRA 3CFEB 3BEWA 2NCEA 5ERWA 5FEBA 5CXPA 3VYPA 1S7WB 1RXLA 3NTCL 4WJ5B 2GBVA 4HKZA 1XB8A 2DMGA 1I3RA 3SQRA 3HNSL 2IXQA 3IDGB 3GO1L 4N68A 3TO4A 3T3MF 1W0WB 3CFDB 4LGSB 1KJMA 4WO0A 4ZTOL 3HKFA 4N26A 4P49A 3DHUA 5A16A 1IZNB 2EDQA 2D73A 2F53A 4I89A 4UIMA 3RL2B 5CEYA 1XB6A 5AOZA 3VXOA 3FONA 1PY0A 1H6FA 3U0TA 3EOBA 4N5ED 3ZRFC 2V2WB 1H6UA 1RZ8A 4M5ZL 1OT1A 5EZLB 5D6CB 4O5LH 2FGQX 4HEPA 1SF3A 5DVLA 4ZFQA 1JV2B 4KZCA 4RA0C 2OMUB 4K3JL 4E9SA 1CFSA 1UG9A 1RJZA 2MTAA 2A0LC 5DMYA 4FXGB 3UTPE 3IS1X 1JPGA 1Q1JH 4Z7VB 1XGRA 1BEXA 1PSKL 1YC7A 2CMRL 2Y07H 4UF7C 5G4MA 2D3VA 2ZX9A 1PIFA 3QA3A 2AJVL 4LO9A 4I0PA 4XZ4A 4X6BA 5FLUA 2H3KA 5D7SL 2AK1H 4HEME 1S7UB 1TENA 3E9TA 5D7JB 1UVQA 1A6UL 5EH1A 4DZ8B 2BS9A 3VFGH 3UTTD 3TX4A 5A2JH 3DJRA 1VDGA 1ZWIB 1RULH 4JQXA 5IW1A 3BUYB 5F9WC 3E6FA 1PZAA 4ZBJA 3NJVA 4YHIB 2F74A 5D1XD 5DR5H 1CFMA 2G3NA 2QKSA 4ZYKA 4HUVA 4BKLB 3KJ4B 4AE1A 3MV9B 2UY7B 2YUXA 4B9YA 2P52A 3TBSA 4WW2A 4PJCB 4ENZA 4LCWB 1XWVA 1Z9NA 1XIWA 2R1XA 4CJ1A 5C3IA 4PJ9A 5CP7B 3MV8A 4FFWD 4Q9QH 1XGTA 3H8NA 3MLWH 4XH2A 3EYUL 3OMNB 5D7KE 4ADGA 4X4KA 1N0LA 4XI5D 1RPUA 2H7WA 5C9JB 4AYFA 3ZKND 2I60L 5DFVD 3VAEA 4HXAL 1JPTH 5GGVH 4L37B 2D4DA 1O7DC 3Q9PA 2KQNA 5SWZE 1DLHA 1YAIA 3UP6A 3MJ6A 3A0HO 4DUVA 2FEDD 1NPUA 2DIJA 1DDHA 1FFNB 3KG5A 3EJRA 4WIQA 3DPDA 5T1MA 2CDEA 4F37K 1VRSA 2MH4A 3IGLA 3S4SG 3ARQA 1LO4L 2BP8B 5AL0A 3EOYG 5CD5C 7CGTA 1A7QH 3FQRA 1J1OH 2YD6A 1BVNP 3DK0A 1DP0A 5I9QB 2ZCKL 4AQ1A 4QAMB 2JH2A 1JHTA 2EDWA 4KTYA 4FESA 3FQXA 4OFKA 1S7TB 1W91A 4FFYL 4ZX3A 2CNZA 4DP4X 5JQHC 1TU2B 1OARH 5D93C 4APQB 4TSAH 5IGXH 2VO8A 5F9JB 1AHWB 1FV1B 1AHKA 1U8OB 1CU4H 5CZVL 4PVNA 1IAOB 2ZIDA 3P9MA 1O7VA 2R39A 3AQZA 3CC5B 4JQVC 3HJ0A 4LASL 3UC0H 2GHZA 2P26A 2JJSA 1F0LA 4ZUUB 2GTWA 3FTSA 2YIHA 2CALA 1NBZB 4F7EB 3QNYA 4JVWA 5MI0B 4X9HA 4FQ2L 3KPRD 4OGQC 1MAKA 4P07A 3VSTA 4UT7H 2FX8L 3AA0B 1MHHA 5AOLA 4IL6O 4R90H 5AUMA 1OSMA 5E8EA 1H3TA 4A7GA 4ABVA 3FYIB 2V5RA 3QUXA 3WNIA 5FFLA 1Q94A 1S9XB 1RIUL 1UA7A 2OJZL 3PWJA 3Q8BA 2QZQA 5BRZB 2HN7B 4HMDA 5KANI 3Q48A 3VRLE 2XKSA 3G6AA 4AV5A 4WI7A 4XGZA 5F2FA 5KOMC 3N44F 4I3SL 3C8HA 3DETC 2MCAA 4GQZA 3HC0B 5EBMB 5FHAH 1PRNA 1GYVA 1HNGA 2EDYA 2K4WA 3V0GA 3V2AR 1YN6A 5IVZB 3MV9E 4MA1B 5JXAH 3OZ9L 4PSRA 4Q6KA 4HUNB 3JYCA 3ILDA 1SXCA 5TE6L 3TH2T 5E2UL 3MV7E 4PBXA 4DQOL 4KH9A 1JWSB 4YBLC 5IB3A 4M02A 4UAHA 4XP5L 1SEQL 3RKDC 1DQTA 5MEOA 1I8KA 1MHPL 4D9RE 1HE8A 4AKMA 2Z93A 4GXVH 3L3KA 1LEGA 2A7BA 3V4PL 3O4LE 2FJHB 1TVHB 25C8L 1MKFA 1MFCH 2G4GA 3TWCH 3QUGA 1BBDH 1MCPH 1PD0A 4A7GF 4MKMA 3U7AA 4AK1A 4AGQA 3VXTA 3QNFA 1ONQB 3D39E 3BRYA 3BVWA 4ZS7L 3WD5L 4FMKA 2YAFA 4PY8J 1T22A 2DWDA 3U4BL 3JWOL 1BYPA 2NSXA 1UWYA 1JVOA 4JG1H 4O58H 2BMKB 1E9QB 3GHPA 1Z6JT 2B5IB 3ALPA 4W9CC 5L4MA 5BZZA 1NINA 5I30L 1DJYA 5DZOA 5JMRA 2DMBA 3OTTA 3MGTA 2C9XA 5FWQA 2BC4B 2BP5M 1ZV9A 1ZLDA 3QG6A 4S11A 4GKLA 5E1IA 5GJSL 5HJDA 5IHUL 4PMFA 5KTEL 3MLYL 4OCWH 2XUWA 2HT3D 3OB8A 3I9PA 5AW6B 4Y2DB 5D1QA 3CFBB 3ZHNA 2HWZH 4X6FB 1ACCA 2UWEF 3FB5A 2OCCB 4WCYH 1F4WL 2CLVA 5PRNA 2JXMA 4HT1L 3FF8A 1OTTC 1IM9B 4TUJB 3IE9A 4U1JA 5D1XA 4FAAB 3HBPA 1UWGH 3T8XA 3KLQA 3CG8A 5AKRA 1RZIB 4NJAH 1LD9A 4Z76B 1TKWA 1AXIB 5DK0A 3S9DB 3UYPA 1IV8A 1FO0B 5E5LA 2H8PB 2QSCH 3KPSD 4GSXA 4XCNB 2A9AA 3BSZH 5DUMH 5I1LA 2OA9A 5ITBH 1MDAA 3MCKB 4I2XE 5GJTL 5C07E 3TA3B 3OPZH 5DI8A 4HKZB 4QXGH 2HA1A 2IH3A 1WZ1L 1WAAE 5DFTA 1TFHA 4GUPB 4HD9A 5A7BA 5AD0B 4YHMH 3VD3A 3WFBL 1MOEA 2NT0A 1E6OL 2OMZB 3LH2L 2P8MB 3GXDA 3H9YA 1USQA 4M7KH 2VJ8A 3CDFA 5EEUA 3BZ4B 2BJML 1QLEL 4QNPF 4YQXH 1AACA 3EO1B 5GSVB 1Q72L 3C6LD 4F9PC 2W92A 1TQCB 5IQ9A 4I88A 3L16A 4WSJA 5FGBC 3H1ZA 2ZF8A 4XMXA 4OY9A 5L4IA 3HZMA 4WU7A 3ZL2A 3NIDE 5MP6L 2HLEB 3WHE0 1EJ6A 4ZFFA 4LHUG 5JZ7D 1JV2A 3VM7A 5K9OA 3ARGD 4NKMB 2MOVA 5BRZD 3MPCA 2QSTA 4MMXA 2WINA 1A4KA 5H35A 4CVZB 1ZGLM 6PRNA 3LZPA 1CXLA 5D1QE 4J23A 4ZPTA 1UT1A 3BT2H 2KLRA 4HJ0C 5AVYB 3II3A 3UIYA 3BYYA 5F88A 5DL6A 1TETL 3VY8X 2QGBA 5BUAA 1VA9A 1V10A 4BUMX 4U1HA 4GKSB 5TF0A 2A9MH 1T5XB 3TYFB 5IHZA 2ESVE 2VZSA 4YIQA 4Y4HD 1UXWA 4S1QH 4NPJA 3IDIB 2WVSA 2PO6C 3FO2B 2J7LA 3ECQA 1A3RL 1ITBB 1GHFH 4YUEH 5HGGS 4RGOH 2PO6A 1CTMA 1TEYA 3POXA 3D39A 3WL9B 1T66D 1NTDA 4JFDE 2G9KA 2WQWA 3L3IB 1JTTA 4J1UA 2GKIA 2XV6B 4GI8A 5FWRA 1P7HL 3VACA 4F2FA 1CD1A 2OL3L 2ZCZA 3P02A 5AVTB 2XTJC 1RUQH 1BD2B 1V55B 2FCBA 5IBTH 4K9EL 4U05A 2GY7B 3CU1A 3CZUB 1YEIL 3AC0A 2RCSH 2OBGA 3TYGH 3SDYH 4PW4A 4G1MB 3UFIA 4GW1A 3C12A 1HQ4A 3NG5A 3U79A 4X6DB 4X8XA 1HSAA 4FXGA 2VXVH 1P5VA 3PNWB 2OYKA 4KO6A 3RGVC 2WGNB 1XGPA 3FSOA 3NIGB 2AI0L 1J18A 3BP6A 5B1AB 3ARZA 5SWSA 4FQJL 4TNWK 3GJEB 4TULL 4DN4H 4YHNA 4A67A 4HD5A 2YRPA 3BDYH 4L1BA 1NCAH 2TAAA 3VXRD 1XSKA 4U3SA 4ERSL 4WEMB 1KT2A 1CQKA 2GBUA 1K8DA 1Z1WA 2K9FB 4UQDA 1B90A 1QI3A 2BSTA 2JWYA 4L0ZA 3NGBB 2DQCH 4AJVA 4L29B 1JWUB 5I1CL 4DAGH 3IVKA 1XGQB 1PG7X 2CHZA 3OKOA 4YHIA 2R0KH 3TV8A 3O0EA 1OAZL 3ZIYA 5EDSA 4YMPA 5MERA 4HJJH 1UATA 1EHLL 2PP7A 4AQ1B 4AMKH 4H8HA 3S34H 1R3KA 1NFDF 4HGWB 1O6TA 2DWEA 3BQUC 2WQSA 1ZVNA 2MMXA 3BP7A 3IDXL 3ZGIA 4GAYA 2Q6WB 2ETWA 2GAZA 4NQCE 4JFFA 3EYQD 3FOLA 2I5YL 3O9WD 2YSTA 3THML 1HNYA 3RWHB 1ZEAL 1ILSA 2XETA 3VRJB 1OKEA 1O9ZA 2F7QA 3K91A 4G7VH 3IGFA 3RG1C 3T2QA 5CEZL 1RJYA 4O00A 3D69A 5EB9A 2B16A 3EDEA 3SBWA 1IARB 4N87A 4UQBA 5BPPA 4NQCD 1KB9K 4OIIL 4EN3A 5HHXH 3CZEA 4GRWF 2OX5B 2WMPB 2FZ3A 3NAAL 2Q76B 5I1HH 1N12A 2OI9B 1FORL 3E6HB 3NABL 3SJVD 4PY7B 2IEPA 5D2NB 3MXWL 1PNCA 3DVGA 4XBGB 5FA3B 2H32H 3KPNA 1XCQA 2DQTL 3S96A 3VXMB 3QW9A 4AVJA 4JHAH 5I76A 4XVUC 3NIFB 4JHWH 1A9EA 3EJQA 1QO3A 3MA7A 1OP4A 1ZDSA 4Z7OE 1KBBA 5IV2B 2BIQA 3QIWA 2C4FT 1XGRB 4FE9A 1U8CA 5F1NA 3CUPB 4AT6A 5JDJA 4Y19D 1PLCA 4C4UA 4IMKC 1LEIB 4PUXA 5HHOB 2B3RA 1QRND 1R24A 3WEXB 1EFXD 1G7PA 5DT1L 3BUBA 1U3JA 4DZBB 3N9GL 5FOBA 1G90A 5C9KA 3CSYA 4XN4A 1DUYB 3A6CH 4Q6IA 5C0CA 1T0PB 4FDWA 4QRRD 5EU7E 4YDJB 2R0LH 1J8HB 3VZTX 3BQUD 4OFIA 1OAJA 1F41A 2IWGA 3X1GA 5C0FB 2OZ4A 1I7UB 5HI5D 5A2KH 3MLXL 1E9PA 4L8DB 4PJ8A 5DWUH 1ERNA 3FFCA 3BISA 4JKPH 3FTXA 3KXFE 4NFDA 4HKBA 4TF4A 3O11A 2KT6A 3F6JA 5JOFB 4XTRC 4H8VA 4XCEA 1E9OB 5DHVA 3Q05A 3O6KL 2JMMA 2VMEA 2MWCA 4HOXA 4U6VL 3BVNB 3SDXE 4LSEA 1JF1B 5HD8C 1RFDL 1AXTH 1FQ9C 1MELA 3WDIA 4RISL 3AROA 1OT4A 4K73A 2ZNWA 3G6AB 1LQSR 2YMXH 3FQNB 2V3EA 3U0WH 4K94H 1ZS8A 2WVVA 3BE1H 3GD1C 5CJXC 1VB9A 4ZG1A 2VW7A 3B3BA 3SE6A 1BOYA 2OP4H 2XRAL 3HWBA 4M9PA 2UWEE 4L37A 5EBMA 5EUKA 4DP0X 1MCHA 2H2PD 4XXCA 3QG6B 4XVSH 2ISDA 1I9IL 4AIZB 2ID5A 4DK3A 1B0RA 4IBSA 2VR5A 3CX5J 5F7WC 4Y2DA 5D1QB 2FR4B 2DLFL 1MFUA 2UZYB 1CR9L 3O2DA 5F97E 1U3NA 4LFHG 5EF3A 3ILQC 1J0IA 4G43B 2JJSC 1C7TA 2OQJB 4Z8FH 4OLVL 3LDBB 2E9BA 4W4OA 4M1GH 4IBZA 4P4KB 5DVKA 4RMWA 4QTIH 1RZIA 5DMGD 5B1JA 4JQIA 5CINH 4B6ZA 3CZNA 3OXSA 1UJ3B 3MA9H 2VUKA 4X5RA 3NP4A 4OZHB 4LAQL 1BYOA 1WT5C 3L5XH 3QQNA 4KKBC 1FC1A 3MRFB 1ONQA 4WTXA 1QSFE 2YPKB 4NS0A 2DMKA 2XVBA 4JFTA 3CSPA 4H13C 3L5WA 3D2UA 2NXYD 5EUOF 3RX9A 5GS0H 2OPCA 5M94B 2IWFA 3UTTE 1FYTB 1RPQA 2BDNL 3CCHA 5DC2A 1RK0B 4AENA 1I3GH 3VU2A 4LXFA 1E42A 3V5KA 2IH9A 1NEUA 2FB4L 4JO8A 3CXDL 2CBQA 4LVNC 3RX7A 2QR0B 5CJQL 2VDOL 3TN0C 4AKQA 1E5CA 1CLCA 1OB1A 1FL3B 1JGLL 4M7ZC 1VJSA 4LL1A 3QDJD 2R1WA 2J1WA 3VQ2C 2YD7A 4YDLB 1T89C 4YX2H 4XXWC 4NZRL 2YSSB 3P2BA 2EXYC 1UH2A 3MNVA 5DEZA 3RWEB 3CQQA 1T03H 2VIRB 3WMQA 1WFJA 4NO3A 2UXVA 4OZIF 2XWJA 3G04A 1XF3B 2MCPH 3L95B 3VW3L 4LFHD 4KKAD 4LSVL 4BFEA 1KXQA 5BJTB 4Q0XH 1SJVA 4U1SB 4XNQA 1WEJL 2EO7A 2NX5E 5DJCA 4UT9L 5E1HB 4ZMYA 1INDL 2NYZA 4JFPA 4LEEA 3S37X 1E40A 2ZOLB 5AW2B 1HHHB 2ZOTA 2WTRA 1LYQA 4OQ1A 1LE5B 2OR9H 3ZDWA 3VUAA 3W0WE 1RZJL 1SVZA 2DBLL 2JKIS 4PRDB 1QRNB 3RBSA 3GS0A 1U33A 3TO4D 2IPTL 4QJ3B 3KPLB 4NRYB 4WFGE 2W91A 3QJFB 1BZ9B 1NIFA 2DWYA 4Y19A 4K3EH 3UTZB 2N7SA 4DUXA 5I1KL 1JPFA 2XTSA 4WW2C 1X7TA 4U0RC 1GC1L 2QPDB 4NZDA 4FLRA 2X4TB 4NWUL 4X80H 5GSRB 3ZLQC 4B3VA 1AQHA 5F44A 4RFEA 2DD8H 2Y3AA 1MCOH 2YD0A 4OR1A 5CEYB 4KRPD 4Z77B 1BXAA 2ESVD 2OMZA 2Y1YA 2OJZH 4RAHA 2WQRA 4G83A 2B2XH 3D39B 3WL9A 3QRGH 5GZOC 5F9OH 4CSPA 2Q7NA 3D9AL 3C08H 3MVSA 5DK3A 3UJJH 4P46B 1MHCA 3VXTB 5F8QC 2Z92A 5AYUH 3QUMA 4QHLB 1F3DH 4KXDA 2RQ8A 5JR1L 3ZL4H 3I75A 5T3ZL 5FFOA 1KN2H 2VE6A 2QADB 3B1TA 2BNRD 2UZXB 3GXUB 2WXJA 4EVNA 2FVNA 4LT7A 2HJLB 4JUSA 1JUFB 1CQYA 2WQ8A 4HIXH 2QZ5A 4JPQA 4N3TA 3RWIA 4WWID 3GUTB 1ZVYA 3WNJA 3CXFA 1JZ3A 3GBNH 4UTAH 2EKSA 4X6BB 2K0LA 2I7SA 4KK5D 3WTTA 4ZPVA 1AD0B 4KY1H 3L08A 5C6PB 1P4UA 4RX4D 1K9TA 4TRPL 3GJEA 3QUYB 1UZ8B 1KTLB 3F8UB 2D7TH 4HZAA 3TZVA 5C0NC 4DJMA 4HOMA 1QR1B 2ENJA 1KCRH 4PHZA 1AS6A 5H2FO 3UH8A 2ATKA 3ZHKA 2KKQA 4F7TB 1L0XA 1R3LB 1GXEA 4Q4IA 4PI2A 2JTDA 1QSFB 4MBRA 1XHHA 1NDGA 2HLFD 2X1WL 2C5DC 4TL4A 2DYRB 4K9EC 4NQVA 4ZS7H 3DX7A 4TSAL 3D25A 4UIKH 4JM2F 4XCYA 1DQVA 3MC0A 3MRRA 3L3IA 3X3FH 4CU6A 2M8XA 3BEWB 5ERWB 1CICC 4MQXC 2VLRD 4MXWL 2Y7SA 4NM8L 2RFXA 4ZO8A 4GAYB 2Q6WA 3S4SB 1EEYB 3HMXA 3RA7L 4M6ML 3BP4A 4ELMA 2BNUA 2E9WA 2L7UA 4PRHD 1IMHC 1O7SA 3CFDA 1WD8A 2HLAB 4PG9A 1FYTD 4RZCB 4AYFB 4KDTA 1OGAD 3BUPA 2X40A 5D7LA 4A6YA 4PJ7B 3V0JA 3ARFA 3KYOB 1A2YA 1Z7JA 5CLXA 2J5LC 3K74B 3GMMA 1MCDA 2DYSB 4X42A 4FJ6A 3VWJD 2R8SH 4JKLA 3DX8A 2EEXA 1ZLUH 1N5YL 5IG7B 5I82A 2Q76A 2CDEB 2AGJL 5IHLB 4QXTA 3TT3L 3VFSB 4QRUB 3AA6B 5B66O 3U48A 5GGQL 4KAQH 4NOBA 3QFGA 3C60B 4ORGA 4W9KC 1ZT4B 2WXMA 4EZLA 5IJBC 4TUKL 2WP3O 1TQTA 4YSAA 2R2HA 4NZJA 2PWGA 2VN4A 1NOFA 4MAYA 5ACLA 1YVLA 2DPKA 4I13B 4I18C 3CBKB 1IM3B 5HHOA 3WFEL 1G1KA 2V9TA 3VGDA 2RA1A 1NBCA 1BZDA 3CLEL 3QEGH 1WFOA 4YHML 4XNKA 3B2VH 2WXPA 1T3FA 4YXHL 3SDCB 1NGYA 3CVHA 3RFZC 4LLAA 3SBPA 1ORQB 2G0KA 1ZKAA 3TYGL 3VE0A 5I1IH 1N8ZA 2IG2L 1FVCB 2YD1A 3VFMA 5FAAA 1S7SB 5CM1A 1MNNA 3ARBB 4OFYD 3BPOC 3JT0A 3N91A 4F80A 3DROA 5BVJB 2WWKT 4KRPB 5A1AA 5C0FA 2VDQH 3N0AA 1T80A 5DTFB 5FV1L 4JFOA 3TU6A 4S10A 3N6YA 4JZNB 1HZHH 1G6RB 4FQQB 5KN5B 4QHUB 2VZ1A 1QHOA 4YLCA 3DRQA 1UA3A 4L3CA 3Q3GA 1I7TA 3IXTB 2OYLA 2OL3A 1KCSL 4I48B 4MD4B 5IYUA 4F7CB