4AYEC

Structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 1 e283ae304a mutant
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
243
structure length
243
Chain Sequence
b'GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAAKGSYSLGIFGGKAQEVAGSAAVKTVNGIRHIGLAAKQEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT FACTOR H
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 243
sequence length 243
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4ayeC02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ayeC01
4Z3TA 3VE2A 2Y7SA 3V8UA 3HOEA 3VE1A 4AYMC 3PQUA 2KC0A 2YPVA 2W80C 5T5FA 4O3XB 4AYID 1YS5A 3PQSA 5EE2A 4AYNA 4QQ1A 2LFUA 2W81C 4O3ZA 4O4XA 4AYEC 4O4UA 3KVDD 2KDYA 4AYDC 4O49A 3UAQA 3HOLA 4O3WA 4U9CA 4O3YA
chains in the Genus database with same CATH superfamily
1FV1B 1BSIA 4IRSB 4KKCC 3D51A 1XSIA 2YEQA 2P24B 4M00A 3MHZA 1E28A 5SV3A 3KAAA 4AIZB 3VW3H 3MCG1 2IOIA 2NCEA 2J1NA 4NM8L 1YMMA 3DX7B 2XI9A 1C7TA 4F4BA 1HZHH 4LU5L 3PWPE 5LGHH 2OCJA 4IU2A 4Q9QH 4OZHB 5DLML 5C70A 4I9WD 2VDMH 4NUPA 5TDPA 2R2HA 3PWLB 4UBDC 4GOSA 1B4TA 5HVWA 4DKAA 5CUSL 5EH1A 4QXWA 1AHWA 1LO5B 4OLVH 4IOSA 5TK2A 4Z3TA 2E7HA 3S8FB 1E67A 5KSBE 4AEIH 3ORJA 2EDMA 4QO1A 5JUEH 4N5UA 4W70A 2E9IA 1AGEA 1RLBA 4IOFD 3Q6GH 3A0BO 4XNYL 1WEJH 4FI7A 1OCZB 3U4BH 1YQVH 1M7DA 2OMVA 3DX9A 1JI2A 4AUUA 3HVDA 1HILB 4OFQA 1LD9A 1D5XA 2WUBL 5JLZB 5CMAB 3S4SB 1DQDL 4JZJA 4WIQA 1R24B 3NJNA 3VGBA 4Z3FA 1SHMA 4WO4D 3UZEA 1BVKB 4ZO8A 3WS3A 5B3SB 3M1OA 5JHDA 3MRHA 2XIBA 2EUXA 3O45A 2Z7UA 2PORA 3ARGB 3CZNA 2X12A 3I75B 2PO6C 1HE7A 3NFPB 2ZCHL 2ZOOA 1JNHA 3TCTA 4AQEA 4DQOL 3MXVL 5M95B 1JMXA 1ZANL 3HC3H 3ME0A 4X9YA 1GYCA 2KL6A 5EOQH 3QIBC 3L6FA 3QDGA 5HHXH 5HHPB 3TIDB 2B77A 2R4NA 1NDGA 1GPOL 3L5XL 5TFSH 7CGTA 1T20A 2F74A 3CZFA 2DN7A 3K81A 4EI5D 3VCLB 3SGEI 4HIXL 3FAWA 3WIAA 4U6VL 1LE5A 2PYEB 3OZ9L 1XMEB 1CGUA 1N9PA 3C2SA 1MI5B 2XWTB 2WWMC 3GS0A 1PYWB 1EJOL 3SB3A 5IT2L 4KTYA 4G83A 5D6CA 5C6TL 1VCAA 2X3AA 3CQQA 1JWMA 3NSXA 3QUXC 5D7JD 3MLVH 5D7LD 2VAAA 5DL8A 3TEUA 3VH8G 3WLWD 5L0QB 4Q0XH 5G2NA 2XKNA 3CVHH 4OB5L 5E95B 3B9EA 1HCYA 3G6AB 3WXVL 4HX1B 1TQSA 2F5BL 2FJGB 1MFNA 2FX9H 2R39A 4JFDD 1ZT4B 4I2XE 5DRXB 1DUZB 4X5LA 2FDBP 5JHLH 1E40A 3L16A 5H37A 4J3XA 4MLSA 4I87A 1TMCB 3MAWA 4XP1H 2CKBH 3WKNA 3GPEA 2GG1A 2H6OA 2Y5QA 4J4PC 4OZFA 4F15C 1M6UA 2VXSH 1D7FA 1MRCL 1PZ2A 3IRZA 4K94C 4N6RB 2Q87A 5CD5D 4P9MH 1A66A 2BFVL 3ULVH 4B6ZA 3QJQB 1RZJL 4GP8B 4JKMA 1EGJL 2HXAA 1CFNA 1HE8A 4ILDA 4YBQD 4AQ8A 2XTJB 5IOKA 2PCFB 3IFPB 2PWFA 3IEAA 2MOVA 2V17H 4JE4B 4LEXH 1U42A 1TZHB 4XMLH 1XZ0B 5I1IH 4J12A 4PP1D 1YJDH 4AQ1B 2NX5E 3JTTB 2QZ5A 5JXED 4EBQL 4PWIA 5I16B 1HXTA 4ISVA 5L88L 1RK7A 1ZLWH 3N1GC 3O11B 4HIJA 4IJ3B 1RKRA 4ABQA 2D4DA 2HX8A 2Y6TE 4XXDB 3FONB 2G75A 2ZKWA 4J3WA 1QFUH 4GUPA 4POZD 3MRDB 4JPVL 3HG1E 3RPBA 4EMZA 4GO6B 2W59A 3EBIA 4ZMPA 3UYRH 1QFPA 2WQSA 2ED6A 4FXTA 4JDZB 3I6LD 3UZQB 1EXUB 3FQRB 3L95B 3IDNB 4QWWD 3CPLB 1CDCA 1RZ8A 3TF4A 3GS4A 5K59E 2FIKB 2J44A 3G5ZB 4AYDC 2V7HA 2D3JA 3IVKB 5FYJD 5IROD 1WG3A 3T71A 1IIIA 5IMMB 1FVEA 2A6JA 5AOJA 3N55A 4MNHA 3F01A 4OFYD 3FB7B 5HGDB 5EBGA 2PN5A 4QOKA 3QQNA 1EHKB 1D3CA 3VDAA 5I23A 3MV8D 3H56A 3DROA 3KS0J 2AVFA 3GZQA 4BFOA 5FOJA 4N0CC 1WZ1L 1BIIA 5IJVB 3S3SA 3U9UA 2Y25A 4ZODA 3LK42 3IE9A 5FK9B 5KSBA 1JMZA 2A77H 3IXAA 1T2QH 4N2EA 3B7RL 4MJIB 3K2KA 1BBJA 1DL7L 5DS2A 4HSAC 5LVEA 4P2OB 2WLIB 3JT0A 1IFGA 1S3KH 2F9BT 3VTTA 3ARFA 3P3SA 3BRDA 1OSMA 1OB1A 1WPCA 1YEEH 3HRPA 3CSBA 1T0NA 5JOPD 2VYRE 2AAAA 4Q6IA 5CLXA 3MCLL 4BH7A 5LLIC 4H0LC 3UO8B 4FZEL 2CRYA 4KUCF 4NDMA 4YHML 4GS7C 2HRPH 1GFNA 1FAIH 1LO3L 1RQ5A 4HS6A 3PJLA 1QR4A 4LRNH 1OE2A 3IETA 4L4VE 4LVNB 2FZ3B 3V9EA 1L7IL 1WBXA 3MBWB 5FV1L 1NC4A 1HHJA 4J3SA 4PWFA 4GAJL 2PP8A 1IBBA 1O75A 3G6JB 3SJVE 3X13B 4M03A 2LHFA 3F5WB 1MREL 3NZHH 4S1RH 2VDPH 3QNZB 3OB8A 1DO5A 3OGOE 3UBXA 2ATAA 4GEIA 1IGJA 2NY3C 5E00B 3CMOH 4OLYL 1FSKC 3QJRB 3UGEA 3LIZA 2DV6A 1IZJA 4J3TA 3HHSA 4N20A 1OGPA 3EOBB 5IMLB 4HIPA 4ONHB 1SPDA 5EOCJ 3O81A 1C12B 1MCOH 2N0MA 2V5MA 3APCA 4IRJD 1TO4A 4JB9H 4XPTL 4YC2C 3DJ9A 1XAKA 2G3ZA 2XPGA 3ZXAC 1GS8A 4UZUA 4PJEF 2FHCA 3VFRA 1INDH 1XCWA 3WEMA 4Z18A 5C2BH 3D69A 3FN9A 3MRNA 5LBVA 4L1DA 1ZSHA 2ZX5A 4YBLC 2QPSA 5DTFB 4AGQA 5F7DB 5TE6H 1D5RA 5EZOH 3JSSA 5HI5C 4ONOA 1BD2E 2YKLL 2ERJB 1JRHL 2Z4QB 2OMUB 3HPLA 3MLXH 4QXTA 2V2TA 5ADXK 4I2XA 2M07A 1KIQA 2YN3A 2OMFA 5IQNA 4PVLA 2VLJB 1SMOA 1I85A 1ZTXL 3PGFL 4NZUL 3PJSA 3QYNA 4WK0B 2W88A 1W6LA 1GGIH 2V33A 4KK9C 3WJLA 2V9RA 4PBVC 3ZMRA 6CGTA 1EDQA 2F54E 1MWAL 4TYUA 3NIDE 3WG7B 3WEXA 1S7WA 4KVPA 4GRLC 3GJFB 3Q5OA 1ZDQA 3O3EA 3QNYA 3QXDA 4FHKA 5DDHB 2EUZA 5DWUH 1PFCA 1MFDL 3LIUA 2OI9C 1BLIA 3OKNA 4E0RA 3A4AA 1ET7A 1NCWL 1N6VA 1WWCA 1BHGA 3IJ7A 1S78D 1MIEL 2YD5A 5EFIA 3HZYB 3LQMA 2DQDL 3P11H 3L4YA 5C08D 2YOCA 3GHEL 1GZQB 5HPOA 2A9NL 3BFQG 2P8PA 4YSRA 3TOPA 4A6YA 4HEPG 1WFUA 2EKSB 4LVHB 4R7DB 1U8IB 4OI9A 2ZYIA 4GO8A 3NRFA 4JHAL 5EEUA 1JF1A 3DX3A 1BVLB 1A64A 3MRJA 4K2UL 4MXVE 4APXB 2BNRD 4ICWA 3AAZB 4NYLB 5DJDB 4NP9A 4FZLA 2IFFL 4FFYL 1F90L 4DNLA 3I6GB 5FCUL 1UENA 3CZSA 3KWWB 3QXVA 2OZ4A 1MKFA 4HCRA 4ONGL 5KYUA 4OZIE 4JFWA 4BHUA 4V1DB 5EORL 4KROC 5L2JB 3BAXA 2B08A 5DEGA 1Q90A 2X1OA 3E6FA 3VH8B 4N75A 2K70A 5BVJB 1WITA 4LSTH 1XXDC 3B5TA 5EEXA 1RV6X 1S9YB 2ORBL 3RB7A 5JMOC 3IWVA 2X9KA 2E7DA 1IAIL 4RIRA 1K8DB 3HG5A 5E9DB 5I0VA 2Y2WA 1G7LA 4DF9A 1H15B 4NBYB 4TLTA 7TAAA 3DPBA 4KFMA 2VR9A 5C0BA 2B2XL 1M71B 1JZ7A 3IMSA 3MRMA 5T3ZH 2QELA 4ZFOB 4W9GC 4KR8A 4KVCH 3SIKA 4G82A 4LDOB 4D5UA 1L5GA 4GBXB 3S8GB 3SDAA 3HKZA 3SYOA 3SY7A 3L4CA 3WD5L 1RCYA 4FQXD 5D7IF 4PLOB 1D9KD 1JYVA 5TD4A 4N2KA 2OQJA 2DYPA 2OR9H 2FYVA 3LZNA 1YQ2A 5JPMB 4JM2C 2NY1C 3WN5A 2X0VA 3QIBA 4HWZA 4KKBD 4L4VA 4YDLC 2V5TA 4FZ8L 4HUCA 1FFQA 1THQA 1P5UB 1A3LL 3SJVA 3AA1B 1LM8V 2UZIH 5HYQA 2HLFD 5AQ0A 2F58L 4ZT1A 2WYTA 4JZNB 3MREA 2VRKA 4NKIH 4YH6A 4BFJA 2FH8A 4RGOH 1G9NC 3BE1H 4O2EA 1QSFD 4YUEL 5E94A 2ZUVA 4X0KB 3TNMB 2EIZA 4KI5C 3M46A 3HE7B 4L1LA 2NT1A 1ZKAA 3QRGL 3W11C 1YEHL 4FZNA 1AZNA 2GSIB 4JFVA 4D9LH 4QLWA 4PJ9D 3BLPX 4DKFH 1QFHA 4PS7A 1I75A 2BSSB 4N74A 2YD0A 3RFRA 4PJDB 9PCYA 4LE8A 3N43F 1XEDA 4YDIH 4F92B 2R0KL 4OGYL 3QRCA 5EG6C 3RIAK 3ULUD 4JFOA 3E8UL 1RIVL 2WN2A 4FRTA 1XB8A 3BH4A 5EOTB 4PJ8C 2I07B 4PCYA 1FVDA 4X9FA 1KWKA 4B9JA 1OSYA 3TNNA 4KHXL 4MNQD 2Q8AL 3RNQA 4J4PA 4BHUI 4Z7IA 2HKFH 4WNSA 5TE7L 3A6CH 4PLJC 1A3ZA 4NC1C 4Y2OA 5E6SB 4HSCX 1WUNT 3VXRD 5FC9A 3AREB 5HGAA 3KPOA 2NY4B 5BJTA 4LSQH 4L2LA 3RGVC 5C07B 2X2UA 1N64H 4NQSB 1PEZA 2X4PA 3U1QA 3EG9A 4Z7WB 2WLJA 1FFPB 2I9LA 4BBWA 1DQQA 2CD0A 3G5VA 4MJ4A 3KDMB 4U3SA 2ZP9A 1TZIA 3S36X 1CU4L 3JVGC 2X7LA 4I48B 4KDTA 2ZOWA 1VADA 5I1JL 3K71B 1IFRA 3D2UB 3C60C 1YN6A 2VN5A 3NDYE 4TVPH 3TPKA 3P73A 3HS0B 4D8OA 5EEWA 2DPKA 1ORQA 3TTSA 3C5ZA 4NFDA 2DKMA 2VJ8A 3SGKC 4KRPB 3RY5A 1KN4L 4OZGF 5A2IH 1LK2A 2ZOLA 3ARGC 1CI3M 2BIMA 3GSQA 3NCFB 3AMLA 1QSEB 3X1GA 5IW1A 1ZMYA 4XCEB 4X9IA 4Y2DB 5JDSA 4EVNA 4NWUH 4NZ8A 3HC4L 3S5LG 3BWSA 4KTEL 4ZZFA 3N44F 1X5AA 3U83A 3B2MA 3SKJH 5FLVA 2CA4A 5DCCA 3SCMC 1DQML 1I3VA 3IDIA 4U6HB 4OAWA 4ZQTA 4KY1L 5D7KD 1QBBA 4MD5B 3DGDA 2FJSA 2NPLX 3BX7C 4S1QH 5F96L 3MLUH 3MRFB 5LBSH 1AZVA 2VDRL 2NY0D 3L3JA 3SE8L 1JIBA 4XOBA 1FLRH 1IGIH 1DVFD 3BXNA 3NSJA 1MAMH 3DOSB 1EJFA 4O02B 3TN0B 4BFNA 5FYKH 4BWUA 2D2OA 1TO5A 2BP8B 4FT6A 4P4KC 3MV01 5AW6B 3SZKC 5D72L 4X6FB 4LK4A 3ABKB 4QRPB 3QDHA 3N40F 1FO0L 4XNXH 3GMOA 1ED3A 1YEDB 5E1AA 1LO0L 4DWHA 3U36B 4DZ8B 2EDBA 2JIXB 5H2BB 3MRQA 2AK4A 1I1AB 4HEMA 4IJTA 2Z3FA 1XTMA 2ENJA 1HVXA 4NO2A 2L4OA 1HH6A 4LOFA 5BV7L 3PHQB 4JY6B 1RK1B 2V3DA 2ZFGA 4RNRA 4L4TB 3V6ZA 4AITA 3MV9A 2FL5B 3U2IA 1UD4A 5FGCB 3UTOA 4O3ZA 2JE8A 4FFWD 3NT0A 3P4NA 2P8LB 3D4YA 1UM6H 2Q6WB 4IQHA 1YEKL 2UXTA 5I8EB 2JCCE 4MD4B 1GZHC 1KGCD 5B8CC 1G94A 1G1OA 4HJJH 1FF5A 1T7ZA 1QI5A 3LNGA 3HI5L 5DUPL 4HZAA 3QFJD 5AWNH 4FQHA 5DXWA 2GYSA 2XTJC 4U1GC 4PJHB 1IEHA 5T5NF 1AO7E 3BSHA 1NMCB 1ZLVH 2VDOH 1DDHA 4KI5E 3SEPA 1UADC 2A4ZA 4ONFH 2E7LA 3JV0A 4NN7B 2ADYA 3MGOA 1NGXB 2Z92B 3AMKA 2X3CA 4AQ1C 2BFGA 4ZYKA 3FTSA 3CFEA 1ROWA 1E9QA 3MRKA 1I9RL 4AM0B 3U4AA 3GTNA 4JCLA 4RGMB 1AQKL 1IC7L 4MMZB 4IJ3C 3APDA 3DX1A 1AGDA 1JUFB 2P5EE 2XQBH 5DJ8B 1H6S1 43C9B 3UFIA 1UXSA 2NQCA 4KJYB 4DW2L 3AU1A 4EIGB 3QR0A 1XGUB 2Y07L 1L9NA 1BT9A 5IR1A 2NNXA 2Z8SA 4WWKB 2NW2B 2XX0A 4JMNA 1OE3A 4AVKA 2XWBB 2J25A 1HIMH 1DQLL 1GYUA 3MN8A 1FIEA 1VRSA 2JKNA 4OI7A 4GIPD 3BUPA 4UCFA 4OIAA 4NC1E 5EO1A 3FO0H 3FQ1A 1F4WL 2NMSA 1P7QA 2IH1B 2BC4B 3B43A 4HMCA 4NNXB 4AV0A 4KMTL 3RE0A 2DQMA 4G1MA 2VLME 2A6KA 1OARL 1KT2A 3M88A 2NSQA 1W72H 4GRLA 5I8OL 1HYSD 5K9QI 4NZRH 3TONA 2CK0H 4RAUA 3HS8A 3L3GB 4PGCA 3WY1A 4XH2A 3O6ML 3T65A 4P06A 1CIUA 3TH4T 4AK1A 1KB5A 1VFAA 2XBZA 3QJZA 3IMRA 3B1UA 1XF3A 5LAPA 3LN5A 1OD7A 1G7IA 2W5PA 1CTOA 3LZLA 1ZA3A 2VL5A 2ZE0A 4NNPH 4JK0D 3FSWA 2AXJA 3VX0A 3BISA 1BXWA 3U0TB 5F7UA 5K1NA 2R69A 3S2AA 4CSSA 5JNYA 3F85A 5AD0A 2ZF9A 4ECNA 3B2XA 1L6XA 5C09A 1EAOA 5BUGA 2CUAA 3IE4A 4LZKA 3KL0A 5GGSB 5KZCB 1A8JH 4PYGA 3ESNA 2R88A 4LVNC 5BUAA 5IV2A 2RBLA 3GSXA 3KWVA 2YK1L 2XYBA 3CFJA 1G7HB 2YEVB 1AI1L 2AJYH 4NPYA 1F2QA 1AP2A 3U9PH 4HS3A 2I9TA 3GMRB 2FBRA 2DTMH 3DXAE 4NQXB 4NP4L 5DMIH 1N5YH 2YWZA 5DZAA 5T33H 3K46A 5KVFH 4M43H 3HPJB 3Q1SH 5FGRA 2PYEE 1DYZA 4KMLB 1A9BA 4JPWL 4TNGA 3RGHA 4A66A 4LLAA 1SHXA 2D7QA 3S88H 1J9TA 1U58A 2X2IA 5ABZA 1T1YA 2WXMA 4F1ZA 4F93B 1OPFA 4MHHI 5FYJL 4PWGA 5F8RC 3TYFB 2HKHH 2JJWA 4FQQA 1JV5B 1VFBA 5E8PA 3MRBB 1EH9A 1PGRB 4HQQH 3VX1A 3QI9B 4G8FA 1AZRA 1DCEA 1L9SA 4I8DA 5F93C 1E9PA 1DR9A 2FSEA 2ERJC 1KTDB 2V5YA 1AGCB 3OKDB 1FG9C 2R7EA 4WWNA 4GKNB 1NCAH 4APQC 5ID1B 3MODH 1ZGLB 3NEOA 2D31A 4RMVA 4X4KA 5KSVA 3GSNH 2Y7SA 3QC5X 2DWYA 2GC7C 5DD0L 4JRYD 4Z0BL 2FWOB 2XTJE 4L8SA 3LNIA 4HIQA 1M1XB 3CXDL 4KNSA 5DJ2A 5BOPA 5IHZB 3H1ZA 2CBMA 3EFOA 3R8QA 2ARJQ 2I5YH 5CJOL 1YCSA 5F89A 4POUB 4PHXA 2PXYA 1HXKA 3I50L 1KLGB 5KUMA 1AO7A 2OTUB 4HJGB 3S37H 1ZWIB 5AVZB 4A7GA 4EIZC 4DVRL 2PPAA 3FHEA 4XB3A 3WTTA 3IFOB 4FTDA 1OM9A 2YPVH 4H8PA 2YRZA 4D94A 1KIRB 3O3AA 1R3LB 3O6FC 1KN2L 3D25B 2PPCA 2BY0A 5C2UB 4F5CA 5DZVA 2VDQL 5K1JA 3RVTC 3GJFK 4NM4L 5CEXB 1XAUA 2G3XA 4ATWA 5ILTH 4U1SA 1MPAH 2WKGA 1FV1A 3S5LB 1SM3H 1CXHA 4FN0A 4RH4A 1A14L 6FABH 2P24A 4FABL 4I0KA 1I9JH 4AIZA 4OT1H 4HC1A 1RXLA 4AYSA 1JXJA 5AB0A 3DX7A 1LGVA 3GC3A 4IRZL 3QS2A 1USZA 1N0LB 3ULVD 3D33A 3VJ6B 4BSJA 2DDQL 4AQZA 1CLOL 3JWNH 4OZHA 3NPZB 2QTEA 5I6PA 1MJJB 4K5OA 3PWLA 1GIGL 3D87B 4L2YA 1PY4A 1T89C 2DQTH 4AWJC 1LO5A 2JKRM 1WFNA 4WFHD 4YHIB 4JUSA 5FV2A 4PW9A 5JW3H 3NDZE 4JX0A 2HFEA 3VD7A 2F8IA 4PG2C 1GGUA 4MJIE 4PJFE 5HDOA 2WZ6A 3IM1A 3JVGA 1NGZB 2E6PA 3DSFH 4W6WB 4X9GA 3VUAA 4QAMB 4AY0A 5JW5B 4RQQA 5CNHA 3VAEA 3EYQC 1HILA 5JLZA 5CMAA 3S4SA 3US0A 4M9OA 1R24A 2WXRA 3MZGB 4LPTA 5ICYB 4XO3A 1KFAH 1ONQB 3ECWA 4F33B 4QXGL 1UA7A 1BVKA 2R4SH 3W0WE 5IVXB 3ARGA 1ZT7B 1U30A 2CIIB 3I75A 3NFPA 3EOYG 1E6OH 1H8OA 1VGEH 2KPNA 4H0GA 4HSQA 3B2PA 4L0YA 1U3JA 1GGCL 1RZQA 2BWQA 4JFXB 3G04B 4NO5B 2XKSA 5GHWH 4RMSA 3NZUA 4GRMB 4KMQA 1WHPA 3SHSA 3WIHL 3TIDA 5HHPA 4TRPL 4MSWA 3S3CB 1P5UC 1KC5H 3BQUB 3VCLA 2EE0A 4F7CB 1A1NB 1IFHH 1RUKL 5JR1H 1DVQA 1E5ZA 2PYEA 4MLIA 4ALAH 3O0RH 4HWBH 2ZSWA 3EGDB 3QUML 4KQ3L 4LKCB 1KDIA 5CGYC 4QHUB 1MI5A 2XWTA 1DJHA 1PYWA 4IW4C 1RERA 1WGVA 5KSUB 1E7UA 4LAQL 2BSRB 3C09C 1CDYA 4RGNC 3KPQB 2RB8A 3G5WA 4NN5B 1RZKL 3G6AA 4HX1A 1HS6A 2XXCB 4NQDD 3EXLA 1T5WB 2FJGA 4OLEA 3W81A 3FU5A 1ZT4A 5DRXA 1DUZA 4A2HA 1ZGLP 5F6IB 2OZNA 3HMWH 4C00A 3ZDYF 2ZXGA 2VLJE 2HYMA 2J88L 1QPXA 3FUNA 2GEEA 1LEIB 3LTVA 5F1IB 3BD5A 3QPQC 1GZHA 4KK6D 3L3KB 3LH2H 1MFEH 4N6RA 2FLRT 2VAJA 3SE9H 1GL4B 1KTBA 1ID5I 1IBGH 4G5ZL 1P4IL 2PCFA 3IFPA 3V0AC 3ZJAA 3I9AA 2O6PA 3Q2NA 1UUNA 1XZ0A 3I9IA 2R4LA 3NA9L 2UWEF 3NUKA 4AQ1A 1X5GA 3JTTA 2AV7B 2EADA 3OD3A 3BEVB 4E9VA 3DTXB 3SD2A 5I16A 5MI0B 4BELD 4FC3E 2ODIA 3O11A 4KY2A 3LPWA 1BQSA 5DFTA 3MCKB 5DVMA 2NNCA 1AJ7L 1MWAB 1NCHA 2WP3O 3KM2A 1VKXB 3T0AA 4XXDA 3FONA 4G6AD 4Z7WF 1TTFA 2YA0A 4X6BB 3MRDA 4XNKA 2HT3D 4JDZA 1V7NL 4BZ2L 4MVBD 5AW2B 3UZQA 1U8LB 1EXUA 2G3NA 4FLOA 4Y9FA 3FQRA 5I5MA 2YPLB 3IDNA 4M1GL 2DMKA 3CPLA 5ID0B 5J1AB 4OJDH 2GIMA 4KRPC 2FIKA 3G5ZA 3IKKA 4TLUA 5I2IB 3ESMA 4EIBA 4DH2A 2QHRH 5IMMA 1GKEA 4OCXL 2VQ4A 4GXUM 3BP6B 3NSFA 5HGDA 3FB7A 2EE9A 2CCLA 4NQTA 3V0JA 1Z5LB 3S6CA 3HAEG 3KPSB 4FFVD 5J0BA 3QHZH 4XHJC 3BMWA 5ITFA 1U3HD 3QXUA 2GJPA 1AQMA 1AOZA 3QCVL 1XHHA 2OMZB 4KX7A 3PFQA 2N0KA 3H9SE 4RA3A 4TTDD 2G2NA 1F8TL 4Z7VF 5IJVA 3RJOA 2DMCA 4UOQA 1SVBA 3ULUL 3CN4A 3FYIB 1U8JB 1P4TA 4S1SL 3OPZL 2P7TB 1I9IH 3TN0C 3U30C 5FF6B 1J11A 2YD9A 4MJIA 1D6VH 4P2OA 2WLIA 5AZEH 1II4E 3B8SA 3IK2A 4JG5A 3ZE2F 2FNWA 4X7TB 3CJJA 3N1MC 4AC4A 4OM1L 5HYSG 4U1LB 5B7EA 1X4YA 1VPOL 5HYJE 3B9AA 25C8H 3TT3L 3RFZB 3OXSB 5I6LA 3WUWA 3TO4D 4M8RA 4W9KC 4JFUA 3HZVB 3NPSB 2FZ3A 4XO9A 4AG4H 4HUKB 3MBWA 5D2LB 4FRXA 2QVIA 3HIZA 2WXNA 1WCBB 3G6JA 5D1XC 3X13A 1RVFL 3F5WA 4ZRGA 2EDFA 3QNZA 4FERA 4Q74A 1NC2B 5IVZB 4U3XA 5LQBH 3O2WL 5E00A 2BW4A 4Z7QB 1TR7A 4HAGA 4KKRA 4R2GC 1CR9L 3FTYA 1NMCC 3CHPA 4KTDH 2VJ0A 3EOBA 3Q01A 4NN7C 5IMLA 4HCGA 1M05B 2O5YH 4ONHA 1C12A 3MNWB 4G6FD 1FC1A 4UINH 4DESA 2ZCLL 4RGNE 5D7SH 1S5IL 3GSUB 5GRVK 5T3ZD 2R29A 4HPYL 1TKWB 3VXPB 3I9GH 2IWGA 3ZT5A 4P8QA 4QYOB 3BDXA 1OD9A 2PUQT 5DTFA 2KLSA 5CSBA 3THMH 4GQ9H 2X6CA 1IBYA 4WWKC 1IM3A 1B2WH 1QZ1A 2OMUA 5DS8B 3NJHA 4QKXB 1X5XA 2DAVA 3Q13A 5ICZB 1A7PL 1BEYH 4YDMA 2VLJA 3BIBX 3T8XB 4GYBA 1V3MA 1WTGT 4N24A 4KK5D 2WVPA 3FTZA 1IBZA 3C2AL 1CQYA 2V3FA 2ZAIA 3CZJA 4HT1H 5C07E 4TQIA 1CGXA 5LBGA 5SWZB 3LPFA 3U82B 4KRAA 1NKGA 3REVB 5KG9B 3GJFA 4MXQD 3H3BC 3FF8A 1COBA 3OF6D 5DDHA 2PCPB 2C9SA 4OGAC 4AJYV 2Z1PA 3HS9A 3WDIA 4FFTA 1DJWA 1EFQA 5DZOA 1ITCA 1UWEL 3O6FA 2OX5B 5KJRH 4O2FB 2JKWA 1J8HB 1E9OB 5DRWB 3Q5TA 1TEYA 1GZQA 2WWKT 2VJXA 3RWIB 2KPWA 2EKSA 4R7DA 4ZFGH 1U8IA 2WLZA 2WLYA 3R4DA 4W9EC 2FR4B 1GS6X 2R8AA 3QCUL 4APXA 1BVLA 3ARYA 3D9AL 3AAZA 1QP1A 3HLAB 4NUJA 4V11A 4NYLA 5DJDA 1KV3A 3UCRA 3QG7H 1MF2L 2XN9D 4J6RH 5GJTH 2HFGH 3I6GA 2CR0A 2AEPL 4OFVA 1PF3A 3KWWA 4UTBL 1NCBL 1TQBB 3QJHB 5C7XL 4MAUL 4JKLA 1C5DB 3BAJA 2ZG3A 5KVGE 4GUOA 5TISO 2BIPA 4UT6A 4DTGH 5L2JA 5T1JA 4YZWA 1M7XA 3ZKQD 1UC6A 4FG2A 2EEBA 5FM5M 3VH8A 3PV7A 5BVJA 3WCYA 1EQWA 4PG2A 2A9BA 4JRWA 5HHOD 1S9YA 4MAZA 1ZHXA 1O6VA 3BUIA 2M1KA 4ZS7H 1K8DA 5D4QA 5E9DA 5GGRY 5TDOB 1RIUL 2AABH 3QEGH 1H15A 2C9QA 3BW9B 4KO5A 2FJHB 1M71A 3TBSA 1I1FB 2JJUA 3H6JA 2WVUA 4TVPD 4N3UA 3ZDWA 4ZFOA 4PQXA 4NGHL 4GF4A 2VDNL 2VDRB 1A6AB 1LP9B 4GBXA 3KPTA 4QGTA 1E8WA 1KENH 2CM6A 4EUPH 1T03L 2OM5A 5ALCL 3QI9C 4CKVX 3I3BA 3U6RB 4Y1AD 4I4WB 1LNUB 4L4TE 4K3EH 2ICWI 4Q52A 1JWUB 5JPMA 5D1XE 3ZKNC 1GJUA 5IHBA 4QJ5B 3GBLA 4LGPB 1I3UA 4PRHD 5DVNA 2HRGA 5ECGA 4N2NA 2I27N 5IQ9B 1P5UA 1ACXA 1EX0A 2Q2EB 4PJHE 1VZIA 1ZVHA 3AA1A 2LAAA 4XWOD 4ZD3L 4JMXA 2OSXA 4ZAKC 2KI6A 4JZNA 4I1RA 1EHLH 3NG5A 5BV7B 4JG1H 1RP8A 3NA4A 1JZHA 5L6YH 3OLEA 4O5LH 1DVZA 1TZGH 3VW3L 5FYKD 1JCVA 1J5IA 3N5AA 4H8WC 1QSZA 1BVOA 4WUKH 4LCIH 4X0KA 4YN3A 4E1SA 3TNMA 5CCKH 5KYWB 3WE1A 5F1KC 3HE7A 1HZHL 5LGHL 4YLQT 3FN0H 3Q48A 4Q9QL 2BRRH 4FI6A 2GSIA 1RZJC 1Z3RA 2VDML 1RL1A 4EN3D 2BSSA 2DI9A 4WO4B 5I8CB 4TUKH 1IQWH 4PJDA 2L7EA 3ELAT 1XR8B 4U05A 4YXLH 2ROYA 2G2RB 1R9FA 3HBQA 5JUEL 4AKRB 3HAEB 2I07A 4H8UA 2HMID 3Q6GL 2AK1H 2OJ1A 3U4BL 1YQVL 1EMTH 4IU3B 5D5MB 2ADIB 4KQ0A 3O8XD 3NRPA 1YECH 1I7TB 5LB1A 3IGFA 3SQRA 1FRGH 5I1KH 1CF1A 1ZOXA 3NFNB 3ECVA 1V8HA 4FXGC 1AHMA 3AXLB 2WMPB 3W56A 2HPOA 4EI5B 4OF0A 5E5MB 3AREA 1EVTC 3QR1A 4R7NB 5I1HL 1ZHKB 3EIFA 1YAIA 1GOHA 2G5BB 5C07A 2H0EA 4NQSA 3VA6A 3ZTJH 3PQYD 4Z7WA 1XSOA 1FFPA 2Z34A 3VRIB 5HYSB 4UMGA 1AZBA 3KDMA 3HC3L 3E3QC 2W9LA 4KRLB 5C0AD 3ES6B 5D7JB 5EOQL 2P8MB 3OB0K 5D7LB 4I48A 3LKOB 5AALA 5HHXL 3K71A 1QJ9A 3D2UA 4WSGA 5TFSL 4NZFA 4FADA 1SGKA 3BJ91 3MV7D 2VN4A 2Z8WC 3WNJA 4JFDB 3HS0A 5C3IA 2B3RA 1XMWA 2EINB 3DO3A 5KSAC 1QSEA 4EKXA 4XCEA 4Y2DA 1IT9H 3UO1H 4HPHA 2MPAL 4PJBB 2ZUSA 5D96C 3ZYZA 4N6QA 3EDFA 2BHZA 5CBAB 3CZGA 5IVXF 4Q0XL 3CVHL 4U6HA 3RGBA 2NSMA 1QFWL 5AFAA 4JM4H 2YXVA 3BQUC 3N2JA 2C1OB 4UIMB 3MRFA 4X8XA 2VQUA 2J2ZB 5JHLL 4RRPA 3DOSA 4O02A 1G4RA 1SYVB 3PXLA 3TN0A 3K80A 5K59F 5HVHC 3V8OA 4OLXH 2CKBL 4X4ME 4XP1L 3VE1A 3W39B 2BP8A 5GS0C 2VXSL 3RBHA 4P9ML 4X6FA 3ULVL 5J1TC 2PWDA 3KHOA 1PTZA 1HDMB 4GRWB 2DWTA 3O9WD 1YEDA 1J0JA 2RR3A 4V33A 1L9OA 4UANA 3U36A 3BP7B 4DZ8A 4X0NA 4NN5C 5H2BA 2V17L 1ET5A 4LEXL 3TCLB 1BV8A 4CAGA 1K5WA 4XMLL 1FHNA 1U36A 1TJGH 1I1AA 3GK8H 3L9BA 5I1IL 5DUBB 1G7MB 1YJDL 2H1XA 1GXEA 1W8NA 3LSOB 3QS3A 5GS2H 4ZFQA 5F9AC 4BWTA 3PHQA 4JY6A 1JXKA 1RK1A 3FUIA 5CIPH 4YIQB 3T6VA 4L4TA 1MCFA 2FL5A 4HZLB 4MGXA 2IDUA 2P8LA 4OQTA 2Q6WA 5I8EA 4MD4A 1PS3A 4S1DD 3CD4A 1QFUL 2B3IA 2IPUK 4MQ7B 3V0EA 3MV8B 5HGHB 1Q9FA 1S9WB 5E6ID 3UYRL 2R4PA 4PJHA 1R5VB 1UOWA 1OWRM 2QEJA 2LFEA 3UG4A 2WV3A 5H8DA 1QUNB 5E03A 4I77H 2EO9A 4Q9RH 1U4EA 3TZVD 4E42B 2X4UB 1NGXA 3UAQA 2Z92A 4MA8H 5DR5H 4Y5VB 3TIEB 4KQ4L 5DJAB 3EBHA 3M7OA 1XF5B 4HEPA 4AM0A 1PSKH 5MI0C 4J28A 3PE9A 3VE2A 1T6WA 3UP1A 4MMZA 4QMEA 5D9SB 1JUFA 1KLUB 5DJ8A 3VXOB 4KJYA 2DM2A 4QHKI 4P3WA 1XGUA 4L0ZA 3GO1H 1KG0B 4PV9B 1HZLA 4WWKA 2D0FA 2NW2A 1PZSA 1WAAE 2EICA 2XWBA 2OJEB 3OMAB 4WTZG 3GBNH 1MEXH 2A77L 2O26U 4PGEB 1T2QL 2QGBA 3L13A 5CM1A 3ESPA 1P6AB 1KUMA 2IH1A 2BC4A 4NNXA 1XCQB 2BHUA 2VDQB 4KRNA 4AMKH 1YEEL 5I73B 1HL9A 1JHLH 1ZY9A 2XN2A 3E80A 4H1LG 2KH2B 3EBAA 2GY5A 4FOMA 5IESL 3Q44A 1G7PB 1JV2B 1RPKA 2P80D 1BQHG 5ETUB 3L3GA 5GGQH 4B9FA 3E3QE 2IADB 1NAKL 2FGQX 2HRPL 1FAIL 5A2CA 1DO6A 4R7LA 4LRNL 1A47A 3PV6B 4IRJB 4HU2A 2BP0B 2R9HC 4B96A 4LGSB 4YPGB 4DP8X 1JERA 3O3DB 2DD8H 3NZHL 2MJWA 2VDPL 4S1RL 2X88A 1GYAA 1E4XI 4CKQA 2C9RA 3U0TA 3POUA 1H8NA 3CMOL 2F8OA 1P0SE 2X4SA 3ARWA 1NICA 3W1ZA 1SF3A 5GGSA 5I19H 1ZAGA 2CXGA 2A6DB 1HOCB 3V0HA 1FN4B 1S8DB 1TFPA 3HCVB 3NJVA 5E9AA 1G7HA 1CYWA 5ITBH 5CU9A 3P2TA 4WV1B 4CMHB 1INDL 1T66C 3GMRA 3RWJB 4NQXA 3TFKD 5C2BL 1KCKA 1RUQH 1SXZA 2WKLA 4PRID 4X42A 3KLHC 4BM7A 3HPJA 1E6JH 5TE6L 1HXMB 5EZOL 1V3JA 5CWSB 1OCOB 1RUPH 3MLXL 4ETQB 4E36A 2OJZH 4MXVF 3UTTD 4Z7OB 4IHOB 4CADB 4GG6B 3O0LA 4PJ0O 4Y1TA 1X7QB 4Y9EA 4TULL 4ZTEA 1WA1X 4X4MA 4XHQA 2Y7LA 1ZTMA 5T1DH 4L5FE 1BM3H 5HHNA 1GGIL 5C08B 4JHUA 5HDWA 5A43C 5EN3A 1NFDE 1BPVA 1JV5A 3MRBA 4WEMB 2OYPA 4Z77B 4GG8B 2C3VB 4J2QA 2X41A 2OSLB 3QI9A 3X3FH 2BY1A 4ZOBA 4KAQH 2KZKA 3O3BB 3QUMB 2PLTA 3AQZA 2BNRB 4XVJH 5DWUL 3G5XB 1KTDA 1YYMH 1AGCA 3OKDA 3CH1B 5C86A 1ZGLA 4GKNA 2C4FU 2E9GA 3FB8B 1G7QB 2X53A 2HP4A 1H3GA 2DBLH 1S9KC 3QDJE 1NGWB 2BIHA 3QVAA 4R4NC 3FU7B 1SMDA 4RDBA 5CKAA 2JK5B 2FWOA 3FT4B 3P11L 1S6NA 1M1XA 3ISYA 5DC4B 4WSKA 1VA9A 5IHZA 2QPUA 3BUTA 1F6LL 4P2YA 2YLKA 4E41D 4AVIA 2PR4H 4N59A 4KJWD 1AHKA 1ZTXE 3INOA 1T83C 3NP4A 1KLGA 4FGMA 2OTUA 3KPMB 3GNMH 4HJGA 4ODVH 1Q9LB 4OUUB 1ZWIA 5CEYB 3VVWA 5CLYA 2X4RB 3IFNH 2CALA 4JO1H 3IFOA 3CLEH 1EGJA 2AC0A 3WKPA 1MRFL 3NSCA 1KIRA 3SKNB 1R3LA 3H55A 3D25A 4AVHA 1W91A 5CEXA 1RJCA 4NZTH 2NOYA 1J1OH 2Z64C 4ZS6C 2Z4TA 4FQXB 3S5LA 2GTWB 2W38A 4UQ3B 1D9KB 3WNNA 5JOFB 1SN5A 4LSTL 3CX5K 3GMPB 1TNNA 4IGBC 4KC3B 4PJXE 1BOYA 4NHCH 5KBPA 3IJHB 5E6ZA 3HW7A 1BYOA 4RDQF 1IKNC 1N0LA 2XY2A 2OMYB 4R0LB 1MJJA 3HHMA 4U6YB 5T3ZL 5ERWB 4GH7B 3EYFB 4ZG1A 1TTRA 3OL2A 1NPUA 1IIKA 4KVCL 2GITB 2G60H 3WEOA 2O6FA 4YHIA 1ZLEA 4ZXBC 2CPCA 2QFRA 1P4LB 4RZCB 1WS7A 1KELH 4U1JB 2K0LA 3DBSA 1QSFB 1Q1JH 3GZKA 1R19A 2OR9L 3ZE1F 2Y2TA 1E7VA 1PZBA 1NGZA 1DHKA 1CWVA 3ZIMA 43CAB 2XJKA 1X9RA 5D2NB 5JW5A 4PJ9B 5MENE 2DMHA 2VRAA 1FCCA 3LJ3A 4UB6O 3HUJF 5LHDA 4CNIB 4OF3A 1J9CT 1OTUD 2EDQA 2CLZB 1GY2A 4GXVH 2UZIL 3TEXA 5ICYA 1ONQA 2R1WB 4MNGB 4F33A 3HBZA 5EB9A 4Z3GA 1EHXA 2MCPL 4NKIL 4KX9A 4L9LB 1ZT7A 2CIIA 3C8HA 3PRZA 3BE1L 2P48B 4MNQB 1T1LA 2VR6A 3U48A 5A3IC 5EBMB 1QNZH 3MYJB 4ACPA 4J2XA 2FO4B 1Z9PA 4FD0A 4QT5B 3ZZ1A 4ZUSB 4JFXA 4NO5A 3G04A 4DKFL 1J8SA 3VSUA 2EDEA 3HRZB 1NCNA 4GRMA 1D7BA 3VXRB 3V7AG 1JK9B 3MNVB 3BQUA 3C5JB 3BGAA 4J23A 5DJYB 4Z7QE 1F56A 1QLFB 4YDIL 3ZE0B 4F7CA 2VLLA 1A1NA 1C16B 2HFFB 1AZCA 1GC1C 3C6EA 4JQIH 5EF3A 3AG1B 4Z95H 3D08A 5DHVB 4ANUA 4IIZA 5FS5A 4HOXA 2GPZA 3D39D 3WFEH 3RU8L 3EGDA 4IOFC 4LKCA 2YUXA 3P9MB 4QHUA 2HKFL 3KPLB 3BAYA 2IALB 4M8UA 1MCHA 1TETH 3A6CL 1BMWA 4WTWA 2WC7A 5KSUA 1OAYH 3NK3A 2BSRA 5DK0B 3V9CA 2ODHA 3KPQA 4MJ5B 4BD4A 1MJ8L 5D4JA 3VD9A 5DHYB 1NFDA 3D12B 5DZJA 1DBJH 3S98A 4LSQL 1T5WA 4JQVA 4AUIA 5I66B 1S9VB 1JOIA 1N64L 4MB1A 2ZQKA 1JGVH 2J6WA 3WEBA 4AKMA 1FL6B 3OJ2C 4HETA 1EEZB 4H1LB 3VXQA 4RAVB 3ARDD 2AEQH 1LEIA 5DMJB 5F1IA 3BGFC 1BQHB 3L3KA 3QDJA 2RALA 4WEBH 1P7KB 4W1TA 3DYOA 4Y0GA 4G43B 2XVBA 4OVUA 2J12B 3BZFB 2CRIA 3DARA 1XGPB 3OX8B 1YA5A 2AI0L 5DYOB 4PMEA 4TVPL 5SWSE 4XXWC 1DLFL 4LVOB 1CC3A 2BDNH 2NY0B 3V0DA 1DVFB 5BCAA 3LQAC 1ML0A 1NFKA 2AV7A 1A4JB 3Q6FB 5E1IA 3DTXA 3FU3A 2QPFA 4NWUL 4X4XB 4F8OA 1PIGA 5IBTH 4Z7UB 5SWZE 5AW5B 4JG0H 4LFHD 5D7JC 3SKJL 3MCKA 1VKXA 3CLFH 1MWAA 5I1DB 3DETC 5IQLA 2XV6B 3EDDA 2ICWJ 4YK4B 4JRFA 4X6BA 2UXFA 4AYMC 2FD6H 3GIVB 4H88H 4ENEC 4S1QL 3MLUL 4RMRA 5LBSL 3O2VH 3ZN6A 4Z7NB 5KVEE 1U8LA 3UROR 4OD2B 1IGIL 2YPLA 5ID0A 5F0LB 5J1AA 1MAML 1LE9B 5DD1H 5I2IA 4GHBA 3I2CH 5FYKL 1CQKA 2FK9A 4PJXA 3W57A 4OJFH 1GMEA 5BS0D 4O51B 1H19A 1ULVA 2XPYA 4FEIA 3BP6A 4HXBH 3OJMB 5CD5C 8CGTA 5LGJB 5CJBA 1WBYB 1A6UH 3KPSA 4B27A 4DPCX 2VW6A 3QFJB 2XPZA 2KBGA 4MZRA 3N42B 4XZ4A 5ICXB 2UZYB 5GXBB 1T22B 2OMZA 3BVUA 4RSVA 1CGVA 3RBGA 4PP1C 1F45A 5EE2A 1S7QA 5D1QC 1SQ2N 4FFYA 1B90A 3GFUA 3QUGA 1U8JA 1UM4H 1JK8B 2P7TA 2X4OA 4QRTB 3CVIH 4ODHH 2E7MA 5FF6A 3LRMA 1VEPA 5CN2A 5BZWA 4FAAB 1UM6L 1MLCB 3RVVD 1NCGA 3V10A 4B3EA 2B15A 1CF8H 4TL5A 1YAZA 4X7TA 3K6DA 4U1LA 5AWNL 4EZJA 4M1DH 3RP1A 4YDJB 4X80H 2VDOL 2YJLA 3RFZA 2NT0A 3OXSA 4ONFL 2FT8A 1YUKB 4QWWC 1SXAA 4XVTH 2R2BB 3HZVA 1HOEA 3AG4B 5I6KA 2WQUA 2FQFA 5H94B 4MWFB 2GAZB 3GKWL 2JLPA 3MYZA 4KJPC 5D2LA 5F7KC 1WCBA 2PETA 3BGMB 2XQBL 2R1YB 3OKMB 4Q9BA 2VDNB 3GRBA 2EDXA 4JCMA 4OCMC 5CS7A 4YSEA 4PJGB 1NGQH 5FYLD 1NC2A 5IVZA 4P23D 3DDFA 4PBWD 1ADQH 1FNSH 2VSCA 1AMXA 2V8MA 1KYOK 3QA3B 2DH2A 1L9MA 1HIML 4B9CA 2BERA 5JIHA 1M05A 3TO2B 3MNWA 3FO0L 2WQRA 4Y5VC 3KLKA 2MTPA 4X50A 4UOW0 3HG2A 3GSUA 5F9OL 1R5WA 5B7FA 1TKWA 3VXPA 2MNWA 1FYTD 3ZR6A 4QYOA 3QQ4A 5KAFO 1W72L 3CC1A 5G38A 4NZRL 1UXMA 5JW4R 2CK0L 1GGBH 2J1XA 2IOOA 4UAHA 5DS8A 4HGMA 4QHNA 5D5ME 2D7NA 1DSWA 5D93B 2A83B 5DO8A 5ICZA 2O72A 2WZ5A 2ATKB 2VDMB 3T8XA 1M9SA 3GXMA 3QYCA 4K23L 1NCJA 3PIQB 1Q9OB 1IB5A 2F1AA 2JKJA 4NNPL 1QNIA 2BIIA 4ANWA 2BNUB 5KG9A 1T83A 4WVRA 2CHZA 3SDCA 1AIFB 3GSVB 2PCPA 5B4MC 4GKLA 1CTNA 2J8UB 4KUCD 5I9QB 2OULB 3LPOA 3DNKA 1FDLH 1O0VA 5D7LE 4IRJC 4YEFA 2ZJSH 3FT2B 3LV3B 4O2FA 3U9PL 1J8HA 1IAII 1E9OA 2E27H 2DTML 2Y4SA 4P9HH 5DMIL 5DRWA 1N5YL 1FBIH 5T33L 4JFDE 3LKQB 4TNVK 5AFUL 1MW3A 3RWIA 5KVFL 3U2SB 4M43L 2HT4D 3NOIA 3Q1SL 4XOCA 4NQQA 1NIEA 5FO9B 2FR4A 1A6TB 5JIMA 4YDNA 3VGGA 2OMBA 3SBRA 4MZ3A 2WSKA 1MCBA 3HLAA 1IKNA 4D0BB 3ZOAA 1G0XA 2OA9A 3O4OC 4JRYB 5AKRA 2HKHL 4CMHC 4AGMA 3QJHA 2O61B 1PCXA 2UZPA 1C5DA 4CU6A 4HQQL 3AB0C 3FU8A 3LNDA 3FU0A 5D1QE 1RIHH 3JZ7A 3P0YH 3UTPD 3SYAA 2H32H 3A22A 3EUUA 1XIWC 3R7RA 3DMMD 3M07A 3RIFF 3QRFM 5LXGH 1NCAL 4QHKJ 5IY5B 3MODL 4DCQB 3V5KB 3U4EB 5TDOA 3GSNL 3V79C 4W4OC 4LP8A 3GHBH 1CFTB 1CFSB 2DQFB 4KRMB 3CVHB 1S78C 3BW9A 2FEJA 2FJHA 4K15A 1KTLA 4M3KB 1I1FA 3FBKA 3G9VA 5FDWB 3H2WA 3FOLB 3BSZH 1A6AA 4WENB 4B60A 1LP9A 1UCTA 4U1MB 3POHA 3RTLA 1UVQB 1WT5A 2GIXA 3U6RA 5DQDL 5FYJE 2Q76B 3S37L 2CKBB 4JLRB 4I4WA 1LNUA 1QO3B 4AC2A 1TJMA 4BH8B 1JWUA 1J86A 4PJFF 1N68A 1OTSC 5E4EC 5FW6A 4WUUD 2Z0BA 2WXIA 4M7ZC 2YPVL 1UD3A 2YGQA 1HEZB 1TLKA 2QDVA 5IQ9A 3KMDA 3VRLE 2ID5A 1MCCA 2BP5M 3DRTB 3QIWC 5ILTL 1M3IA 1ZHYA 1UXLA 1MPAL 1YNLH 1QRND 3HN3A 3T4YB 1SM3L 2ZCZA 2TSAA 6FABL 4EJ1C 1SJEB 2X27X 1I9JL 2NZ1A 3DV6B 4OT1L 5AAPA 3F64A 2MEJB 3MUGB 3L4TA 1TJXA 4P59H 5KYWA 4C8XA 5AUMB 2X1WL 3SYPA 2O5XH 4BSVB 5JOPE 2EDTA 5H2FO 5KOVC 3MRGB 1SLUA 2W9DL 4NFCA 1SOKA 4WO4A 5I8CA 2DQTL 3E38A 4KHTL 1XR8A 2HRHA 4MCMA 5GS2D 3T3MB 2G2RA 3EO0B 3SOBH 1S5HB 2H0FA 5JW3L 5DJ6B 4AKRA 1EAJA 3CBRA 1DUYB 3HAEA 1R0AL 1AD0B 1YPZB 2CK2A 1R34A 1U41A 2VMFA 4IU3A 4XAWH 5D5MA 3P0VH 4ZFZB 2ADIA 4KKBC 3L5HA 4PEEA 1I7TA 3T3PF 2HG5B 1EBAA 3CVDA 4O2CB 3GRGA 3NFNA 3AXLA 2WMPA 3FTGB 3LH8A 4EI5A 4XXWA 1KFAL 1DQIA 5B38G 2W60B 1INQA 4KPHH 4R7NA 3REWB 3FC8A 1XL4A 1ZHKA 2XACC 4OF8A 2R4SL 4ZQKB 1MNNA 3RNKB 2G5BA 5E2TL 3FKUS 2OV0A 1GAFH 3ZT7A 4HLJA 5KAQG 3VRIA 5HYSA 4P5KB 1VGEL 1S3RA 2Q3ZA 2WXFA 3NIFF 5HI4C 4BZ1H 1HESA 3ES6A 3KL5A 4G2AA 5D7JA 1IGCH 2P8MA 5D7LA 3GBDA 5D2NC 3LKOA 4N8VG 2HA1A 4PJ9C 5GHWL 3IPEA 4ELKB 4JKPH 5J8OA 2WQWA 1OGAD 4NQDB 2HVKB 1TVBB 5LNEA 4YZFE 4UT7H 3N41B 4JFDA 3SO3B 2YQBA 5JIIA 1IFHL 3F65A 1JE6A 5CP7B 4ZX6A 5JR1L 4ALAL 3MACH 3QJUB 4Y4HC 3O0RL 1FVCA 4L9LC 4HWBL 4B9IA 5CFHA 3TVMD 2ZSVB 4X5WB 4LASL 4N8CH 4HK3N 3CXHK 2ZYRA 4XO8A 5EU5A 4XR8C 4PJBA 1ROCA 2EXTA 2VDPB 1PIFA 4OSUH 2UXVA 1AVAA 5C9KA 2AQRA 2QGCA 4WU5B 1KJMB 3UTSD 5CBAA 4FFZH 1N18A 3OR7B 4XMXA 3H9ZA 5BRPA 3K2IA 2C1OA 4UIMA 5CSGA 2AAVA 3AY2A 5DHXB 4CVZB 1THAA 2J2ZA 3T2OA 4GG6E 3T9WA 1PLGH 4JR9H 1TQWA 5JXEA 2XG5A 1CD1B 3HMWL 1SYVA 1NEZG 3QWRD 1L0PA 2H2SD 1MCQA 2AJVH 4WFGD 4NO0D 2GI7A 5C08E 1B0WA 3LH2L 1MFEL 5I1EL 3B2UD 3SE9L 4GAGH 4D2NA 1V10A 1IBGL 1HDMA 3SDDD 4JFYB 3BP7A 3LZPA 1RU9H 2Z9TA 3TCLA 4XNYH 5I15H 3S3JA 1NBCA 3V52H 2QQKH 3ZW3A 5DUBA 2JJSC 2J4UP 1G7MA 3DHJA 1Q72H 3LSOA 5PRNA 3D7PA 1UWXK 1DN0B 3COOA 4Z3HA 3A67H 5T8IA 5IROA 2A3TA 4JPIA 5J9PB 4H2AA 4YIQA 4ZUWB 3KNBB 1DQDH 4HV8B 3P4LA 4HZLA 3UAEA 4JY5L 4AKQA 4OFYA 2F6AA 2X1PA 1JZ3A 2YQGA 5C0IB 3RA7H 3H0TB 1W6WA 4MQ7A 3MV8A 5IREA 5HGHA 2H6PB 1U3HB 1S9WA 3TZGA 1L4IA 1NH6A 4OQ1A 4P46D 1R5VA 3WMPA 3KR3H 3MXVH 1L0YA 1GFPA 4FJZA 1QUNA 2NY0C 3NJGA 2H4EA 3CBJB 4E42A 2X4UA 4FTVD 2WO4A 1A4BA 1OZUA 4Y5VA 1S46A 1UOVA 5DJAA 1XF5A 2QHRL 2A0LD 2OR7A 3LRSB 3TXAA 4HIHB 4G42B 1E5AA 5D9SA 5FCSH 1KLUA 3VXOA 2TRHA 2ZWLT 4M61B 3QHZL 4G8IB 5F9JB 2W9EH 4RMWA 4TSBH 1LK3H 2VABA 4Z7UF 3TO4B 5GSRB 3ZPDA 2OJEA 2CHXA 5C6TH 1DVSA 1VZHA 1MHHB 2EEDA 1OAXH 3HLKA 4ZOCA 3PWNA 3VGEA 1I9IL 1ZHNB 4MQSB 4M7LH 4J1UB 1D6VL 3IAPA 2ZXEB 5LG6A 4FFWC 1BWWA 2MIZA 5AZEL 1XCQA 2K0RA 2F5BH 2ZIDA 1YO4A 2GJ6E 5I28A 4S0HA 2XA8H 1W0VB 3FPXA 5D70L 4RVBA 5C71A 4TPRH 1IC4H 2TSBA 3SPVB 5GZOC 2EJ1A 2CPUA 2XWRA 25C8L 1G7PA 1JV2A 4NPJA 2BXZA 1BLNB 1QBMH 2IADA 3BRZA 4IRZA 3UZVA 2OAAA 2ISDA 1OOAA 4IRJA 4G6FB 5D2NE 3UJIH 1J5HA 4AG4L 2YAFA 5CZRA 2BP0A 2XZQH 2FQGA 3H2QA 2V7NB 3GTTA 1Y1UA 3MTRA 1JYNA 4YPGA 3VXMD 4GP4B 3O3DA 4MNGE 4XNMB 3FUMA 5C3LD 1CURA 5LQBL 5AB1A 3MJ7B 1SUJA 1AGFB 3CFMA 2P5WD 2WAHA 4BCZA 3MLZH 4KTDL 2Z0UA 3BC9A 4AKPA 2OMNA 4MZ2A 1ZLDA 2R0LH 2O5YL 1F41A 1HOCA 2A6DA 2XTLA 1S8DA 4UINL 3WHXB 5AZ2H 5D7SL 3HCVA 5HSFA 3QZNA 3IGAB 1EERB 1NFIB 2VWEC 3OB0H 4LNRB 4M1CD 4WV1A 1ZLUK 5K93A 3RWJA 3V7MA 4JPKH 3ZE0E 2MOQA 5TH2B 3PQSA 1TYRA 1KCUH 3FQYA 3THML 4GQ9L 1HYSC 2WGNB 5EDXA 1HXMA 1MVUB 2HTKD 4FUVA 1ZIBA 5CWSA 4KZCA 4ETQA 5KN5B 2XVGA 1PG7X 4IHOA 4GG6A 3VDBA 3C12A 1X7QA 4UM8B 4W4OA 4AL8C 2L8AA 1ZK5A 2FBOJ 2WHVA 1Z3GL 3WIHA 2CDFB 5C08A 3H3KA 5FFGA 4N9GB 5C0EB 1D7DA 1O7SA 2MFNA 4KKPA 5FO7B 4Z77A 4HT1L 4GG8A 2C3VA 2QHLA 1KXTB 3SYCA 4YE0A 3WSQL 3AT8A 4U4BA 2VW7A 3O3BA 3QUMA 4W9CC 2BNRA 2WBJD 2COQA 3CFUA 4Y16C 3G5XA 5DFWH 3PABB 4IBZA 4Z78B 2LOEA 1PDKB 3CH1A 5AVUB 2LLLA 2XN9B 3FB8A 1G7QA 5D93C 4DEUA 5B38B 3N85H 3WAJA 4E1TA 3WI4A 3ASWA 4PD4K 1NGWA 3F58H 4YVNA 3FU7A 5KJRL 2N7AA 1CYGA 1P6WA 3DX0A 2JK5A 3FT4A 4TLKA 5D7KE 1UFUA 5F70A 1AR1D 3AM8C 4V2CB 2FGRA 2KMWA 4CGTA 4P2QE 4YHYB 3T0XA 4ZFGL 4S2SB 1SVCP 3RZWA 3STZB 2EYSB 4N8VB 5HHOB 3KPMA 4OUUA 4R8WH 5CEYA 1Q9LA 4M4RB 4GW4B 4OLZL 2F8XC 5INCB 2OKMA 2X4RA 2PF6A 3QG7L 4AMWA 4J6RL 5GJTL 2HFGL 4LAJH 4KO7A 1YNTA 1AC6A 2RD0A 1BP3B 4MA7H 4MAYD 4CC4C 3UIYA 1JYWA 3HMXH 3QE5A 2FCBA 2WQAA 4M7LT 4PS3A 4DTGL 5FYLL 3HBPA 1MJUL 4FQXA 5JOFA 2GTWA 4UQ3A 4Y1AB 1WQVT 4JN2B 3VWKD 4L37B 3GMPA 3CZEA 4JFPA 3BDBA 3Q2VA 1U9KA 2XWEA 3IJHA 4ZS7L 3EGXB 2JVUA 3QEGL 1Z0NA 4LHUD 4PRHB 4WJG3 2OMYA 4H2CA 3QFJE 4R0LA 1E5UI 3VQLA 4U6YA 5J06A 1HJCA 3JWOC 2WLNA 5ERWA 4F58H 4DAGH 4KXZH 3TA4D 4XMTA 3EYFA 3BRYA 1OAQH 1NEZB 1BA9A 4BZ2A 4PGJA 1Q0XH 3JWNG 2GITA 5E7BA 3AT9A 1X3DA 2FEEI 4LDEB 1GOGA 1P4LA 2BS71 4U1JA 2XWZA 4E9YA 4K3EL 3GSOB 3C8KB 3Q06A 1JNJA 1V05A 1UEMA 3RX8A 4YHKH 1QD0A 4XPHH 1C7SA 43CAA 5D2NA 4PJ9A 5E0QA 5JZ7D 1PMYA 1FHGA 4CNIA 1AQDB 1K8IA 4EN3B 5D1ZC 2CLZA 3K1KC 2X05A 2R1WA 4MNGA 4NAMA 4QTIH 1RPUA 3HBGA 4X6DB 1EHLL 2ITDA 4JG1L 5L6YL 5DK3A 4L9LA 4O5LL 1TZGL 5I76B 5CGMA 1IX2A 1U3ZA 3CXFA 2D9QB 4MNQA 4WUKL 1J1XH 4LCIL 5AW9B 3VI4E 2VWEE 2EE2A 5EBMA 1A7QH 4N8UA 4QQ1A 3S35X 3FN0L 3MYJA 3O8XB 3GEFA 2FO4A 5B5EO 4LSRH 4QT5A 4ZUSA 3ULVC 1DJYA 1UH2A 1BZOA 3BYYA 4ZMAT 1HL5A 4PJGE 3HRZA 4MTMA 2JMRA 4JHAH 3LPPA 1JK9A 3MNVA 2VDOB 3C5JA 5DJYA 3O41A 2BH0A 3CGTA 3QULB 1QLFA 3ZY7A 4YXLL 1AOHA 3BPLB 1C16A 2HFFA 1OK0A 3OZLA 5CP3A 3KYAA 3X14B 3PQYB 1F90H 5J56B 5A2LH 3K91A 3A6BH 2K6ZA 2OW6A 2AK1L 3VE0B 1NM4A 2ZAHA 1EMTL 2ZUQB 5C0AB 3P9MA 3VGHA 3KPLA 1ZEAH 4G9DA 1EUTA 4AQOA 4HIEB 1YECL 3DJZA 4X7DC 1XSKA 5I1KL 1FRGL 5IUSA 1ADWA 2ZWSA 5DO2C 5AVRB 4DO6A 1JZ6A 4WTZA 2RAMA 4MJ5A 5KBNC 3MV7B 3HN8A 3LZOA 5I30H 2EXWD 5DHYA 1A7BA 4JAMB 4ZMZA 1CE6B 2JJSA 3D4CA 1IAIH 2WINB 4HG4J 1ZLWK 4LRIA 1S9VA 4AGOA 5I66A 2AQSA 4UNVA 2R1XB 4JREB 2GTQA 2OLDA 3VFTB 4EIUA 2HVBA 1EEYB 1A9EB 1FL6A 2HPTA 2XOTA 3BD4A 2A99A 1EEZA 1WA0X 2ITFA 2WIMA 4H1LA 4RAVA 1JD7A 4PV8B 5IB5B 2Z8RA 5JW4M 1BQHA 4GSRA 3T3MF 3D50A 3FCSB 3MBXL 3KG5A 1P7KA 1BH3A 1W72B 2JQZA 4G43A 3BZFA 3OX8A 1UG9A 1XGPA 4C57C 3NCEB 5DYOA 3RAJH 4AMXA 5DC0A 3UBGA 5HJDA 2UUDH 3BRGC 3NK4A 4YSOA 4LARL 4HPOH 1VAHA 3FB5B 2J8UE 1DVFA 2HX7A 5J13C 1BXUA 1FG2B 1A4JA 3Q6FA 4R4FH 2KC0A 4WW2C 4FLRA 3VZWX 4X4XA 4ZW6A 4M02A 3UO1L 4Z7UA 3R0NA 3UMTA 2F58H 3BD3A 2LHAA 5I1DA 3O9WB 1E8ZA 3VM5A 2CH8A 2IWKA 2X40A 4ZSOB 3GIVA 1BFOB 3DTUB 3FJTA 4JM4L 3PDGA 4PGZA 3MLTB 4XOEA 4YUEH 5JTWA 2Y7NA 5B3JE 5DQJB 3B1TA 2WW8A 2ZF8A 1H8LA 3QRGH 4XB8A 1YEHH 1LE9A 2WK2A 4NJAL 3DI3B 4DK5A 4OLXL 4JRYE 3MROB 4JRLA 5HJGA 5DZ9A 4OU3A 4ZUTB 4HUXB 4RLBA 2HWZH 2FE0A 3NP3A 2ITCB 4LOVA 4O51A 5AENA 4QXUH 3NVQA 4I7ZC 3B5GA 2EO7A 4OGYH 5C0CE 5LGJA 1WBYA 1I3RB 1FUNA 3QFJA 2AXHA 4K8RC 5E6IB 3ROOB 1A3QA 4YFLF 1RIVH 4OY9A 5DEZA 2F19H 1B0GB 5ICXA 2UZYA 3FQNB 3VA2C 3GK8L 1T22A 5LCVH 3W2DH 2FQDA 4X7EC 1WAAF 3TZVB 2R89A 1MXGA 2VR8A 2X9ZA 3ZQ9A 3AG3B 3DBXB 2B39A 1JK8A 3FXIC 5CGTA 4QRTA 4LPXA 3IDUA 3G7GA 1KB3A 3B3BA 4UTBA 2WNGA 5CBEB 3IDGB 4QY8B 1MLCA 1WISA 2K6WA 2Q1EA 1RHFA 4JGJA 3SBPA 4ES8A 2YQ2A 1V7MH 2OSWA 3TH2T 3RWHB 4YDJA 1IQDB 4I77L 4Q9RL 1TQUA 1JFQH 3JV5A 4MA8L 3GSNB 1BXAA 2R2BA 3MO1B 4PY8I 5DR5L 1HXYB 3ULVE 2WAQA 5LAXB 4G5AA 5H94A 1PSKL 4MWFA 4Q97A 5I0DA 2GAZA 5F7AA 1UM5H 1S7TB 3VXUD 4WI4A 1EZVX 4R96B 3BGMA 2R1YA 3OKMA 1QBAA 4FQ1H 5E1HB 3ZL1A 2NXYC 4FFVC 4PJGA 5E5UB 4YDVB 3HG3A 4WLCA 2HH0L 1KN4H 3QDMD 3EJJX 5T3XH 1GS7A 2IWWA 5T1KD 1D5BB 4PPTA 5K9JH 1IKFH 5BMFL 3EJZC 3K2UH 3QA3A 1BEXA 4TTDC 2Z31D 4O4UA 3HC4H 3GBNL 1MEXL 3AABA 5ESVB 3TO2A 4M4PA 1X5MA 1QMUA 3A21A 4PR5B 4Z7AA 1B0IA 2EXYD 4KNUA 3FUHA 2OXHB 1CD0A 1BQ5A 3P1VA 1FH5H 1KYFA 1QW9A 4AMKL 4FF9A 1JHLL 3VDCA 4YJZL 4M6MH 1BZ8A 2BP3A 2ZX8A 4F57H 1MZZA 4XBEL 3LQZB 4LFHG 4N0UE 5ANME 4WSJA 2QMJA 4QJ3B 5GGQL 4Y16A 1YPZE 1OP4A 1MFBH 3KZ8A 1R1CA 4W6YB 1N70A 2A83A 4BCYA 2A2QT 1FI8C 1XH2A 2UZXB 3SOTA 2ATKA 3BZEB 3ULSB 1FO0H 2Y24A 3DV4B 4F2MB 2IO5A 1LO0H 3AADB 3FT1A 4X6CF 1B4JH 3ILPB 1Q9OA 5KVDE 1WUZA 2DD8L 4PRIB 4WEEA 2MCG1 3VFNB 4FL4B 4Q58C 2EC9U 1HXXA 3QWNA 5ACZB 3KPPB 2BNUA 4KO6A 1Z6JT 4IOSD 2AHIA 5EF2A 3UTTB 1AIFA 3GSVA 1GY1A 5FIEA 2J8UA 1WZMA 5I19L 1SF5A 3QZLA 2JB5H 1JYXA 2J21A 2FO8A 4TS6A 1TSHA 3G5YB 3BVTA 5ITBL 2LABA 3FT2A 3LV3A 4RMBA 3W9DB 1YHPA 5CLWA 3TBVB 4H5SB 2N01B 2R4RH 1P84J 2BS9A 3LKQA 2EACA 1CGSH 4FLSA 1SXSA 3U2SA 2CO2A 4KJQC 1E6JL 5AVVB 2BOLA 4X5PA 5FO9A 1RUPL 2VOTA 4LCVA 1A6TA 3KWXA 4H44C 3T0ED 3MKGA 2N2MA 2OJZL 5ICUA 2VKXA 2JH2A 4JS7A 2KZWA 2LU5A 4P99A 4D0BA 5FO8B 1A7RL 1UJTA 5EZLB 3WIIL 4HLEA 2RFXB 1BF5A 1BF8A 4JRYA 6TAAA 5T1DL 4FQLH 1BM3L 2PABA 1I3GH 5HI3D 1HX0A 4PJAE 1XH0A 2O61A 2AJUH 4PY7B 2NNFA 3ILDA 1HJBC 1L0XA 2FLMA 4E41B 3X3FL 4OGXH 1DJXA 5L4JA 1RLWA 4KAQL 3MNZB 4WK4B 4XVJL 1YYML 2H1PH 1G9NH 5HDBB 2DBLL 4DCQA 2AJXH 3V5KA 3U4EA 2XVLA 3DC0A 1CFTA 1CFSA 2PP9A 2DQFA 3OLGA 2PWEA 5EC2B 3CVHA 4B50A 1PNCA 1XR9B 5KS9E 5C0NC 1G4MA 2GQHA 1VEMA 5FDWA 3B9KD 5IK3B 3RTQD 3PGCA 3FOLA 2H0JA 3O6MH 5JHLA 1INEH 4RWYH 3SGJC 4U1MA 1N8OE 2PR4L 4AE0A 3BESR 1UVQA 1KDJA 2Q76A 3GNML 2CKBA 4JLRA 4NZJA 4ODVL 4P4RB 4X8CA 4BH8A 3IFNL 1L9QA 2IIJA 1HWHB 2APWA 4HS8H 5HDQH 4EUPG 3K5RA 4JO1L 4PW4A 3AAAB 3CLEL 3HE6D 1SQMA 3ZKSD 1HEZA 3F8UB 1RZIA 3HI1B 4FQ2L 4JUTA 4UQIM 4FZMA 4NT6B 4YHLH 3OG4B 5GS1B 2VXQH 3DRTA 3NACL 1EHNA 1T5XB 4NZTL 3MLPA 1J1OL 3T4YA 3GXIA 4KZDH 2GY7B 4F37K 1IJ9A 5KJ7E 3MVSA 1T4KB 3DV6A 1KYOJ 3UPCA 4J3OF 2YMXH 3WFBH 3ML9A 2F1VA 5GRUH 4DJMA 4NC2B 3L3OB 4JO4H 4NP4H 1K3ZA 5AUMA 1WIOA 4U33A 3ZKMD 4BSVA 3P2DA 2Y22A 1TQVA 4PRPD 4G75A 3LVEA 4UB0H 3MRGA 3QHTC 4CW1A 2G60L 4QKTA 1RAMA 4O3WA 3JWDC 1E4KC 1KPRA 3GB7B 3EO0A 1RUAH 1S5HA 2FWSA 2Y0KA 1KELL 1CFMA 3D0VA 2IAMC 5DJ6A 4B53A 3S48A 1IAIM 1DUYA 1VSCA 4NQCD 1AD0A 1YPZA 4JZOB 2IGFH 4PN6A 4AEHH 4HGKC 3HI6H 4ZFZA 1B2YA 4JVUA 5I17B 2YRPA 2WB1A 2ATPB 4N1HB 5TF1H 1D5MB 2HG5A 1E2WA 4O2CA 2CQVA 3PWPD 1CXLA 1CICD 2VMJA 3FTGA 1OP9A 3LS5H 4HHGA 2W60A 3REWA 1JD9A 4ZQKA 3U7YH 3W5NA 3V9FA 3RNKA 2DEWX 3S2CA 1FFTB 4URKA 1VENA 1QFWI 3PLYA 2HB0A 2XG6A 3D39B 3K8KA 4HAKA 4MS8C 4ODUB 3SE3C 2XFXB 4P5KA 5T3ZE 1QNZL 35C8H 2GJZB 2WKOF 2VLKD 5JHAA 2JI3A 3WJJC 1DANT 1IEBB 2VR5A 3ZTJG 4AH2B 5J6HB 5E08H 3QWQB 1OV8A 4ELKA 3NTCH 5CJOH 2IH8A 3T1FB 3FOMB 4EN3C 4NQDA 2HVKA 2JTYA 3D3VD 3LKPB 4OV5B 4OFDA 1TVBA 5CP7A 1B88A 1ZV2A 4JQIL 2AFNA 4DVRH 5D7EA 3WGUB 1PEWA 4Z95L 3VYPA 4FNLH 3WFEL 4O58L 2NR6C 2C3XA 2ZSVA 3ARDB 3M86A 4X5WA 1BBDH 5IJKC 1UZ6F 1BAWA 4Q2ZB 3DOHA 3VNYA 3TX4A 1TETL 4WTXA 3O8XC 3FT3B 1TQTA 5B1KA 1OAYL 4WU5A 1T6VN 1KJMA 1UWYA 4MYWB 3RX9A 2UYLB 1A14H 3OR7A 4TUJB 5CZXC 5KYXB 2B20A 3ZQWA 2DI7A 3S34H 2DIEA 3QORD 5A6LA 1MPFA 2ESVE 1NUGA 3U25A 4U1HA 1X5HA 2BNQD 3BPLC 3AXHA 2AXWA 3D05A 4IKIA 4N2CA 4A04A 2UY6B 1N2RB 3L9EA 3LZFH 2Q2LA 1CD1A 3A3YB 4R5XA 1MIMH 5GISH 1XEUA 2XWCA 2YLHA 4ZX3A 3UAAA 2QV4A 4L0PB 2AEQL 4RJWA 2F53E 2R0ZH 4E9WA 1RURL 1NIBA 4WEBL 1ZLVK 4TUOB 1MH5B 2FT6A 4NZDA 5B3NA 1F86A 4JFYA 1GYWA 2X87A 5HHMD 2VZ1A 4BDVB 1M3JA 2ZOKB 1OCWH 1YDPB 2BDNL 3BIAX 4PJ5E 1ZS8B 4YSUA 3PF1A 2P42B 3TF7C 2DM4A 2MKWA 1DN0A 1I82A 3F3HA 3SDCD 5J9PA 3BHBB 4HWUA 4ZUWA 3KNBA 4ZUUB 3W9EB 4HV8A 5KW9L 3FFDB 3JZYA 5BS0B 5IBTL 5INDB 4JG0L 1G0DA 4JO8A 5E2WH 2IH3B 3X17A 2KZBA 4K3HA 3CLFL 3BN9C 3VSTA 1WV7T 5C0IA 6PRNA 4DO5A 3NSGA 1JHKH 3H0TA 4QI3A 5J4MA 1TVHB 2VE6B 1I7ZB 4RAHA 1IBDA 2AQPA 2FD6L 2H6PA 1U3HA 4H88L 4XPFH 4R3SB 1HSAB 3Q8BA 2CO6B 2CO1A 3O2VL 3BEWB 1UA6H 5F97E 4YVUA 4BKLB 1FGVL 1PQZB 1Q0EA 4KKAD 5DD1L 2G0LA 3IB4A 3I2CL 1S7UB 3ARXA 3IN2A 3V5HB 2NX5D 4OJFL 5A2FA 4U1SB 5BVPH 3LRSA 4HIHA 4G42A 4HXBL 4P2RE 3TWCL 3G7TA 5LJYH 1A6UL 4P04A 4YFLI 4M61A 4JFQB 3O9WC 4G8IA 5F9JA 2W80C 4Y1AE 3AS0A 3UPRB 2WLMA 1PX8A 3QT2A 3GEWB 3QZWG 4HALA 4KQ3H 1MCWW 3HG1D 3U7AA 4LLUA 3TO4A 5GSRA 3ILQC 3GKZA 5DT1H 2DOCA 4FKEA 3CFIC 1MHHA 3FB6B 1OEZW 5D6DC 4L8CB 4CL7A 1UM4L 3PGDB 4LAQH 4QRRE 1ZHNA 3T20A 3CVIL 4ODHL 5EUOE 4J1UA 2BWDA 4YSQA 3RVUD 1UGNA 5FM4A 3WTVA 2P9RA 1E90A 5EN2B 4UBDD 4S1DC 2WXHA 1W0VA 2AQ3A 3DUSB 3M7FB 4P23B 1JHTB 4CN4A 2YZ1A 1TXKA 5E6IC 4M1DL 3SPVA 4CTDA 1JG9A 4UAOB 5FYKE 5FEBA 3EJYD 4X80L 4JNXA 1H9VA 1BLNA 4Y5YB 2JLLA 5EMYA 1KPVB 4P5SA 3TZVC 3V5DB 4D65A 3DIVA 3H4FA 1PZDA 4ZFFB 2B4CC 1R46A 4CGUB 4ZMYA 3EYVB 5AFUK 3BZ4B 3D34A 5DZNA 5IB4A 3II1A 1MJ7H 2V7NA 3H9YA 4NOBA 5E4AA 5IVOA 4AX3A 3PDOB 3UZEC 3D8MA 3JV6B 4XNMA 1FYTB 1PKQB 3P30L 4X6DE 2OCFD 4EUPB 4RBPH 1OP3H 1P7HL 3SPHA 1U8QB 4RMQA 1ADQL 2AXFB 1FNSL 3MJ7A 3KXFE 4AYFA 1AGFA 2A9DA 2B9AA 4PCSA 2WY3B 3M17B 1ZHWA 4XNZB 2PO6D 2AMUA 5LXVA 4LPUA 3NEEA 3BP4B 5D71H 2X38A 1RFDH 2IDQA 3WHXA 2WJ5A 1NLBH 2WQVA 5DF0A 2XC8A 3IGAA 3QIBD 1NFIA 4LNRA 3LXBA 5EF1A 2WCGA 3I9PA 4N2MA 1AQ8A 5TH2A 5IQ7H 4DT2A 4PJ7E 3VRJB 5IKCB 3FMGH 3RYMA 1I1RA 2IDSA 1MVUA 1GGBL 1FL3B 3OF6A 4U6TA 5KN5A 1N59B 4OCXH 5C0AE 1NCTA 4RJXA 1UD5A 3MOBH 2DL2A 3BZDA 1KBGL 2PR9A 4UM8A 4ZMNA 3O3UN 1HHKB 3QUXD 3NSYA 1UEYA 2FWUA 1H0DB 2CDFA 2F53A 3DX8B 1J0KA 3MV7E 4NQUA 4PJIB 4CBPA 3QCVH 2D8KA 2D73A 5C0EA 3FK3A 2YAPA 4N9GA 2AXGB 2P5PA 3FFCE 2EDRA 4MA1C 3L9RB 5FO7A 3ZTCC 4AT6A 3O2DH 1P7BA 4BK8A 3R4RA 5TGBB 2JJTC 4X8JB 2P52A 2QSCH 4S1SH 2Q8BH 4U7MA 4OVVA 3ABLB 1X9UA 3QFDB 4ELMB 4NKQB 3W82A 3GM0A 3PABA 5CHNB 1K5NB 1PDKA 1BD2D 1FDLL 2XN9A 1VEOA 4J3UA 5I74B 2HRLA 3S36H 5B38A 2BJMH 3BO8A 5AL0A 3C6SB 1Z9LA 3RI5F 4IEFA 2E27L 1QHOA 3QRLA 1KSRA 1FBIL 1X9QA 2LTQC 2OPCA 4FRWA 4PJEB 3X1FA 4LPCA 1JNLH 1QLRA 3TTYA 4KNTA 3QEQE 2F54D 4FL4C 2E56A 4S2SA 4Y19D 5A40E 12E8H 1TFHA 5DHVH 5J89A 1ECYA 3STZA 2EYSA 3E9TA 4N8VA 5HHOA 3DMMB 4LBEB 1ZXQA 2H45A 2NCMA 4M4RA 5D4IA 3D0AA 1UUSA 3EH4B 4GW4A 2H3KA 3LZQA 5INCA 2Q3AA 1VDGA 2E6QA 2LU4A 3GXTA 2X9WA 3RDJA 3FULA 1NLDH 3ZO9A 4UILH 1FNEB 4F27A 4ZSOE 4PY8J 3VRLF 1J0IA 1CR9H 4XX1E 2IDFA 4L1HA 3B7SA 1YMME 2ILLA 3V4VH 1E4KA 1TTUA 2ADGB 3Q9PA 1RIHL 3AY4A 3P0YL 4HUMB 4Y1AA 3WXWH 4JN2A 3B3IB 4L37A 2ZCLH 1PZ5B 2CDEB 1S5IH 4V2BA 4HIIB 5LXGL 2JJVA 2F0CA 4WUUB 2AKRB 3EGXA 4A2DA 1N0XL 2ADFL 3GHBL 1J0ZA 4DERA 5KVFE 2EYRB 5CXPA 3OBAA 1SJVA 3ZR5A 1M56B 2X1QA 1AZZC 1Y6KR 1DZBA 1CFVL 1NEZA 5LBSA 2ZKMX 3V0GA 1QRNB 4NKMB 4QF1B 1ZLSH 1F42A 2NDGA 4ERSH 5IGXH 5IMKB 5JA8B 1P1VA 2WQ8A 3P54A 2HVJA 3Q5YA 5TK4A 4E68A 1GTNA 4BXVA 5DRNB 2C34A 1J9SA 2OMTB 3GSOA 3C8KA 2YUWA 4LLDB 5JQ6H 2UVFA 3WJJA 4P3CH 5M94B 1GFQA 4LPVA 1I8IB 2IG2H 1UD2A 3ARFC 3L5WA 4LEOB 1FNLA 3H9HB 4RFOH 4Q6IC 4EN3A 1AQDA 4UTAL 2OK0H 2JXMB 3R1GH 3PL6D 4RWHA 3VFGH 2MMXA 1TQCC 3WUZA 1YNLL 1FCGA 4X6DA 2ED9A 3WS6C 1P4UA 5CIPB 1UWEH 3QDGE 5I76A 4H20H 1BMZA 2VIRB 4U2ZA 1QTPA 3W5MA 4FA8A 4FI8A 5DJ0B 5I5RA 3O8XA 5CR1A 1JPEA 2CBOA 2QL1A 2O5XL 4PWHA 1U2YA 5DSCB 4WO0A 5A2KH 3AUWB 2BVUA 3L4VA 3QULA 4R26L 4OIIH 4BJLA 5I71C 4YZFF 3SBWC 2Y3NA 5I75C 3SOBL 2EE3A 1MF2H 1ASOA 3X14A 3PQYA 2XTRA 1PVHA 4PBXA 1ITBB 2Q86B 5D7IB 2BWIA 2V8LA 1CGYA 3QEHB 5DEFB 4EQ3A 3GXFA 3VE0A 2ETWA 4XAWL 2VDKH 1NCBH 5C0AA 3P0VL 5C7XH 3QZWB 2ZCKL 3HNVH 4BQ9A 4HIEA 5PCYA 4BZYA 1BX2B 4PTUA 4Z76B 1OWWA 4B9YA 5CN3A 1UT9A 4BUHA 1OGAB 1ZLUH 1EFXD 1OTUC 4B9PA 2K3HA 3MV7A 3RJQB 2JV6A 3OKEB 4KPHL 4JAMA 1CE6A 4M8QB 4XN5A 3UU2A 2WINA 5HI5D 4PRBB 2W95A 3KLAB 2H47C 3H42H 1OAZH 1GAFL 3VGAC 3MJ9L 2CCVA 1I85C 3TVMB 3ZUCA 1EEYA 1YEJL 1A9EA 3GMMB 1DN2A 3HZMB 4BZ1L 5FW8A 3N0AA 4PV8A 4ZO6A 1IGCL 4NGHH 5HHVH 1MHCB 1P7QD 4HMEA 4JW3A 3UTSB 3T0BA 5DI8B 3FCSA 4PRIE 4JKPL 1W72A 1NZRA 1DE4B 2YZ8A 1Y7VA 2EEXA 4QRFA 1F0LA 5IQMA 1YEWA 4M48H 1DQKA 3N43B 5ECJE 1QLEL 4YEEA 3FB5A 3MLSL 3SO5A 1YC8A 3MACL 2HFTA 3U46A 1ZA6B 1QAWA 2Z7WA 4LF3B 4X5QA 5KVGH 1FG2A 4WQOA 4Y2NA 4NO0B 2L7JA 4QAWA 2IF7A 3NGBB 2JI2A 2CUHA 1OO2A 4WGKA 4OSUL 2EVFA 4P07A 4G72B 4JDTL 2D7PA 2MSPA 2ARWA 2WYHA 4FFZL 4WI8A 3O9WA 3SDDB 3BT2L 5EPMB 2YNKA 1G5AA 1IM9D 3MX0B 4ZSOA 2WOYA 1BFOA 5I1HH 2YD1A 1DJSA 4FQCH 5DQJA 4EOWL 1IGFH 4JL1A 4DP2X 1PLGL 4JR9L 5D6DA 3MUZ1 4QOKE 3KBHE 5ACMA 5CZVH 3TJHD 2A9MH 4OCYH 3MROA 3GZOA 2AJVL 4G7VH 4F7TB 1SDDB 3ARDC 4ZUTA 5HY9B 4RLDA 4KO9A 2ITCA 1OW0A 1OCCB 3HC0B 4PJCF 4GAGL 2XLLA 3FRPG 4OM0H 3KH4A 3KPNB 4XPBL 3A0HO 3BUYB 1I3RA 4WHTB 4CDHA 5E6IA 3ROOA 4WFFD 1QBLH 5FYJU 5CGBA 2CXKA 4P46B 4KROD 1RU9L 4YSPA 1B0GA 5I15L 3FQNA 3V52L 2CHWA 2QQKL 3DYPA 4HOZA 3TZVA 1Q72L 4FTVB 4Y4FD 1CLZH 3CLWA 2ZX9A 3L2MA 5HDBE 3DBXA 3A67L 4KKZA 4OZGB 2IAND 1TPXC 2WIIB 1WICA 3VFMB 3VWJD 3C5SB 3FT0A 3T2NH 1AE6H 5BRZD 2WD0A 2ITEA 4PP2B 2OMWB 2F7IA 2NZIA 2CSPA 5EA0H 5CBEA 3IDGA 1ORMA 1N3NB 3DO4A 3C6LC 4QY8A 4TM9A 4KV5E 3N44B 4Y5XB 2YS4A 1QI4A 3RA7L 2XZCL 1H9DA 1HCZA 4O4YH 3SDAC 1Z9NA 3QC6X 4LO9A 3QO0B 4G7YL 4AJ0A 5EOCH 4BFRA 3AROA 3RWHA 2DKUA 2Z65C 1LWJA 3KR3L 2JF1A 5DEJA 3KEHA 1YYLH 2ICCA 2X4NB 5DFVD 3A6OA 3QPXH 4XTRD 2P26A 3WN5C 3GSNA 1EUUA 3MO1A 1HXYA 2AITA 4JM2D 4M8VA 5LAXA 2NY1D 1GSMA 4JFBA 3WEAA 3VB8A 1S7TA 4PRNB 2CG9X 1R3IH 4R96A 2XBTA 1KYDA 4L23A 3T2LA 3V0IA 4LXFA 4XCCL 1NDMA 3ABMB 3K5SA 3RWFB 3FQWA 4YDVA 2W9EL 1O7DC 5FGSA 2KLRA 3IXTB 4TSBL 1D5BA 1LK3L 2P80A 3VFUB 3VD0A 2DEYX 3WELA 2H5UA 4E9RA 2PPEA 1GH7A 4A37A 5IFAL 1AR2A 2MPAH 1KCLA 1OAXL 2YPVA 2P43B 4LLWB 4M7LL 4PR5A 1VERA 4DN3H 5EU6D 5HDRA 1BJ8A 1SN0A 1XFPA 2OXHA 1QFWH 1NPJA 2DKSA 2W94A 3NRQA 3VXMB 3F84A 5CJQH 2XA8L 4PG9B 4TPRL 1IC4L 2P5ED 2JJTA 4OKVB 2P5WB 3LQZA 1H6FA 2KXPB 4XMVA 3AXIA 1PBYA 2EE6A 3BH8B 4ZMVA 1QBML 1WFIA 1QHPA 3UTZB 4PJ8D 4TSCL 2G4GA 5A16A 3P3RA 5ESQB 1U8PB 2UZXA 3UJIL 4UQDA 3UACA 3IKCB 1L9TA 2IH9A 2Q20A 2XZQL 3ULSA 4D3CH 1NINA 3DV4A 2O6CA