4AYFB

Crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the tyr40ala mutation in the caf1m chaperone
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
136
structure length
122
Chain Sequence
VEPARITLTYKEGAPITIIDTELLVGTLTLGGYKTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKFDISPKVNGENLVDVVLATGSQDFFVRSIGSKGGLAAGKYTDAVTVTVSNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Chaperone/antigen
molecule keywords CHAPERONE PROTEIN CAF1M
total genus 23
structure length 122
sequence length 136
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ayfB00
3DOSB 1Z9SB 1P5UC 1P5VB 4B0MB 3DPBB 1P5UB 4AZ8B 3DSNB 4AYFB
chains in the Genus database with same CATH superfamily
3CDGB 3J2PA 1MQKH 2R4RH 4R7XA 3F7RA 4GO8A 3FZUC 1G43A 2APTA 2AZAA 1TNMA 4LCYB 3HG2A 4BH8A 3D2UD 3EAKA 2R2CA 3LH2L 5DWUL 5FIEA 1O6VA 4R8WH 1KTDB 2GHWB 2ICWJ 1I9RH 3F7LA 3X1NA 3UTSB 2EDEA 4UYQA 3NA9L 5CR1A 3IFNL 4YOKA 1E9OB 1SY6L 3PIQB 1QHOA 5E1AB 2ZG2A 3JVFC 4WHYG 4PLOB 4U3XA 3BHBA 2YK1L 4OZHE 4LO9A 5B8CA 1YEKL 4XXCC 2I5YH 1RLBA 5EIIG 4PUBH 2Z4QB 4RA3A 5FO7B 2CBTA 5FLVA 2IJ0C 2L3BA 4G6FD 4GYBA 5C9JA 1CC3A 2YD5A 4FNTA 1YQVL 2AJYH 1GGUA 3GHEL 3BGAA 4XMVA 4EPSA 5DJXA 1ASPA 3S4SA 3DYOA 5E1GA 3VXQB 2EC9U 1GZHC 2XTJE 2P80D 2IGLA 4GRWH 4DO6A 2IAAC 4U1NB 5DCCA 2IV8A 2XTLA 5DK3A 2KZWA 3HS0B 1PLGL 2X1WL 4YLCA 3IBEA 1JMZA 5GJSL 1JPFA 2K6ZA 4OZGA 5AW2B 1LP9E 4WEBH 4YBLC 4TNGA 1MAJA 1XBDA 2W60A 5C0RH 2PCXA 3LMJL 4WCYH 3IRZA 1LYQA 5HDBF 3SZKC 1MFDL 1AKJD 1KTJA 4I4WB 1LD9B 5CEXA 3O3BB 2VWEE 2XJLA 3IMBA 3BSHA 4TNWF 4XBGA 3V7AG 2R29H 3QQ4B 4FA8A 2FWUA 1D7CA 2JTYA 4I2XB 4PJXE 4P2OA 4KBPA 5HI4C 3QEQA 4FRWA 5AUMA 1JZ2A 1HXMA 3MV7E 5L6YH 1KIUA 1O5DT 3PAYA 3FF7A 4L9LA 1QR1A 5E8EB 1F1GA 1R75A 2P5WA 2XRAL 4CSZA 3IDYB 3AS3A 1VF5C 4QRSA 2GJ6B 4Z7OB 1TNNA 1YZZA 1EEYB 2X4PA 3EGSB 4Z78A 3NOIA 1T0NB 5E2UH 5BMFH 3VRLE 4YSUA 4KK9D 2R4SH 3KL0A 2UXTA 4A6YB 3LD8B 4YHKH 1FYTE 3J7HA 4ELMA 5AVVB 3JV0A 3QWRA 1J8HA 1N5AB 2F53A 2W5PA 4FX5A 1FH5H 3KYKL 3CLEL 1KB9K 1U21A 5IF0B 5HGBB 1QR1B 5GZNC 3HBGA 1ZHNB 5H94B 3VWKB 2ADFH 4PJDB 5I8EB 2EEDA 1R24A 3HR6A 4OZGF 4AW7A 3GBEA 1V10A 1S46A 1VZGA 3QXVA 5FYJE 1MPAL 4U1LB 2EVFA 3IFOA 1NM4A 1JZIA 2APFA 1T6WA 1Z9OA 4CSPA 4GQ9H 1JHTA 3HB3D 1GCFA 4EOWL 3LD8C 3W11D 3HUJB 5AKVA 3K81A 1PKQE 3CN1A 4HK0B 4OI9A 4X2UA 2F61A 5ICUA 3T3PB 4ZQTA 5HHOB 1TQWA 1KYOJ 3O3DA 4CDHA 1PY4A 2Y7MA 4XNUH 4GQZA 1XVSA 2HRLA 4DP6X 1I7UA 1B6UA 4D0BA 3APCA 3ZSSA 5LGKA 1NM9A 2CA3A 2ESVB 3F7KA 4U1NA 3CZUB 3FB5B 4XMZA 3WNNA 3DXAD 1B0WA 4HV8A 5EZJA 4PJ8C 3GBML 4F93B 3ARGA 5L7XH 3L17A 2GIMA 1SHSA 1VFAA 2Z7ZA 1Q9KB 1ZT7B 4PGZA 1ZDSA 3PP3H 4MMZA 4PN6A 3IDNB 3NCYP 2VZSA 4MCNA 2WQSA 2HSIA 1J7VR 1CLYH 3FOMA 4F5CA 4IBTA 4JRYA 1JF5A 3QJXA 4NC0B 1T0MB 3IK2A 2P5ED 2WCGA 1BVZA 5EWIL 2J8UB 4HS8H 3VXOA 4CSSA 2JJTA 3DMMB 4NBXB 2XV3A 4PJ8D 4P5SA 1FDLL 4OCRL 1ID2A 1LWJA 3DNKA 3AABA 3CVDA 4HK3J 3ZL4L 1HZHH 2ZWYA 1IGML 2D2OA 1GY2A 5DUMH 2CQVA 5A3IC 1P9MA 4OD1H 2WWOA 3UTSA 3GHPA 4PJDF 4F37F 1PKQB 3WDJA 4GEJA 1PFCA 3QAZC 2VC2L 1SYSB 3QPXL 5EEYA 1YEDB 3C6EA 1I7ZB 4GW5A 2GUOA 3HFMH 5ADOH 4K5MA 3WBDA 4YAQA 1BG1A 4N2LA 1H9VA 4RFOH 4L0ZA 3HMXL 3K1KC 3NZSA 3GZOA 3NAAL 5HI4D 3VXNA 2IXQA 2XN9E 3EFOB 2BXZA 2VLKE 4LF3A 4FMKA 4KWUA 1T1WB 1A6AA 1B0IA 1OARL 2J1XA 3EYQC 2BSCA 5IMKB 5GZOD 1MVFA 1GVIA 5MENB 1AO7E 1MZYA 2EP6A 1OTUD 1DSYA 2QVFB 5D4JA 2JKLA 2WVVB 3O6FA 4PY8I 3SBRA 1SLWA 4G1EB 4NAQA 5BUPA 3ULUH 3FHQA 3B9KA 3KH3A 4PTTA 5JNYA 4YHPB 1FYTA 1JNJA 2WXOA 1NGQL 4MLSA 1DDHA 2HLFC 4WEEA 3RPKA 5I8OH 4YPGA 1ZMYA 5E2VH 5K39A 3T2OA 4OUUB 1TFPA 3CN4A 5LXGH 1DVZA 1G6VK 2KH2B 2Y23A 5FYJL 1ZHBA 3KS0H 4Y2DC 3ETSA 1J8RA 1P53A 4BK5A 2O5YH 5EOTB 3RZWA 4Z77B 2BWQA 1VEOA 4WEMB 2B5IC 4LMQE 3O4LB 3OMZA 4UDTA 3GMPA 3FHEA 1FUNA 1IBDA 1IZKA 3INOA 4BUGA 3IJ9A 3TF4A 1XBRA 2AJSH 4H1LH 1U3HC 1LP9B 3QDGE 3TT1L 5JDSB 2ZAHA 4XCEB 1DQTA 3UJTH 4LQFH 4XO5A 4YDLC 5FF6B 1YO4A 5DHYB 2KUTA 4OZHA 2EYTB 4MAYA 5ACMA 3NIFF 4JHAL 4KQ3L 3DDFA 4CMHB 2YD4A 5T3XH 2QEJA 3V4VL 4YC2C 3TBYB 2GAZA 3WO3B 4ZOEA 5DT1L 2FLBT 2PWEA 4HKBB 4K7PY 3RE0A 1ORSA 1PDKB 2EDFA 2Y7OA 3BQUB 5G4MA 5J9PA 1KB5L 4UAOB 4BHUA 2E8YA 2B39A 2GK0A 3B2PA 3GZKA 2ADIB 1TETH 3PXHA 3L4XA 2A9NH 1S5IH 1MF2L 1XH3B 1GZHA 3BI9X 1OAJA 3UJJL 2F53B 4LGRB 2DW5A 2FJHB 4XVSL 1H8LA 3MZTA 4NQCB 1YC7A 4FJ6A 1QLEH 2X2UA 3S8FB 5D1XE 2BZ7A 2GYSA 3NPSC 4X9YA 3UAFA 1UKTA 3DUSB 2DLFL 4N6RB 2NY5H 1AMYA 4DUVA 1OAUL 5IBLC 4AW4A 1JRHL 3K8LA 5I15H 4CVUA 4IKIA 4G8EB 4NO5B 3WGVB 4OQTA 1CGWA 12E8H 3VYPA 4G9FE 5A2AA 4I48B 3DXAA 4HUKB 3B6SA 4K3EH 4HPOL 3NUKA 4K9EL 4KH2A 2EXSA 1AZBA 3Q2VA 1I9JH 4YBQC 4Y88A 4M6MH 3NSJA 5AVXB 3BH9B 4UIKH 3I9AA 3CFNA 2NX5D 3VFPB 3GXIA 5I30H 3C08H 5E00B 2E56A 5LAXA 1KJ2A 4QY8A 5JQHC 1BQRA 4HDIB 1X5JA 2OL3B 3FCGA 4DH2A 4M4PA 3LQAL 4QLRA 4NKIH 1F4YL 1TQCB 3QQDB 2VYRE 4ODTL 3P4NA 2F53D 4U1KB 4UMGA 5ESAA 3CD4A 3CMOH 4OBSA 1V8HA 3D39E 1VEPA 3LH2H 2OZNA 3ARVA 4GSDH 4XO8A 5DS1A 5DWUH 3ZL1A 2A77L 3HKZA 3NCMA 4PJBE 1E7VA 1R3JA 2EJ1A 1MFUA 4X0KB 1UD3A 3UGUA 3VFPA 3KXFD 4ES9A 1WS8A 1PIFA 2GJJA 2AV7B 3O9WC 5TDOB 1MCWW 4OFIA 3ULUE 2D9CA 3CG8A 5ADOL 1T5XA 3PU7A 1SVBA 1G7JB 2X9YA 4B7LA 3HHRB 3WUWA 2P5WE 3TO2A 3UC2A 4Z7WB 3L2NA 5L4MA 4A7VA 4PRHD 3NSXA 4KKAD 4WKZA 5CINL 3TESA 5C0RL 2Z92A 1JTOA 2F74B 3FOLA 2EDDA 4GFXA 2MCPH 2HX7A 4GSUA 4MJIA 4QTFA 3ZT6A 4S0TD 5JIPA 1S7QA 1KBGH 1X9QA 3DX8A 5HYSB 1EHLH 5CP3H 2IQ9H 4Y9BA 3ZBMA 3O9WD 5I1AA 4JRYD 4MDJA 3CLFL 3QA3B 1SYVA 2CO4A 2LT9A 3BDBA 2IXQB 4ZQKB 4AV0A 2R2HB 1TQBB 3CDGA 3SY0A 3M1BA 1HVXA 3NJHA 4PS4H 2X6CA 2VITB 4MX7A 2X89D 3VWKD 3D33A 4X8CA 2K70A 5I26A 3GZQA 2PXYD 2J25A 4IJ3B 4LSPL 2Q2LA 4HHWA 4WLCA 2YSSA 1T4WA 1AACA 1D6EB 1P1VA 3KYAA 2DMHA 2JK5B 4P49A 2KERA 3HEIB 3IDGB 1WV7T 2ZWZA 4BFBD 1ASQA 5C7XH 1JN6A 2FUTA 3WHXB 4I4WA 2HTLD 3OD3A 3QYNA 4NKMA 4IOIB 2KC0A 4PHXA 2HFGH 4JW3A 2H47C 4KZEL 1YY8B 4MD4B 1KEGH 1UVQB 4PWGA 4M9OA 4Q14A 1BOYA 3TEWA 5H4YA 1CDUA 2O4EA 4M61A 5DJDA 3TT3L 3TBTB 4Z7OF 5AW8B 1T22B 4M29A 4P4KC 2WQXA 2HKHL 4BHUI 5E1HB 2HB0A 5DQJB 4MB4A 4FFZL 1B2YA 4P06A 2QGCA 4PGCB 3LHAA 1TVHA 3GMMA 1MHHB 3O4LE 1IM9A 1O0VA 4N2FA 5K59F 3TF7C 1MAML 4G8GD 1W0VA 2H6UA 2FQGA 2R0WL 1QBLL 2CUAA 4BSVB 4N9GA 3FU8A 4K94C 2DTSA 2CRIA 3THMH 2NY2D 4ZTEA 3V55A 1FL3A 4PG9A 1KCLA 2Y5QA 2YN3A 3A23A 3BGMB 5EO0B 1HEJC 1U8LB 2IPKB 2J56A 2ADFL 2XXGA 1ND0B 5ERWA 3LRMA 1NDGA 2VSKB 3QI9B 1T2XA 3D30A 3KLLA 2C8NA 2EXWD 5I16B 4PEEA 3S34H 3C5ZD 4U3SB 3V0VA 1X7QB 1CLCA 2RQ8A 3H85A 4BQCA 5AAPA 2YPKA 4H20H 1IBHA 4M1CC 5HHME 4B5ZA 4ZMAT 2CUIA 2IOIA 2IGFH 2RA1A 3SGJA 4YXKH 4KROD 1HCVA 2BVUA 5ANMA 3WG7B 3HAEH 4Y4HA 4P5TD 3UTTA 4XNZC 4XVJL 2Y2WA 2X3AA 5KVMC 3US0A 3X1BA 2DIBA 2X40A 3GEWB 1OT4A 1X5AA 1ZS8B 3EJJX 4F9LA 3LXAA 3RZCC 3NTCL 2CCLA 1FFOA 2PP7A 4QRPB 3QFJA 4LNRA 5LWYL 1ID5I 1YYLH 4G7QB 4HUVB 4BZ2H 4AGLA 3G5VB 1OPGL 1ILSA 2ZT9C 3KPQA 1S9KC 3O0RH 3SQBB 3DJZA 1M53A 4A7UA 1QSEB 3DX8B 4HEME 5BQDA 1EGJH 4G72B 3DRQA 2DIJA 3GGWA 5TF0A 3B5GA 2APWA 1YEFH 1HNYA 4BUHA 3RDTD 1UWFA 1WE5A 2QPSA 4QRSB 1LE5B 3OLGA 2WTRB 3V5DA 4DW2L 5E2WH 2BVOA 3KDMA 3B37A 4P9MH 3N5AA 2AEQH 2R9HD 2UUDK 3FFOA 3IN0A 4NQVB 5IJVA 2H1PL 4MDRA 1RZFL 3TN0A 2H41A 1H5BA 3A6CH 2Z3FA 2I07A 2VRAA 1KJVB 2A77H 2WLKA 3E80A 3MV11 3QJUB 4MNHB 4QI3A 4YSOA 3ZUNC 3NPSB 1C08A 2EDJA 4P5TB 1MRFH 2X9WA 5MEOB 1DN0A 3BKYH 5JYMA 2FJFA 4F7CA 4M8RA 1WA1X 2VTFA 5E99H 1YVLA 2LABA 2OFQA 4GUPA 3R18A 1FO0A 3HZYA 4OZGB 2CGYA 2J44A 4GRWE 3U6XA 5A16A 1MREL 3TBSA 3CLFH 5E51A 2ZOWA 2C9XA 4CADA 1G0DA 3VFGL 3BSGA 3IJYB 1OARH 1ZOXA 2JKRM 3MR9B 3UG4A 1IGTA 1D5XB 3OKNB 3D8MA 4XPGH 4HXBH 3ULVD 3HUJA 1NQBA 4HUMB 2WWKO 1ET5A 3OMAB 4XMTA 1ZHKB 3E8UL 5GGVH 2FJFB 1PTZA 1E2WA 4NN5B 4GW4A 4DAGL 4U6XB 4BSVA 1QTSA 1ZTMA 2YZ8A 1IU1A 4FQIH 4WI9A 1GHFL 4XPFH 3WFHA 4F8LA 3I9PA 2MFNA 2AJXH 3FO0H 2Q7YB 1R33A 1NH6A 5CO1A 5EA0H 4JKNA 4POUB 2BDNL 2AEQL 3APFA 3LQMA 1K6QH 1R0AL 5D2LB 4M7KH 3ESNA 3T0AA 3PWVA 3HMXH 4LL4A 3O2DA 4AQAB 1EXHA 2RQEA 2YD2A 4L4VB 5CIPB 3T2LA 1MWAL 1O6TA 2DWYA 4TNFA 1L7TL 2DWSA 1YEKH 3FH7A 3WIHH 2PKDA 3HAEB 4Y4KC 1CFNA 4N9OB 3HOGA 2Z31A 2OMTB 5D7KD 4CJ0A 4PJXB 3HE7A 3KLDA 2FQDA 3O45B 4KKRA 5JPMB 4XP4H 5JW4Q 4IQHA 1U0QA 1S4IA 3D06A 4EAEA 5DJ2A 4K8RC 3V4VH 2EACA 2P5EE 3QQ9C 4H40A 4QT5A 5AAMC 5KOMC 4MS6A 4QTIL 4H5SB 1WFJA 1CGUA 4X4ZA 3VSUA 2NXZC 2VW4A 3TEXA 1I7ZA 3SBQA 2A73A 3QWNA 4G1MA 2PYEB 5DUBA 3JSSA 3W9DA 4DN4H 4TQPA 1J9RA 1MI5A 2QGBA 4NKDA 4EUPB 2HRPH 4X4YA 2DTML 1Y6NR 3U9UA 3QHFL 3HZKA 1JXKA 2UWEA 1H5BC 3BPCA 3Q5OA 5GGSA 5TF1H 5KSUB 1D6VH 3BVNB 1NPJA 3T2QA 5ICZA 1RZIA 3R7RA 4FHJA 3UBFA 5AOIA 5F21B 3VG0H 4FAAB 3QAZB 4YN3A 2IDUA 4DF9A 3NTCH 1A7QH 2LU7A 5DLMH 3WIAA 3ISYA 1I9JL 3AMLA 3EJZC 1I3RB 4KV5F 2FWOA 2FVNA 3L1EA 3QDJD 1JV2A 43CAB 3IKCB 1FCCA 3RVTD 3ZDXF 1FH5L 3KYKH 3PFQA 5JHLL 12E8L 2EH8H 2AHIA 3QDHA 1CD1B 5DJAB 4FC3E 4O2CB 4XCYB 1UXMA 2VL4A 5IKCA 1P7QB 4O02B 3UFIA 2BIIA 4HGWB 1OAUH 4NI6A 3FU6A 4ICWA 1HH6A 5AVWB 2W80C 3G5YB 2E7HA 4HF5H 1C5BL 4HIEA 3T8MA 4J6RH 1R34A 4LLAA 2VDRB 4DGIL 5IVXE 5JA8B 32C2B 3QVAA 1IM9D 4XMKH 3VGFA 2CMRH 4JFTA 4QTHB 1U8HB 5HJGA 1U95B 1WT5A 5SWSA 2KYIA 3DHMA 4IGBA 5LAXB 3S35L 5C0EA 3LKNA 5F7MC 4WTXA 3VXSD 4IU2B 2O30A 1S9VB 3EOTL 2HVJB 4RRPG 1BOGA 3OR6A 3CFDA 3T1FA 3RFZA 2E59A 2KKQA 2OR9L 3QO1A 4YSRA 2JELL 5GGTA 1AR1B 4AMWA 3UJIH 1XGYL 1EV2E 1OT1A 3FCUB 1A4KA 4UINL 5FUCC 4DGVH 1UCBH 4EE2A 4DPRA 3KXFA 3UTTD 3CFKB 4GKZB 4PRIA 5CINH 2X53A 4HD5A 4GUOA 4BE5A 1UZ6E 4DKFL 3CU7A 3ASOB 3RU8L 4A2LA 4PBXA 4P2QA 1FZJA 3MLVL 1E6OH 2YRPA 2VSDA 1P2CA 2LW3A 1CFNB 4P5RA 2Y06L 1UKQA 1YEJL 1IT9H 2WBWB 4JQXA 1NZRA 4AEIH 5JIDA 2BW4A 1M56B 4UQ9A 5LCVL 4NQQA 3EH2A 3OHXC 5MHSD 4URTB 5BO1L 4X6DF 4F2MB 2XPYA 2EXYD 3LKPB 3TZVD 2NYZA 2VKXA 3ETTA 4R0LB 5AZ2H 3MOAL 3ZRCC 4YK4B 4DGIH 4ZMTA 3FO9B 4UT6H 2DQGH 3H9YA 3KVDD 2QGDA 4Z23A 3QXDA 3G6JA 1YEIH 2XQBL 3VSVA 4XNQB 1NAKL 3EO0B 4C58B 3GSNB 3VG9B 3MV8B 3RPIB 1QBML 2X4QB 3K2UH 2CLRA 3GBLA 4DCQA 3O4OC 4FQ2H 1I7RA 3QEUA 3GNMH 1BJ8A 5DSCA 5EU7C 3L7EB 5CLZA 4FYTA 4YFLF 3UBHA 4A2EA 2GAZB 1NKGA 5T8IA 5FKPB 1R5WB 2DDQH 1PBYA 3OB8A 1RJLA 4IDLA 2FJSA 4JFHD 5EFIA 4AT6B 2FLMA 3SKJH 4LE8A 3X3FH 3I9IA 1GY1A 5EPMB 5TE6H 4HFWA 4KK9C 5C0ND 1JZDC 2DLIA 1OCOB 1NCJA 1MWAH 4GQQA 3X13B 4N85A 4OZFA 3O2DH 3HNTH 1PPIA 4PB0H 4XX5A 1IGMH 1KNOB 5DUML 4Y5XA 3IFNH 2QSCH 1Y1UA 4YLQT 4JZNB 2X4QA 2VN7A 1SHXA 3RURA 3L1OL 1BEXA 4OLXL 4ZTPL 1NGXB 5GGUB 1MW1A 3ESVF 4JFDB 4XNQA 3ZRFC 1P4LB 3HMWH 3TNMB 1NMCB 4DN4L 1QLEB 5IHHA 2XY1A 3Q6FB 3QXDB 4KRLB 1ZJAA 1KJVA 4GRWF 2EIMB 1A3RH 4X9IA 3OKKA 2XNAA 1GGCL 5I5MA 25C8H 4OUUA 3B9KC 4CBZA 5FW8A 1G94A 3Q1SH 3FQWB 5T5FA 4B9YA 3LIZA 3V4VA 5A7BA 3NFSH 1QW9A 3GI9L 5BW7A 5J6GB 5HHQA 1MDAA 3ZTNH 2CWRA 2J4WH 2X05A 1SXSA 5ILTH 2O6DA 1TVBB 3R1GL 2C9AA 4MNQD 4ZSOE 4E9SA 4Z78B 3L48A 4ALAC 4MS8C 4F7TB 2OI9B 4WF7A 1V3KA 3WYRA 1F3DH 4NRYA 1CG9B 3BT2L 2FGWL 1SDDA 4ZUSB 2WYZA 3GSXB 2BIOA 1YEEL 1HSBB 1OAZL 3QISA 2GSGB 3VFTB 3V6FA 1ZS8A 2Q20A 5BQ7B 4IIZA 3RY6A 5HYJA 5L2JA 4A7SA 3EJYC 3JWDL 4ANKA 1A1OB 1GJWA 3PUUA 1MJ8L 4FLHA 1KXVC 5BXFA 5B38G 4WENB 4TOYL 4QO1B 4R5XA 4G6KH 5IB1A 3LQZB 3MC0A 3PQYD 4PCSA 1GPOH 5BZWA 3OF6D 3VFOB 4BGDA 3OAWA 1KT2A 2BPBA 5C0JB 2MNWA 2PCPA 2HTLC 3HAEG 5A2IH 2A9ML 5FGRA 3QUXB 2IOOA 2NMSA 5JMOC 2JB5H 3L4VA 5BJTA 5KAQG 3FHAA 4CKQA 1KJ2L 1Q94A 4HUNB 3LIUA 4PY8J 1FNHA 2BJML 2A9AA 4NIYE 4X7FC 4X0NA 3VFVB 4Y5YB 2BSBA 1X5FA 3LQAC 2OCJA 4ELDA 4ZYKB 2E5EA 2VN3A 1CDYA 5E8NB 4HV8B 4I3SL 4CC4C 3Q44A 3MBEA 1TQUA 2DBJA 1GMIA 3D18B 5C0JA 2D7PA 4URKA 2ZAIA 1P1ZB 5CFHA 2Y72A 5CJOH 4Y5VA 1MCOL 4JFVA 1NFDA 5SX5K 2FO4B 4EUPG 4JGMA 4JKPH 2ZP0T 1MEXH 2A3TA 5ETUB 2VLJD 3QIBB 3WU1A 1T6BX 3MVSA 3KLKA 1N68A 3T0EE 1L0XA 2OSLA 4ERSL 4V11A 5DF0A 1A6ZA 5KYNA 1B9KA 5MI0C 3VXUB 4H0GA 4NNPL 3HHSB 2D7TL 4XN4A 5KG9A 4PRIB 3CFJB 3BT0A 4ODXA 3FUIA 1KYFA 3O8XA 4LSVL 3SPVA 2XIIA 3HC0A 2M8XA 1PZ3A 4JO5A 1NPNA 2GPZA 5EZPA 1G9NH 4Z76B 4NXSA 3FQRB 3JTSA 1E8WA 2HN7B 5HGBA 4QXVA 4DETA 3GMLA 1ODAA 1AGDA 4PJ7B 3ECQA 2DQFA 5FYLL 3T0ED 3L4WA 3LHPH 3VNYA 1G87A 4BFRA 5C92A 3MTRA 5FUOH 1DBAH 1TTBA 2AW2A 5FR3A 2BS71 3ARUA 1EK3A 3ZIYA 2AV1B 1EZLA 2QQNL 2WLLB 5TK4A 3QNZB 4S0SD 1KIPA 5GXBB 3U2JA 1AVAA 2H45A 4TKWA 1I82A 3B1UA 5KBPA 4ZS7H 4WI6A 3VE0A 2A4EA 1CPUA 1CI3M 1HHIA 2C5DC 1QACA 2XZQL 3HG1E 1U8LA 2X0WA 3IFLL 4UQ2B 5I1GH 4LSPH 2EUWA 4FDWA 1MIEH 3KLHC 3CXHJ 5EN2B 5C6WH 4PRID 3V7MA 3PWUA 4UT7H 1BFSA 3OKMB 5L7XL 5IMOB 2GTWA 4NKQB 3F58L 3KAAA 1JZFA 3KH4A 3GMRB 3KW7A 3QDJB 3QPXH 1ZT7A 4IJ3C 3IE4A 2HZHA 2X9XA 2HFFB 3AT0A 4E41E 4FQHA 1KNOA 3SDYH 5EV7A 5EBWA 3VD2A 3AWGA 3QEHA 5E94B 2QJDA 4RFNC 1IVTA 3B5TA 3PGCA 3SDXB 3ULSA 1E9PB 4UM9A 3DC0A 3ZKSD 4LEXL 4ODWA 2AXFA 3WEXA 5BO0D 1JK9B 5DXWA 5KJ7E 3GI8H 3ARFA 2Z93A 3D25B 3G04B 3TX4A 3M17B 4OQTL 2FEDC 1CFMA 4N2AA 4QRPD 1TTUA 4A67A 2IG2H 3K6NA 5A2JH 3EJPA 4LU5H 1G5GA 3T6QC 1KUMA 5DC0A 4W6WB 3IFOB 5TF1L 1J05A 3ZZQA 1QSED 1ZLWH 4LVNC 4NO0A 1D6EA 3OKMA 5D1XC 3C2SA 4JB9L 2M83A 5I8EA 2PTUA 5DMIH 1U2YA 1OAZH 1ZHNA 4FMVA 3NQIA 1WFMA 5IQ7L 3BDYH 3CSFA 2P4AB 1A14H 4XNBA 1W0YT 1FVCA 4MFHA 3QIUD 1M7XA 2ILLA 2WTRA 3V5DB 3INUH 3BP6A 3JV6A 3R06A 1TYJA 3BN9C 2ERJB 4U4IA 5DRXB 2ROYA 2CJUH 4I0PA 4JFEE 1T66D 4C56D 5GGRY 2X2JA 2X2IA 5C09B 5D1XD 3DO7A 4D9LH 1LO4L 3BISA 1T1ZA 1NGZA 1TJGH 2IALA 4YVNA 5JPMC 1XZ0B 4DVBB 1A1MB 3VH8A 1N18A 2BJMH 4L4VA 2FJHA 4NN7B 3NACH 5GS0C 3F5WA 3S35X 5K9OA 1FLTX 1MG2C 4L5FH 1A6TA 1XGQA 2BOBB 2P5WB 1ADWA 1KPVA 4XMXA 4DP8X 4TYUA 2VXQA 2VDLB 1Y6KR 4HMDA 1AG0A 2YXVA 4HKXA 3AY2A 3LMJH 4WCYL 2Y24A 4X6FA 2NY1C 4K2UH 1G7HA 2A38A 2NNFA 4ZUUA 1A7OH 4GAJH 2A1WH 3F3HA 2YD6A 2ZZUT 4LSDA 3NCBB 2DRUA 3NCJL 5I9QB 1TEGA 4HKZA 4AQ8C 4H7VA 4WW1A 2IC2A 3I75A 3GO1H 4C56B 5E1IA 4DIXA 1B4LA 1QVOB 2XACC 4ZS6C 3HNVH 5DJYA 1ZIBA 3Q8CA 1UXSA 3OKYA 5E94A 5JLZA 1G9MC 4PJ9D 3AUWB 1PF3A 1PEWA 1T7XA 1SNRA 1TZOA 3K2KA 2FWSA 4W9LC 5GRJH 4EKJA 4F24A 2FL5B 5F9OH 5CEZE 2C3GA 3ZYOA 3V8CA 2ED6A 2GTWB 5FDYA 4HWUA 4BFNA 5CF3A 5ITBH 4FQ2L 3L4YA 4X6BB 1M2VB 4P46D 4XP9L 5IHBA 5E70A 2NYKA 5E2TH 3VFUA 3LN5A 1TYRA 4GLRI 4K8RD 4X50A 3UEZA 3VGHA 4F92B 3D2UA 3JV4A 4NQVA 3SKJL 4D2NA 4OCLC 4AQEB 1LQBC 4KKQA 4E68A 4FJYA 1T22A 1LEIA 4Z3IA 3FFDB 3QJRB 2G0KA 1NUNB 4PREA 1IFHH 5KOVC 5B38B 5C8JA 4OVUA 2K45A 2E74C 2OX5A 3CVIH 3L95B 5DEFB 3FQTA 1LP9F 1RULL 2CPCA 4NC2B 5I5IA 2DWDA 1HXYA 3MLRL 4LMQI 3A5VA 4G7VH 2ZUQB 1BDYA 4HJ0D 2JLPA 4MNQB 3WSQH 1J9SA 4BH8B 4M6OL 4JZJC 2NW3B 1KCKA 2BOCB 2ODHA 2OPCA 3IJHA 4XNAA 5C0GB 3KBEA 5EEWA 3GMLB 3L5JA 3ML9A 3US1A 2R0LL 3TV3L 1F8TL 5PCYA 5D6DA 1E3XA 4GT0A 3O2DL 2IWFA 1EJFA 3WNPA 5IVXF 4BCZA 4CVZB 4XHJD 2J6EH 3VM7A 1B9ZA 1MREH 1IBYA 4KJQD 2DQTH 1VDGA 2DMGA 1CXFA 1IEAB 1GR7A 1J9CT 2ZKHH 4G7YL 3V4LA 1EAPB 4AQ1B 4NN7C 2KI6A 3IWVA 3L16A 1U8PB 2H32B 5F9WB 3GNML 3P11L 1NTDA 4DK6A 1JCKA 3ILQD 4HCGA 1A6UH 3OGCA 3C60A 2YUWA 1XF5B 2J1ZA 3D4ZA 2L0DA 3MREA 5KANI 3OB0H 2HG5A 3MLWL 2JJUA 3PAZA 4GAGH 4V2CB 3SE8L 3IMSA 3WIIL 5KYXA 5FFOA 5ID1A 4XOEA 4X5XB 4ZO6A 3O6MH 4P05A 2P46B 2QHLA 2DM4A 4PBWD 3S8GB 1KTRL 2WLZA 3CHPA 1A9EA 4HIHB 4NO0D 1IUZA 1E9QA 2VMEA 1S6NA 3VFSA 2WQ8A 2NDFA 1TU2B 1IM9B 5DK0A 3VA6A 2DM3A 2R8SL 4NZFA 4M00A 4PGCA 2MHAB 1JGDA 1THCA 2XN2A 4MZ2A 3LS4H 4WUUB 1NC2A 4YPGB 3X13A 5D70L 2GJZA 2NDGA 1E30A 4KZDH 4C56A 5E2JA 1T7YA 3OGCB 4GI9A 1DR9A 1YMMA 4NN6B 1OM3H 1U42A 1SEBA 5GRVK 4A55A 5BOPA 1ZK5A 4NQTA 4LP4A 5F1SA 2W8CA 2J8UF 2V7HA 1INDL 3HI1B 4EXPX 1MZZA 4C57C 2OS7A 2L7EA 4CRPA 5ALCL 4LL9A 3O3EB 1CTNA 2YS4A 3ARFD 4PJFB 4ADIA 3ELQA 1RAMA 4KC3B 1T1XB 3MLWH 4GAGL 3WO4B 4G43B 1X6NA 3V0FA 4EI6B 2D3JA 4C4BA 5DJ0A 5C0AB 3MV9A 3K4AA 3SOTA 4QHKJ 3UADA 3IVKB 4WSJA 4JLRB 2FRGP 5DHDA 1YEDA 3WELA 4H26A 4YHOH 3DHJA 2D7MA 3W38A 2YGNA 43C9A 1WWBX 5BRZA 4JFQA 1MFMA 4L9DA 1LEGB 2JCCE 2IH1B 3DVGA 1Z0NA 3BXNA 3OXSB 1XD0A 4MZ3A 1L5GA 5KBKA 3C8KB 2J21A 5MEND 4HJUA 2F7QA 4TSBL 3RX7A 3UTPD 1ZVHA 3GRWL 1M3IA 1DE4A 3FB6A 3IJEB 4TUKL 4Y16B 5EU6B 1G7JA 4R4FH 3RTLA 2YMOA 4BSWB 3VG0L 1U8IA 1CFSB 2R1XB 5HYJE 5B1BB 2K7PA 1QA9B 4C83A 1TFHA 4I2XA 4YMPA 3VWJD 4G7YH 5DD6B 4MKTA 3BP4B 2ZUSA 1OT2A 4XBGB 3OX8A 3T09A 3MRGB 4DQAA 1Q9KA 1JMXA 5IEHA 5EU4A 2HUEA 4DP1X 4LIQE 4XGZB 3STLB 3RUGB 2KDYA 3P3TA 3BQVA 4NUPA 4FG6D 1HT6A 1RMFL 1SMDA 5GGTH 4POZD 4U0QB 3MGOB 5K69A 4F20A 3GSWA 4P2AA 5AZEL 4BM7A 4D7BA 1G7IA 4KU1A 2ZPKL 4HF5L 3U9WA 2E3VA 5JW4M 3R0NA 2V2WA 3NZHL 3PY9A 4XWGH 5KYUA 5A6MA 3H8NA 3LRHA 5HDBE 3ATAA 1DQJB 3ZKND 2WTOA 4DERA 1F13A 1NKRA 1YQVH 3GHEH 3MRGA 5KSAD 3RWHB 3WO4C 4F37K 1KMGA 2YO3A 5CNHA 1AGFB 5JOEA 1NGWB 3LHPL 5GJSH 5I0YA 1PGRB 5I23A 1PYWB 4JO3H 1ES0B 1IBZA 5KJ4A 1NLDL 1T04B 3ZE2B 1RZFH 3OZ9L 4DO5A 3E1ZA 3P73B 1G9NL 4X42A 2E9IA 4NCC1 1YEIL 3TBTA 2OQJA 1KPUB 4PJXF 3U46A 4BRJA 3ESUF 1USZA 4RLDA 4O9HL 4JDZB 3CFMA 1F41A 4IBZA 1H3TA 2WUBL 3E3QE 3MRRB 5MP6L 3KWXA 4IOIA 3EG9A 4NWTH 1FNLA 1FL5A 3H9HB 3UBXG 4LFHD 5D7LB 3PXLA 5DDHA 5C0DA 2UZXB 1Z6JT 2AMUA 4OLVH 4RWYL 2IPTH 3AJ7A 2R7EB 4H5SA 4KXZI 2WMPA 3WIIH 4HXBL 1FSKC 2ALWA 2YUXA 1KIUB 4EI6A 1EVTC 1FFRA 3SCMD 1AMXA 1N6VA 4WJKB 2JJWA 3WEBA 1ECYA 4P2OB 3ZMNA 5IVXB 3KPTA 1QO3A 5D7JB 5L8KB 2X4NB 3CZFA 4J5VA 5E4IA 2J5LC 3PDGA 1OQOA 3KWVA 4ZAKC 1KXTA 1LO4H 4KI1A 4XCCH 3BVVA 1GGIL 1G7MB 5FA3A 3SDYL 3A6OA 4B50A 3BIKB 3PAUA 1DEEA 5E9NA 2LHAA 3CHXA 3SCMC 5B38A 1CICC 3FTGA 3HW7A 1FHNA 1BVLA 3LPPA 4TLSA 4UTAH 2CRYA 2MWCA 4WRLA 1OXYA 4RGNE 1JF1A 1SJVA 2FE0A 4PVNA 5CJXC 2ZF8A 5DRZB 3D2UB 3JV4B 2I60H 3BQUC 5J57B 1MJUL 1U3HD 2CR0A 4NZUH 2P42B 4E9LA 5C0BB 2FX8L 1NBCA 2EDKA 3MRHB 4JCLA 2IADB 4UQIM 4HXAL 3D0LA 1XXFC 4W4OA 1QKZH 2H6PB 5KSBE 2D0HA 4JO1L 5DFWH 4CAGA 2XI9A 1NFAA 1EHXA 1K3IA 2DYPD 3ILPA 1JZJA 1BXUA 1Z9SA 4P04A 1A9VA 3V9EA 3A6BH 2A6IA 2ED8A 2FBRA 3B7TA 3F01A 4NHCH 5AVQB 1XCQA 1RJYB 2VZ1A 2K8MA 4MMXA 1W2KT 3JZYA 4CC0A 4K7FA 1G7PA 1LE9B 2ZCHL 2HAZA 4F8TA 5K9QI 3ARDC 1D5ZB 1UA6L 3NJMA 4Y2OB 4W9FC 5DEGB 1YPZF 4ZMNA 4R7NA 4JO3L 4PJ7E 3DJSA 2VCOA 1WBZB 5IFAH 3FQRA 4NJAL 1FJ1B 1JVOA 5EDSA 1E4HA 2NQCA 3MLZH 5J8OA 1JJUA 2YQBA 1YDPA 3DX4A 5HYFA 3CC5B 2R2HA 4AEEA 2XKNB 3O2WL 2UY6A 5E5MB 4QTIH 1ZTXH 3QA3A 4F8PA 4XP5L 3ZUCA 4J3BA 2VAAB 3DYPA 4WWKD 1FL5B 4MASA 1MH5A 2G0LA 4JS7A 5LKNA 5JIMA 1H6FA 3MXVL 4X6CF 3MJ9H 4G8AC 3Q8BA 2IFFL 4FFTA 4Z1PA 4AKOA 2BHFA 1N19A 4HW6A 3HFML 5HPOA 3FQWA 1ZANL 3H9SE 1X4YA 3T6VA 4JM4L 3V6OE 1NLDH 3Q05A 1PAMA 3FRUA 4HUCA 2JB5L 3AT9A 3K2MC 1EEZB 5FUZH 3WLWC 5C0CD 3SDDB 4L29A 1A0QL 3DURB 1AGFA 4FQCL 4P07A 3RKDC 2HX9A 4BA0A 3ZL4H 4K9EC 4DQOH 1CXEA 4EDWH 3EOTH 2QL1A 1SRDA 4PJCB 1MCKA 3NZUA 4ZPTA 4JFOB 5E7FA 2OM5A 2OMYB 1PG7W 1KFAL 2BHUA 3GUTA 1SY6A 3DSNA 2HMID 2GIXA 2RAMA 3VB8A 2AXFB 3WEXB 2F53E 1U93A 5IHWA 1A6WH 4P2RB 4S0HA 4TLUA 3M1OA 3VGEA 4LCWD 2I60L 1WP6A 4J6RL 3W9EA 1YJDC 4U6TA 2JNZA 2IBGA 3HB3B 3TZVA 3TTYA 4MCMA 4UB0L 4X5WA 4YQXH 5IB3B 5K59E 1NBVH 4PJ8A 4DVRL 3UCRA 4POYA 4XAWH 4L29B 5DVOA 1BJMA 4LDOB 3P77B 2XA8H 3IEAA 4O2FA 4WUUE 5FO7A 4RBPK 1NFKA 3NA9H 3VW3H 2ZUVA 2OULB 3TH2T 1AAJA 3WJLA 3L9RA 3DIDA 2BIMA 2CPUA 5FO8B 3QDGA 3SGJC 4MXQC 4NM4H 1A1MA 3H9SD 3VH8B 3E8VA 1X5MA 3RVWC 4A6YA 1T1ZB 4JHBA 1YEGH 1YY8A 1NFDF 1ET7A 3FO1A 4FQXB 2FZ3B 1FZJB 3FL7A 4UCFA 2CNZA 1TIUA 4KK5D 3S98A 1RKRA 4YO0A 2VC2B 4YHZH 5C0CE 1AG6A 4FP8L 3OAYH 1A6WL 1JGLH 3D4CA 4JO1H 5F1NA 3X12B 4HMEA 4D8PA 3P30H 4L2YA 1BWWA 1ZLSL 3SPIA 3HCVA 1XSIA 2ISDA 3P2TA 4MMXC 4OCYL 3K6DA 5CBAB 1JK8A 3C5JA 4PJ5E 3O41B 1YQ2A 2WNWA 2BOCA 3IJHB 5D7IE 4WQOA 5C0GA 2XN9B 4PY7B 3QR2A 2W65B 4PWEA 1N64L 3ROLB 5SWSB 4DGYH 3KMDA 5B7FA 2DQIL 1F5WA 4FQLH 4NWUL 4IBQA 5IHUH 3N43F 3FU3A 4KJQC 3UDWA 4YXKL 3ZE1F 3VD0A 3VI3B 3GBNL 4X8GA 1QSVA 5I16A 3ECBA 5DO8A 4L18A 2G3NA 3IE9A 3INUL 3PHQA 2W0KA 1NDGB 1TETL 4AMKL 1E28A 2DWTA 4M4RA 2PPFA 3G6AB 3FCSA 3QUZB 3KEDA 5DJCA 3QG6B 1LTXA 4JDTH 1SOKA 2VERN 1K8DB 1FHGA 1ZIAA 4JGJA 4EBQH 5JPNB 3UPRA 4JFDE 4YHKL 3MFFA 1MFAH 3EO1B 1A6VL 1MRDH 4OFDA 2JMRA 3LRSA 4OB5H 4ONFL 5C9JB 5L8JB 5IB4B 5DZAA 1Y0LA 2ZWSA 2ZCKL 3N43B 1G9HA 5CGTA 5AWNH 5HVHB 5I71B 3FSWA 5ADPH 5DA4A 1HHIB 1DCEA 3PHQB 2A99A 2H3NB 3VD4A 1QEWA 4MLIA 1OE1A 2AQPA 1HX0A 5FHBL 3REVA 4R4FL 1HXKA 4KK8D 4HK3N 3GUFA 5GRYA 2JKWA 1KFGA 5AENA 2RH0A 1L0YA 1XFPA 3P3RA 1M3JA 5IROA 1BD2E 4Y89A 5C97A 3GS7A 4LGPB 2Z35B 1NAKH 3GMOA 3VQMA 1XGPB 1BZ7A 4FL4B 4XXCA 5LBSL 2R27A 3BZDA 1BZDA 5BZDB 4G9FA 4PQXA 1ACCA 3DIVA 1DVXA 2A9MH 5E9DD 1UFUA 1JZ4A 4K3EL 1VZIA 2HRGA 1XV8A 3EJQA 2EDNA 4I1NB 4K55A 4XI5C 4OGXH 5C08E 3WNMA 4M1DL 3NJXA 1M57B 1JWUB 4O02L 2B1HL 4ONFH 3QC5X 3BOVA 3K3QA 4WWPA 2KLRA 4K8RL 3O6FC 1KYOK 3EYOA 3DUSA 4BUQA 1X4ZA 3FO1B 2IH1A 3N42F 2WCSA 4WHDA 3DVFA 5J5EA 4NO3B 1O7SA 1SMAA 5HI5D 4DOHE 5ABDE 1HIMH 4GSRA 3A22A 3REVB 1FIGH 4BQ9A 3KS0J 2G75A 4DP5X 5GS1B 4OCRH 1KJMB 1UC6A 3ES6A 4UOW0 1ZV5A 4UBDD 1U8CB 1U8OA 4PJGF 4PJHF 5ID0B 1UKSA 1BYNA 4U0RB 4I3RH 4P3CL 5D5MB 4N0CD 2CE6A 1HDMA 4DZ8A 4YZFE 1CF8L 5GRXG 4E42A 3WFHB 3V6OC 3I02B 2BFVH 4ZTOL 1XB3A 3BUPA 1OP5K 3LKOB 1Q94B 4MA1B 1NUFA 1I9RL 4N0RA 1NCOA 3NIDF 1T2QH 4Z7NF 5CN3A 2X4TB 2WIIA 3OG6B 3VFMB 1I8LA 5L2KE 2OTUA 5E8PA 4M4RB 3ARFB 2WAHA 2R4RL 1MQKL 2EYTA 4WHTB 2AQNA 5AW0B 4TULH 3IBOA 1J0YA 2W9EH 2Y2YA 4KNTA 2IPTL 4N0FA 4ONGL 2QVTA 3KPRE 3QFDB 3QQ3B 1KBBA 3S37H 3HVDA 1OGAB 4NM4L 3ZT5A 3DX6B 5T1JA 1A47A 3HBQA 4MYPA 1DLFL 5KW9H 4X98B 3OKOB 5CSZA 5JOPD 1JP5A 1YEJH 1PX4A 2CLRB 5CLWA 2AGJH 1A6UL 1NOAA 3RVUC 2NUTA 3SE4A 1HI6A 4KRPC 3ZY7A 4ZBJA 1QWHA 1GMEA 3O6LH 4P5TA 4WFFD 3CXFA 4L3AA 2VXTH 1HHGB 3H0TB 5F3BB 1HDMB 4RDQF 4MNHA 1HL9A 1JIBA 3FRUB 4JFXA 3L3DA 1T7WA 1DJWA 2BC4B 1SBSH 3TN0B 1TUPA 3ZKNC 1KJ3H 5FUCE 4LEXH 4AYFB 1MFCL 1YUHA 5D7HA 3IXAA 5B8CC 4ABQA 2ZCZA 2GIYA 3C60B 3L9YA 2JKTM 3NCYS 3S3SA 1ADQH 4YFDB 3VXME 3KWUA 4EN3C 5MHSE 4OFPA 1I9IL 4KPHH 1DVSA 4C8XA 4LLWA 2QDVA 2BMKA 5GRUL 3NN8B 3APMA 3ZL2A 1KB5A 4AY0A 3GIZL 3PWNB 4MWFA 4PG2C 4WI2A 4YUEL 1GA2A 4QGYA 4MQSB 4BZ1L 3WTXA 1U8JA 3EOBA 2R1WB 5DMIL 3UTTE 3P3YA 4JL1A 4U3CA 4YFLI 1WBYA 3GSVB 3HZVA 3L3OB 4Z7VF 1CLOH 2VSMB 4GS7B 4WFED 3IDJB 4V2BA 1SXZA 3WENA 2F1BA 2AJUH 1X5HA 2GBVA 1QFWL 2EC8A 1FC1A 4MDIB 2XZCH 4NT6A 3EGDB 4OJFH 2Z8SA 3JWDC 4FI8A 2J72A 4QYAA 4JJ5B 2VAJA 5DD0L 2PYFB 3ABGA 1UXLA 4ZFGL 1MG3C 1NFDB 5BV7H 1VENA 4PWFA 5DC2A 2WWMC 4C59B 3PGCB 1HE8A 1PG7H 2CK2A 2QQKH 3FTZA 2P8MA 5FO9B 7FABH 3VSTA 2JB6B 3V4PA 2O5NA 3VXPB 2GK2A 2VR6A 4FI7A 5C07D 5DEZA 1KDJA 2YD3A 3AXHA 1AQHA 4LSQL 4N9GB 4YVUA 3S35H 5FHAL 4FULA 4CC1A 1AOHA 3NVQA 1S7UA 2YRLA 2HRHA 3P3UA 4Q0XH 3U82B 1Q0XH 1U8MA 1CFVL 5BVJA 4WFEE 2OAAA 2VERA 1J1XH 4TNVK 1DO6A 3ILQC 5HDOA 5ENWA 3VE0B 3VFGH 3PF2A 1OL0A 2WXRA 4XCNB 3IETA 1CT8B 1BQ5A 1YNLH 1JZEA 3AQXA 4N0YH 4JFUA 1OP3H 1BXAA 1HWWA 3AG3B 3EYVB 5A40E 2BS8A 3SDCD 3JYBA 3TV8A 4P2QB 3K7UA 2EEFA 3UZEA 4S1RL 1L9PA 4KDVA 3VXMD 2X4NA 2VT0A 1WG3A 5G4OA 3Q2NA 2BVPA 5JMRA 5LJYH 1RD6A 4TF4A 4FNRA 3SKOB 2DKUA 1FA4A 4LK4A 1CGSL 1FJ1A 2OL3L 3NJVA 3REWB 2H1PH 2XC8A 2F1EA 3BMWA 4EI5A 2Z91A 3B2UC 5KVEL 1A1NB 3MNWA 2YWZA 3RZCA 4N8VB 5FOJA 4OZIA 3TZVC 3CSTA 1RZ7H 1FG2B 5FECB 1AI1H 2IO5A 3RHWF 3RDJA 3UO1L 4UTBH 3DUUA 3TVMC 3WY2A 2VIRA 5I6OA 3D85A 5E6SB 2X2YA 3GMQB 4LLWB 5MI0B 3ULVL 3KR3L 4Z3TA 3T04D 2ADGB 1FBIL 2MCMA 4RGOL 4WKZB 1XL4A 2MH4A 3HKFA 3BPOC 3RY6C 4M5YL 1LM8V 1U91B 2Y07H 2YOCA 3OJ2C 4R6UA 5I1CL 3CVHH 1HZHL 3TCTA 3N0PB 3V6ZA 4B0MB 5DHVB 1XB8A 1RH8A 2L04A 2C9PA 1S7TB 5KVDE 4PG9B 4KI5F 5EO0A 4UU9A 2XX1A 5J7CC 1BYPA 2PWFA 4JFDA 2AJVL 1HHJA 1WIOA 3L5WA 1J05B 1FNEA 4ZPVB 4MJJA 1BQKA 1DHKA 4YHYB 5FO2A 4UAOC 5IQLA 2VDNB 3MQIA 1B90A 3GS0A 4MJID 1ZLSH 5C0NC 2J6EL 3DX6A 1NEPA 1U58B 3OLIA 3FSOA 1G6RL 4HEPG 4AVHA 3L08A 3VD3A 2WZPD 4JQVC 4LBEB 3LV3B 5DZPA 1OE2A 3RNKA 3HZKB 2OMZB 4O9HH 1E5AA 4RWHA 5HHOA 5HBBA 2RCSL 2I26N 1KLUB 3BAEL 3CXDH 1HQ4B 3EYQD 2P44B 3LAFA 4PJDE 2YRZA 1PZ2A 3QO0B 1P5UB 3LH9A 4HP5A 3UBXA 1SFDA 1GGBH 4Y7OC 4NWTL 1UD5A 5IBUG 3CZFB 4BFIB 1COBA 4Y5XC 2NPLX 2PO6B 1HCFX 3FFCB 7PAZA 2DLHA 5FW7A 3OV6A 5E6YA 2ARWA 4YSEA 4UU9B 4Y5VC 2F7OA 3ZDYE 3ZDZF 3HZVB 3L3OA 2GFBB 2AQTA 2J2ZB 5D1ZA 4UT9A 5JHDE 4APXA 2G9HA 1OGTB 1RK1A 3L5XH 2OR8A 3ES6B 3MNVA 5IP4A 2O5YL 2W59A 1ACZA 4P8QA 4FOMA 3FT4A 4YXHH 3Q7JA 1SF5A 3C8KA 2XBZA 1X7SA 1MVUA 5D1QD 1IBGL 1X9UA 1HJBC 5DT1H 4ZUWA 5I2IA 4KO5A 4J23A 1JPTH 1N0LB 2D7TH 5TK2A 43C9B 2HMIC 2JSFA 2PTVA 4U1GB 4WTQA 1FNGA 4Y9FA 1FPTL 1KPUA 3S3JA 4XO9A 4N28A 1G7QA 3MNWB 1ROCA 3RWJA 4OCWH 1J5OH 3PL6B 3U4AA 3QZLA 3REWA 1S9WA 3VI3F 1ETZB 3RJQB 3RIKA 1P84K 1AI1L 2Z8WC 2HLAA 2IBBA 4KTEH 4MNGA 1RZGB 1X5YA 3ASWA 2J6EA 4ZODA 4OIIL 2QR0A 4HG4K 1YA5A 1J11A 3U7WH 2ALAA 4S2SA 1I3VA 5KS9F 3AXIA 1RJYA 2Y3NA 1CN4A 2BIHA 3W9EB 2AK4D 4I77H 4LSTL 4PJBF 4L1TA 4Y5VB 3VRJB 2ETWA 4XOAA 1CD9B 1WIPA 5CP3A 1UEYA 2XFXB 3IU3B 2A4ZA 3DUHA 1H3XA 3QJQB 2HXAA 4H8WC 2DQEH 4JFFB 5FM5O 3T8VA 4JM2F 2XPZA 4G8GB 5BVPH 5I8CA 3AT8A 5C6TL 1CLVA 2EQDA 2OSXA 2VM3A 3IKCA 2VDLL 3T4YA 3KZ8A 3EO1A 4UV7H 4E42B 1I3GH 4FG2A 2WNXA 1RK0A 4P0DA 3QCVH 1J1OH 1N6QH 1DUYB 3HUJF 3KM1A 4JQVA 4KGLA 1THAA 1C8QA 3HC3H 3RNQB 3QIUC 4IRJB 1INQA 4LCWE 2ERJC 4U7KA 1EFQA 1G6RH 1M9WA 3D39B 1HC1A 3I6GA 3UTOA 4ELME 2CR6A 1LE5A 1FYTB 1WICA 4DT2A 3F6JA 4KY1H 3SEPA 1AZVA 1NJ9A 3PWLB 4JN2B 4JKLA 1N3NA 3OAYK 4TRPL 4XB7A 3V4UL 1IKFL 4FD0A 5CBEB 4LHQB 1PX3A 3S8WA 5JHMA 4FNLL 4ZO9A 2UZIL 2QPFA 4RISL 2P7TB 1CF8H 3II1A 4MDIA 3FU7B 5SWQB 2OJEA 3E6HA 1GGYA 3B7YA 5CJXA 3S2CA 3WCYA 2R8SH 3ROOB 2YSSB 2V2XB 4BFJA 3WHE1 4BBWA 1ZVYA 2VR8A 2UV3A 1OKEA 2Q1EA 5KW9L 2C9RA 1XD1A 3M1BB 4N5ED 5DZLA 3VYOA 4CC4A 3KYOB 3UTZA 3VWKC 3DMMC 4IIQA 1XDTT 2AJZA 3EKCA 4KXCA 5DHMC 3QUZD 3BE1H 5EF2A 3MRPA 1RIVH 2CGRH 2JWYA 1N26A 2BP0A 1O7VA 2V7HB 4LFHG 2VDQH 3RVXC 3IMUA 1BFVL 2CJSA 2NZIA 2I24N 2VR7A 5CLTA 5DFAA 4S1QH 1T0PB 3E2HC 5EU6D 4AWJC 3PP4H 3SGDI 3F7YB 4AIOA 2E27H 4TULL 1XEUA 3NIFE 4U1MA 4PS4L 1WWCA 3IDYC 3WS3A 1XCXA 5FYKH 1M6OB 2ZYSA 4ADJA 4HAKA 3KPMB 3VXRA 4LLQB 3U7AA 5L8LB 3BEWB 1DJGA 3BP5A 4KHXH 4OCXL 4NKOA 3OC5A 4JFYB 5DHEA 1KCRL 4LSSL 3FFCE 2OJ1A 1LXMA 3S7GA 4Z5RB 3MTXA 3C6LC 4QUOA 1PFOA 4L48A 2P28B 3L3KA 1GTFA 2DJSA 4EEEA 1QMUA 2HLEB 4PRBB 3CDZB 2CALA 3TA4D 3BFOA 1OTTC 3WN5C 2BM3A 5KZCD 1R5IA 3CN3A 4XNDA 4CADB 3LB6D 3W81A 3AWFA 1NC2D 2ZG1A 3GI9H 5KJRH 3V0JA 3HZ3A 2KBGA 2Y7QB 4WV1B 3HS9A 1DZ0A 5HPMA 4JFOA 5GISH 4L8SA 3ROLA 4HUWB 2R4SL 4MRCA 5E00A 5FHAH 4CA4A 1MCWM 4PY7A 5CCJA 4C56E 5LBVA 3RKDD 4JPWL 3SDAB 2HVKB 4LASL 2BIPA 1CBJA 1QO3B 2VLKB 3VFRA 4H1LA 4KROC 1NDMA 5EUOA 2BY0A 1E7UA 5FV2A 4RZKA 1QA9A 2FX9L 2CBQA 2OZ4A 2Q6WB 7FABL 4IJTA 1BIHA 1WITA 1MI5D 3M45A 5EG6C 3O6KL 3ZTDC 4WGKA 5K9OB 3AVEA 1FG9C 1RUAH 1KB3A 4PS8A 2YD7A 2X1XR 4M1GL 1KCRH 4OGAD 4OT1H 1QPPA 1ETJA 2VDNL 3NGBC 4M6AA 4PRNA 3W2DL 4X7DC 1TTCA 4FNLH 3AG1B 3MBXH 3MLXL 4GG6A 1JGEA 2P24B 2QADB 1F11B 2COQA 3CSGA 1J1XL 2HFGL 4LP5A 1F4WH 1TG8A 3JWOC 3P9MA 2GITB 1UACH 5IIEB 1MFBH 1BAFL 2BSRA 1T3FA 4HQQL 3TH3T 1TEFA 4OCMC 2IVFC 1X5KA 4JRXE 2BCKB 4TNWK 1BBDL 1PNDA 2NNXA 3UMNA 1CURA 2VSCA 1NANH 1BIIA 1EO8H 3MJ7B 4FXKB 1GYWA 1PS3A 1OAYL 3FTXA 2C9SA 2HVJA 2VR4A 2PCYA 3KBFA 4LRIC 2F58L 1OAKL 3T4YB 4MNQE 2VW6A 5KVDL 3B83A 3VD5A 4M5SA 1NC4A 5FC9A 1P5UA 5C07A 1MCEA 4PIRF 3MX0B 2VJ8A 2YA1A 1HWHB 3D3VA 2JELH 4ACPA 5JA9A 4UUJB 1S3KL 3IU3A 4BFFA 4DGVL 2TSAA 4GSXA 5KYWB 3GMNA 4K71C 2R83A 1GYUA 4HJSA 4XXDA 5G4NA 2GB2A 2IBZX 2JI1A 4YWGH 4I18B 1N5YL 1U92A 2R59A 2OMYA 1JGDB 4H88L 3RUGA 4FQHB 1JE6A 4OLYH 3Q8EA 4KHXL 4AIEA 5D2NA 4Z5RA 5T1KD 2IH3B 1WF5A 4OZIE 3SQOH 1OSPL 4EXKA 2WYIA 5IMOA 4KNSA 1G7HB 5FYLD 1IAKA 3L7FB 3OJDA 4G11A 4AIZA 1DBKH 4PH8A 2VR3A 4CUCA 1IIIA 3FSAA 4HKXB 1MHHA 4M7LL 1KULA 3SKMA 4UYPA 4JQXC 2Y1YA 3H3PH 2DH2A 2R2EA 3LZQA 4UNVA 1KCWA 5CEZL 3ZE2F 1Y18B 1KV3A 1Q0YL 4F9LC 2I9LB 2HJKA 3RX9A 5HI3C 3BIKA 3NRFA 5F7EL 4ANUA 1INDH 2OCCB 5MERA 2QGEA 2QSCL 2N0MA 2A9BA 1E2VA 5FB8B 3B2VL 3DBXB 5DRNB 3TIDB 2WWKT 2FSEB 1ODUA 2ZXBA 2H1LM 4OJCA 3QUXC 2AJZB 4FEMA 1XH2A 4Z3JA 1A6PA 2ZF9A 3THML 1ZCRA 3S5LG 3UTZB 3C6SB 3RWCA 1OANA 1A1NA 5CBAA 4AGNA 5E2VL 2F54B 2QSTA 3EYSL 5L4IA 4Y16D 3QO1B 4NZDA 5I1DB 4OV5A 4G9FD 4MCYB 1RP9A 3MAWA 3UTTB 4L1LA 3T0DA 3FPYA 3QI9D 1NFDE 2VDKB 2FECL 4IGBB 4U1SB 3UBXB 5IGXL 3H9HA 4Y4HD 1PD6A 2YRBA 1AYOA 1C1EH 4EDXB 1TTRA 5FGCB 1MLBB 1BPVA 3VG9C 4OF6A 2OMUA 4JO2H 3MCLH 4KVNL 1R3LA 2Q8BH 2I9LA 4BINA 1WBXB 2WJ7A 5A3ID 4PW3A 3VI4B 4TPRL 1EZVY 1X3DA 3D18A 4W9EC 1F3RB 1JVLA 3T0EB 3W0WB 3QI9C 2VZ3A 1G84A 1TZGH 3GRGA 5F1IA 5GIRA 5C1MB 3ULVF 3TWCL 2XQYK 4N2NA 1UA3A 4Y1SA 5HVGB 1U8MB 4B3EA 5KVFH 1NMBH 1MCLA 1CDHA 3BCFA 2XJKA 3AADB 4RCAA 3RGHA 1HHJB 2ICWA 5DD5L 1PD0A 1L3NA 3AQDA 4YXHL 4HKJA 4Z7WE 3TBBA 1IFRA 3TIEB 2CA4A 2J4WL 5E6IB 5HXMA 4X5RA 4RH4A 5DHVA 3QG6A 2MMXA 1IGFL 3EH5B 4BRVA 2ESVA 3QDME 4WNQA 4XP6H 4ABWA 1ZANH 4PJHA 2JKJA 4PJGA 4YHPA 3HNVL 1P4IL 3D0AA 4NS0A 5GGVY 1NSNH 2HP4A 1G0XA 3BCDA 4M48H 3ZQXA 4EBQL 1BVNP 5F1KC 2BK8A 3G6JF 3QB7C 2Q7AA 2NY5C 1FO0B 3HZYB 4PTUA 5F88B 1UOKA 5JPNC 3N04A 4GY4A 4J2QA 4LOUC 3W5NA 1G6RB 5MEOA 3OAUH 1CZ8H 5C3IA 2HN7A 2EDXA 5CWSB 5D1XA 2R1XA 4PB9H 1M4KA 1BFOB 3I3BA 4D8PB 4OAWB 2ZX7A 1M6UA 5ICXB 3H9SB 3UIZA 2X2HA 3WTWA 4R9HA 1HNFA 4WJG3 3L8QA 4ELMB 1U8KA 3EOAA 2MCG1 3UERA 3KPPA 4XPGL 3NZ8A 4ONHA 3O9WA 2E4FA 3PHOA 5MERB 5CBEA 1A66A 4I8DA 2FBOJ 1UJ3B 3QE5A 3ZDZE 5HHQB 5FOBB 2RMNA 3CHRA 4K3JL 4JAMA 4E5XA 1V54B 4UM8A 4FCAA 3GK8H 3G5VA 5ENWB 3OC8A 1F4XL 2QPDB 3PWVB 1BFOA 3PPSA 5IWLA 3UPAA 1UZGA 3WY4A 3TBWB 5C3LD 1NCHA 3HLAA 5D1XB 2AF2A 5IQMA 5T1MB 2EE9A 1NGWA 1Q0YH 3CAFA 3RP1A 1UYWL 4I3GA 3U1QA 3RWHA 3CFTA 5C70A 2JKSA 5T1LD 2PF6A 3SPGA 4JM2C 4WTZA 2YARA 4M7LH 1EDYA 1AS6A 3CX2A 1NEZG 4XVUC 2YEQA 1CQYA 5KZCB 1FC2D 1CFQB 4ETYA 3QUMB 2OK0H 1AP2B 3QHTC 1DBML 4WO4A 3CVHA 2X4UA 4Z7UE 2A74C 3VVVA 5EN3A 3TEYA 3FK3A 1ZE3H 2DWXA 4CGTA 3NFNB 3BGMA 1YPZA 2OSYA 2YSTA 4NT6B 3CZKA 1FBIH 5JTWA 2VE6A 2MKWA 2WKLA 1KIRA 1K8IB 1W0WA 3IKKA 1JD9A 2VM9A 3J8F7 2B4CC 4OZHF 4YEFA 4G80B 2WZ5A 1XO8A 3MU3A 1TQTA 3VD7A 3MMEA 3BGFC 5EF3A 5L2KB 1KC5L 4RAVA 5HTSA 3ULVE 3QARA 2CRZA 4MAYC 4GFTB 1JWMB 2VUOA 2Q8BL 3UTPE 1KTLB 5KEZA 1PLGH 4JR9H 4YBQD 2EILB 1MHEA 3DX2A 3TA3C 1WHOA 1E3ZA 4KQ3H 1UYWH 2C4FT 2Z64C 3AMKA 1ZTXE 2B1HH 4KITB 3WS6C 3UO1H 3ZE0B 3GGWB 1VACA 2EDWA 3DV4B 1BBJB 1AHWC 1BVOA 2GSIA 4G6ML 1NCGA 1OPOA 1DANU 2E9BA 4Z7WF 2O5XH 4ZTPH 3VQ1C 5K9QG 5CAYB 1OOWA 3PQYA 4LPVA 3EFOA 3QP3A 1S9YB 1HINL 1S7RB 2XWJA 5J11B 2JCCF 3AQZA 3MRQB 5IFJB 2FSDA 4XNMA 4ACTA 2YFNA 2D3NA 3CK0L 1EAOA 1AQKH 3ML8A 3OGOE 4HLZH 4H0HB 3WAKA 5DHXB 4YHLL 1SJEB 3IJSA 3AUVA 2DYPA 1B3IA 2NY0D 5C0CB 3BEVB 4YSPA 1OHZA 1EWHA 4W4NA 3QO0A 5T3XL 3MACL 3TPUA 5CEYB 3KYMB 4HBQA 4OZFB 1VHPA 2QMJA 3MRRA 4FZ8L 3D51A 4JDZA 4X8XA 3NT0A 3QSKB 4QLWA 5AKRA 3IDMB 4P9ML 2X4RA 4F8QA 5JDSA 3WTSA 4F3FB 3VXSB 4HJEA 3VXOB 4FFVD 1GAFL 2BHZA 1WZLA 2V3DA 3N1MC 4IRJA 1WC7A 4AQ1C 5HY9B 2B2XH 1SQMA 2I7OA 3IWUA 3H7BA 1O5PA 1A25A 1JPSL 4IKKA 5DUPH 3TP4A 3VXQA 1ZEAL 3VFSB 1UD4A 4GKNB 2LU5A 4JFYA 4TSBH 5BS0E 3M7FB 2CR3A 3RB7A 2D31B 1DANT 3KL5A 4MGXA 1URLA 3QQNA 3WEOA 2DM2A 2X70B 4G8GE 4B5EA 1P5VA 4K94L 1RPUA 4FFVC 2AQ1A 2UXFA 3TFKC 4D9RD 5LUMA 2WSPA 1WO2A 1CLOL 2OSWA 2B59B 2NQ3A 2V7NB 3K5RA 1QFUH 3UX9B 3GMNB 2W88A 3QBTB 1P9MC 3GJEB 5KVDH 4NN5C 5F0PB 5IMLA 5KVGH 4XP1L 3BLBA 4OJFL 5F71A 4ZFQA 4Z7UA 3EYOB 3H54A 4XNZB 4PWHA 4QKXB 4UNTA 1H8OA 4CNIB 5EO1A 3ZVVA 3PL6C 1UZ6F 1YNTA 1T4KB 2V9TA 2ZX8A 5AZEH 4ZZKA 2PR4L 2ZTBA 3CMOL 2HLAB 4MNGB 3UBXI 4LSRL 1FPTH 5LBGA 2JKNA 4HQQH 3NSYA 1CICB 5JUEL 4M3KB 3TASA 1RP8A 4U1JB 2Q87A 1J0IA 1ZLEA 5FFGA 1HH9A 1OF2A 2Z7YA 1ZLUH 1S7RA 5TE7L 1DBBH 4WWKC 3STBA 1RUKH 1JDCA 1E40A 1N10A 1UD2A 1S78D 3O45A 3LKNB 2VQUA 3TYFA 4PJXA 2NY2C 5HHVH 4OD1L 3MV7A 2FYVA 2KHAA 3CV5A 2DYSB 3BUYA 4DZBA 3DV4A 1CIDA 3L1GA 4AIXA 1IQWH 5JIKA 3NCCB 1T0NA 3DSFL 1A7PH 1FSKB 3G9AB 3E0GA 5EU3B 5SWZA 5CZVH 1TR7A 2C3VB 3X1GA 1CDBA 2AEIT 4NNXA 4GRLD 2XA8L 1VZHA 3DDGA 4KO9A 5H2BA 5HVFB 1OP5H 4WU7B 3LN5B 1JDAA 4RAUA 2J1KA 4FE9A 4S1SL 5D8JH 1AIFA 3T0XA 3UTQA 4PPTA 3NIGF 1T21A 3NJIA 2G3MA 1K8IA 1W0WB 4ATTA 5FYLE 1MCPL 3IGAA 4IRZL 3A0OA 1FO0H 3P11H 5T3ZH 2KLSA 2DIEA 4ZX3A 3W5MA 3AU0A 1AJ7H 2PETA 4N87A 2X4UB 1TZHB 1BZQK 1YMMB 2CHWA 2DKSA 5LNEA 2N59A 3NEXA 1KYUA 5GQBA 2DPKA 4PP1D 1ZGLP 3BAJA 2ZYHA 1N7ML 1A4BA 3DX0A 4XWOC 2OZ4H 5CUSH 2BNRD 3D3VB 2VL5B 1LHZA 4JFPB 1L9TA 5CD3A 5I8KH 1I7RB 2Z6FA 3EFDH 1IARB 2EO1A 3ZO9A 4M6OH 2BLFA 3SDDA 4NUGH 1TLKA 3BKCH 5TD4A 3IGUA 2WSDA 3HCVB 4XNMB 2AEOA 1JYVA 2FD6H 2X6AA 3MLUL 4R0LC 5ID1B 3V6BR 4PJCE 2MPAL 1TO5A 3TT1H 2XV2A 5D9SB 5E7BA 4ZT1A 5J13C 1M1XA 3CVBA 2Q86B 4HWBL 3AU1B 3PQYB 4Y19D 5GGRB 4AH2B 5J13B 5F3FA 2GITA 4J3OF 1XZ0A 4DVBA 3HRPA 2YLHA 2AV1A 4QNPF 3ZT7A 1F11A 1RUQL 3Q2WA 4G5ZH 4RMUA 4KKLC 2J71A 4QXTB 3CSYB 1BYOA 1LNUA 1QPXA 2C1PB 1MDTA 4WO0A 2F7IA 1RZJC 4Z7UF 2AS5M 1TKWA 1MVYA 3L5IA 4P4KB 1JWUA 1YYCA 4AYFA 1H3PL 2ZOLB 1XT5A 2UYLB 2NUPB 3QH3A 1UM5L 4JVUA 2ATPA 1ZDQA 1QATA 4I3SH 4L2LA 4GBXD 1Z9LA 5HP5A 3UTSE 1MI5E 1W16A 3BDXA 4IOSD 5BZXA 2NYYC 1WPCA 4ZOAA 1RZKH 1ZVSA 3T5WA 4AUJA 5EH1A 3W39B 1QSEE 4PUBL 3A47A 3O8XB 3V0EA 2GUOB 5AAMA 1DQDL 4U6XA 2GK0B 1C5DB 4OT1L 2X4SB 4J8QA 3WMPA 4IDJH 5SWQA 5I19H 4JPWH 3U9PH 4FYRA 4R4ND 3F58H 2CLZB 4L3EA 2HH0H 2Z31D 3G08A 1MNUH 4OB5L 4L8SB 2DLEA 4NPYA 4AVKA 2Y7QA 4A1RA 3EH4B 4EKXA 1AC0A 4XNXH 5TGBB 2YPVA 4Z3HA 3HR5A 5ADPL 1HL4A 3QORA 3KLAA 1VRSA 3K1DA 2VDMH 4QHMB 2NY1D 4ZI8A 1RZ8A 5E8PB 3KNBA 3U2IA 2A5UA 3KPLA 3MFGB 2J88H 3A6CL 4HALA 4NBYB 1P5VB 5CGMA 3OSVA 2W07B 1CGTA 3BAEH 4MCZA 2KLTA 1VFUA 2IDCA 5KANG 5FCSH 1YEFL 3DTXB 4XBEL 3B1TA 1D9KD 5CCGE 4GAJL 4AGQA 2ICWB 3DURA 4OIBA 3ARYA 3DX3A 3QJZA 4JY6B 4H2CA 4N5EC 5I8CB 3QG7H 5C9KA 5EN2A 5IESH 3VM5A 2PWHA 3CFEB 3EYUL 4R83A 3FT1A 5FKAA 3WIFB 3BWUF 4ILDA 3QHZL 4XMLL 1H0DA 4YDJB 2DJUA 1U91A 3DWTA 4MXVE 3RGVB 5HHPB 1QSFD 3RVXD 5CU5A 1YYLL 3BD4A 4M5TA 3KLAB 4GMSL 3WXWL 2HT3D 3I6KA 3QIBC 3MA9L 1I8UA 2QVMA 4YDIH 3BH8A 3GXUB 5F6HJ 3D85B 1FVEB 1QP1A 1OWRM 2Y6SC 1DL7H 1KXTB 4RMWA 3FFCD 4RGNB 1RLWA 2AZUA 4UT7L 4A2GA 4JK0D 5AW7B 2DYPB 2ZQKA 2RD0A 1FLRH 2VQ4A 8FABB 4AX3A 1KXQA 2GJ6E 4Z7OE 4L8DA 1GH7A 2X28A 4ZUUB 2HPTA 2K78A 4P9HH 2H2PC 3TA3A 3S3CB 3VVWA 1FO0L 1A2YA 1A3RL 1UH2A 2BZDA 5T3ZL 4GSDL 4HZAA 4N6QA 1U3JA 3MV9E 3D0VB 1MOEA 1RHFA 2V2XA 1MFCH 3QH3B 4L0PB 4OD2A 1FFNB 1JV5B 2XIBA 3CFJA 1OSPH 2ICEC 2YPLA 3QUKA 5D1QB 3OMIB 4FQCH 1OAXL 1J86A 4DQOL 3FSVA 3L6FB 1AO7D 4GKSB 2JXMA 3FO2A 4FQQB 3P2BA 4FQXA 4UILH 3BH8B 2F08A 2WXNA 3BSZH 4R96A 4X99A 1SLVA 1UOWA 3VTTA 1MN4A 2VXSH 2DN7A 1X5XA 3QI9A 1P7HL 1I1AA 1ICTA 2N56A 3VI3E 4PMFA 4BZYA 2WLYA 1K2DB 4X6DB 3V5KB 2XWDA 5L9DL 1MW0A 4XI5D 3HN5A 2WSKA 1A7BA 4F15B 1BF5A 4X6BA 3KXFE 1Y7VA 3DECA 4HKJB 4UQCA 4Y5YA 5ANHA 3UDWC 2Z65C 4MB1A 5FM5M 2WZ0A 2X10A 5LGHL 3MJGX 4WTZG 2RACA 4FERA 4KZEH 2CU9A 1R3HB 3GPSA 2YBRA 3JWNC 4JFPA 3V4PB 1LO5A 3VRLF 1NANI 3UAEA 4FZ8H 1E4WH 1IVLA 3RIFK 4Y9CA 4JM2A 3LZOA 1AP2A 2FO8A 5AL0A 4BH7B 2B3IA 1I8LC 1DVYA 4BFGA 3PQYE 1B3JA 2ROXA 4KVPA 5J12B 2XBTA 3EF7A 3MGOA 2ICES 4YHIA 1NCDL 1NKOA 4KKBC 4Q7DA 1CUOA 3WMSA 5FUOL 3WFDL 5D7SH 4AENB 4PW4A 1PY9A 2G5UA 3QCUL 1KWGA 2HT4C 3QDJE 4IHOB 4AYID 2MCAA 4B3VA 4CMHC 1EVUA 4OIIH 3T2NL 2IQ9L 1V55B 2AABH 4ZMXA 3TT3H 3D69B 1RK7A 4RAUB 3MRMA 3SJVD 1B4RA 2R1WA 3P0VL 1VPOL 3LEYH 1ETA1 3P9LB 5KYYB 2C7FA 1NMBL 4ZUSA 3GO1L 4OIAA 4Y8DC 2WXQA 4NNXB 2YXWA 1MCOH 2O61A 4M48L 1D7DA 4JZOB 5JW5A 1Q90A 1LK3H 4X7SH 5HYSA 5KSBA 1SDAB 1GAFH 4ODUA 2CMRL 1Z3GL 2OP4L 1QNIA 1VACB 4TV3A 5DMGD 4ZS6D 1AFVL 4P2CG 4ZFZA 4FABH 4MXVF 2CO6B 3QFJD 1S7SA 1YY9C 2Y0SA 3IMTA 5LBSH 3Q6GL 5DJZA 5T1LB 4UTAL 2H8PA 4ZUTA 1UUNA 2R23A 4N4YB 1ZHLB 2NCMA 1I53A 4JCWA 3MHZA 1QTYT 5BZDA 1RUAL 2NW2B 2WBXA 4HD9A 5FHBH 5I71C 2VLLB 4GO6B 4N0YL 1ZGLB 2BSED 4AJYV 3M8OH 2BWDA 3FQNB 4UT9H 4NQDD 1RSYA 4NFBA 4QRQA 3BRGC 5F7YC 2IAMA 4FTVA 1GSKA 2A6DB 3CVHB 2BO0A 1QSFA 2M2DA 2YIHA 4XXDB 1H15A 3HE6D 1AZUA 1R4XA 3QDGD 4IMLA 4ODWB 1ZGLM 2NY7L 3FCBA 5AZ2L 5ESAB 4NO2A 4JFHE 4KDTC 1AY1L 4WI5A 1XGTA 4YPJA 3MX0A 4J3SA 3F62A 2MQGA 3NJKA 3KCPB 3WJMB 1EGJL 1CD1A 3MODH 5DJAA 2Y06H 3FTUA 5E8DL 4O4YH 5IEKB 4PLKD 1YYMH 5I1JH 5LWYH 1YNTF 1KELL 1RZ7L 1OB1B 1SOSA 1RUMH 5ALBL 1N0XL 3I02A 1T21B 1IQDB 3B3IA 3B5HA 4L3EE 2H0PA 4U7MA 4HWEL 3SGKC 2EYSB 4Y2LA 1L9QA 4U1IB 5BOJA 3PP3K 4ZMVA 3ENEA 3S88H 2XKUA 1DEDA 4NPKA 1A7PL 5TE6L 4N0UB 3GSQB 1EBAA 4QRFA 3K0YA 3T0EA 2HG5B 5G55A 3FH5A 3O3AA 4YL9A 2A83A 2Y7NA 2FR4A 3UJJH 3BWZA 3QPKA 1N7MH 3P9MB 1AZRA 4RFEB 2XWRA 2PYFA 3FF8A 4LZKA 4HEMA 4OTXH 2SODB 2W0FA 4EN2A 2MOGA 3MLSH 3RYMA 2CHNA 5EB9A 3RUGF 2VLKD 1BF8A 4OFYA 5JOFB 4YIQB 4QJ5B 3B8YA 3A67L 1H19A 1ZJBA 5D7JA 4PP2A 1DZBA 2J12B 4J1UA 2AP2A 2GTZB 4X9BA 1GGCH 5A2BA 1D7BA 4GBXB 3RL2A 3AW5A 1UQSB 4WEUD 3PL6D 3LNHA 2VDPH 1MFVA 2HTKD 4LLUA 2NY6B 4XN7A 1CG9A 2WLIA 3EO9L 3L1OH 1GS8A 3C6LA 1PZUB 5MP6H 3OVUB 3HMWL 3HI1A 4ZFOL 2WNGA 3I3DA 5FYKD 4F91B 1KG0A 3SGEI 2VISB 4MQ7B 4WWOA 1C12B 4KQ4L 4LOUD 4AEFA 4OU3A 3IETB 4DVRH 4K5LA 3FTSA 1PQZB 3U7YH 1L9NA 1N8OE 5SV3A 1CD0A 4BIKA 1Y07A 3CX5J 5FO8A 3F6IA 1MHEB 2ZYRA 4KY1L 1J48A 4Q6KA 3RGBA 4JVWA 1UWXK 2EDRA 3V4UH 4TMPA 1JRHI 5F7EH 5FWRA 4FQ1L 5KVEE 3QRLA 3KJ6H 3Q9PA 2G2RB 3GC3A 1X5LA 2V5YA 5DJ8A 1FAKT 1K9TA 3M7OA 2BNRA 4JZNA 4UV4H 4PSRA 4LLDA 4ORGA 3TOPA 5G2NA 1CMOA 2JB6A 3VJ6B 1AFVH 2G60L 1D5XA 2D4FA 1XGRB 3OKNA 1XGTB 3NAAH 1IL1A 5T1DH 3VI4E 4B9KC 3RLSA 2FJGA 4AKPA 4QHLB 4XT1C 1S78C 3MCG1 3WFZA 1R3IH 1SEQL 1TQCC 1RFDL 4GRLA 5A16B 4NP4H 3DSNB 3U9UB 3P4NB 2DQEL 3NP3A 3EXLA 2WQUA 4JDTL 1MJ7H 1ADQL 1KIQB 1PKOA 5K9KA 4EUPA 3LKQA 4NKMB 4XRCA 4PYGA 3KPSA 2AVGA 4UDUA 1EHAA 3J27A 5D4HA 2NR6D 3NABL 4YH6A 2EDQA 3DVNB 3BP4A 5I30L 2HFTA 4Y1AD 1IO4C 1R24B 3U7WL 2LE9A 2YFOA 3IM1A 3MRBA 1WZMA 3MXWL 3OKEA 1S9WB 4FQLL 1S7XA 5DD0H 4WNSA 3ZE2E 5TJWK 1ZA6B 4NC1E 1U8CA 2VABA 4PRHB 2WOBA 1RZQA 4KV5E 4R0LA 1JGVH 3PABA 1CD8A 1F0LA 2C3WA 4R7VA 2C3VA 4LAQL 3DROA 2EE6A 4W9DC 3CIQA 2AJUL 2BP8A 4R5TA 1T5KA 4L1BA 4C4UA 3CTTA 5KWYC 4Z7VE 1C7SA 4XVUD 2VMCA 2BMKB 2H2SC 3S5LB 3LH8A 2GY5A 4MS8D 1Q9WA 1GOFA 5J12C 1MH5B 3WFEH 3MJWA 2XWTA 3TCXA 2XTJC 2VLME 4DHLA 3T77A 1MXDA 4YGVA 1DBKL 2AXGA 5TFSL 1M7UA 3IVKA 1HOEA 1HS6A 1ZA6A 4WW2F 1K5NB 2CCVA 3ZJAA 4OM1L 3KWTA 3HRZB 3LDBB 4PGBA 5D93B 1QZNA 3NA4A 1MHCB 3IPFA 5AUMB 1NDMB 2VXVL 1NLBL 3L7FA 3OJDB 3UAJC 5EHFA 2RB8A 1QZ1A 1QRKA 4R4BA 4CMMA 4N2DA 3OM3B 2VN6A 4DUWA 3IGLA 4KI5D 1BJ1J 3CX5K 3WFCH 3WL9B 1AGBA 1AYRA 4PJ6A 4Y5XB 5AOKA 1U33A 3H6AA 3MA7A 1UB5B 1NIFA 1JD7A 1XCQB 4OGYL 5EWIH 4J6IA 3V0VB 3IJYA 4M5YH 4B9FA 3D48R 4YSAA 2YC1A 3N41F 1F45A 4U1KA 1Z3RA 1F3JB 3CDZA 1MSPA 1O7DC 3RVVD 1W72H 3L3KB 3DJTA 1BVNT 4Z7QF 3TEUA 4FFYA 5F7UA 2HFFA 4NCC2 1EGJA 4Y19B 5AW5B 2E7MA 2WGNB 1NBYA 3DSFH 4AYEC 3QDJA 4JHUA 1Q9OB 4I7ZC 1RU9H 3LZPA 2C1OA 2HUHA 3QJVB 5CFAA 5JPNA 1F4AA 3G6JB 1EQWA 2BNRE 3QJFA 1OCZB 4LOVA 1BFTA 2JCCB 3PL6A 2X6BA 3NRQA 3ZU8A 5IB2B 4E41B 4KNQA 3RVVC 4IM8A 1CXHA 3KDMB 2VMDA 2MRYA 2P47B 3MRLB 5J1SC 2D73A 2G75B 1A0QH 3FTGB 5I8OL 4G71B 5EU3A 2FATH 5I1CH 3KPSD 5DI8A 1O9ZA 2VR5A 4XCFL 5EC1A 1SF3A 4N6RA 4JKMA 4N8CL 5F89A 1LWRA 1SN5A 3DVGB 4KKNA 1KG0B 3LN4B 1JHLH 2OXGB 4KROB 4P5MA 2VRQA 4PW9A 4PRNB 2K6WA 2BP8B 2QADD 4AI7A 4FQIL 4MYWB 4QAWA 5K1JA 1BP3B 1KN2H 1DFBH 1AGDB 1P0SE 3CZEA 4O5LH 7PCYA 4HJIA 3ZMRA 2QPEB 2UX6A 1GL4B 3BZ5A 3P40A 4QT5B 4AYDC 3N41B 1KYDA 1IGCH 3D69A 1T1YA 2EYRB 2BVQB 1HWGB 3OR6B 3RBSA 4BYHA 1NAMB 1QFWI 4Z3FA 3CZJA 5ANMB 2UZXA 2XCMC 1ECZA 3FCTA 4PV8B 4DAGH 5D4QA 3TS8A 4ATWA 5GGQL 3DBXA 5DRNA 3TIDA 1IC7L 1JNNL 5F7NC 5EEVA 2BY3A 4ZSOB 4DFIA 4TUJA 1HXYB 3SYOA 1I8KA 2P8PB 4KTDL 4L1SA 1JUFB 2CIIB 1BAFH 5F2FA 1QSFE 5IZ7A 1SOQA 5EIIA 2BCMA 4KO7A 1UM5H 4BZ1A 3QRFM 2ZSWA 3HPLA 1EMTL 3VWJA 1A21A 2PXYC 4ABVA 4OCSH 1KCUH 4D9LL 5BVJB 4LLDB 4ORGB 5IY5B 2VDOL 5IB4A 4FABL 2D31A 4PJAF 5DMKA 1J10A 1OV8A 2D7NA 3L5WB 4E9VA 4MJ4A 4K15A 3U0TA 4GINA 1BD2D 1RERA 4ODBD 2VE6B 3FU0A 3L54A 3T3ME 3QZWA 4L3CB 3MACH 4X80L 4QMEA 1WTGT 1KTKE 4KDTA 4Q6IC 2BDNH 3FJTA 2C4XA 3NSFA 5EC2A 2P5EA 3DTDA 3MRFB 1JF1B 1UXSB 3MLUH 4LAJH 1F3JA 3FQYA 3P0VH 1VGKB 2QKIC 4D0BB 3RQ3A 1GJIA 3NIGB 3KPRA 5EIIB 3ZHKA 2VXQH 2H4EA 2OTWA 4G1EA 1BECA 2OMUB 4IBUA 4MQ7A 5ISZA 3V4PL 4A2FA 2SEBB 1GIGL 1XAUA 2DQIH 3DUUB 3S96B 4K2UL 2ENSA 4G1MB 3C6LB 2XN9A 4ZFGH 1BX2A 5BV7L 2OA9A 1FV1A 3GIVB 4X9FA 5EU5A 1ROWA 4Y16C 5F3HA 3WD5H 1JK8B 3C5JB 4OZIB 1X4XA 4I9XA 1G9EA 1QI5A 2W92A 5CKAA 5E99L 1J1PL 1TJIL 4Z7IA 3EDJA 4H44C 1I8MB 2ZXGA 4QPEA 1U8QB 2VB5A 1X6LA 3DRTB 4JG0L 5H35B 3MLPA 1KPVB 4UTCA 4H8QA 3WE6A 1O6SA 5DUPL 3ZR5A 3U25A 4Y1AA 4YGVB 2Y1ZA 2NW3A 1ACYH 1HQRB 3APNA 3VXMA 4X7CC 5EO9A 3SY6A 4HWEH 2CKNA 1QQDA 1HKLH 2XV0A 3KPSE 4EVNB 5L4JA 4PLNC 4JN2A 1CYXA 1RUML 1JDDA 5D1QE 4A6YH 1TTFA 1UXWA 2ATKA 4JFED 3K8MA 4WO4C 1KCVH 1H0DB 4HC1L 5DJ6A 4CKVX 2XKNA 3TL5A 3MV9B 2ZOUA 3HNSL 5FKAB 1JWMA 4DP7X 5H35A 2YXMA 2WB7A 5ECJE 4NN6C 5JHDD 3K2IA 1ANUA 2D7OA 3HI5L 2Q6WA 1JZ3A 3W0WD 3B7RL 1A7QL 5DLML 1KGUA 4K3DH 4OLYL 3VGAC 3GXMA 2VLKA 3Q9QA 4FQJL 3ZKXC 4DK5A 3G9VA 5JXAH 1KJ2H 5D7IB 1DQQA 4MMZB 3BH4A 4XPAH 4B9JA 3MJ9A 2IH3A 1N0XH 4R26L 4KJYA 3KGTA 3O3BA 1XF2A 4GUQA 1AQ8A 4Q2ZB 4AGOA 3FN9A 3H2WA 4B95C 4NXKA 2O93L 2YEZA 2OW7A 3FB5A 1J0J<