4AYFB

Crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the tyr40ala mutation in the caf1m chaperone
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
136
structure length
122
Chain Sequence
b'VEPARITLTYKEGAPITIIDTELLVGTLTLGGYKTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKFDISPKVNGENLVDVVLATGSQDFFVRSIGSKGGLAAGKYTDAVTVTVSNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHAPERONE PROTEIN CAF1M
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Chaperone/antigen
total genus 23
structure length 122
sequence length 136
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ayfB00
3DPBB 1P5UC 4AZ8B 3DSNB 3DOSB 1Z9SB 1P5UB 4B0MB 4AYFB 1P5VB
chains in the Genus database with same CATH superfamily
1QEWA 5C0NC 3IGKA 3KLKA 1MAJA 4QAMB 2OTPA 5FYJD 3ARFA 3CK0H 4HCRA 3NZHL 3I9GL 4HK0A 2F1BA 1CXHA 2F5BL 3Q5TA 3FONB 4Y5VB 1OALA 2PO6C 4WJ5B 3FT4B 3WXVL 4WV1B 1G84A 2A6KA 4Y4HC 5GZNA 3KGTA 4YHLL 3MROB 3GXTA 1ZGLM 3UTTB 5FDYA 3AY4A 3IAPA 2F54A 3FN0H 2CKBA 1JRHI 3NK3A 1D9KA 3S6CA 4G9FA 2G4GA 2WSPA 4IGBA 2A74A 1Q72L 1TTUA 5MEOA 1M7IA 1HTYA 1FFPB 4IRZH 1KIQB 1QSFD 2CLRB 4K5MA 4FAAB 5I75C 3KR3H 4G80B 3HLAB 4UDUA 3VGAB 1MCBA 4PJXB 4KNTA 3QIWD 3VXNA 4M5SA 3NTCL 4XH2A 3H3KA 3Q1EA 2NOYA 2VC2B 4KUZH 3EADA 1YNTF 5DU7A 1GA2A 4LF3B 4R97B 3PDOB 4D3CL 2HA1A 4PI2A 1IGFL 3IJSA 3QUXA 4N2IA 3JWDC 1MCCA 2N4IA 4ZUWB 1S78D 4QMEA 1IAIL 2XWRA 1Y18B 4G8GA 1YC8A 1RQ5A 4LASL 3V5HB 1RZKC 3VMPA 1W91A 1DVYA 2ZX7A 3GJEA 4Y1TA 3ZX1A 1KCRH 1KCUH 4WW1A 1S7UA 2W5PA 1JZJA 1D5XA 4GQ9L 1IVLA 1AR1D 1U8CB 5CBEB 1BYPA 5JXEC 2G0KA 4ZODA 4YXLH 4L8SA 2GIXA 1KB5L 4JKLA 4W6WB 5AKTA 4GG6B 2B9AA 2YAHA 5EZOL 4LP5A 1EJ8A 1A4AA 4XX5A 4FMKA 4JX0A 2FWSA 5FYJH 5CU9A 1KIRA 1NUDA 4HGKC 1J11A 3AC0A 5AW2B 3CFKB 1OWWA 3HVDA 1NGXA 4NQUA 1VGKA 3ZKNC 3ZHKA 1ECYA 3N85H 1BIIA 1JUFA 4UAOB 1J1OL 1OLLA 1HC1A 5AYQA 5HDOA 3HC3H 4TULH 1I9IH 3BJ91 3OAYK 2R1YA 4UQ2A 3OR7A 3QG7L 3U4EA 1HHIB 3OB8A 4BWWA 2BC4A 1BJ8A 3O2DL 5DJZB 1NOLA 3RNQA 4W9JC 4BH8A 3S37L 5ITBL 3QORD 3H85A 2AXGB 2HG5A 2E7LC 5IQ7L 3L54A 4ZAKB 4NN5C 1QPKA 2H3XC 2DRUA 3UP6A 4AGNA 2VLLB 4K2UH 5I2IB 1EFXB 1T7XA 4X5WA 4D8PA 2YEVB 2ZG2A 4PRDA 4WFGD 2WLJA 4ZMVA 1CQKA 2GK2A 4DFIA 3TCTA 3V7MA 3AT9A 4WSJA 2ZX8A 1RSFA 4X6BA 3TFKC 5T1MA 3IWUA 3U4BL 2R4RL 4QRUB 5HYSB 1FN4A 1VZIA 1MCIA 1OAQL 5I16B 5I15L 1EXUB 1N8ZB 3LQZA 5EO0A 3FO1B 2APSA 1DJZA 3M07A 5CD5C 3RU8H 1NCNA 3C2SA 4KY2A 4Z7WE 1ZVSB 3NJGA 3HN3A 2F15A 4M1GL 1C5DA 4ZS6D 3ZE2F 4HD5A 5LBSA 1A02N 3O41B 3M6DA 1F3DH 4WW2F 3TVMB 4JO1H 4A7TA 1CU4H 2AJVL 3LS4L 4QDGA 4M7KL 1HQ4B 5DJCB 3UZEA 2WD0A 3S3DB 2WLLB 2J88H 3E2HC 5IB4A 4CU6A 3TESA 2YC1B 2QQKL 3E80A 2WLMA 1KJVA 1V55B 3GNML 5DZOA 3NESA 4TMPA 1DCLA 3P3UA 5TGBB 3RTLA 3STZA 1R9FA 3A67H 4ISVB 3BVDB 3SE8L 3OHXB 4P2RB 2E86A 3GHBL 3EDEA 3LTVA 3ZZLA 3RUGF 1QHQA 4GT7A 3RWFA 4WZ9A 5T3ZE 5JR1H 2EKSA 5C6WH 3IMTA 3L3OA 2IANE 1XGPB 3WFHA 1H8NA 4LHQB 4J3VA 1PX4A 1TPXC 3PWJB 3K6NA 3ROLB 1A6WL 5D7LB 1QFWH 4L2LA 3V6FA 1NBQA 3KJ6L 2X70A 1N2RA 2CBOA 5JIMA 3AJ7A 2C4FU 2HVBA 3MRFB 4PJ9C 3D05A 4RZCB 3U1QA 4TLUA 1F13A 2JQZA 5CCKH 1YUKB 4IIQA 2R9HD 4G3YH 4JRYA 2WV3A 5KJ4A 4YUEL 4ZUUB 1B4JH 4U1NB 2OX5A 5GRVL 1U9KA 4QXGL 4XP5L 3RURA 4LEBA 1VDGA 4N2CA 1GW6A 5A2JH 1IM9B 1GTNA 5KBKA 4GRLD 4PJAE 2WLNA 2OMUA 4Y9CA 3IXAB 4M03A 1DANU 2WM0A 2FIKA 4MNHA 4Y4KC 4NUMA 3QARA 3FTGA 2XC8A 3W0WA 5ISZB 4KUCF 2FSDA 2XLLA 2D3LA 3OAZH 1AKPA 3BKML 5EMYA 4WWKD 1KPRB 2QEJA 3T08A 1S9KC 3JT0A 1UEMA 3NCWA 4UZSA 3IU4H 1B0RA 3DWTA 4B0MB 1R5IB 3RWCA 4IDJL 4FTVD 4A1RA 1UQSA 5EUOB 2VR6A 1PSKL 2VC2H 1D6VL 3K6FA 4DUWA 1PF3A 3ZYJA 1MI5E 3IVKA 3EUUA 2YA2A 5INDB 1KY7A 3GLDA 4Q14A 2OV0A 3WKNA 5DHDA 1YEJL 4C57C 5KJ7E 1JNNH 1J9SA 1F90L 3PGCB 3VGHA 4PCTA 1O6TA 4NP4H 4I2XA 4UZGA 3MMEA 5TDOB 5BOZG 5I1JH 2NX5A 2GABA 5I1LB 3OG4B 1EBAA 3B6SB 2IXQB 4LE8A 1AY1L 1UT2A 5J12B 5JPMC 1TZIB 1N9PA 4P9MH 4P46C 1FG2B 5E5LA 4M1DH 5TQ0H 5JHAA 4G7YH 1N64L 3P54A 4BFRA 4JN2B 2FO4A 1WK0A 4JG1L 4HH9B 3TM6A 4CGUB 5E6ZA 1XGQB 1DEEA 2VR9A 4OLZH 5FCUH 4OFQA 1ZS8B 3SSGA 4ODUA 1NFDB 2W9EH 4XXCA 1A7NL 4LCCB 1T03L 2UV3A 3P9LB 1S7WA 1QX1A 1XSKA 2QPFA 1ZLEA 3KPNA 3A47A 5ICUA 4PB9L 3PGDB 4GXVH 2OSWA 2IJ0C 1JD7A 5TTRA 1ODUA 1U91B 3CSBA 4HMEA 2QKIC 1QAWA 2FWLB 5E95B 4WI8A 4BUGA 3S36L 1YEKH 4GG8B 2QDVA 3OKLA 3VMOA 5MENA 1F2QA 2MPAL 2DQTH 3CN2A 4JRXE 5JIDA 1AKJD 1IQWH 3CFJA 3ZR6A 5I8OH 2UVEA 1WYJA 4U0RC 4LXFA 4IRJC 4ES9A 1CFVH 4KQ3L 5EIQA 2X6BA 3A6BH 4HK3N 43C9A 4S1DC 4GW4B 4O02B 2BNUA 1J10A 4A2HA 4OQTL 1J9RA 4UZUA 5KN5B 4G8IB 3G5XA 4PJFF 5AAPA 3ULUH 4YSCA 4H25B 1BDYA 1XGTA 5D70H 4LL4A 3S88L 2I9TB 4C56E 4PREA 4XMPL 4XAKE 3HUJF 3V0HA 1NCWL 5BJTA 1ZT4B 4EKJA 2WWMD 1NUFA 2NY7H 2BVUA 4XN8A 2VMDA 1HFUA 1BXUA 1CD1A 3MRIB 2D7TH 2K4AA 4XN9A 5C08D 2BVTA 2VQUA 3ZK0A 4OD1L 2W92A 4P57A 2CU9A 3ULVD 1B4RA 2IGFH 3PWPE 4HETA 3OPZL 5CD5D 1DFXA 3QI9D 4Y5XB 3RVWD 1EEZA 1H5BB 2XVKA 3ILPB 4HS3B 2ED8A 3VWKD 3CZNA 3VMNA 2RGSA 3QUZB 4F9PA 4ES8A 1FORL 3B2VH 3GHEL 5EA0H 4POYA 3DUUB 4YGVA 1H3WM 4YL9A 1LM8V 1PYWB 5I1IH 3EGXA 2R2HB 3SKOB 3ATFA 1S9VB 5HDWA 3CDZB 3FB8B 3VFUA 2WMPB 1XGUB 1E4WH 2W65A 3L4TA 3VFTB 3ES6B 1X7SA 4XC1L 3ZVVA 1NGQL 1RFDL 1SLVA 2DQGH 3NIDF 3QA3B 5D55A 5B3SB 5CD3A 1JG9A 2E9WA 3RZCD 1HKLL 4ZTOH 2Q7YA 5J13C 3RWHA 3CN3A 1WCBB 5GGVH 2Q87A 1P1ZA 2YGQA 3MRMA 3EJTA 2V8MA 3IXTB 4PRAB 4ELKA 1F58L 4R26L 4PSPA 3I2CH 4RIRA 3WE1A 3WN5A 3QJFB 4O4YH 6FABH 1HWHB 1M6OA 2R8SH 4OLEA 2WXLA 1JDCA 5DMKB 2ZNXA 1TVHA 3CN0A 4OCXL 3M8OH 4HFUL 2AQ2A 2EEBA 5F1NB 1R0AH 2KYIA 1UD8A 1RZ7H 1FVDB 1E9QB 4XWGL 5DHVB 5K93A 3H42L 4ANXA 3SDCD 1U2HA 3C8DA 5A6MA 1ED3A 2E7DA 2DJMA 2H9GB 5CNHA 4P2QD 4LPTA 4Z3TA 4PJ9D 4QKXB 1FL6A 2PXYA 4OZFB 3NFNA 1GY2A 5GRXG 4JBSA 1H3GA 2FEDD 3AREA 1EHKB 4I7ZC 3O4LB 2JIXB 1KLUB 3WS3A 3BYTA 5CZXD 2G60H 5IMOB 3FU3A 4N8CL 2PCFB 3SDDB 3K71B 4PVNA 2BCMA 4QHNB 5T1LD 1HHGB 2Q9OA 3NPSB 3APDA 3AG2B 5KSBE 1JFQL 3KS0J 5B1KA 2MEJB 4L5FL 5DJ8B 4TTGA 3G6JF 1BQHG 1ID2A 1WTLA 3DMMA 1KULA 4QT5A 4WJG3 4UMSA 4OCSH 5FHBL 2UZIL 4XPHH 4XVUD 2XYBA 1K4CB 4B41A 3LD8B 4OM1H 1EAPA 5I8KL 5EZLA 4N8PA 3U1PA 5IV2A 1XZ0B 2P5WE 4HAKA 4R0LB 2WYTA 1RUPH 4PQXA 1WC7A 1XEDA 4ATWA 3KHOA 4NLAA 3V0WL 1U8MB 4F7EA 4JFQA 2ERJB 5F6IC 1L9PA 1ZA6B 4WNQB 5G4OA 4UOQA 2W07A 1DR9A 3SJVB 3QEGH 4MTMA 5DI8B 3C6LC 3ALXA 1R6VA 5ICXB 4OJAA 5IB1A 3VD1A 3P4MB 3WHXA 2NCMA 1CG9B 5DMJB 1MW2A 1NWPA 3QDJB 1ETJA 2JKNA 4PRIB 4FYRA 4IEFB 3GXIA 1BXAA 1YHPA 3FMGL 1WEJL 2A0LD 4NI3A 4WI4A 4ZTEA 2KC0A 4NWTH 3MRJB 2P7TB 2EP6A 3UTZB 1KMGA 3RPBA 3CVHB 2WCSA 2K6ZA 4OJYA 3ZL4H 1L9MA 4YXHL 2AJYL 2XV3A 4B3EA 5B7FA 1WFTA 4KQ4L 1Q0EA 1RZ8A 4ONFH 1MXDA 4BQBA 4PHXA 3M45A 2DQCL 1F56A 2L7JA 2YSSB 3T0BA 5B1AB 2W80C 1IBDA 2AEOA 4FG6C 4Q4EA 3N0AA 2ZXCA 3NJKA 3OXSB 4GUCA 4L9LB 1QTYT 2AI0H 5AB0A 3P4LA 3CSFA 5FV2A 4JG0H 5BZXA 4XPFH 4HK3J 1OGTA 1IGJA 2ZICA 2IPKA 2FX8H 3CWGA 2K7QA 5AD0A 4Z7WB 5DZNA 1QASA 1U8JA 3C8KA 1NC4A 4O02H 5FUZL 4MMZA 3H9YA 3ZMRA 5A2BA 2R27A 4JO3L 2VM3A 5IVZB 4OU3A 3V5KA 4J2XA 4GQPH 3V4VB 4MZ3A 1A3LL 1W8NA 1G4RA 1PZ5A 4XXDA 3KPMB 1QSZA 5D7SL 4PJ8B 3QCUH 4JY5H 1J8HA 5E9NA 3FT2A 3PDDA 4HUUB 3CV5A 3QRFM 6TAAA 4H13C 4Z7OE 1CGXA 4RLDA 4DHLA 3D3VB 4S1DD 3JT2A 2JSFA 3O6KL 2IBZY 4TUUA 3B9KC 2CXGA 3Q0HA 1AGDA 2YQBA 2ZXQA 3QH3B 3U9UB 1XWVA 3L3KB 1NMBL 1NJ9A 1A1NB 2HWZL 5CIPB 4I9WD 3FQ1A 3D4YA 2IGTA 3D0AA 3WKPA 3VFNA 2WXPA 1P5VB 1UJ3A 1U8HA 4A2DA 3SOTA 4J3OG 2XYCA 4DQOH 2IANB 5KSVB 2NY1C 1RIUL 2ADJA 3TWCH 1CR9H 2JI1A 3RWDA 2ZSVB 1UXWB 2HX8A 2QQQA 4Y9GA 4U7SA 1Q9KB 1TVDA 1UM5H 2YPVL 4TRPL 5F3HB 4ANUA 4K7PL 2XXFA 3X1BA 5KVFL 5KVMC 5D1ZB 2QMKA 2XXGA 3WIHL 5IJCC 3QSKB 1WIOA 2ZJSL 1OGPA 3ASWA 3GSOB 2P5EA 4P23D 2VXUH 3VFRA 1XCQA 1V5JA 5CLXA 3KYOA 2BP5M 1INDL 1RCYA 3SJVD 2DL2A 1CICC 1SJHA 1X5JA 1DSFL 4X8XA 1FPTH 2GITB 5EIIG 3MO1A 4LFHG 4A67A 1JNHA 2YXWA 4QRFA 5DEGA 3ZY7A 5IT2L 1QKZL 4FABL 4PRID 4OV5B 5IHHA 3NCYS 4QRRB 1YEEL 4Q6KA 3ZRFC 4Z7AA 5DRWA 2QSQA 1A6ZA 4BQ9A 4LLMA 3KWVA 1CT8A 4HJTA 5DHVH 5GGSA 4ODTH 1EBPA 4XPBL 1ZS2A 3VRLF 4LLYB 4YL4A 4OFIA 3HS8A 2DJSA 4B60A 1MKFA 1ESOA 1NIEA 1DQML 4OZFH 4Z7VB 1M71A 3TN0A 4HPYL 2ZAIA 1U58A 1ZV9A 1IT9H 5D4IA 3LMJL 1YNKH 2O5YH 4JY4A 3Q8AA 5CSZA 1A9EB 1CYWA 5C8JA 4ODXB 4UBDC 2GJZB 5E8NA 3TA3D 2OJZL 3L5JA 4EJ1C 1MI5B 2MCPL 3EXJA 3CZGA 1JPGA 1SYSB 2X09A 4MNQD 4UINH 4AQEA 3N1QC 5FGBC 1AQMA 1HZHL 4QTFA 4R90H 2OTWB 4YDZA 2WBJD 1HCFX 1QI4A 5E2VH 3MJ6A 4ZYKA 3IDNB 1W0WA 1L0XA 2EC9U 2ZCKL 3UDWA 3O2VH 2GTWB 3K4ZA 2UZXA 1PU0A 4NJ9H 5HHME 1S9WB 1XGYH 4MJHA 4CMMA 1QW9A 2CO3A 4F2MA 2VSDA 2IADB 2VISB 4J6RL 4JGUA 3BE1H 2DAVA 3LIZA 3NACL 2Z31B 2FATL 4J3UA 2ITCB 4EIUA 1FYTE 1VFBA 1ES0A 4APQD 1AHWB 1XF1A 4D0BB 4PJEF 1C1EH 1PS3A 5ENWA 3V6ZA 2NY0B 4ALAL 4QHPA 3WNLA 1MH5A 3IFPA 3P0VH 5JTWA 1GZPA 3O3EA 5DGQA 2RAMA 3WNKA 2E6PA 5JHLL 2HSIA 1YEFH 4RAVB 1GYWA 3C5ZC 3D50A 4N2KA 2EXYC 1IBBA 1JK8A 2VT0A 4GINA 3QIBC 2COQA 2DIAA 1L6ZA 4YR6A 2CR0A 4NO0D 4G6MH 4LBEA 5AKSA 4OT1L 3EJQA 3DTUB 3FXIC 5FXCH 4JGJA 4KZEL 3PF2A 3ZDYE 1G4MA 4L05A 4RSYA 4JM4H 3GMOA 5EO1A 2Y69B 3EF4A 2AJUH 3CVHH 4NZTH 5DD6A 4LAQL 2EE9A 3BLBA 4JRXA 2R69A 3JQOB 3MGOB 1K6QL 4XODA 3WUWB 5J56B 1RAMA 1A7PH 3MODH 4GIPD 4L18A 1G7QA 4H26A 4PJIE 5IG7A 1FRGH 3OMAB 4A63A 5IHLB 2VDML 3L95B 1QNIA 4J1UB 4LBAA 1JOIA 5ALBH 4HOZA 4CSTA 1QPPA 1CS6A 3BZDA 4KK8C 2BP8B 2PUQT 3EOTH 4N1EA 2DQFB 3HUJA 4KPHH 4LSQH 1JF6A 1B4TA 5ANMA 1OY3B 4C56B 2YUWA 2G2RB 3QZOA 2HJKA 3D39E 5AKVA 1TSRA 4LLWA 1AIFB 1NCGA 3QDMD 1BM7A 3QXAA 3V4VH 4JN1L 1UB6A 3LZRA 4DPBX 1UGKA 4UDTA 1NPNA 1CI3M 4EBQH 4RFNB 4HIJB 1Y0LA 3MBWA 5C0BE 4Y4FB 2X7LB 1QZ1A 5CR8A 1I1AB 3DJTA 3PWPA 3D5OF 3MBEC 3PCYA 3EDDA 1NGWB 2SEBA 2DQIL 4OLYL 3CTTA 4WUKH 1VEOA 3V95A 3WELA 5HYQA 1KT2A 2QHRL 3MV9E 4HIHB 3T3MB 3NEEA 2VUKA 3QWRD 1BVKA 1OT1A 4UV7L 5CGMA 4X6DA 1JMZA 1ACCA 1UOLA 3S4SB 1BZ9B 1XF2A 1QNZL 4OCYH 5F7YC 2N1TE 4FXKA 2VDPB 4F92B 1KBVA 3GMRA 4U1IA 2OMVA 1AGBB 5CUSL 1BQHA 1OP5H 2X0VA 1F97A 2I60L 2BM3A 2BK8A 4JFHD 3ZXAC 2CRMA 1Q0XL 4RMBA 5LO7A 5HHPB 3LEYH 1GS7A 3PGFH 3LN4B 2XG4B 4XI5D 1PLGH 1YMHB 1ZIBA 4G71B 3BQUC 3GSXB 5IEKB 5CJXC 5IGXH 1NCBH 2Z31D 2Q86A 3EH5B 1OE2A 5IJKA 5IB3B 2Y3NA 1TG8A 5GGRB 4HJGB 1G7HA 5BQ7B 3EDKA 2P45B 1X5IA 3KG5A 2YD7A 3TBTA 4X9YA 1C08A 4Z95H 3V10A 1N5AB 1ZGLA 1E28A 1DVFB 3S97C 4IM8A 3MA9L 2WSKA 3HS0C 5EU6D 3WKYA 4APQC 4F33B 1W2KT 2BIOA 2E27H 3KR3L 3OMIB 1E50A 3VQ2C 3LRLA 5C86A 1A7QH 1MUJB 4HJJH 1MNUH 4KUZL 1D2OA 1SMDA 4YFEA 2OYPA 5K69A 4L3AA 5IOPA 3WTYA 1P7QA 2VJXA 3GIVA 1AC6A 1EHNA 1YECH 2HT4C 1P84K 4U1HB 3B9AA 1UM4H 3BN9C 3GMLA 1TQSA 3DX6A 5KSBA 1LO4H 3Q1SH 1QQDB 4WI6A 4YDJA 1IAOA 3D85B 2WXNA 2JK5A 1I75A 1RIVH 3QDHA 2BIHA 4Z3GA 1BPVA 1NSNL 4Y0GA 5H2BB 2EXTA 2V5SA 4RGOH 1TTAA 2YAOA 5DA0B 4B7LA 2F7IA 1BYOA 1NCIA 2P5WA 3DX0A 4N2NA 1DJIA 2JQMA 2CO2A 4XVSL 1KELH 1PZ2A 3VAEA 3D33A 5DUMH 4L29A 1KTLA 4ALAC 4QEGA 1Z0NA 4U1LA 3UG5A 1F2XK 1HHJA 1YAZA 3BW9B 4H0GA 1TQBC 5IKCB 4YN3A 4M61A 4L37B 4X0KB 3HC3L 5A2CA 2Y06H 1JK9B 3TO4B 3ZHDA 1KYAA 2VLJB 4YPJA 1Q9OA 1ZLVH 2P26A 1A1MB 3GI9L 1N3NB 4K2UL 3SD2A 4XCEB 2BERA 4N0UE 1CJYA 4PGEA 3EG9A 1LXMA 5FS5A 3TNMA 3FTSA 3TU6A 1RPKA 3B2PA 1AAJA 1UENA 3B5HA 4NZ8A 2G5BA 4UB0H 3RFZC 1KIUB 2ALAA 2EABA 2IMNA 2ZG1A 3OWEA 4TL4A 5D2NB 1IGTA 2DI7A 2EYRB 3RU8L 4GSXA 2EXYD 3PQYD 5B38G 3I6GB 1UWXH 4F7KA 2IQAB 1FO0A 3PHQA 3X13A 5I0ZA 4IOIA 1ICTA 1VRSA 1QVOB 4FKHA 1DTUA 3MUZ1 3VH8G 5KZCB 1H6EA 1FZKA 1CU4L 4JO1L 4PTUA 1VJSA 3R1GH 2OMZA 5DDHB 2VDLL 2ZPKL 3O45A 3UBHA 1RJZB 1RIHH 1Q90A 2UUDK 2BNRB 4NENB 1Z9LA 2J88L 3QUMH 4OGAC 1HH6B 3KW8A 4N1HB 4UTBA 4UQAA 2W9LA 4S1RH 4J4PA 4UM9D 4MJID 4I48B 5EIIA 3K6IA 1M9SA 3D0LB 1INQA 1YMME 3A67L 4QRTA 2BSED 4AQ1A 2Y7QA 1JZFA 5ALCH 2C9UA 1OHZA 4PLJD 4KK8D 1NUNB 2VO5A 2G5UA 3E38A 2NZ1A 4K7FB 3PL6C 4DT2A 1VF5C 3MGAA 3T4AA 5JR1L 2X9YA 2FBJH 3SE3A 4DP0X 4GEJA 5CO1A 1R24B 1DLHB 1IBGH 5F7EH 3NZ8A 1QA9A 1A7RH 2A6DA 4LLQA 4NPKA 4PH8A 2KLRA 4S2SB 1BOGB 3EO0B 1FNEB 1G9NH 4APXA 3BAJA 1K8IB 2WBKA 4F7PA 4OLXH 1UTDA 2BX5A 5HI3D 1AXIB 4EN3A 2VXVH 1WJ3A 3EOBA 5CEXB 3WKMH 5CCKL 2VDPH 4QI3A 1U42A 4Y1AD 4KHXH 2OXGA 4G3YL 4D9RE 4F8QA 5CEZD 2FSEA 2MHAB 1S3RA 4NUJB 4P04A 4MQXD 4E41E 4UQCA 4ZFOL 4A7UA 3N9GH 3IFOB 1E6OH 4HCIA 3O3AA 4FMVA 3UTSE 3H9SD 4LSRH 3MLZH 1E9OA 4XB7A 5FK9B 5AVQB 5JNYB 3FOMB 2YUVA 1EMTH 1X4YA 3OZ9H 5EBMB 3KPQA 3HMWH 1BXVA 5FYLH 2ICEA 1ADQA 4OGZA 1TJHL 1OF0A 3BKYL 4MA1C 1TJMA 5I1DA 3ARYA 1S7SB 4XCNA 4F37K 2VM9A 2Z7UA 1Z5LA 2FLBT 2GTZB 3IU4L 1G1OA 4FCAA 4MJ5B 5GHWH 3THMH 4PWJA 5EG6C 1FLRL 2NY6B 1GZHC 5FAAA 3HBGA 3UAFA 5KYNA 1IC5H 4KGJA 2H1LM 3SY0A 5HVHB 3RJOA 5C07D 3IDMB 2VC2L 5HHVH 1TQCC 2FJFA 1SXBA 4M43L 5FW7A 4XMWA 5F1OB 4WO4A 3D52A 5E6RB 1B0IA 3GM8A 1MJJB 3KXFD 5JDSB 2CBPA 1JYWA 3QAZC 3U36B 2V9UA 3GPSA 1NKRA 1BV8A 5KVEH 4AM0B 3WGUB 1WWBX 3MTXA 4NP4L 2EECA 3GT6A 3N42B 1FGVL 1OCRB 4AVKA 4L3FA 2WY3B 3QPXH 1KBGL 2PYFA 4F37F 4P9ML 1E4JA 2E0PA 1F6FB 2BNRD 4I1RA 3EGSB 4OY9A 3V0FA 2ENQA 2PKDA 3EFFA 4JRLA 4JFVA 5FA3A 2EZ0C 5HHMB 3BFOA 5JW3L 4PJ5A 3PABB 4U1MA 1VACB 1FNSH 1PD1A 2XPYA 4OLZL 5EF1A 5BO0D 3DIFB 2WAHA 1UUNA 1OAUH 4PJEA 5CEZH 1O9VA 2P8LA 1ITBB 5HD8C 2XU9A 2DLFH 1BD2E 1YPZE 2RBLA 2J44A 3DV4A 1FYTA 3HFMH 1KXQE 1V7MH 2BY1A 5EEUA 3T2PA 2MJWA 4IJ3C 2R2BB 5BS0B 2LQRA 3HBPA 2A83B 4ZXBD 4AH2B 2EVIA 1VSCA 3CUPB 1TDQA 4PAZA 1R1CA 2J57A 3QDGA 3EYVB 4HVBA 2FT8A 1AQKL 2VLME 1AQHA 3W37A 1KDIA 1TZHA 2DQTL 4L8DA 5HY9B 3Q6FA 4HW6A 4Y16B 5DFVD 1RZFH 1IQWL 2P1YA 5I8OL 5C0CD 1HL8A 1I9JH 5HGHA 1UKSA 1CFVL 4WU7B 3A6BL 3GSRA 3RTQC 4HU2A 4A2LA 3C5JB 5EU3A 1K8DA 5I1AA 2DLHA 4X5XA 4PJIA 1KEML 2J8UF 3P0YH 4QGTA 3EO1A 2IFFL 1ZE3H 3GS0A 1DUZB 1NDTA 3ULUL 2NY2C 5D70L 2HTLC 2GSGB 4KTYA 2ZUTA 2C1PA 3F85A 3QQ4B 5HGBA 1BFVH 2ZWSA 3IGLA 4G8EB 4IMLB 4MDJB 3CFDA 1AXSA 2QQLL 3VGDA 2SODB 1UA6H 3ZQ9A 1PPIA 3GEFA 1FC1A 5ESAA 2D7TL 1I7TA 4P4RB 5LGHH 1MFNA 2LW3A 1GOFA 1AO7D 1KTDA 3O0RH 2HH0H 2NXYB 3NGBC 2GY7B 1A5FH 2DMBA 4DUXA 1G9HA 3WEAA 3B43A 1YY9C 3RY6A 4ZNEE 5LJYH 1EANA 4Z9KB 1YY8A 5DUBB 2MCMA 1LDSA 3HE6B 3P2BA 2FX9H 3PUUA 7PCYA 5F1SA 3VI4E 2AK4E 3FQRA 1E5CA 4I0CC 2A6JA 1XH2A 4BYHA 4EUPG 3QNFA 1MHEA 3B2VL 2ZCLH 5EA0L 3K6OA 2XIBA 3MV9A 5DZVA 5I1IL 4HXAH 5KYWA 1ZLSL 4Z23A 3WO4C 4MXQC 2HFFB 3NA9H 4YK4B 1KIPA 1QI3A 2Y6SC 3H9HA 4JFOB 1E4WL 4TLSA 5DWPA 1QFWM 2DQGL 2WP3O 5SWSE 4W9HC 3O8XB 3M1BA 5HJGA 4DNLA 5FO9A 2EUVA 5D9SA 4HYTB 3KLAB 4OZGF 1JSYA 2Q6WA 1FP5A 3QIUD 5GGVL 3U6XS 1F11B 1Z9MA 3RWJA 3PL6D 5DTFB 1YQ2A 4DKFH 1B0WA 1TYRA 4YZFE 3I2CL 3O6MH 4F2EA 5DJ2A 1OSZA 3T1FB 2OMTA 2R8SL 4O4YL 6FABL 4M7LH 1CFSA 2H26B 4PJGE 4Y5VC 2J72A 4CBZA 3EJSA 2QTEA 4WV1C 2F08A 4XNBA 3M8OL 5E8EB 3BUYB 2VZVA 4PP1D 1E3FA 4QOKA 4RRPG 3RGBA 1GSKA 1R0AL 3GSUA 5DHXB 4ZDHB 1RZ7L 4DGWC 5F0JB 1FL3A 3ILQC 5EZJA 5B1BB 4IBWA 1Z9PA 2O5XH 2AJ3B 2P44B 2BO0A 4MCMA 3TURA 2KKQA 4GAGH 3VGAC 5LBVA 4I0PA 3ZIYA 1T1YA 3KBPA 3POHA 4JFDE 2KMWA 4BUHA 5I17A 1ZHNA 4C83A 4Y16D 4AJ0A 2G60L 3LYRA 3KPRE 2FJHB 2G75B 5I5IA 1HHKB 1TU2A 2CDEA 2IH8A 3KBEA 1OAYH 4HZ1A 4NZFA 5I1HH 2FT6A 4NT6B 2VWEC 3TBYA 2WANA 2IDTA 4QY8B 3HC4H 1FCGA 5CSGA 4HUVB 4HIQA 3RB7A 3NIFF 5IVXF 4S1SH 5EDSA 4M4RB 3K72B 4LHUD 4WDIB 5D5MB 3JTTA 2FRGP 4OM1L 1I7UB 3HBQA 1LP9F 1OP3H 5LCVA 3BD3A 4LB8A 4XCYA 4MB1A 2B4CH 5CLWA 2DWEB 2CIKB 1LO3H 3SIKA 3VXMB 1RUPL 2B15A 4NQVB 5DJDA 4EI5A 1BREA 4AI7A 1G7LA 5B38A 4ZD3H 2NZ9D 3PREA 5FGCE 5K9JL 3TZVD 4BZYA 5F44A 3VH8A 3OG6B 1H15A 1NAKH 2VZ3A 3KM2A 4UMGA 1CDCA 1NC2D 3LH9A 1EAQA 1QSVA 2H2SC 4JK0D 4UAOC 1B88A 1T5XA 3EXLA 3HE6D 2Z8VC 5SX5H 3ETSA 2D2CC 3GI8H 4Q9RH 1ZHLA 2LLNA 4IKNA 2CK0H 3D2UB 4PRHA 4HLEA 1CTOA 5FECB 5A2FA 1KTRL 3ARFB 3DSFH 4LO9A 4NWTL 1OAJA 5HJBA 2Y36H 1JRHH 1U93A 1BVLA 4TTDD 4KU1A 1MVUB 3ZL4L 3RKPA 7TAAA 5L4MA 5IBLC 5AAWA 5T3XH 4NHUB 1GGBH 4PR5B 4YSQA 4B97A 1J0IA 4X2UA 2VZSA 3QAQA 4N0UA 4XO3A 2J55A 1JTPA 1RZJH 4WGVB 4IOSA 3QW9A 5C09E 2F54B 2C3VB 3PDGA 3N50A 1T5WB 4G9FB 4IGBB 2AQSA 2AI0L 2Y7SA 4RGNB 1M7IB 4XHJD 5HGDB 1A7BA 5J6GB 5MEOB 5DHMC 3B9VA 5HI4C 4JG0L 2AV7B 4TXVB 4ZMWA 2R2EA 2FX8L 9CGTA 4LPXA 4O02L 3TVMC 1R3KA 1UXSA 4WFHD 3C60A 3A5VA 3FCTB 2OQJB 2BSBA 4HEPG 4BQCA 1F41A 4PJBF 3IJSB 5GGUB 3VM5A 5I1EL 3QISA 1SPDA 1ZGLP 2ZKMX 4JY5L 1BZDA 3CVCA 2C34A 4NQDD 1XB6A 3CPLB 4JVPA 1JXJA 2BLFA 4G8GB 4HJ0D 1MCHA 2JJUA 5IHBA 4LCYB 2Z7YA 1YCSA 1NINA 4ANVA 5I1GH 4HKBA 1SFDA 3GSQA 4P5TD 4UIMB 1A14H 2L04A 1J18A 1YMMA 2NY2D 4A04A 3PPSA 4Q74A 3MLRH 4MCYA 2IWKA 4GKSA 4NI6A 2OA9A 5J6HB 2GIMA 3W38A 2GCYB 5HYJD 1HAUA 1W0VB 4WU5B 4L8BA 1JV5A 4NUQA 3CN4A 3S3SA 3A4FA 2E59A 2VXSH 5DWUL 4DQOL 4JQIL 4N0CC 5T8IA 3MACH 4QWWD 2EDYA 4JR9H 1Z9NA 2YIHA 3Q2LA 2KUTA 4UNVA 1UM5L 3W5MA 2AFNA 3FB7A 3VXMD 4PD4K 4UQ2B 2A9MH 3U4EB 3CVBA 3C5XA 1R3JB 1RERA 2H6PA 2R2CA 3JV4B 2ZCHH 1CBVH 5KBPA 2HG5B 3LKRB 1Z5YD 2VXUL 1D6EA 1OOAA 3DDFA 4LEXH 2GJ6D 4E41B 1E3ZA 4X5WB 5LNEA 5I6LA 4BD4A 4A38A 4HEMA 3R06B 3MUGB 1LHZA 4BCXA 1FPTL 3CX2A 5L9DH 4NQCD 4F9LA 1X7TA 3UTSA 4L1DA 1UATA 4KJWC 5DCCA 4JAMA 1A3QA 1QHPA 2W9DH 5DFTA 1T6BX 5E9AA 1CE6A 3RL2A 3UAJA 1KLFB 4BBWA 2HTKD 3IGAA 2BY3A 3SGKC 1H3XA 3V0IA 2H32H 2FEEI 3BAKA 5TF1L 5D1QB 3DSNB 5GZND 4D9QE 3LEVH 1CGYA 4YHZH 4Y19B 4HBCH 5E03A 1YNKL 2O5YL 1D9KD 1MG3C 4IGBD 4PV8B 3UPRB 3WD5H 4UT7H 1J9CT 1RK7A 2AEQL 4CVXA 1U3HC 2YQGA 2V2WB 4UINL 4KKBC 2KS0A 2ZX5A 3OKKB 1AS8A 3KBFA 4R90L 4BE6A 1CGTA 2DQMA 3DROA 3K74B 4OZIA 1YQVH 5HHOE 2Z1PA 3RUGE 5E2VL 5J12C 3RVVD 1NBVH 1OK8A 3GBEA 1AH1A 3QJHA 5DC9B 3O6LL 4KDVA 1C7SA 3QUXD 2DMKA 3WTSA 1JI2A 4NJ9L 4YHNA 2XNAB 1XGYL 2EKSB 1ZXQA 1JZGA 4GAYA 4KMLB 4YDVB 4G8GD 2DKMA 3ZQXA 1ILUA 2D2OA 4QJ3B 3BE1L 1ZEAH 3FCSB 5T5FH 5JQIB 3GKZA 1G7PA 3UMTA 1FFOA 4LCCC 1E9PA 3P3RA 3WXWH 4JQVA 4WHTA 4BK5A 2F9BT 5J7CC 5ECJE 1Y1DA 1T66C 3D25A 1I1YA 1KXQA 1SGKA 2BINA 2F7PA 2JWYA 3DIDA 3KEHA 3T04D 2J1XA 2Z1KA 4NDMA 4R8WH 4AIZA 2OX5B 3QEHB 2CWRA 2NNFA 4I4WB 4FNQA 4N0RA 1M57B 5AL8A 3ZL1A 4G70B 4LCWE 3TCLB 5IEHB 4JM4L 4HCRH 3ABLB 2V17H 4NZTL 3CVDA 3CVHL 4AKOA 1IL1B 2K8QA 3NK4A 1TCRA 4EUPA 1YN7B 1AP2B 1TTRA 4NNXA 2WKGA 1KUMA 2FIKB 1UCBL 1A7PL 3EOAA 3MODL 2YRZA 1A9BA 3GXPA 3B8YA 1FRGL 1NIDA 3LCYA 1QYGH 5AQ0A 2P52A 5FM5M 1CXLA 3VG0H 4UCFA 2B1HH 3H3PH 3L4VA 4ZW7A 1XD1A 3GMMB 1CE1H 1MLCA 2QPDB 2DDQH 5ALBL 5F0PB 12E8H 1PKQE 3QJQB 4OV6F 1B0RB 2R1XA 2YBRB 2MTPA 3EOTL 2IC2A 4TQHA 4KPHL 1R19A 2WNGA 4LSQL 1T80A 1MCOH 1MNNA 3FFOA 3TFBA 3L9RB 1OW0C 2YMTA 2OK0H 5IIEB 1CF8H 2OMNA 5DK0A 3IVKB 3V4VL 1WIUA 3CC5A 4L3EE 1HH9B 2QADB 4DKTA 2XICA 1RKRA 1IFRA 3ARDC 4Y8DC 5ETUB 1QRNB 2WWKO 4EBQL 3G7TA 4RRPA 3MFGB 1EDYA 4Y5XC 5D7JA 1ZHKB 3ETBF 1H5BC 3MMEB 2NLJB 2NX5B 3WL9B 1EZUA 4HS6B 1KZYA 3QUZC 3BZ4A 1LMIA 3UH8A 4WUKL 5GRYA 3VI4B 3GBNL 1QUNA 3CSYB 1CVRA 2HMIC 1C12A 2B39A 1FH2A 1XHHA 4IHOB 4PU2A 5GSRA 3UTPE 1I9EA 3CXFA 1KTJA 3BGFB 3FN9A 3AWFA 4OCYL 5T3ZL 4ODUB 1BG1A 3LSOB 2WXHA 4OI7A 1IAKA 3H1ZA 3BX7C 1SEBA 2JKXA 2QTVA 3PWLA 3KPNB 2XWJA 3LEYL 1KGCE 3PGFL 2UY7A 4DKAA 1PLGL 5D2LF 5IGXL 3KL0A 2WJ7A 4P0DA 4IKJA 1ZVHA 3BDBA 1MFBH 1BQUA 1NH6A 5D8JH 3VVWA 4F1ZA 2A4ZA 4PJGB 3KWWA 3T1WA 4U49A 5IWLC 1SJEB 5B7EA 2FO1A 4Z95L 3KGRA 4GMTH 5EV7A 3FTUA 1KPUA 2RQ8A 2WUCH 4JRYD 3O11A 2Q3AA 5C0DA 3DVIA 2E27L 3UJTH 1ZMYA 4J8RA 1DEDA 5M94B 3TV8A 5DJYA 3BAYA 2ZNWA 4H0HB 5EC1A 4JFDB 5CFHA 4HJJL 4ZRGA 1MNUL 3SDDC 4Q8BA 1A6UH 4IS6B 4QO1B 2LFGA 1ANUA 3Q5OA 3NPSC 5IB5A 2EDNA 3ZKSD 3KPRB 5BJTB 5TK2A 1CO1A 1Z7JA 4J23A 3SHSA 5LBSH 3CHQA 4PJXF 4U0QB 2BHZA 5FYKE 3W0WD 4H1LG 4KVPA 3ZE1E 3TXAA 3DGCR 1UM4L 2CHZA 5FCSH 3BKJH 4UM8B 3LV3A 1Y07A 2F8IA 5IVXA 1LO4L 3Q1SL 5IOKA 4FKKA 4O2EB 3LEXB 2UYLA 1LEGB 4XMZA 4XMVA 3DVNB 5JORB 4QRPE 5C0AE 3MJ9A 5DK2A 4MA7H 3QO1B 2B8OT 1IX2A 1EEZB 1ND0A 4RGOL 4HJIA 1DQVA 4KKAC 1NBZB 4LSPH 4OAWA 2BS8A 1I85A 1G7JA 2DLTA 1WQVT 3ZSTA 4ZW6A 1JZIA 1KTBA 3ARBB 2ZUYA 3VG9B 3NRPA 5F3BB 2DI9A 3VTTA 4B53A 2ERJC 3RWIB 3LNIA 1KV3A 1KELL 1HL9A 5DUML 2WWNA 4N85A 5FGCB 3O3DA 3T65A 1MG2C 1U3HD 1QFUH 4HEPA 2I5YH 3W3BA 3D08A 4H7VA 1IM3A 4LVNC 3UO8B 1FZOB 2Y06L 2VR3A 2HLEB 4OB5H 3L3DA 1P1ZB 2F6AA 5EN2A 2CE6A 2M26A 1YSOA 4NNYB 1EUUA 1PZUB 2JV6A 3SPJA 2J6WA 2BOLA 2ODIA 5E9DE 5JYLA 4ZNCD 4E2OA 1XEUA 3QNYB 3L5WB 3VDAA 4JANB 3MAWA 2NYZA 1LE9B 2F8XC 4L9LC 5D4QA 4UB0L 4OJFH 3TIDA 3U4KA 4GBXB 1ED3B 1WGOA 5HDRA 2OR8A 2CDGA 4OIIH 5C09A 3QJRB 2R7EA 2PXYB 2NNCA 5DRNA 1P4IH 3NFNB 3AREB 4JDEA 1JZHA 5MEND 1YNTB 2A77H 4Y8AA 1T4KA 5EO9A 1NFIA 2DQHH 3Q9QA 3SYPA 3WFBH 4U7KA 1O9WA 3FU7B 4N5UA 2EXWD 3R1GL 3MLVH 4PJ8C 1RIHL 3FRUA 3EJCA 3UBXG 4NBYB 3DMMB 3AMLA 1OIOA 5B8CB 1L9OA 3GUTA 2WXIA 3ARGC 3DXAB 4S1RL 2PP8A 5HDQH 1I9RH 1RUKH 3EUDA 2W1NA 3IDYC 3CBJB 5DHYB 5ICZB 5EZLB 5E6IA 3Q2VA 5ALCL 4JEGB 4GUPA 4PJCA 1TUPA 1DVTA 1XAKA 4F20A 3BD4A 2ESVB 2BIPA 2ICWA 4Q56A 1OM9A 1T89C 3A4DA 3KYKH 5D71H 5DYFA 4L9DA 5E08H 1S5HA 2DM4A 4XPAL 3N1GC 4JFQB 2OLDA 4A66A 3WJMA 1FFNB 5F7EL 3U6XA 4M6OH 4N1CA 5JDJA 3O6FA 3TBBA 3ZLQC 3PY9A 4QHKI 1IARB 5DFAA 4OCLC 1E8ZA 1BQ5A 1PIGA 1CL7I 3ARDD 3QNZB 2JFCA 3BPCA 1JZDC 4OKVA 2X42A 1DVQA 4FF9A 1AZNA 4RMRA 4UT6A 4G8FA 2VXVL 4XRCA 5D1ZC 5DMIH 4PJ7A 3WKML 3ZTDC 3TA4D 2CO1A 2VDPL 1GKOA 2AKRA 4NHCH 1HCZA 2EYTA 1B2YA 4KHXL 4CADB 5IR1A 2LTQB 3WS6A 2V0AA 1P6WA 3APNA 4KY1H 4ORGA 5E0QA 2OMXA 1XR9A 1T1ZA 3BH9A 3MLWL 2J1YA 4ZMTA 1RK1A 1E6OL 1IC1A 2AJXL 5E51A 3IDUA 4FQXB 3MLZL 4LSRL 1L6PA 3GLEA 5AB1A 3BZEB 3NCFB 1RHFA 2CHDA 4EZJA 1F4AA 3ZDXF 1EMTL 1CK0H 5FLVA 3SY6A 3FO0L 1U95B 1VERA 2H1XA 3HG1E 3HMWL 5KW9H 5FYLL 5HHQA 1AVAA 2D7PA 4PBDA 4MS8D 4CJ1A 1UEYA 3CFNA 3G08B 4FNUA 2W60B 4XMTA 1NDGB 1T2XA 5FKAB 3ZE2B 3RJQB 1LO2H 3THML 3CCHA 4X6FA 3GF8A 3T77A 4MMZB 1I1FA 2ID5A 3WCYA 5AW9B 3BZFB 2V6HA 1IC5L 3VU1A 5B4MD 1SHMA 2JLPA 1DBBL 1WGVA 2GSIA 4G5ZH 1DQDH 3ULVF 1J8HB 4F7TA 2D7MA 2XT1B 3HG0A 1L0QA 1E6JH 2V3EA 3FT2B 3MX0B 3OV6A 5A3IC 3GMPA 5E2UL 3VJ6A 1HCYA 4F3FB 2PXYD 2IVFC 3HB3D 5DJ0B 3VCLA 5KVEL 3ARED 4JFEE 1A4KB 2BXYA 3MRDB 2WTPA 3S3PA 3RWGA 4YOKA 1F4WH 2ZXAA 2BZDA 4FG4A 4AJVA 1YNLH 3CVIH 4Q0XL 2R0WH 4B9FA 5HHOB 4AGQA 5ACZA 1N59B 1NJ9B 4BFNA 3ZYZA 3GIZL 2KL6A 1SXZA 4OUUB 2DYPA 3VFNB 1UJ3B 4MWFA 4CN6A 2XTJE 2Z0UA 1NOFA 1FNSL 2B3RA 1AHWC 1I1RA 1OAUL 2B2XL 3HZKB 4U6VH 2Q8AH 2NY0C 4U2YA 2DLFL 1AJ7H 3FUNA 1DJYA 1MREH 3HFML 1DE4B 1GC1H 1HL5A 2HVKA 2E5EA 2CIIA 2VN4A 1EZSA 3E0GA 1BF8A 1U8KB 5AAMC 5KS9F 1AS7A 1I8MB 3PPEA 2P5EB 4GH7B 1MEXH 1XCQB 2IH1B 2V3FA 4H8PA 3QXWA 4YE4H 5FM5O 1R3HB 2B1AH 2IGLA 3QO0B 3BLPX 3DKHA 4MJ4A 5EZIH 5I8CB 1Q4NX 3OPUA 1KEGH 4LCWB 1RZFL 2FYVA 1BVZA 5IZ7A 5DEGB 1I9JL 3FT3A 1ZA3B 3MJ7A 3ECWA 2DMCA 3ZKQD 1G9MC 5DRWB 4HS8H 3VRLE 1A6ZB 4LLMB 9PCYA 1Z3GH 2BVPB 4OJEH 1WUNT 1NGZA 4Q7DA 1V10A 5C97A 1PNCA 4Z78A 5IW6A 1C8PA 1B9KA 1A66A 1PX8A 4YSUA 3NP4A 3CLFH 4F8OA 4AYBA 1GYCA 1PKQA 2F58H 3MXWH 1BFVL 3X12A 1W72B 4NNPH 4NQXB 3IJ8A 3NJIA 4QHUB 4IBVA 5HDBF 4F57H 1D7BA 3G6AA 5JHDD 4JY4B 5CSZB 4PBWD 5I5RA 5C8JB 4NSKA 3GSWB 1OB1A 4C55A 3HE7A 4B3VA 5MEPB 3RGVB 5LGHL 3O0RL 4RFNC 3A6OA 2VDOB 4AQEB 1UOVA 4HT1H 5ECGA 2ATAA 3DUHA 1A5FL 2IDUA 3F7LA 3OLGA 3QJVB 1SDDA 4Y4FC 1NC4D 2AJSH 3LJ3A 1I1AC 3QQDB 4KKCD 3FW6A 4OSUH 2FVNA 2O6PA 1JPFB 1SRDA 2Z4QA 2WVTA 1HIMH 5D1XE 2FX9L 3B7SA 1DO5A 1P9MC 5HPMA 1J8HD 1PZAA 1ZJAA 4FFWC 3HG4A 4FULA 2ZCLL 1ASQA 4F2MB 2QR0B 2ARJQ 4HXAL 3RP1A 3VXSB 2AJZA 2BJMH 2HUHA 1X5XA 4RH4A 4D7PA 4AEEA 1G6RA 2ZUUA 3T0EB 4K73A 4M02A 2C4XA 1P5UA 1VFBB 3ARGD 1TSHA 1ES0B 1EUTA 3KLSA 1X44A 3PV6B 1ECZA 2WTRA 4FQQA 2WXQA 4FOMA 2ZP9A 4ZFFA 1RK0B 4H1LA 1L0PA 2RFXB 1HYRC 2X89D 1P7KA 2ICWI 4NO3B 3ZKMC 1GZPB 5IQNA 3STLA 2E7CA 2VAJA 2M8XA 2X2IA 1G7IB 3CLWA 3LX9A 1JK8B 4U31A 2WKOA 1TJXA 3G9VA 1L9SA 3W81A 4G7SB 1W9XA 2JKIS 5KYXB 4PIRF 1TEGA 4M7LL 3LKOA 1JS4A 4EOWH 1NPJA 4RFEA 2JE8A 5FA4A 2WC7A 3FUJA 3GMOB 4YHKH 2CJ3A 1MY5A 3D87B 2R23A 1OGAA 4EN2A 2ZD0A 2O5XL 1H8LA 1CLCA 2ROYA 4LL1A 4PLKD 2YPLE 3FN3A 5DJAB 5E1AB 5KG9B 2P5ED 2APWA 3FYEB 1A22B 1S3KH 5DFWH 4E5XG 3DO7B 3TEYA 3NJJA 4PJFB 3QFJE 4IMKC 1AOZA 2W0FB 1DSWA 2I24N 4KJPD 5KSUA 3ZN6A 4MCZB 3HUJB 4U2ZA 4YDIH 4OR1A 5ANMB 2XX0A 4AMXA 3OAYH 1J0HA 4N2AA 4HV8A 2JKLA 5I1HL 1IKNC 4BZ2A 2D3VA 5F9WB 2DTMH 5ID0B 3HC4L 1LD9A 3AVEA 2L8AA 1OB0A 1JL8A 4I18B 4NERA 3IGFA 4PRNA 3ROOA 4PY7A 4C4KT 2Y7LA 4S1SL 5IHZA 3MBWB 1LDPL 1OSYA 5TH2B 4QRPB 5IJBC 3EH3B 4ZQKB 3MRPB 3TN0D 4X8JB 2WXOA 5E2JA 5C0AA 2B4CL 5CCHE 2C3GA 4N68A 2SEBB 1I4FB 3I3EA 2H3NB 5L6YH 1OWRM 5DVNA 4E42A 3FT9A 3SE6A 3GHPA 3FTWA 5GRVK 5KSAA 1K72A 1MPAH 1XMWA 5C9JA 2HLFD 4X6DB 3DRTA 4G6FB 5A3ID 3QQ3A 2ITDA 1NAKL 2HRHA 5E2TH 1CF1A 3BRFA 3NIDB 4D9LH 4GW5B 2IF7A 4DN4H 1SXSA 4LGPB 3GMRB 1ZIAA 4W68A 3RHWK 3UBXA 5IMKA 2YSTA 4Z0XA 3GI8L 2XG5A 3MYZA 5DJXA 2LT9A 2CK0L 5BXFA 3AM8A 2XWDA 3VFOB 4A7SA 5TD4A 3BGAA 2OW7A 1JWMA 1OPGH 1S9XA 3MRHA 4Q2ZA 3DSFL 5DEFA 1I31A 2Y36L 3GJFK 1O7DC 2P8PB 3MRQB 3OXRB 2H2PD 2BDNH 2K70A 5T3XL 4J6IA 1GGBL 3KLHC 2UWEF 5E9DB 3TBTB 1SOSA 2Z35A 3R7RA 3U9PH 3HMXA 1BWMA 4J3OC 1ZGLB 3B83A 1RZJL 4HJ1A 5FX3A 3TO2B 1ONQA 2B77A 4Y88A 5D2NC 4Z7UA 1Z6JT 4AYFB 4U3SB 1GRWA 4KRPB 1ORSA 1D7FA 2PO6A 1S7TB 4L8CB 3HC0B 1XZWA 4Y4HA 25C8H 1U3JA 5IUSA 1PQZA 3PIQA 3ZDZE 1Q94A 3L1OH 4Y5YC 5CP7A 1MJ7H 2H0EA 3HJEA 3UROR 4JRXD 3QRLA 1P7QB 3WTTA 3IBEA 3G6JB 3VXPA 4LLUA 1AD0B 4P4KB 1CFNB 5KYYB 4ZW3A 2NY4B 4P5MA 3L1EA 3RVXC 1JN6B 1TEFA 4HOXA 2CRYA 4YDJB 2IDQA 1ODAA 1EDQA 3WTUA 5JW5B 2GQHA 2VDOH 4KOCA 4NKIL 5SWQA 1A14L 1N7ML 3FOLA 1SN0A 1JXDA 3V0AC 4YNYA 3Q3GA 5A6LA 3V5DA 3MLRL 5B3NA 2BP0B 4XAKD 2DWYA 3MZGB 2GHWB 2Y1AA 4U7MA 4QRBA 1SF5A 1V7NH 5KYUB 3F7YA 1OD9A 5F8RC 3LKQB 4LLAA 3P9WB 3VI3F 3QUYC 2VERN 2C1OB 3DX1A 4OCWH 3MACL 4JR9L 3OKOB 4IBYA 4YWGH 5JXEA 2RR3A 3AITA 3HI5H 4OBSA 3PWPD 4KO6A 3LIZH 2XBZA 4RDBA 3BKCH 1Q9LA 2PABA 1NAMB 1KWGA 1I3UA 5AOLA 2A9ML 2VABB 4BK8A 2O93L 3DK2A 3SZ6A 4I8DA 4FKEA 1CVSC 4B27A 2V4LA 1CBVL 4YSPA 4MLSA 3MCLL 1OE3A 1ZWIB 5C1MB 4C8XA 3FBQA 4X80L 3ZT5A 3T8XA 5IF0B 4FJZA 5IFAH 5L9DL 4KI5D 4JPSA 5LLIC 1A6AB 2M83A 4N2LA 5JMOC 3SO3B 3SKNA 1URLA 2E7LA 4MLIA 5D6DA 2HFEB 1QFOA 2ARWA 3SPVA 3IGUA 3PP4H 3QP3A 4CBPA 1AE6L 2R69H 3A21A 3DETC 3HG1A 4JFXB 4W9EC 1AMYA 4MAUH 4AQOA 2NY6C 4HD9A 2CK2A 3I50L 2EICA 3PHQB 1D5ZA 1JZ4A 5DHEA 1J12A 1F1DA 5HVHC 4DEPB 3LEVL 1FZKB 4XMXA 1NKOA 1UD6A 3CDFA 4PTUB 4YHZL 4HBCL 1PY4A 3G9AB 4QXWA 2EDXA 3BWUF 3TASA 3WD5L 4UT7L 1QMUA 3IN0A 3CZFB 3SGJC 4LK4A 4UAHA 4TVPH 3O0LA 1QBMH 5IROC 3FSAA 3EBIA 5DVLA 2B4CC 1D5BB 3FUMA 5BV7B 3L2LA 2HT2C 5EIIB 2A9NH 3VRJA 2JJTC 4ZFQA 2X40A 3X11B 2Y7QB 1WS8A 1YQVL 3F01A 4YSEA 1NBVL 1MFVA 5ID1B 1H0DA 1NIBA 1P7QD 2AV1A 2EDTA 1NUGA 2ALWA 4K3JH 3QC6X 1EVTC 4KROC 1KOAA 1XCTB 4AKQA 1GMEA 4WWOA 4MNGA 2NXZB 5FDWB 3IDJA 4XHQA 1IB5A 3U0TA 3REVB 3SKUD 1JV2B 5A40E 1QA9B 1OOWA 4LVHB 3FF8A 3VNYA 1OAZH 4R2GB 1VFAB 1ZEAL 5T5FL 3WOVA 5JXAH 4AKPA 3RX5A 3SYAA 3TTSA 4APXB 1GOHA 5IHUH 1KYFA 4U6XA 2OJEB 4NFCA 4YSAA 3NA4A 4PJHF 5D7KE 2HPOA 3HCVB 5AWNH 5GIRB 4CDHA 4E0RA 4OW6A 3C9NB 3EOBB 2P5WD 5I6XB 5T1KA 1JWUA 4MD4B 4LGRB 1E40A 1QI5A 4GUOA 3PNWB 1NDMB 3QCTH 1OANA 4OZHF 4IJTA 4R8WL 3VNZA 2H0FA 4G6JH 3NSCA 4HHGA 3VE0B 4BKSC 2AEPH 3O3AB 4ONHA 4R96B 4U6TA 2ZOKB 4YHYB 2MFNA 3JV5A 3U25A 1OAKH 4PJ9A 2V17L 2YGPA 2JTYA 3UBXI 4AIOA 2ZOWA 4DCQB 3HRPA 3EYQC 1TR7A 3KPQB 4U1KA 1AZVA 3AW5A 1GL4B 2ICEB 3A4AA 4IBQA 3ZW3A 4F8PA 3VG0L 3WJLC 3GMNA 2WQXA 5D7IE 2E47A 3KBHE 4X5LA 1CE1L 2E75C 2DDQL 1FNGB 4Q52A 2YMOA 2NY3B 5HGAA 3JVGC 3MJWA 1Z5LB 12E8L 4NCC1 4A7QA 1U3YA 2HKHH 1N0LA 3SZKC 3VFMA 3FQXB 1J88A 2W91A 4XNMB 3HC2A 5JQ6H 2EH7H 4Y4KA 1IFGA 3UZVA 1IVTA 2L0DA 3MC0A 4WI0A 2BVYA 4FZ8L 4D0DB 2FJFB 4L5FE 4J3OD 4O2FA 1CF8L 1IILE 3FQWA 3MRCB 3OD3A 5C6TH 3U2SB 2OXHB 1FNHA 2IDCA 2VQ1A 2NXYC 2MRYA 4GSUA 5F7HA 3LHPH 1X5FA 3OM3B 4F7MB 4BUQA 3BEVB 3E7JA 5F96H 2CLZA 4KZDH 4YHIA 4PJDF 3CXDH 4RESB 4UU9B 4OZ4B 1YZZA 1F86A 1D7DA 2QVFB 2FB4H 2CUHA 3BP5B 1KZQA 3DX8A 1E4KC 3EIFA 4E5XA 1CXFA 1VPOH 3EFFB 4M48H 3AXLB 3L3JA 5DURB 4AENB 1F4XL 5ACMA 4ELMA 3Q2CA 2BW5A 3WY4A 1JGUH 1JHKL 1KB5A 4J4PD 2WZ6A 4U1MB 4YK4C 4LFHD 1KXVC 4HX1A 4NM8H 3RVXD 3P3TA 4I88A 4K8RD 5J1AA 4PJEB 1NGPH 2P8LB 5TK4A 5JPMA 3O8XC 3OKDB 4P46A 5FOBB 3TH2T 5H4ZA 4HC1L 2J8HA 4N20A 1MCLA 1TF4A 1NAMH 2DBLL 3JWNE 3LKPB 3BVNA 2JJWA 2BFVH 1F6AA 2X0UA 3QDGB 4ZTPH 5DGRA 4YHML 5D8JL 4FQ2H 4E9XA 1XIWB 3Q6FB 1QO3B 1U8QA 1PVHA 2NY5H 4UTAH 2EIJB 3BEWB 5IQMA 2W38A 3MRNA 4GMTL 4EN3D 5K9KB 2MQGA 5EWIL 4LPYA 5BRZA 2QKIA 2WUCL 2J8UE 4NUPA 43CAB 5FEBA 4H8VA 5EU3B 4DZ8B 4ZSOE 3DI3B 3UJTL 5B39G 3EO1B 2WLZA 3IMBA 2JJSC 3GGWA 4JVWA 3TV3H 3QEQE 3D4CA 5GGVY 4HWUA 4RWYL 2K1MA 3QFJA 4KKQA 1A6UL 1HE7A 4IRJA 5DK3A 5IMMA 5AUMB 3QWQB 1PY0A 3AS3A 2DKSA 4HSQA 1FO0H 3DOSB 5DZPA 4PGCB 2MNWA 3E1ZA 4XGZA 1FZJA 2NTSP 2FJGB 2Y07H 5GZOC 4GW1B 1KTDB 3KPTA 3NRFA 2D73A 2NY3D 2N59A 5CINH 3HKFA 3KPSB 3KVPA 3X2QB 2AQPA 3CZKA 2VM4A 3HHRB 4TNWK 4UTBH 3NIGF 4MA7L 5FKPB 5LN8A 3NJVA 3W9EB 5BV7H 4LSPL 4JJHA 1G5AA 5IP4A 3CPUA 4LSUH 3ET9F 1M6UA 3FQRB 3FRPA 1YDPA 2ZXBA 4OLUL 4PMEA 2F53B 4XZUB 5AOIA 1FCCA 1MHEB 5K59E 4WO4D 4ZPVA 2X9WA 4CMHC 1HQRB 1I3GH 2V7HA 1HSBA 2B3IA 4OI8A 3NVQA 4OLVH 3UYRH 2BVOA 4ZK8A 1PD0A 2NUPA 1QFUL 1PLCA 2I5YL 1FLTX 1P6AB 2Z91B 4FADA 3VYPA 2IAAC 5SWZA 3WE6A 3QULA 5F9JB 4OZGE 5AFAA 3WEMA 3M1BB 1PAZA 3ENEA 4H8WH 2X0WA 5FO9B 5D9SB 3LPOA 2NR6C 4B9KC 4OB5L 5E8OB 4TNWF 1JPST 2C4FT 2Q76B 2WLIA 3B7RL 3WNJA 1JCKA 3OR6B 4PJ5D 5DJ2B 1OSZB 3UFIA 5LAXA 2BOCA 4X7DC 1LTXA 4EDXA 5CKAA 4X5PA 3FTVA 1MRDH 1LEIB 3VXRE 4TSCH 2AEIT 1HI6B 3MLTA 4XVJH 4GAJH 2EIZA 2JCCF 1FYTD 3AMKA 3GSUB 2GK0B 4PSRA 3RIKA 3EBGA 5IW3A 1NPUA 3I6KB 4RFOH 5MI0B 4JHWH 1T21B 4OJFL 4RGNC 3BGMA 2ED6A 1RULL 4HUMB 1KB3A 4OIIL 3DNKA 4XNUL 3NZSA 3FB6B 5SX4I 2FYYA 3QDGD 1Y6NR 4HP5A 1P4IL 4F91B 4LQFH 3H8NA 2A77L 1UWFA 2YRLA 4FYSA 3LPGA 4UNUA 1VA9A 3WFBL 3GJFA 4MNQA 4TQ8A 3US0A 3BC9A 2CDEB 3MLVL 4P5KA 3RJDA 4F15B 4FLQA 3GSNB 3MUY1 1TEYA 4JVUA 5F7DB 5JYMA 2FUQA 4BKTC 3VFGH 1RUQH 3HAEB 3OKMA 5CZRA 2HFGL 3QUKA 1HHHA 5HDQL 1I9RL 1LP9E 1RUKL 3FB5B 3RFRA 5ITFA 3TNNB 3U2IA 2OI9B 3IDGB 1UJTA 3BUPA 4MQ7A 1V27A 2P48B 2VL4A 3MJ8A 1PMYA 1AZUA 2C9RA 3P9MB 1U36A 4HUCA 3D39D 3JZ7A 1GJIA 1IGYB 1X7QB 5BPPA 2EDLA 2V5TA 5E08L 1KYOK 5C0EB 4DIXA 1OT2A 1PZ3A 3ZE0E 2CBTA 1FIGH 1KCVH 4M6OL 1R5VB 2WXRA 5F71A 1F45A 1WBZB 2BNQA 3VH8B 4JNXA 1XB8A 1DN2A 3B5GA 1T5XB 5C0BD 3KHQA 2APVA 1ZHLB 3L6FB 5HVFB 2Z7WA 2X6CA 3B7UX 4ZW5A 4NHCL 4WQOA 2OTUA 2NPLX 4UIKH 2APXA 4DP1X 3QC5X 5LWYH 3MV9D 4KY1L 3WLBA 3C6LA 1WVZA 4KJQD 3RDJA 4GY4A 4CILA 4L2YA 1EIBA 4X7SH 2PW1B 4F8NA 2QZQA 1WHPA 3B3IA 4X98A 2A99A 5CJ8A 3NEOA 1PW3A 2G3NA 4I5BB 1CK0L 1LE5B 1XO8A 4E9LA 3UAJC 1CDIA 5KW9L 1U8PA 2G30A 5DRXB 1L9RA 1LGVA 3X17A 5DLML 4AV5A 3MNVA 2HKAA 2IWEA 2EJ1A 2ED9A 1LO2L 4BKLA 1TTBA 2EDDA 1BECA 5D1QC 3VXUE 3L5HA 1WAAE 4PJBE 4QOKD 5K1JA 3C60B 3Q6GH 4FS0A 4N2GA 5DRZA 2XY2A 2YD6A 4QHMA 2VDNH 4A6YB 4G5ZL 2EC8A 1DQDL 4PWFA 1T22B 4L0ZA 4L4VB 2TAAA 4U1JB 3BIKA 4MA8L 4I0PD 1XH0A 3QJUB 5AVVB 1PGRB 5F7KC 1GYAA 2LU5A 3NYKA 3QBTB 5D93B 1BM3H 2IQ9H 1YVLA 2X3BA 5JUEH 1S9YA 4P59H 2DY2A 5J6SA 1EO8H 1NMAH 3LQMA 3OZKA 4HKBB 1AYRA 2H7WA 1M3JA 1YNLL 1RJLB 3CVIL 4CW1A 2R0WL 3AXIA 1ZHBA 1HEHC 2QDWA 2YWYA 4WKZB 2F1EA 2IOMA 4LNRB 4UOZA 5IQ9A 5C92A 1T3FA 2ETWA 2AXWA 3C6SB 2DZEA 2HKFH 2EADA 3DUSA 3N42F 4IOFC 4WUUE 2ROXA 2FNWA 2YAEA 5F7UA 1P4BH 3B9KA 4HJSA 5FYKU 2JMRA 4BFEA 3X3GH 1YEDB 5DD1H 2AMGA 2ITFA 2OYMA 4GJTB 1FA4A 3ETTA 4U6VL 2Q8AL 3SDAB 4NZUH 3DIVA 1H6TA 2BSTA 5I1KH 2VLKB 2YR3A 3TEUA 2J25A 2YRBA 4EI5D 4IBLT 1OD7A 2JELH 4HWZA 3BISA 1D5MA 5LAPA 3MJGX 3HZ3A 1D6EB 1MEXL 4HOWA 2WQRA 1DCEA 4YE4L 4PB0H 2XPGA 2MKLC 2B1AL 3UTQA 1R46A 3FUEA 3HPJA 3JZYA 3PWUA 1F4HA 4P2YA 5EZIL 1KEGL 5LBGA 3VXTA 4DW2L 4ZMAT 1A64A 5C0FA 3IMVA 3M86A 2I26N 1M4KA 2XBTA 1MAMH 4MASA 5CHNB 4PRHD 4HZLA 5E56A 4JAMB 4DP8X 4LLDB 3AB0B 4XVTL 1CICA 1Z3GL 1DBKH 2GPZA 4LSVL 3L08A 2RIKA 2XQYG 3CHOA 2XFXA 3WEXA 1FZMB 2Z7ZA 2J2ZA 2XBDA 3CH8A 1FJ1A 3ELAT 4X6CA 3SE4C 1BFOB 3RNKA 2EDWA 3E8UH 3AU1B 3CLFL 4BFIA 1VADA 2F58L 4OD3H 4V1DE 1F18A 4NNPL 2VLRE 1FSKC 1K4DA 5GPRA 4F57L 3MTRA 5DQDH 5F7FA 5BRQA 4J3SA 1HVXA 5KTEL 2QADC 5EU7C 1MCPH 1UB5A 4UV4L 2OULB 1EO5A 3SQBA 2QZ5A 1BJ1J 3GSNH 1DJWA 4W1TA 1MFDH 4HT1L 3RA7H 5CJQL 4UF7C 3T3PE 2VSMB 5D7EA 5EHFA 2ZUWA 2AJSL 1R3LA 4OZIB 2BMKB 1G5GA 1GPOL 1TJGH 2BVQA 4OSUL 3QGVA 3K1DA 3RVUC 3F6LA 4GSDL 2VR8A 5FFLA 4ZI8A 1HIML 4U6HA 4KMTL 5LGJB 1SMAA 3O2WH 1HJBC 3Q8BA 4NKOA 4RGMB 1UXMA 5LCVH 5B39A 1E30A 1YYLL 3MRGA 1O6SA 1ZSDA 4IRSB 5FGBA 4YHNB 2IPUK 3VGEA 3SODB 1W0YT 3MV7A 3EH1A 4P2OB 5F7LB 1OM3H 2ZSWB 5ABZA 5FYJE 1G7PB 1FFOB 2FX7L 5DD5H 1J05A 1YMMD 4Z7NE 2CHNA 1C16B 1WICA 2GHZA 3D25B 1J0YA 2XN9E 1FF5A 1I1YB 2AK1L 5G4NA 3G5VA 2RALA 1THCA 2OMWB 1G0DA 3CLEH 4DETA 3VD2A 2HJFA 4FE9A 5DZ9A 2D0HA 2ADGB 2G9HA 5J0BA 4YHKL 3P0GB 1N4XH 3C5ZA 4R7DA 3FH8A 4NNXB 4A37A 3PHSA 3QIBA 3SB3A 5AYTA 4PS7A 1IBZA 2J5WA 4AG4H 4K23H 1VLXA 2ZKXA 4FQ1L 4LU5L 3U79A 2J8UB 3HNVL 1S3KL 2Y25A 4F80A 2Q20A 2F19H 4L3CA 1ZVNA 2EDMA 3S9DB 4X7TB 3SDXA 4ODVL 1ACZA 3GC3A 3W39A 4N24A 4ANKA 1TVBA 3QEQB 4YDIL 1DJHA 1NEUA 3VXQA 3R19A 4KK9D 1S7QA 4DGIH 3CQQA 4YQXH 3UTSD 4H40A 4GIOA 3DX2A 3LB6C 4Y2DB 4FQPA 1HSAB 5EPMA 5DK0B 4GP4B 2JB6A 1VIWA 4OM0H 3UAJD 4A6YH 4BFFA 3RQ3A 4KAQH 4WCYH 5ERWA 5M7QA 4XBPA 1BBJA 4XP9H 4BE5A 2UXFA 2P8MA 4UNIA 3R4RA 5GGTH 2XTSA 1E7UA 2ATKB 5L2KB 3ARBC 1GKEA 4ZS7H 3VG9C 2IPUG 5IQLA 3HHMA 1A0QH 5L6YL 1T04B 1GOGA 3IMSA 1J8RA 3GB7A 3FO9A 4PLNC 4XC3H 5JO5A 2EACA 2JI3A 2J5LB 4JFPA 1PG7H 4NKDB 4FI8A 1SOKA 3MBEA 5JOPD 5E2TL 3E3QE 1DDHA 1QSEB 4MSWA 2JXMB 3NFPA 5GJTH 2QPEB 3BP6B 1SF3A 2UUDH 1O5PA 4OZGB 5D2LE 5E1HB 4N6RA 2FE0A 2XWJB 4XP1H 1ACYH 1FVEA 5FGRA 4MHHG 5CCJA 2YPVA 3SGEI 1JMXA 2UY7B 1RHHA 1OPGL 4JHUA 1AYOA 1KENH 3WIHA 4B6ZA 5LDSA 3SKMB 3GSVA 4ACTA 5BZDA 3P2TA 3WJJC 3KWWB 4E9RA 1HDMB 2ODHA 3K3QA 3QR0A 2ZE0A 5L4JA 1OSPL 1YN6A 3TT3H 1XTLA 2C9SA 4NEHB 3BQUA 4RAUB 4GBXC 5ADOH 5CJXA 4X6EA 3F12A 4H2CA 2BWIA 3MV01 3ML9A 4NJAH 3JTSB 4ZPTA 2IV8A 4MVBD 3UTTE 3UPCA 1T83C 1KGJA 1MFCH 1ZDQA 1VCAA 4JPQA 3ISRA 4WNSA 4NCC2 4NIYE 4QXUH 25C8L 8FABB 1WHOA 1DUYA 3IYLW 3L1OL 3RGHA 4WFEE 4U4BA 2WB1A 4MDIA 1GYUA 3KXFA 4PJXE 1J8SA 1W15A 4EQ3A 4OCNC 4APQA 1MHHA 3EHBD 1RJYA 3FZUC 4H0LC 5B8CC 1W72L 2OL3B 4FA6A 2DM2A 4M5ZH 3FFCA 4PGBA 2TSBA 3NIFB 5IVXB 2JB5L 3S98A 3UADA 5C0GB 1A6TA 4ODHH 2VWEE 2X4TB 1KN2L 2PPFA 4FL4B 4M7JL 4KQ0A 5L8LB 1JE6A 3L3HA 4HGWB 1ZTXH 2XQBH 2VDOL 3ESOA 4KXCA 2GJJA 4H5SA 3EF7A 3N2JA 4OAWB 2BHUA 2AC0A 1LLAA 1G7JB 1JXGA 2XXCB 5CWSA 3U0PB 5E70A 2PYEA 5AZEL 1NANI 1ETA1 1TFHA 4K5NA 3UO1L 1MRFL 4AGOA 4K3DL 1I8LC 3UPAA 5DD3H 2WO2B 3OLDA 3S8WA 4KMQA 5CILH 5D7JD 4GG6E 3S5ZA 4NQSA 3SE9L 3T4YB 3HI6H 3C5SB 4YWGL 3VYOA 2OZ4H 2IV9A 2IG2H 2P24A 3HI5L 5JHMA 3LIZL 2J6EA 3BKCL 2VIRA 1Q9WA 5LG6A 4M9PA 5J5EA 2GKIA 3ABMB 4HUXA 2D7OA 4JB9H 3TBWA 2EIDA 5C0CA 5JHLA 3HHSB 4O58H 1UWEH 5E6YA 1CDUA 3T6XA 4NOBA 3WFDL 1YEHH 1YYCA 4FQXC 2VRKA 4G6AC 4Y1SA 3BO8B 1AZBA 2DQDH 1J86A 5HHNB 4NRXB 2KZ1B 4GXUM 4YSOA 4Z76A 2CALA 4B9PA 4JL2A 4A2GA 2CM5A 4AZ8A 1A1OB 1JGDA 2CDGB 3K6SB 2ORBL 1RXLA 5C3TA 1VZGA 2J1KA 3RDTB 3GTTA 1QWUA 4LVOB 1EX0A 4JFYA 4L4TB 4RDQG 3ZZQA 4WW2C 4MAUL 1KBPA 4WI5A 1JGIA 3ULUE 4JMNA 4NZDA 5B3JF 4E68A 3IPFA 1T4KB 1GGCL 2LAGB 1HXYB 2R29L 4NO5A 3RFZA 2ENSA 4PJBB 5CMAB 3W9DA 2QLVB 4CU7A 5A1AA 5IW1A 3GZOA 3M17A 3FPXA 2EXSA 4Z3HA 3H56A 4IBZA 4G1MB 4TVPL 1CFQA 1UWYA 1QBML 2BH0A 2EDQA 1ZLWK 2A3TA 5AW1B 5GGRY 5IB2A 4MMXC 2OCJA 5E00A 5CXPA 3FUFA 2X4SA 3WBDA 3WEOA 3D51A 5DQJB 1PAMA 1I8IA 3CDGA 1BAFL 4G9DB 4C58B 1JF1A 3S34H 4W6YB 2VMEA 4OFYA 4AXWA 4DOHB 4Y9FA 2ICWB 1KFGA 5E94A 1CL7H 2EVJA 1URZA 1QW8A 5AVZB 3LXCA 4P2RE 1MIEH 4BCYA 2PCXA 2XQYA 7FABH 4AM0Q 1AANA 2DOCA 1ET8A 3MLXL 4GRWF 2QQNH 4AV4A 2AXFB 3WJMB 4MMYA 4EDWL 1PJ9A 2YPKA 3GXNA 1OAZL 4X5RA 5FB8A 4GKLA 1Z66A 3IKCA 4NXSA 4WUUA 1I3RB 3BPCB 4AVIA 5IHUL 3FQYA 2VQTA 3PL6A 1F1GA 4KXZI 2VGLM 5AWNL 5BVJA 1TJIH 5HYSG 1U2YA 3REWB 1G1CA 5HXMA 4R4FL 4XRCB 2B20A 5TDNA 5D7LE 4R3SB 4Z7QF 3L5IA 3QCTL 4TSAH 1M7UA 2ISDA 3DGGA 4PRPB 2JNZA 2NW2B 1IUZA 2UX6A 4N3UA 4G1EA 5EF0A 1F00I 4JCWA 1IEBA 4JKWA 3CSGA 2HCZX 1OAKL 3LY6A 1IM3D 1BGXH 3ZKXB 1X4XA 1IAMA 1R47A 2CG9X 1XV8A 2KERA 3F7VA 2XA8L 4TQIA 3FU5A 4RA3A 4CKVX 4K71B 2CLVA 1GS6X 4CVZA 1CLZH 3HPLB 4RQQA 2UXGA 5F2FA 2HKHL 4KRLB 2ADFH 4JFFB 5JQ6L 4QHLA 2EH7L 1JERA 2Z93A 3ESMA 1N5YL 1HYSD 2Z92B 3E6FA 4V1DA 3ZT6A 3M1CA 3RGVC 4F7TB 2FNBA 4O00A 5C09D 3KPOB 3HZVA 4S0TD 3LHPL 3K46A 4YAQA 1L9TA 4I1PA 4KZDL 2QV2A 1GZHA 3MUJA 4JFSA 2OL3H 3DJSA 4S10A 3E9UA 5E6UB 5BZWB 3L4CA 3EDJA 4FLRA 3KYAA 4YC2B 1ZKAA 2FB4L 5C0RH 1QLFB 4N2HA 5E23A 1VPOL 1MZZA 3MKKA 4M48L 5PAZA 1MHCA 3OKNA 4BINA 1ZV2A 4KDTC 1JGUL 2CNZA 1IJNA 3T0EC 3KCPA 3IU3B 4IBSA 3BDXA 4FHKA 4XB3A 3KDMB 1NGPL 3N43F 5E6ID 3CFEA 3MNZB 5GRWA 1JVOA 1PL3A 1DVUA 3LN5A 3MFFB 4ZG1A 2LHAA 2P3YA 2D4DA 2NUTA 1KGXA 1NFDE 3IJ7A 4I1NB 5KS9E 3LKSB 4GS7C 1ADWA 1LO5B 4DEWA 2CJTA 1ETB1 2M2DA 1NAML 4GXFA 4ENED 5KVGH 4HUNB 5KBMA 1QZNA 2XN9A 2BFVL 4R7NA 3K8KA 4G43A 5F6HI 2X4OA 3O6FD 5EFIA 4ZTPL 1OVZA 2BCKA 3UYPA 3MUHL 4P2QE 4FQ2L 1P4LA 4I0KA 2NY5L 1X6NA 5HSFA 1QSFB 2I85A 3QEUB 5E99H 5T33H 2QGEA 1U0QA 4N0YH 4UTAL 3D06A 3IRCA 1KB9J 5B21A 3QIWB 3U83A 5J9PA 4XNYH 2Q2LA 2D0GA 3SQOH 3FYIB 1KBWA 2PTUA 1AZRA 4JMXA 3T4AB 4JE4B 3IM1A 4DVBA 1BPLB 3TV3L 3GS4A 2UY6A 5DVPA 4F24A 4EZLA 4QNPF 3RTQA 3VSQA 3V6OE 5T5NF 3H0TB 4MJ6A 4W93A 2JH2A 3U82B 2KDYA 1MJ8L 3PS6A 1IC7H 1NLDH 3HG2A 5KBNC 4I18C 1BQSA 2Y07L 1L3WA 1MCWM 2OYLA 2PLTA 5GS0H 1V54B 1AR1B 4RMSA 2DWDA 5CINL 1X5KA 2I07B 5BQDA 1H9DA 2FR4B 2ZT9C 2DV6A 3MRLB 4P2AA 3ME0B 1KCSH 4X99A 2BSRB 3QYCA 4LIQH 4PVBA 3VFPA 2GAZB 2CUMA 5BV7L 3L9BA 3L9EA 5HYEA 1ETZA 1RL1A 4NQEA 4XZ4A 2X9ZA 4BK4A 5HPMB 2JF1A 5CEYA 3TYFA 5CGYC 2B0SH 3GTNA 4B5EA 5JW4Q 1OKEA 5A16B 2ARJA 2XZQH 1EZVX 2K6YA 3MR9B 1SQ2N 1I3GL 1JVKA 3QZNA 3U46A 2O5ZL 4OLVL 4QYOA 1WBXB 3UYRL 5ILTH 1L5GA 1Z9SA 3QUHA 4JUSA 3OAUH 3MLUH 3QORB 1WV7T 2YA1A 3DBXA 4M1CD 4ZFFB 3IJHB 1WZLA 1M2OA 2GJ6A 1P7KB 4YPGB 1AGFB 1SN2A 4KK6D 35C8H 1CPUA 3DPBA 5D2LB 4JLRA 3DYPA 1MVYA 4ODBD 1O9ZA 1TKWA 3MSPA 2DYPD 1SEQH 2XWBB 3MV8A 3QQXA 4JO4H 5DSCB 1TO5A 3RY4A 1MRDL 2C7UA 5J3HD 4TSCL 5E1IA 3LKOB 4ZFOA 4XVJL 5FA4B 2VMJA 4GAJL 4UOW0 3JWOC 2X4UB 1P2CB 1CD9B 3DX3A 3ZO9A 2B16A 2AW2A 4LCIL 4RFOL 5DZLA 4JHWL 4YBQD 4BWTA 4MDRA 3FONA 3NCMA 4FQJH 4KRPC 4BDVB 4Y5VA 4LKCB 1NCOA 1Y6KR 3ARPA 3ZTJH 4KGLA 4DVRL 5I6NA 3FT4A 1H19A 4GKZA 4FGMA 1HILB 2ZXEB 4ODWB 4WV1A 3MROA 2HUEA 4LQFL 5FWRA 3UTTA 5CN2A 1ROCA 4NIKB 1V3MA 1LQBC 4XP6H 1EQWA 2R0KH 2IAMC 1FFPA 4ZUSA 2CLRA 3MDJA 4C54A 3O4LE 4P4KC 4ZO9A 1VENA 2O4EA 2NY4C 5F9OH 4CNIB 1GS8A 4MD0A 2CHXA 3BWZA 1L7TH 5LXVA 1F3DJ 3T0AA 3ROOB 5L2JB 3PDOA 3OF6A 1ZT7B 3ULSB 1S46A 3NUKA 2B5IB 3LRSB 3N40F 1XCXA 4H8UA 1D2PA 1USQA 3VGBA 5E4AA 2UVFA 1Y18A 2DIEA 4ICWA 3UACA 1XF4A 4NXKA 3V5HA 4DGYH 4DUVA 3QZBA 5JHDA 3P73B 3CGTA 3HE7D 1IRAY 1LQSR 2BIIA 1WT5C 1IZKA 3D30A 5F1IA 3BAIA 1A4JA 5CBEA 4X9IA 1JAEA 4WAFA 3FTXA 1XXFC 4GG6A 4PUBL 2CUAA 4PG2C 1YA5A 2FIRT 3SJVE 1QLRA 3TL5A 4Z0XB 5IFJB 2W0PA 5DJXB 1TMCB 4TNVK 5F9AC 1AGEB 3B2UD 4Z18A 5BXFB 4Z6AT 3LKNA 4GRLB 2OR7A 1K5NB 3FQTB 4OZFG 4Q2ZB 3QDJE 2N7AA 4AYDC 3CFKA 4PRIE 5LWYL 3QPQD 4WHCA 4EI6B 3WUZA 4AK2A 5DR5L 2C9VA 2FL5B 4AWJC 1Z5HA 4OLWH 5EOQH 5IBUB 3UTPD 2TRHA 4BCZA 5C0JA 2HAZA 1HHIA 2IBBA 3OL2A 4NKMB 5D6DC 3IJEA 1JDAA 2NCEA 3SO3C 1BSIA 1H9VA 2KQMA 2XZAH 4WWKB 2AXGA 3TPKA 3WIFB 2PPEA 1ZSHA 2VLLA 1T0NB 1DVZA 1EFXA 2ZUQB 2Y2YA 3EO9H 1RZQA 4Z7UB 4FTVB 1ORQA 1KGCD 3HKZA 3VFVB 1MCSA 1O7VA 2YAFA 3MCG1 2XZCL 4TNVF 1OTUD 3OJVC 4QRUA 1U8OB 1S8DB 4UT9A 3J8F7 4Z77B 5I16A 4UQEA 1N8ZA 3DYMA 1ZY9A 3Q6GL 4JZJC 4RVBA 1RSYA 4Y2OA 1DQQB 4PCKA 5CBAB 1OGAD 2VN6A 4KVNH 4XNXL 1VESA 3V4PA 2D8KA 4LLUB 4YVUA 2NYYD 2WXFA 4LMQE 4NGHL 4WWPA 1CIDA 3CZLA 1IEHA 3O41A 5JW4R 4CRPA 3UTOA 3TVMA 4X4YB 4MS6A 3ESUF 1BM3L 2IQ9L 5JUEL 1YYML 4P59L 1HQ4A 5DJCA 4EIGB 2JVUA 1NMAL 3W11D 5E8PB 2WLLA 4KKLD 2Y5QA 3D3VE 2BIMA 3S5LB 3FOLB 5C9KA 3Q05A 2YC1A 3V5DB 3WLWD 2HYMA 3G5YB 3GZPA 3HBZA 2NXZC 4ETYA 4ISVA 5AL0A 4BEIA 5FYKD 2XWEA 3F7YB 4LVHC 2YFOA 4P2RA 1RUAH 2CRZA 1P4BL 4R2GC 2XTJC 4UQBA 3IE9A 1BQRA 1G94A 1LK3L 2HRPH 4LCUB 5DD1L 4XPGL 2JLLA 1KN4H 2N01B 4OGYL 4NZUL 4LNVA 2VN5A 5EU4B 5C0AD 1G6RH 1Q9LB 5I6XC 3MN8A 1A3ZA 2NDFA 5I1KL 1TCMA 1XGPA 4NN7C 4TUKH 4O51B 3PWJA 5KSAD 1AKJB 3N06B 4GFTB 1XR8B 2YZ1A 3II2A 3WV0A 1JZ3A 4YHYC 1M2VB 2E7HA 4BQ6A 3TJPA 1K85A 5DO2D 3DX7B 3ZDXB 2VRQA 2XSKA 3FKUS 4HIPA 4ZUUA 3MCKB 3SBWC 1MAML 3IBOA 2CNYA 2W95A 4NN5B 3M88A 4R4NC 1IM9A 2CCVA 1I1CA 2E4TA 4XBEH 3L81A 3DX9B 1BA9A 4KK5C 5EORH 4QRRE 3ML8A 1OAXH 3RILA 1NFKA 3GXUB 2LLLA 3L2NA 3QDME 1SJXA 1Z3RA 5DC0A 3E8UL 2E9JA 5ISZA 4TOYL 3LNFA 3IPEA 4URKA 2PCPB 5C08B 4OD3L 3R8BB 2EH8L 5C0ND 5I5MA 4NP9A 2BP3A 4U6YB 5DQDL 1PG7W 4AGMA 1CFTB 1CIUA 4Z7VE 3QI9B 4BFJA 2WIIB 4BGLA 1R5IA 1VGEH 3SGKA 1H3PL 2PO6D 3VWKB 3NG5A 2CO6B 2NRDA 4HSCX 3GSNL 2X6UA 5EUOA 1MFDL 3DHJA 4BZ2H 1VZHA 4Y4HD 5EEYA 1OTTC 3VRJB 4NYLB 5TE6H 5FFOA 1D5IH 4UQ3B 1TJGL 1MW3A 1QD0A 5DMYA 5D1XC 5INDA 4K4KA 1XF5B 1Z0MA 2AV1B 3B5TA 3HRZC 3E2HB 4XP4H 1PDKB 1U3HA 4Q9BA 3O2WL 3PGCA 2IAMD 5D6CB 4X4MA 5LCVL 4B9CA 3CBRA 3D09A 2IO5A 4MNGB 5TDOA 3VDBA 3OQRA <