4AYFB

Crystal structure of the complex of the caf1m:caf1 chaperone:subunit preassembly complex carrying the tyr40ala mutation in the caf1m chaperone
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
136
structure length
122
Chain Sequence
VEPARITLTYKEGAPITIIDTELLVGTLTLGGYKTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKFDISPKVNGENLVDVVLATGSQDFFVRSIGSKGGLAAGKYTDAVTVTVSNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHAPERONE PROTEIN CAF1M
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Chaperone/antigen
total genus 23
structure length 122
sequence length 136
ec nomenclature
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ayfB00
1Z9SB 4AYFB 1P5UB 3DSNB 1P5UC 3DOSB 4AZ8B 4B0MB 1P5VB 3DPBB
chains in the Genus database with same CATH superfamily
3N42F 4RDQG 1DCEA 2BVQB 3WIIL 2LOEA 2X4OA 4JZNA 5IJVB 6PCYA 5IJKA 2DYPA 1DLHB 4JO1H 2NY2D 1VFOA 4UINL 1XB3A 3A47A 3VXUD 4HAFA 4EAEA 2NUTB 4LVNB 3CXHJ 1WAAF 3GSXA 2DY2A 1G7MB 3BPNC 4KTYA 3ZL2A 4YXKL 3MDJA 2WXKA 3EH2A 1TT6A 3I84A 4HMCA 2NW3A 5I8EA 4N26A 4U1LB 3IDGB 5F3BA 2NY5H 5AVWB 4P2RE 4U33A 4ZFGL 5CP7A 1BREA 1LDPH 4MJIB 4WO4D 4MA1B 1PSKL 1QA9A 4PV9A 4A7GA 4XC1H 2NLJB 3TJEL 3OL2A 1VFAA 1G7LA 2A6KA 2GG1A 5JHDA 3HN3A 1R46A 3BZEB 1C5DB 3P73A 2IGTA 3RI5K 4AX3A 4ZZFA 1ASPA 1BAWA 1IGMH 4H1LH 3SGEI 3QH3B 1ECYA 3BLPX 3QUYD 1OM3L 3O9WC 5FYKE 2R0LL 2K1MA 3VYNA 3BPLB 2OMXB 3D2UD 1IE4A 3IXAA 1JXDA 4NQDA 4Y1TA 4F8TA 5JR1H 2VR5A 4O9HH 3C8HA 4XPFL 2H47C 1GRWA 1Q0XH 1AZUA 3G08A 3VXPB 4N5UA 4YFDB 4CDGC 3OJVC 4N2DA 5D1XD 1JYVA 2IPKB 3P11H 4JO4H 3E6HA 4QXUH 3ETTA 4YPGB 4NFBA 5T1MB 3UTPE 3U0TB 3CDYA 2OMNA 4UQ2B 3B9KA 2O61B 4XOCA 4LCWB 4JK0D 2A6IB 1S7QB 2F68X 2FBOJ 1T20B 1QKZH 3IFPA 1X7QB 3BQUA 3LQAL 5AW0B 2HMIC 1SVCP 1NDMA 3P9LA 4FG6C 4G83A 5FO7B 4QRSB 1MCDA 2BSBA 2YAPA 2YSSA 3CFCH 3K8MA 3MCYA 3A67H 1OY3B 4PJ7E 2O5YH 5L4FA 4XAKD 5DD3L 4FFWD 5IHZA 4MJ5B 3QUGA 4XWOC 3E8UH 4JFOA 3HG3A 3SYQA 3AAZA 1QSEA 3G5ZA 2PW2A 2VH5H 5DZNA 2F0CA 4HSAC 2HG0A 3JWNH 2GY7B 3DHJA 4KKCC 3PREA 5IHUH 4WW2C 2J57A 5LLIC 2C3WA 2W95A 3G6DH 5AW4B 3VGFA 4ELKA 4ONGH 3BKCL 1AVAA 1WFJA 3KPMA 1DQVA 3SHSA 1JERA 4ZX4A 3QDGA 4J3BA 5ICXB 3MLVH 4K2UL 4Q6IB 4UIKH 5DD0H 4TNGA 1ZVSA 3UC0H 2ITDB 3FUJA 4FXKB 2O5ZL 1JZ7A 4W9DC 2OLDA 2VLJD 4XVTL 7FABH 4TTDC 1D7DA 3GT6A 1NEUA 1KJ3L 4JFUA 1DBJH 2NR6D 3GXTA 4XNQA 1TUPA 2D0FA 1AGCB 3EJZD 1V7MH 4ZO8A 5ICYB 2EYSA 1QFHA 2J88L 1H9VA 1B0WA 3MMEB 1LMKA 3TA3A 2VL5A 1A3RL 3ZE1B 5B3SB 1HK6A 1EFXB 2I07B 4WGVB 4AGMA 4G8GA 3MRDA 2J5LC 1YN7B 5I6XC 5KUKA 1QWNA 3RUGF 3EYUL 1PLAA 5FUZH 1NL0H 3I85A 4PJIA 2QSTA 5IKCB 4K3HA 3CHSA 3BZ4B 3HZVB 1IM3D 3ILQD 4YEEA 3WFEH 1EBAA 1PY9A 1UA6H 2IBZY 2R4RH 2Z91B 5JNYA 3HA0A 3L1EA 1N59B 3ILDA 4IHOA 5KSAB 4F7PB 4RFEA 1GGIL 5IK3A 1U8KA 4HS6B 5E23A 3QPQC 1QHOA 3HIZA 2ICEC 3X2QB 2YGVA 5KYXA 1HKLL 1MCLA 2YPKA 1SZNA 4XBGB 2JJTC 2AMGA 3WL9B 3FTGA 4L2LA 4OJDH 3AXHA 4WFFD 2MHAA 4YDLC 3U7YH 5C6WH 1J5OL 1E9PB 5C70A 2BS71 4FLHA 1YAIA 1QEXA 2FT7A 3G9VA 1LEGA 1A0QL 1TQTA 3MBXL 1BMWA 3VW3H 3SCMB 1HHGA 4HU8A 4KK5D 1FZKB 4IRZH 5A2AA 5KYWA 3DO3A 2JE8A 4FFZH 4I2XB 2E4FA 2GSGB 2RACA 3O6FC 5DFAA 2CZNA 4IRSC 5FFGA 4FQ1L 3DJZA 3UBXG 5DRXA 4C56B 4AQ1C 3H3PL 4ZI8A 3Q6GH 3ZHLA 3UP1A 2DB8A 1JWSB 3G5YA 5TDPB 2G5BA 1JYXA 2HN7B 2OBGA 1CURA 2QSVA 6CGTA 4S1SH 5AW8B 4JFXB 4MBOA 2WXJA 1SLVA 4J3WA 4HS3B 1PDKA 2F8OA 3TEXA 5FFLA 2CO6A 2Z92B 5FGCE 4MNHB 4AC2A 4AJ0A 5JA8B 4A2EA 2ITFA 1C9SA 3KWWA 1F4YL 5KOMC 2Y4SA 3PE9A 4LSRL 5B7MA 3QFJB 5CGYC 3GMNA 1Y07A 1N8ZB 2EADA 3Q3GA 3H9ZA 1YEHH 5FFOA 5SX5H 5I1GL 3PWLA 5EOQH 4URTB 3BPCA 3M46A 3WIAA 4R97B 3SBQA 5D1ZA 3MO1A 3U36B 3U79A 4U0RC 3LRMA 1IMHC 2IXQA 1LO2H 3CSGA 2VB5A 4XPHL 1L9MA 1QWHA 4KO7A 3QZLA 1J9TA 2WPGA 4QRRA 1AQKL 2EDFA 1F00I 2L7UA 5FB8B 3D3VD 4EVNA 2OS7A 3L6FB 4XVUC 3OSVA 4CMHB 1T21A 3QWQB 1PZ3A 2WSPA 3H9SA 4PJ5D 2LVEA 3SBPA 2MJWA 5J1AA 2APXA 3G6AB 4IBYA 4MWFB 4BKSC 5FXCH 5JXAH 4P3CL 1KBKA 2ZCKL 5CFHA 4JANB 3NEEA 3IBOA 5D7IE 2WBJC 3O4LB 5J57B 1X6NA 1NUDA 3QUZA 4NKIH 3VFPA 5IWLC 1JXGA 2XQYA 4D9RE 4WRLA 4PWJA 5E2WH 1MCNA 2ZNXA 1QYGH 5HYSA 3CVIH 2BRRL 3ZKNC 3EBHA 3LKOA 2R0ZH 3MLXL 3LDBC 3UDWA 2B20A 3F3HA 5IROA 4KV5E 2GHZA 3CCHA 3L9YA 4RMBA 3HFMH 4AMKL 1CDCA 3ME0A 5EZLA 2WYHA 3MV7A 3QE5A 1ZLSH 2DTML 3V95A 1U8IA 4PRAA 4O51A 4EZLA 3KR3L 4A2MA 4LO9A 5T1DL 3DV4B 1ZHBA 4G6AC 1SHXA 4G3YL 4R3SB 1W8EA 2TAAA 3OJMB 1KIRB 5D96C 4BBWA 1KIPB 2F18A 4XMLH 1FBIL 2QSCL 5C07E 5TJWK 1CE6B 4QF1A 4XNYH 2XDHA 3DVIA 5CINL 2X6UA 4M5YH 5D72L 4DP7X 1W72B 1U3HD 4U3SA 4BZ1A 4MMZC 2OSWA 5I8KL 4XGZB 5I1IH 5TH2A 4UIMB 1BVLB 1BF8A 4WUUE 4PJEB 3SKOB 2IAMD 4HWBH 4OJCA 2OFQA 5G4OA 3QISA 3TO2A 3W0WD 1E28A 1FV1B 1HH6B 3KYNA 3QARA 5IB2B 1SQMA 2CBTA 2VDRL 1VADA 3PL6D 4FQPA 4XNBA 4WAFA 1NA8A 1S9WA 5AKVA 1G1YA 1KB9K 3KMDA 3VQLA 1H5BA 5E8OA 2WQ8A 3PHOA 2NYKA 5DVMA 3OSKA 5DQDH 4NHUA 3BKYL 1BXVA 5LQBL 2AAAA 1FAIL 5JDSB 1VSCA 3DRTB 5E70A 5CEZE 1J9CT 3K71B 3RIFF 3FUIA 1YNTB 3O2WL 1YNKL 4TSAL 3OB0H 2A6DA 3ARVA 3LXAA 1NGYA 4JFPA 4OF7A 1OWWA 3T0EE 1HH9B 4HJGB 3V6OC 4F9PC 5I30L 5ESAB 2I9TA 3QCVL 1P7HL 3HZ3A 4EPSA 1M05B 3AB0C 4YNYA 4I48B 3VJ6A 3GNML 2H41A 1TFPA 3QZMA 5I0VA 1CL7I 2P28B 4X2UA 2Z1KA 4LBEA 4LP4A 3UYPA 1MFCL 5F7AA 7TAAA 4RA0C 2L4OA 3DJRA 3MRPA 1INEH 2F1BA 1FNHA 3O6KL 1TR7A 2AQNA 4XCNA 4FFYA 3V0DA 4J2XA 2XV6B 3GSUA 1MELA 5T3ZE 4XVSH 5I18L 4R0LA 4DEUA 2E74C 2BSDA 3HBQA 1FWXA 4Z7QE 1PW3A 2JJUA 1KUMA 2FBRA 5IBLD 3SYAA 3RY6A 1D5XA 1H3VA 5MEPB 1AZRA 3DTXB 3IPBA 3LB6C 2LW3A 4DP4X 4B9GA 4NWTH 3KNBA 3AG4B 4HH9A 4RDBA 4AENA 4JREC 5BS0E 2J7LA 4J8QA 2W91A 4EI6A 2VKXA 4KRLB 5E94B 2W60A 4OB5H 3GJFA 2NT0A 1OF2B 5DEJA 4ZUTA 5D8JL 1YEEH 2EILB 3QG7H 3II2A 2ADGB 4HEMA 4P2QD 4WI7A 1R3HB 5EH1A 2R15A 3TBCA 3FN9A 1VF5C 4KPHH 4PJHB 2GAZA 1A47A 3AWGA 2VQ1A 5DUBA 2AS5M 1TJHL 5CJBA 4ZTOH 3O41A 2Z6FA 4F2ME 3S5ZA 1UZ8A 3HPLB 1NCIA 3V0IA 2VLKA 1E4HA 1TTCA 1NBYA 2G9HB 3EIFA 4N0CD 2XWXA 4B3EA 1TVBB 1DANU 4UT9H 5AVXB 4PJFA 4BZ1L 1G7JA 3IRCA 4CA4A 4LVNC 5HI3C 5K9OA 5ABZA 1HU8A 3U0WH 3HC3H 1NIAA 5C0BA 2OMTB 2LGNA 5HHNB 5EWIL 2DWXA 5AVZB 2GTZA 2EDLA 2C1PB 2LAGB 3P77B 4N8VA 1A7NL 3FTYA 1PGRB 4RISH 3RU8L 5AB0A 2WLIA 2VKWA 1QOKA 3BWSA 3QIWA 2EC9T 4MJ6B 1HINH 4MA1C 4JFQA 1O75A 2IQ9L 1F6AB 2BVYA 3GFUA 4GAYA 1GIGH 4JO2L 4O02H 4TLUA 5GSRA 3D09A 1WA2X 4KI1A 3G3LA 4IRJB 3TS8A 5TE4L 1UKSA 3QFGA 1CBVL 4C59B 4OLZH 3HCVB 4HWZB 4LPTA 4Z7WE 5JIKA 2DQHL 1BHGA 2Y5TA 1MRFL 2YO3A 3CK0H 2QDVA 4TNWF 2MTPA 1U8QA 3MYZA 1NBZB 2RAMA 4JCMA 5IM7A 3BPLC 1MF2L 3HHSB 1RMFL 4Z7NE 1CGWA 1EAPA 2B14A 2QHRH 4D3CL 5GZNC 3TO4D 4OD3L 4LSSL 2X40A 2VM9A 4G7RB 4KVCH 5JO5B 2EO1A 3E9UA 3EYOA 4I88A 3NSCA 4LSPL 1JV2B 4AYDC 4QHNB 2E75C 1P6AB 3NP4A 4M5ZL 3PABA 3SQBA 2V2WB 4OZ4B 3L5JA 2RALA 2A9CA 3PIQA 2VC2B 2JQZA 3QUHA 4L8SB 2VZ1A 4NQXB 4FFYL 4ADGA 4HISA 5I1LA 3IJYA 4UBDC 3EDKA 4PHZA 2R23B 3NACL 4YBQC 3WEOA 4EI5B 3V0GA 4FQ2H 5DJDB 1E8ZA 1QUPA 5BW7C 2DYSB 4P2CG 3M17A 4JDEB 3T6XA 2V3EA 5DJCA 3F83A 4PJXB 5ACLA 4CL7A 3NH7H 5FA4A 2XOTA 4EN3B 5T1KA 5HHXL 4GNKB 2RCSL 3T0BA 2ZWYA 4P48A 5EOCJ 5K1JA 4H1LA 1GZPA 3H2PA 1S8DB 4RMUA 1G7HB 4NKQB 5FO8B 1KEMH 2XA8H 4HVBA 4AYFB 2ZD0A 2EXTA 2PLTA 3WIHA 3UYOD 3K6DA 3WTWA 1BQSA 5SWZA 3IMWA 3NJJA 3NIDB 1HL5A 3FT9A 2OJZL 2PR4H 1JL8A 1UEYA 4TUKL 2C3VA 3CFMA 3N40F 4M1DL 1HCYA 3GIVB 4Q6IC 5HGAA 4AIZA 4OCYL 3RVVC 3JVFC 4OIIH 4FXKC 5AG9A 4Y5XB 5EU4A 4OZGF 4W9LC 1OB1B 2H4EA 1ZTMA 5ESQB 2ZAHA 1RJCA 1JYWA 2WO3B 5D6CB 4H5SB 1X5XA 2IOIA 3CPUA 1JZJA 5FWRA 4YUEL 2NW2A 1YQ2A 4PRPB 2EKSB 3U6RA 1E4KC 1LO4L 1M4KA 1NAKH 3VX1A 1FH5L 4L1HA 3ZQXA 4GFXA 4HBCL 4DPBX 5DSCB 3C87A 1A2YB 2BIMA 3KWXA 3K7UA 2K3HA 5C0RH 1CD8A 4JFZH 4YDZA 5JPMA 4Q4EA 1C7TA 5AUMA 2HVKB 2WQVA 4QTHA 5E7BA 4JM2A 4L3EA 4NEHB 2JB6B 3MCKA 4H25A 4FF9A 4YL4A 5DO2C 4IOIB 1UTDA 3D34A 4UANA 3NFPA 3OC8A 5KSAC 1WGVA 2WSKA 2IADB 2E47A 5KJRH 4KTGA 4K9JA 4QXTB 4YMPA 4GI9A 4NBYB 5JZ7C 5EA0L 4FP8L 2PCFA 4XZ4A 1S78D 2LU3A 4JFDA 4XMTA 1ETA1 4MZ3A 1W16A 3V0FA 2AXGA 3VAEA 2XTJE 5G5DB 4MKMA 5BQDA 1BQLH 3SDXF 3UBHA 1N19A 5DCCA 1AZZC 1FYTA 2ZX6A 4PLJD 1RZ8B 4FEIA 4PJ8D 4DGWC 2D2OA 3AMKA 3TV8A 1R17A 1I3UA 1WV7T 2XPGB 3CH1B 2DIEA 2W1NA 5C1MB 3SCMC 4JFFE 1J48A 1LDPL 1TIUA 2XVKA 3L2NA 2XVGA 3A21A 4BWTA 3O3BA 1KMGA 5TTRA 1T04B 4XC1L 5JYMA 2PPAA 5ID0B 4WU5B 3PWPD 2JKTM 1J8HE 2VW6A 1CVSC 2PCPA 5DHVB 1GKOA 4HHGA 2V0AA 2W0PA 1K5NB 1OLLA 3I9PA 2W9EH 5DUML 3ZT7A 3DXAB 3K4DA 4TULH 2VM3A 5EO0B 1O7DC 4YHPB 4FJYA 5HHMB 2JKXA 3MLYL 1CG9A 2GIXA 1CXFA 1IEBB 3CDCA 3LV3B 4NQDE 5IGXH 1CFQB 3SPHA 1B4RA 1GC1C 1E4WH 1DR9A 3IVKB 5J6HB 2JKSA 5JR1L 4UOW1 4O9HL 3E2HB 1F86A 2XX1A 3WIHL 2XQBH 3LEYH 1ERNA 1GS8A 2HB0A 1ED3A 4JE4B 3P11L 3K6SB 1WA0X 4QXUL 1JN6A 2M26A 4YSUA 3VRJB 1JGLH 4R97C 5CLXA 1MHHA 4KKNA 4PHXA 2MTAA 4AV0A 2ENJA 2ZCLL 4H88H 5FECB 4IRZA 1NOFA 1OP3H 3B34A 4YFLI 1T03H 3MRRA 4JQVC 4DUVA 2UZIH 2Y2TA 1BPLB 2VLJB 4NC0B 1SHWA 1U3NA 1ZT4B 5FPIA 5DFWH 1DL7H 3TEZA 4CMHC 3DIFA 5JQ6H 3QHFH 3QUXA 4UTCA 3B83A 2BIOA 4UYQA 3CFCL 5SX4I 1EDQA 2BC4B 3A67L 3CH8A 1DEDA 2O5YL 4OCWH 4H8UA 5F7LB 4J3UA 5CR8A 3ZE1E 3WXWL 2Q8BH 1MW0A 2UWEE 4J27A 2A73B 4MNGB 1DJHA 1KBPA 2WCSA 3ARBA 3I6KB 3DTUB 3NN8B 1XGPB 5F7DA 4HCRA 1FL6B 4K94C 2ATAA 4YHZL 2VH5L 1U33A 4Q56A 2OTPA 5EO1A 2YWYA 5F70A 3QUMA 2CO7A 4PP1D 4XB7A 4M6OL 4OIAA 2HT2D 5JMRA 3MUHL 3G6DL 3H9HB 5MERA 2BW5A 3EG9B 3OG6B 1VEPA 5IMMA 4J3XA 2XLLA 3UC0L 2D2CC 2HLFC 4GW5B 4BFNA 3X11B 1IVTA 4F33A 1BZEA 4YIQB 2ZOKA 1R5VA 4MS8C 3QWOA 3A3YB 4G1EA 4RMRA 3WEMA 5HHQA 2R2HB 3A4DA 4Z0BL 4F1ZA 2EXSA 4UMGA 4BDVB 5ICZB 3PWNA 4CW1A 3AWFA 2HTKC 1V7ML 3LNEA 4KXAA 4U6TA 5GGUB 4NYLA 3BN3B 5DWUH 4JDVA 4LL1A 4IKKA 4I2XE 1V7NH 1BZ7A 4MTMA 4PJIE 1IB5A 2NX5A 3DOSB 2FX7L 5DJ6A 1CVRA 5GS3A 2OK0H 1I1AA 3FB6A 5EU6D 1SDAB 5FW7A 1UA6L 2R4RL 2FEJA 4AOFA 4F93B 3L4VA 1WBZA 2CK0H 2AV1B 4YDKL 1DN0B 1BBDH 3AU1A 5E9DA 2CDEA 3INUH 2QQNH 1JZ2A 1XH0A 3KL5A 3P4MB 3ARZA 4TUOA 4HV8B 2JI2A 1VRSA 2LLNA 3DX8B 3HUJF 3STLA 3QEQA 3ZDXF 3BCDA 3CX5J 3U7YL 4CVXB 3QHZL 4JS7A 4P2OA 4Q6KA 3D39A 1J10A 2EDDA 3O6LL 5DYOB 5D7HA 2DQUH 4H13C 2AGJH 3VW3L 1DP0A 1YMMD 2XIIA 3I6LE 3MBEB 2R29H 3NCWA 1WUNT 1AE6H 4HJ0C 1C5CH 4IRZL 4X5XA 1HWHB 1A1MA 4FFZL 2JJVA 4YJZL 1MAJA 1ZSHA 1YDPB 1LWJA 3JWOH 4IU2A 3SO5A 1UURA 1K9TA 4D0BA 5JUEH 5CFAA 3Q6GL 2QQQA 4ZS6D 3E9TA 4NZUH 2O6FA 5E6ZA 2EYTB 3KXFE 4XI5D 2IQAA 3FB7A 4Z77A 3D52A 3AJ7A 2VSCA 1UJ3A 4I1PA 1IM9B 4S1SL 3U25A 4FTVA 2BSTB 2ZOWA 1I85C 3L3JB 3HZKB 5ILTH 3KZ8A 2E9JA 4N90E 3K81A 1YC7A 2R8SH 1A6TB 1RP9A 3F7YB 4RAUB 1Q0YH 4HCRL 5JIQA 1IU1A 2EYRA 2X70B 5CIPA 3WJJC 4NJ9H 3QULA 2JMRA 3QUML 3QO0B 1INQB 1YEHL 2YZ8A 1VB9A 5AAMC 5EOQL 3ZE0B 1SEQH 2AJZA 3HB3D 1AD9A 4BFFA 4KI5F 5FYLH 4ZNCD 1ODUA 2OTWB 4GT0A 2WHVA 4QRRE 1AXSA 1MJJB 1HZHH 2KZ1B 4U1HA 1WQVT 4ONHB 2VWEE 3LQMA 5LVEA 2H3XC 2A74A 3KWUA 4DP6X 1ZLWK 4RAVA 2DMHA 5DA0B 3J27A 3RVTC 3PGFH 2RTTA 3H9SE 2I25N 3GLDA 2JJSA 1J1OL 1XGTA 2EICA 5ISZD 5D1QA 3WUWA 1X4ZA 4KAQH 4HUVA 2WZPD 5D55A 2NY1D 3R06B 1KFAL 1PJ9A 2PUQT 5E2WL 4PR5A 1MFBH 4BJLA 1SYSA 1HVXA 1QYGL 1U3HB 2I69A 4RDQF 2FWSA 1YMHA 1N64H 3CVIL 3KPTA 1FVCB 1QBBA 1WZLA 2WLLA 3I75A 1R3JA 3VXRA 2R0ZL 2QL1A 4ODSH 1ZA6A 3RX7A 5KZCD 2ED6A 5AOIA 1U8OA 4I3SH 4CRPA 2VN4A 1WT5A 5DVLA 3W0WB 3HFML 1FFQA 3FT4B 1CU4H 4XCFH 4WEEA 4IRJC 4TM9A 3AT8A 1D5ZB 3MNDA 4DK6A 1TQVA 1R34A 3ZYZA 2Q76A 1ZD6A 4R5XA 3F01A 3RIFK 4KJPC 4OF3A 3PDOA 4XMLL 4XCEA 1B0GB 4RRPM 3L3KB 1E2ZA 2ARJB 4N2OA 3MRNA 4XNYL 2JKNA 1H6EA 2UZYB 3UTTD 4HS8L 4UT9A 3NCJL 4H8VA 4RIRA 4XX1G 4J1UB 2PO6A 4FGMA 5L0QB 4GW4A 4JRLA 4GT7A 4M6ML 1I9RH 1G7PA 4NQVB 5SWSA 2YD5A 4HWBL 1MCCA 1GJUA 2KH2B 4L8SC 2XN9B 1I8UA 2ZIDA 2HLEB 1A65A 1VEOA 4LOEA 1Q38A 1G7QB 1K4CB 2Z8VC 3RTLA 1JD7A 1HFUA 3RVWD 3D08A 4EI5C 1LDSA 4JDZB 4LOUD 5FYJE 3ULUE 3F6IA 4X9GA 3DRQB 4W6XB 2WWKO 3LRKA 3MLUH 5H4ZA 4TVPE 3RKPA 5DQDL 5CLYA 4WU7B 1MOEA 4EN3C 4WDIA 4Z5RB 5HVGB 3BIKB 3KW8A 4QY8A 4AG4H 3LEVL 3EJCA 1AQDB 4FMVA 4NM4H 4YGVA 3VCLA 5LNGA 1I7RB 5IEHB 4Y4HD 1QSFA 2K6ZA 3EOBA 3EJQA 1RL1A 3BXNB 3QZNA 4Y16A 2ZSVB 5T1LD 3QIBA 3OR7A 4GG6A 2WUCH 2ENYA 2GSMB 2H7WA 3JVGC 3MV9A 5KYUB 3N1PC 4LZKA 5CEYA 1ASQA 2YRZA 1FORL 2PTVA 3IEAA 5EB9A 5IVOA 5F7HA 4RSYA 2E6QA 2WOBA 4WI6A 4EIGB 4OCRH 4C83B 3TVMA 3QR0A 2H0FA 4K4KA 4JGUA 2P5WD 5JLZA 2Q5BA 4S0TD 3D6GA 1YECH 1ZHNA 5CEXB 4JFYA 4C55A 2CPCA 4DCQB 4Y5XC 4QRPB 4XVSL 3HAEB 3UG5A 4PJ9D 3HTLX 3REWA 3DX2A 1KT2A 3EHBB 1JP5A 4JPIA 4NWTL 1U91A 1IGJA 5PAZA 3T3PF 3NJNA 2F19H 1R3LA 4RMQA 3LPFA 3A4FA 4LMQI 3S98A 3LKRA 4OB5L 1RK1A 1HAUA 2MOVA 2X44D 1DO5A 1A4BA 4OFQA 4PVLA 5IMKA 4LSDA 4WENB 4D0CB 4JDTL 1UC6A 2WNKA 1AR2A 2FJSA 3EYVB 4Q9RH 2IWGA 4TNWK 1T7VA 3RGVB 3RL1B 2IAND 3B7SA 2CIIA 4HGKC 3G04A 1UA3A 1KJ2H 4PRIA 3VFWB 1SEBB 1JD9A 1UWXK 1WD8A 4UT9L 2RB8A 4OFVA 1IAOB 1VDGA 4N4YB 5BRZD 3RHWF 1NUGA 4U3XA 4AVIA 3U0WL 3HC3L 1XF5A 3FQNA 1RIUL 1XV8A 3G5VA 3IDMB 5T3XL 3RWJA 3UJTH 4AIOA 2B0SH 4LLMA 4QEGA 3WFHB 4UDTA 1RIVH 5C0CB 1L5GB 1VACA 4RISL 5B8CB 1H3GA 1M7XA 3J2PA 5IP4A 3O11B 4WW1A 5IW1A 3GSNH 2VGLM 3N44F 4XPBL 3HR6A 1BIIA 3RX5A 1TMCB 1I3RA 5ALCH 5BJTB 3ES6B 4FADA 2ZT9C 4HW6A 1GIGL 1ROWA 4O02L 2CO2A 4LLVB 4LHUD 3HI5L 3GBNH 3C6LB 4OLZL 1XQ4A 4JLRA 2CG9X 2YPVH 3PRZA 3WFBH 3VGGA 3IJSA 3BN9C 4N0YH 3VA2C 4UV4H 2GJZA 1IGYA 1R5WA 4WTQA 2BSRB 1K8IB 3V52L 1G1KA 2ZG2A 3P0YH 2QHRL 3OQRA 2GB2A 3D0AA 3F6JA 4U1KB 1P4UA 3NQKA 1KGJA 4FFWC 5H35B 3E2HC 1AHWA 2O6DA 1G9MC 2FJFA 1U9KA 3NAAL 1OEZW 4NRZB 4PVMA 5K5YA 1S5IH 1OGAB 5G55A 1PLBA 2DJUA 1FNFA 4Q9QH 1VFBB 3QJFA 5ITFA 2DAVA 1IJNA 4OKVB 5AOKA 4Q0XH 4YHOL 2KDGA 3EFOB 3GSWB 4GLRH 3TBWB 5BMFL 3U1QA 1I9IL 1NAMB 5E6RB 1MWAB 1FE8H 2AVGA 2AK1H 3DSFL 5CP3A 3GMQA 5DZLA 4W4OA 1TJGH 4FQ2L 3VXUE 4PU2A 1CF8H 2WLYA 3MNVA 3PLYA 4L0PB 4M1CC 4ODXB 5A7BA 5F96H 3BEVB 4CN4A 3FN0L 1DUZB 3NH7L 3KDMA 4IEFB 4PRHA 3VYPA 3C5ZD 3WMSA 1QHQA 3DWTA 1A7RH 4RWHA 2LFGA 1HCVA 2NR6C 2D31B 4LT7A 4ZXBB 4AITA 1LE9B 2CH8A 4ACPA 4TUUA 4L4TA 5CD3A 4QOKA 4RFNB 3DC0A 3VXTB 1BBJB 2X6VA 4FA7B 1NCGA 2WLMA 5FUCE 3L16A 2KPWA 3CVBA 2BP0A 2XA8L 3OMIB 3QEHB 4EUPA 1NKGA 1LEKB 3MNMA 4KKBD 4C4UA 4W9CC 1GCYA 3TV3H 1OAUH 3BP6B 2EVFA 4W9IC 1S7UB 1KCSL 1PKQE 2GJPA 3BD4A 1RFDH 3F85A 3FF8A 1RVFH 1VGEH 3KPOB 4OIIL 4TLTA 4X0KA 1IQDA 3D30A 5HI5D 5TGBA 5CWSB 2EZ0D 3BP5A 3ZX1A 1N5YL 2HFFA 3QJVB 4L1BA 3ESMA 3EOAB 1XR9B 4PJ8B 3U7WH 4CVZA 4UMSA 2EE3A 1A5FH 2N7SA 4UT6H 3RLSA 5D1XE 4GG8A 1SHSA 1ZS8B 5E9NA 1NAKL 4M8RA 1QO3B 1ZK9A 4JB9H 2DQIH 3P40A 2Y36L 2Q3ZA 3CFEA 2YUVA 3D0VB 4H40A 3IMRA 4JFZL 1KJVB 3JTSA 4UT7H 1RPKA 1TPXB 1P4LB 1UB5B 3PWPB 5BVJB 4LRNL 4QJ5B 2J25A 1VKXA 4Y1AD 4KNUA 3CIAA 1Z5LA 1AIFA 2J4WH 4WHDA 2JLLA 2CE6A 3PY9A 3WI9A 5GGVH 5C3TA 1QFWH 4IMLB 4WO0A 3DGDA 5KJRL 2EC8A 4J3OD 4JFDE 4KXBA 1H3PH 1X5ZA 3LNDA 2DKMA 4RRPA 4HJ1A 1FYTE 1BQLL 1HQRB 2RR3A 3F58L 3WN5B 4Y19A 3NMEA 4U3CA 4ZMXA 4PS4H 3H85A 2CHXA 4JR9H 4FKEA 1NH6A 1SJEA 1I9JH 1VAHA 3MBEC 1PZUB 3SYOA 1QTYT 1M6UA 4BUHA 3ZRCC 1GSKA 4U6HA 2Z7ZA 1TCMA 2VE6A 5GS0D 3W37A 1Z2KA 2IJ0C 3D8MA 5ECGA 3BH4A 3GMRB 4ODBD 2A7BA 3E38A 5E1QA 2VLMD 2VLJE 1EHKB 4KDTC 3BPOB 1WBYA 2W9EL 1IVLA 4L5FE 1USQA 4WHYH 4XP6H 5SWQA 3X1GA 4TULL 2R59A 4ZS7H 1EH9A 1HWWA 4P99A 3OAUH 1FN4B 5DA4A 5HJGA 1S5HA 3HEIB 3K72A 3RZCB 3QUKA 5C0FA 1E4WL 5C0EB 4W6WB 1FLTX 3J07A 1SY6H 4Z7QF 2YAFA 4M29A 3QGVA 2V3DA 3SOTA 5I73B 3LEYL 4G82A 5CU5A 4DKAA 3RP1A 5D7KD 2J8UA 3KBHE 3MNZA 1J5IA 1JGLL 1OTSD 4U2ZA 3TESA 3T2OA 4B9IA 2X4SB 2ICWA 4U6YB 4JRFA 4YSOA 1THAA 2R29A 3L5XH 3NVQA 4XVJL 5IMOB 1T03L 1DSFH 2BY2A 1I8MB 2IFFH 4JW3A 4WVRA 2QTVA 2CBPA 5D5ME 3GMLB 4MDIA 1ZLDA 2FLRT 3GHEH 1JUFA 1DL7L 4GBXD 2WZ0A 2V33A 3WY1A 3UG3A 5JQ6L 3QHFL 2ZNWA 2XSKA 4PJ6A 5HP5A 1F2QA 4KKQA 3I2CL 2ZXQA 1IAKA 2Q8BL 4JZNB 4XXWC 5JA9A 1A1NA 3T5WA 2ZXAA 1NCAH 1WZAA 3QNXA 3KL0A 1D6EB 4AV4A 5CJXA 3QORD 3GBMH 5DK0B 5KS9A 4I9WD 3AXLA 2RIKA 3GSXB 2ATKA 2WLZA 5KVEE 1U3HC 2X10A 1ONQB 1USZA 1OW0C 3CFJA 1FNGA 4KK6C 3EO1A 4QAWA 5GGVY 1HX0A 4ZJ9A 4K9EH 5CP7B 2VSMB 3EADA 4Z7WF 4S1RH 2WCPA 1PLCA 3D48R 3WCYA 5HDOA 3U83A 1X6LA 4HEPA 3CWGA 1VFAB 5JHDB 3O8XA 4HOMA 4YAQA 4QJ4B 4O2FA 2P8MB 4PW4A 4B9KC 2B5IB 4Z7NF 3NTCH 3L3IA 4Q58C 1RD6A 1UJTA 1V7NL 3DHMA 4LIQE 8CGTA 2F5AH 1GA2A 4AYSA 4DF9A 1W2KT 4YDVA 5D2NE 5C2BH 5EFIA 5IB5A 4XPGL 2OK0L 3FC8A 5FUOH 4PJBA 2G75A 2VXTL 4IIZA 4NKDA 3LQZB 3LXCA 4J28A 3M88A 2BSEA 1VENA 3D3VE 2VDQH 3MUGA 1JGUL 2CK0L 5L0QC 1DJWA 1QFUL 2YFOA 4PJGF 1BBDL 2OW7A 3ATFA 4GSXA 1JE6A 2NY4D 5JIHA 2QQNL 2LABA 4PJ5E 4NHCL 2EIJB 4F9LC 1OD9A 2IFGA 3WELA 4L37A 2V17H 4FQXA 2DBJA 5IV2A 4GY4A 5ERWA 4ATTA 1DN2A 3PXJA 3MFFA 2AJ3A 3FKUS 4OTXH 1HNGA 1CXLA 5HHOD 4JQXC 4QHKJ 1H8SA 1Z1WA 2AGJL 3BIBX 2IF7A 4G70B 4W9ZA 1NDMB 3L3OA 2JFCA 2R29L 5D7JA 1AE6L 1OP9A 1C5CL 3EJYD 5E8PA 1M6OA 1TVDA 3IDJA 2Z64C 5HJDA 1MCBA 3GSQA 4OZHA 3T4AB 5I1AA 1MREH 2J1XA 2YSSB 5I6KA 3WFCH 2WTRA 5LDUA 5JUEL 3ZZQA 2HKAA 4IBUA 5EUOE 4AQ8C 1D6VL 3ZTNL 4NZUL 2X4UB 4F20A 1WE5A 5IHZB 3MBWA 1FDLH 3KE0A 4FTVE 4JFOB 3RWFA 5BV7H 3H4FA 4LCIL 3AAZB 1QSEB 5HYFA 3G5ZB 2H0PA 3G6JA 3O3AB 5ILTL 3T0DA 2DQFA 4FAAB 3CIQA 2CO1A 3FAWA 1TZIB 1NMCB 3OAZH 3APDA 1PD0A 2R8SL 3ZKSD 1Q8MA 2P26A 4ELKB 5J8OA 1MRCH 3QDGB 1X5MA 3UAFA 4NJ9L 4Z7IA 4KJQD 1UQSB 4FABH 3MLSH 4NGHL 1QUNA 2DW5A 3UADA 6FABH 2UZXB 3KJ6H 2W65A 4KU1A 1DQMH 1QLEB 1ACZA 1SEQL 5JPNA 3NZ8B 4OW6A 4HJUA 5I16B 1H3UA 4P5TD 1LK3L 3EHBC 2VDMH 4OQTH 3OKLB 1GHFH 3QZOA 3IJ7A 4XNQB 4S11A 1U36A 1HZHL 2EYSB 1QRNA 1GGBH 2VL5B 3UAJD 5BCAA 1YSOA 3CFDB 4EZMA 3MA9L 3L4XA 4G8GB 3MRDB 2F9BT 3CJJA 3W0WE 1J0ZA 1ZVHA 2DLHA 3PGFL 4IU3B 4W9EC 1VGKB 3T0VA 3RGVC 2CIKA 1A64A 5D1QE 5JNYB 1XT5A 3ZYOA 2PKDA 4IHOB 4RFEB 1QPKA 2BZDA 5IK3B 4KAQL 1U8KB 4N2BA 3CAFA 4Q8BA 3TIEB 5IW6A 4NPYA 4Z3GA 2P5ED 5MEND 2HJLA 4HUCA 2DQTH 3JUZA 3MRKA 1G43A 3B5GA 4X4YA 5T8IA 2NNRA 1KCRH 4PJAE 4WI2A 3QPXH 4HK3J 1MFBL 3FTGB 1SN2A 1WWBX 2MHAB 3GKWH 1N64L 3MJGX 5IB3A 1BM3H 5B8CC 4UM9A 3S3PA 1Y6MR 3QDMA 1CD9B 1CXIA 3ZTJG 3OJ2C 1RLBA 5KYWB 3VH8A 2ZX5A 1QMUA 3TM6A 4DPCX 1H6TA 4XCFL 1PX3A 1NLDL 5DRXB 4ANKA 4U1IA 1AZNA 3TIDA 4UDUA 1V05A 1M56B 4OZFB 2MQ3A 3C6LC 1AS6A 3VFVA 3ETBF 2AEWA 2AXWA 2W07A 5ANHA 1EEZA 3KPPA 3NPZB 5LG1A 4HFUH 4CKVX 4OUOA 1UT9A 2B77A 5L2KD 2JIXD 2V37A 3GS4A 2CO6B 2VABA 4G6FB 5J3HD 3QS3A 4L3FA 2BIPA 4DK3A 3CD4A 1X5YA 3DVFA 3EH5B 3V7AE 4JN1H 3HAEG 2R56L 5T1LB 3TBTA 3LNHA 3PCYA 5ICUA 1JGDA 3V9EA 1UWGH 3Q3GB 3OKOA 5EG6C 3RJOA 4J12A 2VIRB 4P2QE 5LGJA 5T3XE 3MLZH 3L5HA 5FAAA 3C8DA 3PWLB 4BWUA 2VDRB 2EDQA 1OGSA 2XXFA 3BPCB 2OL3A 3Q01A 4JG5A 1K8DA 3QNZB 4AYGA 5LBGA 5CBAB 1J86A 1S6NA 1KXQA 2P5WB 2PP7A 2DM4A 2XUWA 3MO1B 5D1ZB 5JYLA 2YGPA 2IXQB 1KN4H 1IBBA 4Y9EA 3GSNA 3QJSB 5CSGA 4UQEA 4BZ2H 1AO7D 4ODTL 2WWOA 4QLWA 3MLUL 3FU3A 4PJ9B 3WNKA 3ZE1F 4EVNB 1L3NA 3EAKA 2UWEF 3P3TA 2FLBT 1EUUA 1T21B 4OD2A 2E0PA 2IWFA 3GXMA 4NM4L 5J1AB 2HXAA 1RUML 4AJYV 2XWTB 3O2VH 4ZXBC 2PWEA 1AMXA 5JW3H 1E50A 2HP4A 3SPVB 1A1OA 5BQ7A 5EDXA 1S9YB 3N1GC 3IE9A 5C92A 2NOYA 1BFOB 4ZRGA 5ACZB 3MTXA 4RFNC 4W9GC 3WY3A 3NCEB 2WUCL 3EGDB 4AW4A 1K85A 4DQAA 2VLRA 3CHPA 1E3XA 4E41D 3U1SH 3O3DA 3VFPB 1E3ZA 4A55A 1BQKA 2N3JA 4EKXA 5I1JH 4OCRL 5IUCA 2C7UA 1MAMH 2IANB 8FABB 3THMH 3PAVA 4RVBA 1CS6A 3RHWK 2JKWA 3ULVD 1BZQK 1YECL 3FBKA 3LKOB 1LQBC 3QI9A 5LO7A 1HTYA 4P59H 4BQ8A 4W70A 2FVNA 1S9VA 2DD8L 3GZKA 3U4KA 1WO2A 4MVBC 4PJ8C 3ME0B 5EZLB 4FKKA 1MI5D 1IE5A 1WFTA 5IJCC 1E3FA 4O51B 5F1IA 3S97C 4GSRA 1ZHBB 2BFVL 3IMBA 1NC4D 3CVHB 3QO1A 3B9VA 3ECUA 1CDIA 1XGRA 2X4QB 4ENZA 4QF1B 1TPXC 4G7VL 1OANA 1OARH 4BCZA 1DQJB 3KD4A 4Q9RL 4BXVA 1L9QA 1MVUA 1UEMA 2KC0A 4P5SA 1DVXA 1CICD 4K8RH 2NY6D 2DQDH 2XZQH 1Y0LA 3RWCA 1IC0A 3RILA 1HCFX 1VLXA 5FHAH 1IL1B 4JO3H 1A6UH 4LFHG 3QXWA 1JWMA 3U6XA 4GSQA 3EF7A 4FXGA 1UYWH 1E28B 3TO2B 5I5RA 3US1A 3CSTA 1R6VA 1VADB 3NSXA 3VDBA 2OL3L 3WN5C 5F89B 4PI0A 1S9WB 4RZKA 4L8DA 4YSRA 5E8OB 3PHOB 4XP4H 4F92B 4CSTA 3GSNL 5EIVA 2DN7A 5EO9A 4DGVH 3NBNA 4NHUB 4BSVA 2XXMB 4Y7OC 2EH7L 4AIEA 4GQ9L 4OGAD 3NA4A 3TYFB 4JPQA 3IRPX 1XH3A 5I0DA 4YSAA 4G6KH 5AB9A 3T2NH 2Z31A 2DLFL 5LBVA 3GBNL 2A6DB 2ZZUT 4MA3A 3WFBL 4JFPB 5CSBA 3BPOC 5H37A 3VSVA 4N0YL 3PP3H 4PLNC 5GRYA 3C5ZB 1CXEA 3DGGB 5B22A 4C4KT 2GK0A 2CXKA 3FT1A 3KM2A 2X3AA 2I9TB 1BV8A 1YO4A 4YNYB 4ONOA 3VJ6B 4GI8A 4YDMA 3RZCC 3MRJB 3P0YL 3PP4H 1EHXA 4LBEB 2B1HL 4ABWA 1FPTL 3RRQA 5CZXC 3TBVB 5I73C 2ADFL 1HKFA 3HG5A 4F7MA 4TUJA 3QVAA 4UM8A 1CTOA 1U2CA 4NNPH 4XCNB 1R47A 4XN8A 4Q9QL 3GSUB 3SE4A 4R0LB 4Q0XL 1X9LA 1RULL 4PBVC 1D5XB 3NZSA 1GW0A 2X1WL 3QQDB 5ELIA 2XIBA 3J8F7 3UX9B 2H6UA 3LQAC 3KNBB 1IC7H 2F54A 4AENB 1FE8L 4HH9B 2OM5A 2R1YA 5IVXE 4EI6B 1BX2B 3UCQA 4KKPA 1CF8L 1XL6A 4Z3EA 4IW4C 5F96L 2P8PB 1UOLA 1KTJA 1D5BB 2W9LA 5DJYA 5C71A 4ZUTB 3GKZA 2L7QA 4TPRL 1IT9H 1U4FA 1A7RL 1IC4H 1NCDH 2GAZB 2XBTA 3MV8D 3BYTA 2VQ1B 3ELAT 4XC3H 2YA0A 5DUBB 1GPOH 4FNSA 3O41B 3UOAB 3LZQA 1Q9LA 4QOKE 3N1MC 3SDDD 3SOBH 2VLKB 1NBYB 4KX8A 3P3RA 3HKFA 4PS8A 1OPOA 1UXSB 4PJFB 3UZVA 2NSQA 1G7JB 4Y4FA 2W38A 2C4FU 2ID5A 3JV4B 4N9GA 4PJEF 3RA7H 2QPDB 4B6ZA 4HGWA 1UWXH 2CRZA 4PJCA 5C0BB 2R0KH 3TV3L 5C0ND 1OAUL 4DK5A 1I7TB 3KLAA 2GTZB 3A4EA 3QXAB 1Z9PA 1CT8A 2VXSH 3BE1H 1RPQA 1WAAA 1QABA 1RFDL 5HI4C 2WLIB 1OSYA 1HIMH 1UD4A 3N50A 1RVFL 1VGEL 3QIWB 4X9FA 4KK8D 4JFQB 1S7RA 4X4XB 3RWGB 2DQCH 3FONB 4GRWH 5GSRB 1E5ZA 1J0YA 1KB3A 3NCYS 1F1GA 4LEOA 5JHLA 4MD4A 4MAZA 1A5FL 3KAAA 4UT6L 3SDYH 2HRPH 2PYEA 4X5LA 1YNTF 2CGRH 2B5IC 1UG9A 4GXUN 3ZDZB 3IPFA 5CNHA 1E6JH 1OGPA 1U8QB 2FDBP 3QR1A 2Z0UA 5LAPA 3RB7A 3WO4B 4YX2H 4R8WH 4UT7L 4IBSA 1XMEB 4L05A 1EAPB 5LGHH 1MLCB 4HKBA 4ZS6C 3F62A 4TOYH 3EGSA 1OM9A 2J4WL 1I1YA 1WWAX 1CF1A 1PEWA 3UBFA 4ANUA 5LXGH 2VL4A 5GGVL 3BWZA 4WEBH 4AQZA 4QIRA 3BFQG 2IIJA 3UTZB 1CDBA 3PABB 3ULUF 5L8JB 3DGCR 2YRPA 3PIQB 3O45A 3DSNA 4PM1A 3D25A 1SOKA 5C0GA 4MAYA 3VU1A 1SMOA 5FGRA 2HWZH 1HAWA 3IJYB 1ETZA 4X6DB 5I1LB 4BK4A 5CR1A 1BPVA 1NGPH 3OKMB 4PS4L 2ICCA 3M17B 4JR9L 3KCPA 4AXWB 2ZJSH 5DJCB 4B0MB 2XXGA 4MCZA 5GS1A 1ACYH 5T1KB 5HJBA 4WCYH 2OMWA 2YD2A 4NX0A 4XH2A 1PZDA 2WQSA 4TQHA 5DMIL 2C9UA 4MZ2A 3T4AC 2VJ0A 1RK0B 4H1LB 3U7AA 1GZPB 1JV5B 3ECBA 1BG1A 4R83A 1HI6A 2I5YL 4S2SA 3Q06A 2BY1A 1XF4B 1PZBA 1S46A 4MMYA 2Z8SA 4R96B 2OULB 1Z3GH 2EABA 3ETSA 3MRGA 3B56A 3BP4A 4GBXB 4ZS7L 5I76A 5TF0A 5AALA 2PP9A 5AKSA 2BNQA 3FPYA 1NMCC 1Q1JH 3ESNA 3ARED 1SY6L 2B4CH 2M83A 3CUPA 4X5QA 3GSOA 5HGAB 3WKNA 2VN7A 3ARGA 5EU4B 5DJ8A 2BM3A 3QORB 1EIBA 4D0DA 2DKUA 3KPRD 3WN6A 4HLEA 1BF5A 3DKHA 3NQIA 2HVJA 4JHAL 4WTXA 2HFTA 4I3GA 4N0FB 4MSWA 1D9KA 3STBA 4B95C 3EO9H 1DSFL 4GIAA 5JHLL 2ED9A 2IFFL 3HJEA 1PU0A 1RKRA 1XCXA 2ZYRA 3RDTD 5AUMB 3GMPA 4NI3A 3RVUD 4QTHB 2B7DT 5GISL 4JM2B 1T22A 2UY7A 3L9BA 5AOMA 3NFNA 4H26B 1A9BA 2BW4A 4P46A 2N1TE 4Y2DA 3RUGA 2CQVA 1YMME 2CKNA 3NFPB 4LNRA 1A21A 2DQEH 2VXVH 4R4BA 1U3YA 3JV6A 1L6ZA 3CSFA 4J6IA 2XN0A 4OGQC 1C12A 1SXCA 1X44A 1NCAL 4F8LA 1VESA 3DPBB 3HVDA 3C5SB 1FJ1A 4RGMB 5DI8B 2AXGB 2Y69B 3MPCA 1R19A 4GSUA 2LAAA 1UOVA 2RFXB 4TXVB 5GXBB 2NUPA 1DBBH 2AEPH 2ALAA 5HDWA 3CFTA 2KKQA 4OCNC 4K9EL 4HPOH 1P7QA 2P80D 4HHAA 1P84K 3KYOA 1F3RB 1YPZE 4QRAA 4PJXF 2NQDA 3C2SA 4AH2B 4K3JH 2MIZA 3D18A 3GO1H 4NC1C 3RVWC 5LWYH 3T6QC 2XX0A 2PCPB 4M61A 4DUWA 5KTEH 5HHOB 3V8OA 2VJXA 3V5DB 2KZWA 5K59F 3OR6B 2X42A 3O3UN 3P30H 5DHMC 3MQIA 2HUEA 4FQHA 1OWRM 1MH5A 2E7MA 4A66A 4I18B 3H7LA 3CBKB 1P4BH 4C4BA 4U6XA 4JFED 2O6EA 4HKJA 3ROLA 1E5CA 4HA1A 4LSQL 4UNVA 1IKNA 4O2EB 3NIDF 3O6MH 4HUWB 3SQOL 1B2WH 4WWOA 4NOFA 1MPAL 2VDQL 1C8QA 3P1VA 4JE0A 1AH1A 3NZHH 3FXIC 1JN6B 4D7BA 3QZWB 5BUPA 3C2AH 3DUSA 5ISZE 5D1ZC 1MHHB 2OR8A 2V17L 4GRLA 1X5LA 2R69H 4MNQD 5FR3A 4PY8J 4Z76A 1A4JA 1P9MA 3MRRB 4OTXL 4IBWA 3KHQA 3D85D 5AD0A 1H3WM 3AC0A 1ODAA 4PJ9C 3TCLB 2EIEA 5GRXG 3DIFB 2LVCA 5SV3A 3IKCA 1MREL 3NSFA 1TYRA 3PJNA 3WFCL 1YEIH 4Z3HA 4M7LT 2F53D 4HGMA 4PV1C 2ATPB 2WC7A 1QQDA 2ZYSA 4XNUH 5KVGE 3T2PA 3VXMD 4BM7A 3RAJH 3W3BA 4MD5A 4NNXA 1EZUA 1NBQA 2R1XB 3ABZA 1A7QH 3D33A 3ARBB 4ZODA 5JW4M 2OSYA 4BK8A 4KTEH 1OAZL 4LF3B 3X14A 1Y18B 3BAJA 3QUMB 2CO7B 1N2RB 1IAIM 3LJ3A 2FO4A 4F2EA 3UFIA 1KGYE 1DQIA 3RTQA 5MERB 2MCPH 4MASA 2G2RA 3TFKD 4JY6A 5IMMB 4FABL 1ZLUH 3MLSL 1CFTA 5IROC 4OZFG 6FABL 3HG1A 2E3VA 1H19A 4L23A 1DQML 3STZA 4AM0A 2R9HC 4KDWA 3UTTE 4HOXA 1JXFA 2ZOKB 3LNIA 2ADJA 3QWOB 4G1EB 5C0AD 5HHQB 3EYSH 4CMMA 3WAJA 2VDML 3MUJA 3N43B 3PQYD 3PWNB 2DQGL 3VI3E 4P57A 1Q9WB 3KLHD 3WD5H 4NYLB 5JW5A 1GGBL 4JDVB 1HSBA 1CDHA 3FUMA 4M4RA 3KLDA 5GJSH 4RNRB 4R5TA 5AYQA 1TENA 5IFAH 4FYRA 2ODHA 1XB6A 1JF1A 4JN2A 3UG4A 2NX5B 2X38A 2AITA 3ML8A 5DJ6B 5E2VH 3FB6B 3BGFB 2BZ7A 4W1TA 2CBQA 2A83A 2QVMA 3IDXH 4HX1B 4ADIA 1G9MH 2FYVA 3GWJA 25C8H 2MFNA 4O2CA 3FCBA 2JIXB 1CZ8H 3AU1B 4FNRA 5E9DB 4ELME 2WQWA 2CDEB 7PCYA 2PPEA 3VTTA 3WTSA 4W9KC 4PG9B 5FYLD 2DQJH 1SN5A 4Z7OB 1KPRA 4TUOB 3L9RA 4FX5A 3STLB 1KCRL 2CBMA 3KCWA 1B4JH 3QPXL 4DZ8A 3BRGC 5DC2A 3IJ8A 4N5EC 4QKXB 3H42L 1U41A 4PVBA 4P2OB 5EHFA 3D39B 4GJTB 2BJMH 1BM3L 2F74A 3QDME 5E6SB 1JK8B 3FB5A 3GEWB 2PXYA 1OTTC 3MJ6A 4ZMVA 1AOZA 4GO9A 1ECZA 2JELH 2P46B 1NEZA 4P5MA 1OV8A 3SYCA 3ARDD 4MQXD 2OXGA 5ESVB 3POCA 4IU2B 4X5WB 4LCUA 4D0BB 1X5GA 4N2GA 3VFGH 3T1FA 1XIWD 4BQ9A 1I31A 4BSWA 3H6AA 2XQYG 5MEOA 2YWZA 1B4TA 3FB7B 4Z77B 3UPRA 4RQQA 3HG4A 4HFUL 4BHUA 3C5ZC 1NIEA 1UHVA 1U58A 5FLVA 3BCFA 3FUFA 4P5KA 2YUZA 2AQ3A 3PHQB 4P49A 1HC1A 3BMWA 2XYCA 1TZGL 4PS3A 4FULA 3VMPA 1SHMA 4JFHD 4JN1L 2GJ6A 4U2YA 5J6SA 2UXVA 3CQQA 5CIPB 2E7LC 1EZSA 5DQ9B 3QULB 4LOVA 5AVYB 4LAJH 3P4NA 4XN4A 4BFOA 4AT6A 1UWGL 2G60H 3N91A 2RMNA 4MJ2A 3NCFB 2CKBH 2YBGA 3BDYH 3MLZL 4R0LC 3I6GA 3L95B 5FDYA 4LEXH 1UGKA 2AJZB 5F7FA 4UNIA 2CLZA 1ZHLB 3FTZA 4O58H 2BS8A 5IFJA 1MWOA 5DMKA 2YD1A 5D5MF 5IVNA 3IGFA 2PWFA 1KN4L 4LDOB 4APQD 1GVIA 4U1HB 1EHLH 1JHLH 5BRZE 2H1XA 5F6HJ 1XCTB 5JOPD 5HI5C 4LHUG 3FRPB 4DN4H 1OE2A 2EZ0C 1R4XA 3HE7B 1UFUA 5A16A 4L4VA 4QD2E 1E9QA 1UCBH 3QNFA 4QHPA 5FYKH 1MI5B 1ZKAA 3VFUA 2ZCZA 3GBLA 2PR9A 4IJ3B 3OLDA 1ZWIA 4UTBA 1NCUA 1XGTB 4I0KA 5C0IA 3W11D 4B97A 3BGAA 3M86A 4UNUA 1NC4B 3WUWB 4NO3B 4D94A 4FNTA 2A4CA 2D03H 2VLRE 3BVXA 1ICTA 4GAAA 4I77L 4G1MB 1K72A 4L9LA 3VSUA 1UZ6F 1DFBH 2CNZA 1FGVH 5TQ2L 1SYSB 4IGBA 2OJ1A 3H6JA 4WWKB 3THML 4PRDA 3KLKA 3U0PA 2DEWX 2WLLB 3I75B 1FL3A 4N8PA 1O0VA 1R3JB 4ICWA 3VXRB 2HG5A 5KSBE 4J3OC 2AV7A 4P59L 4ETYA 3M1CA 5FM4A 3QXDA 1IV8A 1N3NA 3EJSA 3QIWC 4X4ZA 1U8OB 4XMXA 4JPWL 3CDZA 3ENEA 3GJEB 4NUPA 5ADPH 1YEJH 2P43B 1NKRA 1X9QA 2OZ4A 4BELD 1YYLH 2XG5B 1B0RA 2KDYA 4G9FA 5INDA 5KJ4A 3WS6A 4YN3A 1TEYA 4EDWH 1GYWA 3KGUA 3MRBA 2VR3A 2YQ3A 3FCTA 4GB9A 3PDOB 1X5FA 3GXDA 4NQUA 3WO4C 3WNLA 4TNVF 3FQYA 1KIUA 3K8KA 2A6JA 1OARL 4MXVF 1MLBB 1AP2A 3ECQA 1OAYH 2A3TA 1H8LA 5E8EA 3AQZA 2FR4A 4BRJA 5IESL 2PO6B 1WD9A 4GW4B 4K8RL 4M62H 3BLKA 2GFBA 1COBA 3BUQA 5FHAL 5SWSB 4WFHD 4FHJA 4JO3L 2H26A 2V2TB 1Q90A 1NJ9A 3ZZ1A 2H3NB 5TDNB 3B7YA 3RFRA 4F7TA 2CU9A 4R7LA 3ZHNA 5AAWA 4JY4A 5DC4B 5FDWB 2WWNA 1JS4A 2BOBA 3ILPA 4A7TA 3HS0A 1F1AA 4O02B 2BCMA 1MY5A 2ESVA 3FW6A 3O9WD 5EUOF 1HS6A 1MCWM 2QT6A 4DGVL 4WDIB 5A6IA 3Q1EA 4PCKA 5BZXA 1URLA 4QY8B 4YGVB 4HXAH 3MRFA 2NTFB 1ZLEA 1QSFB 3CMGA 3QDJA 4X6EA 3SD5A 4AMWA 1MKFA 5BXFA 1JIBA 1QFWI 1Z7JA 3FN3A 4Y16B 3ZE2B 3KS0H 3QIBB 3S96A 4GG6B 1EZLA 5CEYB 4GBXC 4FYQA 1LL1A 5ALBH 5K9KA 3MV8B 4G5ZH 3TVMB 2GC4C 4J3OG 5I24A 1DJGA 3SDDB 1W0VA 2J8OA 4OVVA 1U3JA 2HMID 4JFYB 4NNPL 1M1XA 1U93A 2LLLA 2YD4A 4FG6D 3QORC 4Y1AE 3L4UA 1Q94A 4BFRA 1DEEA 5TFSH 1DQDH 4OU3A 3NJVA 3REWB 3KPSA 1Q0EA 1X9RA 5K39A 4OZGA 3VRLE 2EUWA 2F54E 2CCVA 43CAA 4JPIB 1U91B 3ZL1A 1MCKA 2YMXL 1WP6A 2ZUYA 3P9MA 1CLZL 4JGJA 1T83C 4UZGA 4XWOD 2KLSA 3LKRB 1DYZA 1I1CA 4UQ9A 2OZ4L 5F1NA 1RK1B 2EEXA 3E6FA 5CM1A 4RX4A 4AKQA 3D1MC 4NP9A 5C09D 1NBCA 4KKCD 1IT9L 4DP8X 4JM2C 3CPLB 4C58B 4OF0A 1IC4L 1NCDL 2Y6SC 1BZOA 1T1YA 2DMCA 2YZ1A 3GM8A 1GPOL 1UM5H 2CIIB 5LXVA 3S36X 4KJWC 4PJAF 4HMDA 5DU7A 5EU6A 3G04B 5I8OL 3VWJA 4FLOA 4BFBD 2X87A 1NICA 3JWNC 4G72B 3CLEH 4PRIB 4X50A 3HR5A 4TTDD 3LKSA 3MOAL 4MLSA 4X4KA 2AK4D 2ZWZA 4ZO9A 3RA7L 5CGMA 4RGMC 1DZ0A 3FOLA 3V4PH 1NWOA 2R0KL 3G5VB 3RWJB 2XIDA 5I6PA 2FB4H 2DEXX 4R7DB 1F13A 4UDTB 1DVSA 1ZE3H 1WAAE 5ETUB 1KPVA 1VACB 3SDXA 1E90A 3L4ZA 3LH9A 4H1LG 3H4HA 4I0PA 5IW1B 4OR1A 1CLYH 4OV5A 4MDJB 1MNNA 1IFHH 2LU7A 2DQCL 2WZ5A 5C08D 4BUQA 4QPEA 4X5RA 3FQTA 4J23A 4KQ0A 2PABA 2BXYA 3D4YA 2E56A 4WI0B 5BNXD 2HRPL 4JLRB 5D7KE 2BOCB 1J18A 2CGYA 3QPQD 2CGRL 2GIMA 1NPNA 5I1HL 3IJSB 2GBUA 2IPUG 2WP3O 1JZFA 1E6JL 2C5DC 3MRCA 5C3LD 1KEGL 4HPYH 2GJZB 1IGYB 3REVA 3EBGA 3DJSA 4FNPA 1R5WB 4YX2L 1Q9KA 1W0WA 4I18C 5I2IA 3BO8A 4QHLA 5CO1A 2FD6H 1JPEA 2O5XH 4GRMB 1GZQB 4TOYL 3VACA 1PZSA 2Q2LA 4AMXA 4ZMTA 1LD9B 2FJFB 1JF5A 4JRXD 2R7EA 5LXGL 3HZYA 1YUHA 4N6RB 3RDTA 3QJFB 5E4OA 5ITFB 3O6FD 3QXUA 2Y72A 3LEXA 3FH8A 5D2LE 1ZVYA 2FJHA 3RNKB 3AREB 1SJXA 2AXJA 1AKJB 3OX8A 2HWZL 1EQWA 2G2NA 4QHUA 3TN0D 1ZTXE 1X3DA 3IGKA 1HE7A 4QGYA 1EJOH 2GJJA 4OJFL 2EIBA 1K2DB 4R9HA 2BVTA 3HZMA 5DFVC 7CGTA 3MJ9H 4I9WE 3CDGA 1UWYA 1SXNA 1XVSA 2ZJSL 4GAGL 4X8JA 3KDMB 1UXWB 1MXGA 2P8LA 4UV7H 1ACYL 5L88H 4PRHB 3JWNG 3QP3A 1HHIA 2XRAH 4X9YA 1BQUA 3GTVA 5CGYD 1WF5A 5CJQH 2EIZA 1OQXA 2CRIA 4L4TB 3K2IA 5CD3B 5F9OH 3ARBC 3IS0X 3KBPA 5J56B 3W1ZA 1FZJA 4G8EA 1ETJA 1TFHA 2BP0B 2OR7A 3TBYB 1Z3GL 2EECA 2B3RA 5I1EH 1XZWA 3S7GA 5MHSD 5B3JF 1E2VA 2HT4C 1CLOH 1WDAA 3D51A 1FI8C 1Q1JL 4QXWA 3UTSA 5EIIA 4PRNA 4LLWA 2B4CL 3U30B 3TYGL 3ABKB 3Q44A 2X4PA 3UTQB 4NQCA 3AQDA 3FBQA 1IQDB 1QPXA 2AFNA 2E4TA 4XVUD 1KSRA 3FFCD 3HS9A 4N2AA 1J9RA 2HFFB 1E2WA 3ZHDA 5GRVK 3WJMA 4CVZB 1SDDA 4GKOA 4H20H 5KYNA 3R8BB 5CEZH 4N1EA 4QHMA 3NJHA 4GG8B 3AS1A 5E4AA 1CXKA 5IG7B 2KMWA 3ZZSA 3M8OL 3NRPA 2WBJD 1DCLA 2J3SA 3CFEB 3BSGA 1BD2A 1ML0A 3JTSB 5DK2A 2ZUQB 1KYFA 1P2CB 1IBGL 1U6AH 1U42A 1URIA 3E3QE 1L7TL 1UUNA 1DZBA 4JJ5A 3BGFC 4EEEA 3ZKND 3WE6A 1VKXB 1AIFB 2N7BA 3QZWG 1QLRA 4XNDA 3ZL4H 1TVHB 3F12B 3VQMA 1UZGA 3U4BH 2VLLB 3QJRB 2A9DA 3MHZA 2RD0A 1HXMA 3IXTB 5T3ZH 5DR5L 1FYHB 3VD0A 1AI1H 5HYQA 4N20A 4K3EH 2WMPA 1YY8A 3IRZA 4PWKA 4MAUH 4HG4J 5LAXA 2KYIA 3BDBA 4MYPA 3S2CA 3PPEA 4G6AD 1PL3A 1T1XA 1WIPA 4P2OC 4Y19B 5IIEA 3S8WA 1KV7A 3WNPA 3HUJA 4XNXH 1DBBL 4L8CA 2AEPL 4FZ8H 3IDYB 5FKAA 2AF2A 5HXMA 1IUZA 4MNQB 3DETC 4U6HB 3HC4L 3GO1L 1E27A 3SJVD 4JPKL 1YYML 1XR8A 1J8RA 3NCBB 5DZ9A 5FX3A 2AKRB 3JUYA 5EUKA 4J4PA 5AFAA 3QQ3A 3V0EA 1KPUB 4LCCB 1REIA 3P30L 1EEYA 4EOWH 5SWQB 3VD2A 3QPKA 3IF1A 3DI3B 1C08A 4PD4K 4CU6A 1S5HB 3K72B 3OPZL 4FD0A 3OKEB 3QUKB 5J9PA 4L3CB 4ZX3A 1I4FB 2YRBA 3GPEA 4N0UA 4YHIB 3O6ML 4Z3JA 4LLDB 1FFPB 4X7SH 4ZAKA 4GIPD 3NZHL 3EH1A 1B2YA 4PBWD 5IVXF 5E1AB 5L4JA 2J8UB 1XL4A 3E8VA 1OCRB 3MLTB 2BHYA 3C2AL 3NFSH 3S35H 2YD7A 1KLGB 2YPLD 3CHXA 4KZEH 5DF0A 2ICWB 2Z7UA 3PWUA 2DM7A 1ORQA 3LS5H 5EC1B 1J12A 5GGSY 2P5EE 5MENE 4AEEA 1SRDA 5EC2A 3QYMA 4Z95L 2P24B 3ATEA 1KTDA 3IFOA 1MHCA 2Q20A 5D7LB 3WHE0 4C47A 2WW8A 1TNMA 1DJZA 43C9B 3HE7C 4MDIB 3X3GL 2CLVB 1JUFB 1ITCA 2TRYA 4FNQA 5FO9A 3R1GH 4IJ3C 1UD6A 4J39A 2JJSC 3FRUA 1YEIL 1GR7A 3FU8A 5IR1A 3QCUH 1IAKB 4XE5B 5IHWA 2B59A 4YXHL 1A1NB 1A7QL 2NZ9D 4HETA 2NCEA 4RH4A 4DOHB 2XWZA 5EORH 4X42A 3IAPA 4KTEL 1XXFC 3G5XA 4PY8I 1F41A 4HF5H 3LB6D 5KS9B 1XIWA 2ATKB 1AOHA 1SOXA 1U8MB 4WWKC 2CKBA 3CFJB 1FNGB 3W2DH 4LLUA 3EO1B 5F0LB 4K7PH 4HJEA 1PSKH 4XBMA 3FQ1A 3W5MA 4RGNB 1XAKA 2UX6A 1HHHB 3TJPA 3DK2A 2M2DA 5IT2L 1KTBA 4IS6A 4F8QA 3LD8B 4Y1SA 1WT5C 3K0YA 3OLIA 4ZPTA 1ZDSA 3EYSL 3O8XB 4AGNA 5CU9A 1MXDA 5HDRA 3VRIB 4GMSL 4ODHH 4GP8B 2DWDA 1L4IA 2C8NA 4O2FB 1LE5A 1TO5A 4ODWA 1OM3H 3WD5L 1KGCD 3UYRH 2VERN 3FU7A 2MH4A 3MNWA 1O9VA 4WV1A 5HI3D 5IFAL 1FHNA 1OT2A 5IB5B 5EFIB 2ZF8A 3Q1SL 2BNUB 3LRHA 3O0RH 5E2VL 1TJIH 5KANI 4PJBB 1AO7E 1BXAA 2G75B 1MFAH 4NKDB 1T3FA 4OLUH 4I1NB 2D3JA 4KNTA 25C8L 2PO6C 5GGTH 1XDTT 1F6LL 2XC8A 4HXBH 1CZ8L 1ZA3A 3OMNB 4MJID 4URKA 4G8FA 4BGLA 3UO8B 4GPVA 4U1JA 2YXWA 3QC6X 2DRUA 3FRPG 4FQXB 1B4JL 3FQ4A 4Z23A 5IV2B 3LQAH 2N01B 2X12A 4HLZH 1XCQB 3ISYA 3GUFA 3WLWC 2OV0A 2BJML 4E41E 1NGXA 4OFYA 4AM0Q 4UNTA 4LB8A 1TKWA 3L8QA 3L3OB 4Y8DC 3DHPA 3SDCA 3WUWG 3IDJB 2JELL 3TEUA 5DZOA 4I3RH 4OZHB 4ZT1A 1A6ZA 2BMKA 4HFWA 2DL9A 3ULVE 4APQB 1JPSL 1GMIA 2QKSA 3VFGL 5FWQA 2GC7C 3AG2B 1RZGA 5GIRB 4IBVA 1SF3A 5I6MA 3HBGA 4Y16C 3MBWB 3QIBC 1HHJA 2NXZB 2DM3A 4WEMB 3RWFB 3BP7B 4LDEB 2P7TB 2AZAA 3KS0J 3G6JB 3LRSA 2H1PL 1MI5E 4Y2OA 2DQFB 4M3HA 1IGTB 1O5DT 2DL2A 1CFNA 2DV6A 1N0LB 5DUPL 5EZOH 2H32A 5GRUH 3TVMC 4K2UH 2GJ6E 4LCWD 4ENEC 2CSPA 4JZJB 1EJ6A 2EDTA 2O5ZH 2O1AA 3SDDC 1K5WA 1IX2A 2BY3A 5A43C 1BDYA 1T1WA 1QUNB 2A9BA 2A77H 4BSJA 2CKBL 1FL5A 1HOCA 2W65B 3BDYL 4Y5VA 1WCBB 3NDYE 2WLJA 3TL5A 3B5TA 3KPQB 2GTWB 4PTTA 1W15A 2J88H 1NFDE 4BWWA 1A3RH 3MRLA 1SPDA 4U7MA 4PGBA 4K7PY 1QRNB 1EHLL 3EYUH 2A38A 3QEGL 1H6FA 1KIQA 2N7AA 3BVTA 4NCDA 4N1HB 5EDSA 2MQGA 5HJ3A 5FYKL 3RKDD 1FA4A 2BNRD 2G5RA 5KN5B 2CIKB 3WLBB 3DX0A 1U8JA 4N1CA 4NQED 4WFED 5CN1A 5IW6B 1BZDA 4NPYB 1M7IA 2D03L 1QFOA 3X12A 3LZNA 5LBSA 3MRKB 2N59A 5J06A 2Q2EB 1J5OH 1W8OA 4X4YB 4NO0A 1DFBL 2MPAL 3JV0A 2AJUH 3HJ0A 1A0QH 1FGVL 2LR4A 4HH8A 4N87A 1YPZF 5F6HI 4PS7A 4BH7A 1CC3A 1RUQL 2FSEA 2VITB 5IB3B 4ZQKA 4UM9B 4J2QA 1EFXD 4CNIA 1CN4A 2WNGA 5GGRY 2E6JA 4OD1L 4HKZA 1RSFA 3BVWA 4FQ1H 1CGSH 3VH8B 3F7PC 1FNEA 1FGNH 4NZRH 4UQCA 5DO2D 3UROR 1FC1A 1D7FA 4ZMNA 4U1IB 5ADPL 2WB1A 3VWKA 4UDUB 3C8KA 5L6YH 1IKFL 4G42B 3B43A 3C75A 1GJIA 3HG2A 1XSIA 4KH9A 2W07B 1EEZB 3MLRH 1OSZA 4J3VA 4EDWL 1KBVA 2BSSB 4X7CC 2E5EA 4ZUVB 3WKPA 1F4YH 3H56A 1P4IH 1ZLVK 2NY0D 2C9SA 3PFQA 12E8L 1M1SA 4PREA 3UBXA 1KJ2B 4ILDA 2Y1ZA 4TSCH 1AHWC 1OAYL 3UO1H 5I1GH 4XMZA 3SCMD 4IKLA 5CCKL 4N9OB 3IJHA 5LGJB 3OKOB 3DA0A 4OGZA 4R4NC 3V4PA 1X5KA 4M5SA 3MRQA 3WNIA 2GUOA 4B7LA 1P5UB 4ZOCA 3D05A 4B41A 4KVPA 3FUEA 2UVEA 2LFEA 2E7CA 5EF3A 1QHPA 1QPPA 4OFIA 4C56D 1AQKH 2KHAA 3AREC 2ISDA 4MKTA 3T0XA 1QTSA 3GSNB 4N6QA 4W4OC 3GC3A 5GJTH 1MN4A 2AW2A 2Y2YA 4OY9A 1II4E 3IDIA 3BZFA 4NQSA 1SN0A 1LQSR 3H1ZA 3WS3A 2LU5A 1N5AB 3CN4A 3ALPA 2J20A 4PYGA 1A6AA 4OCSL 4G43A 4UQ3A 5IMLB 2WNXA 3QFJD 1JNHB 4XMKL 3T04D 4MGXA 5BQ7B 1LLAA 5BVPH 2ITCA 3NIFE 1E5UI 1M57B 1WISA 3W9EA 5K33A 4PV8A 1N9PA 4XCYA 1QBLH 5EBWB 5ALBL 2ZXDA 4V2BA 4LSVH 3ZLQC 4G5ZL 1LILA 2MQCA 4DVBB 3IFLH 1M9SA 5LBSL 3T1WA 3V6ZA 1TLKA 1CFSB 2BLFA 3GXUB 1WVZA 3D4CA 3U30C 2GJRA 4XO4A 3H55A 1GGTA 5KAQG 1QZNA 3VI3F 1JRHL 2AK4B 1QASA 1RZQA 3RY4A 4DKFH 2ZX7A 4KGLA 4PGJA 5TFSL 1DQDL 2QEJA 4OZGE 3KR3H 4JGMA 3N0PB 4Z9KB 1JVOA 5T1DH 1P6WA 3HNVH 3MJ9A 3GHBL 3VXSD 3ARUA 4G3YH 4UZUA 1JNLL 2J5LB 3IB4A 3K1DA 3I6SA 3MKKA 4IRSA 1EGJH 3PHSA 5C07A 3MX0A 4P4KA 4PGZA 5F7WC 5CINH 1B3JA 2OTUA 2ZUQC 2LLGA 4ELMF 1ZHKA 3MYJA 4M43H 1KYDA 2Y06H 3TPUA 1EANA 1KULA 2X0WA 3VVWA 1MVUB 4Z7VB 4KZDL 1UD3A 1IC1A 1PFOA 2HLFD 3N85H 4FTDA 2IH1A 3FO9A 4JKMA 4WUUA 3RWCB 1Y0LB 1F4XH 3CLEL 4B3VA 5GS2D 5D7SL 4E42A 5GGSA 1ZJAA 4MS8D 2KZKA 4ZG1A 1JWMB 3V4PL 5GRJL 1EXGA 4FXGB 1KELH 4OAWB 3HI1A 4FFVC 2EINB 3EJJX 3WO3B 2HTKD 3KGTA 2WANA 3IGLA 1RU9H 5JW4Q 3LN4B 3SDXE 1A7PL 1KYOK 3NG5A 4PSRA 4L8DB 2OKMA 3SPJA 3BKYH 5LQBH 3IDYC 1FAIH 1KCKA 3FHEA 1AXIB 2YSTA 3VG9B 5EO9B 3I02B 4OSUL 5MI0B 1CLYL 1IFHL 1AACA 3TN0B 3L7EA 3CHQA 5IF0A 1PCSA 2A9NL 2EIDA 1HQ4B 5D4IA 2Z31B 1VHPA 3VA6A 2QVIA 4YFEA 5I30H 1P6FA 2I7OA 3QCVH 4IIQA 2B1AL 4MA3B 4QCIA 3KPRE 4LCCC 5EOTB 3VGDA 3WDIA 2AJVH 4XMPH 4F58L 5J7CC 1PKOA 3T65A 2CDFA 1SQ2N 2XJLA 1H8OA 2GK0B 2R2BB 4YE4L 5JQHC 2EXWC 2JXMA 2JVUA 3LKQB 1TYEB 3FF7A 1KYUA 1DVQA 3AG1B 3O6KH 3MXVH 1AZVA 2EUZA 1H15A 4ETQB 4F7MB 5I18H 1AXTH 2Q86A 2WWMC 4HJ0D 2CAKA 4UM8B 4E9LA 1SUJA 2KUTA 1SOSA 3VFRB 2VN5A 4GI6A 3T3MB 3P3YA 1MJUH 3T77A 3WEXB 4TQPA 1M71A 4P2AA 1ZPUA 3M1BB 4PH8A 5KBNC 2PETA 1N4XL 1BLIA 3FFCB 1EZVY 2WVUA 3FCGA 3MJ9L 4WKZA 4HHWA 2YN3A 5DJYB 1WZ1L 5L88L 1JGIA 1TJHH 2F1EA 3CC5A 3EDFA 4OGXL 1TTFA 2GPZA 2EE0A 2W0FA 3QR2A 2XRAL 4FHKA 2Z4QB 5E6YA 3SY6A 4QRQA 1U8CA 5CJQL 1FHGA 4CJ0A 2WGXA 5HGBB 2FNBA 4QT5A 5F9OL 3TOPA 5HPMA 2Z93A 1R5IA 1L0PA 1NBVL 1JHTB 3B37A 2IO5A 1X5IA 4CBZA 2EJ1A 1N6UA 4DH2A 4QAMB 2PPDA 4NO2A 3MA7B 4HGWB 5KSBF 3U9UA 3ECWA 4PJCB 4JRYB 3UTSE 3A0OA 1D5IL 5CZKA 1CLOL 3Q05A 3RU8H 3S37X 3KLAB 3L5IA 3TH3T 1ORSB 3L08A 3FQUA 1AHKA 3IWUA 3SDAA 4AWJC 3LZLA 5FYJH 4NQCE 3ULUH 2IQ9H 4RGNC 3UJJH 1AQMA 1R75A 2HKFH 4FNLL 1Q1PA 3H2QA 3RVTD 4JFEE 4TVPH 3WUZA 2D8KA 4E9TA 3LD8C 1NFKA 4WI8A 5F7YC 4DFHA 1UA7A 3U2JA 1F3DH 1I53A 5FA3A 4Z7WA 2VMDA 3O8XC 3DUUA 3ILEA 5I15L 2O5NA 5CEZL 1EK3A 3MN8A 4FLRA 3F00A 4XNMA 4WK0B 4OLEA 4X99B 1BFTA 2Q1EA 4AUUA 1CBJA 4MQXC 4X6CB 3SJVB 1SYVB 2OMUA 5JDJA 4AV5A 4JAMA 3GSVB 3EGSB 1EVTC 4GSDH 4E0RA 3ZW3A 2V8LA 2DLTA 4F9PA 2WAHA 4FJ6A 3ZL4L 5J0BA 4QJ3B 3GM0A 4FFYH 3IU3A 2WY3B 2FZ3A 2CR6A 2QVKA 3OKKA 5DMYA 5KBLA 5T3ZL 2F53E 3NACH 5JHMA 3VXME 5A2CA 4IRJD 1AI1L 2L7JA 3DV6B 4PJGA 4OF8A 1DVZA 5C0GB 1D5MA 1ETZB 4FQXC 1S7TA 2Q7YB 4MAUL 4BKLB 2DJ4A 3LRGA 3LPOA 1FNLA 2QR0A 2HRGA 4PWIA 1HJCA 4X7TA 3ZDXE 2JNZA 5HHXH 1JZIA 4R84A 2RCSH 4KJPD 1JNJA 1K4DB 3GJFH 3KCPB 4PWGA 3L3OC 2OSLB 5TK4A 3V4UL 3B8SA 2OMWB 1OZTG 3P9WB 1GYUA 3BSHA 3INOA 3UL4A 1FZMA 4APQC 4LEEA 3ECBB 4YZFE 1D7BA 3ZDYB 1HCZA 1EAQA 1OT4A 1RZIA 4S2SB 2HT3C 2GEEA 4WWNA 5ADOH 2R4SH 4MMYB 2NXZC 4GP5B 3L3HB 4WGKA 5C0AE 4BK5A 2E8YA 3BP4B 2OJZH 1KJVA 4HDIA 3PQYE 4NKOA 2VDKH 2VDQB 3NA9L 4M1DH 2Q9OA 4HUNB 1XGZA 1DLHA 5GGTA 5GGRA 4ZD3L 4EI5D 5HDQH 3RVXD 5EEZA 4JZJC 1NPUA 2MNWA 4KROB 5HDBB 4OJYA 3CUPB 3TLRA 4DP5X 4HEPG 3FFOA 2PYFB 1XH1A 4XXDA 3TNNA 2VMJA 4KBPA 2ZYIA 2FGWH 5AWNL 3ARGB 3SN6N 3OJDB 2DMKA 5DJ8B 2EIMB 1G7MA 4IKJA 1KTLA 4J3OF 4D0DB 2AEOA 1DBAH 1NIBA 4Z7UB 3SY0B 1LO4H 1SUHA 1WLHA 2HVJB 2MOGA 4U1LA 2B1OA 3IDGA 5H2BA 4CAGA 3IDNA 1WIUA 4WTWA 4HCFA 1KLFA 3LS5L 2VNCA 1VJSA 4MJIA 4KI5E 2BWDA 2OI9B 5FYLE 3W9DB 2NLJA 5K9JL 3TZVD 3MREA 1UB6B 2AP2A 4I9XA 3ZDZF 5C9JA 3ZIYA 1DVFD 2F1AA 3BAKA 1ADQA 2OR9H 3CE1A 4F7EB 3BZEA 1RHHB 2J1KA 5HD8C 4GH7B 2E9WA 1AGEA 3Q8EA 3R1GL 1A9BB 3QH3A 4Y2DB 3RUGB 3QAQA 5BV7B 3BH9A 4P23A 4LNRB 2YFNA 5EA0H 3QCUL 1DSWA 4FP8H 4R4BB 5E0QA 3JV6B 1ES0A 1ZRUA 3GI8H 3DYPA 3L5WA 5DDHB 5HBBA 5EORL 2K9FB 5GZNA 5KVMC 2XWJB 4AL8H 4KMLB 4NO5A 1Q72H 4HF5L 1OCZB 1SXAA 2VXUL 4MMXA 4OCXL 3VXPA 1LNUA 3ZGHA 3BH8A 2QPEB 4PRPD 4P07A 1L7IH 3I74A 5HYJD 4X6DF 3W2DL 1ILUA 4JFFA 5T1MA 2QZ5A 3LAFA 4K7PL 2NY3B 5SV4A 3U0TA 4U4BA 3EDEA 5DYFA 3VSTA 4UQ2A 1P7QB 1NM4A 2VXQH 1FG9C 2G0KA 2VDMB 4HHAB 3KYOB 4TLSA 2QV2A 4JFHE 2D7MA 3ZGIA 2MCMA 2A6IA 1S7QA 1J8HA 1IAMA 4ZZKA 2YN5A 1YQVH 4OLXH 5DUMH 5TF1L 2ZUXA 4G59C 4ODHL 4L1SA 1W6LA 1WAPA 4KK9C 3MLYH 1PD1A 4QRSA 5FO7A 3UYRL 3OHMB 3TH2T 1FFNB 4FQHB 4CC1A 1V55B 3PAZA 3S8FB 2HPTA 4B7IA 4M6NH 1PBYA 3WIHH 4KUZH 3BDXA 4U6XB 2EKJA 3O0RL 4QRBA 1TJIL 1B4LA 4MJ5A 3CSPA 4GMTH 5JOPE 2CUHA 1G0XA 3KYMB 1MFAL 2D9QB 3ARFD 2FJGB 3PHAA 4RWYH 5D2LF 1M2VB 4OLUL 1E5YA 2X28A 3BKJH 3RJDA 5GGTL 1JNNL 4HXBL 9PCYA 5B39B 3LYRA 5TD4A 1P5UC 3TWYA 2VM4A 2ZCLH 4X6BB 2MNJB 3DUSB 4LPWA 1SJVA 4X98A 4GRLB 3GGWA 2SODB 1B3IA 4Z76B 3T0WA 3QWNA 4TSBH 4ZSOE 3BN9D 4GYBA 3DXAD 4V1DD 1S9XA 5AD0B 4PUBL 1H8NA 5HHMD 3WSQL 3FCUB 4N3UA 4PW3A 3VGHA 5ICYA 1E4KA 4I3RL 3EYFB 1SVZA 3BIAX 3MMEA 4NT6B 3WJLC 4U0QB 3WXWH 1BAFH 5CZVH 1JDCA 4LVEA 2UWEA 3S5YA 1C5BL 1YN7A 2BP5M 4MD5B 3F2LA 4NNXB 1P0SE 1P1ZB 3P02A 4OQ1A 4YHZH 3WTXA 3BZDA 1T5XA 3HZVA 4M8QA 1IARB 4M6OH 2Q10A 3A24A 1N59A 2BNRB 2QPFA 5KSAA 2OJEB 3CXHK 5EZOL 5GRUL 1JCVA 2FO4B 3VH8G 4FG0A 4NQEB 4M1CD 2MSPA 4ZUUB 5C8JA 5JW4R 2K0RA 2QJDA 5IB1A 2G2RB 4JY6B 5A2IH 3FFDA 2A77L 1SNRA 3O2DH 2NY7L 1LEIB 3HG1B 4UF7C 2LV4A 4Z0BH 1R33A 3UABA 3STZB 4AM0B 3CN2A 3GYRA 3NDZE 2WAQA 2ADJB 1UATA 1XGUB 2N1KA 2VJ8A 2FHBA 1GTFA 2V5SA 5I6NA 3BISA 4P57B 2CJTA 2K45A 4I2XA 5JW5B 4WFHE 3T3PE 1HSBB 4M4RB 5A6MA 5L7XH 1RJZB 2FX7H 4C56A 3VI4B 3LIUA 4L5FH 5F9AC 1LVEA 5HVWA 5EU3B 3LY6A 1JF1B 4JN2B 3ZMRA 4AVJA 1T1ZA 4QNPE 2ZSWA 2A83B 4JFXA 4YDKH 1JHKH 2AXFA 5E56A 5L9DH 3HRZB 4K5NA 2IMMA 4EF3A 3DK0A 4MNHA 4O2CB 4P2RD 1JRHI 3SKNB 1BOGB 5D9SA 2NY0B 2X6AA 4HIQA 4C4KO 2Y7NA 1G0YR 1KPRB 4LRIA 3QHZH 5E4IA 5K1VA 3L2MA 1IFRA 2AJUL 3V5HB 1N8ZA 4DZ8B 1UD5A 1XGQA 3O6LH 4FXGC 4KX7A 1TZHA 2BCKA 3B3BA 5TQ0L 3S48A 4L1DA 5CUSH 2JB5L 1A6WL 4NQTA 2F74B 3EZJB 2GVYA 5IUSA 1KCVL 1PG7L 4N2EA 3VG9C 4G5AA 5MI0C 2TRHA 1CGSL 3N3EA 1FGNL 4NZRL 2E76C 1NEZB 4GQQA 3TN0C 1J5DA 3MFGB 5B38A 2OXGB 2W0KA 1QRKA 1SOQA 4H0LC 2GSIA 4RMTA 4JQVA 4F2FA 1WZKA 3TH4T 3LN5B 1EGJA 3KXFA 4AGOA 4LPYA 5L2JB 4OZIE 4BSWB 5L6YL 2Z31C 3OKNA 5MEOB 4OJEH 3L6FA 2V6HA 3UPRB 4CU7A 1DSYA 3MLRL 2CNYA 1M2OA 4Q97A 3QZPA 3UTPD 4AQAA 3VFOA 4XCCL 4QWWC 4HCRH 4PMFA 4X0NA 1U58B 1P4IL 3L48A 1DANT 4P5KB 3MUZ1 5EBMA 1N26A 1L0YA 4XODA 1MUJA 3QUMH 4G80B 4KOBA 2IV9A 2HCZX 3O4LA 4TSCL 3UO1L 2ZG3A 3MRHA 1I8LA 5IOPA 4XP9H 5C09E 3L1GA 3P4NB 1KXTA 3MBED 4AT6B 4NKMA 5CILH 1OB0A 3OTTA 5AG8A 3SE4C 1Q9OA 1ZV2A 1D7CA 4RESB 1NLBH 3A6CL 3RWIA 2AQQA 3MRIA 1MJ8L 2CLZB 4OF6A 1E8XA 5DMKB 4Z8FL 2VDNH 2K8QA 2WV3A 3GUTB 2D3NA 4F57L 2XKSA 1IM9D 5GJTL 2FTAA 2JCCB 3QSKB 1BQRA 2VUYA 1MCOL 4R5VA 3P4LA 2IOOA 3I3DA 2EDRA 5LB1A 3VMOA 4A68A 5A16B 2APTA 1MCSA 4NSKB 1J1OH 2CA4A 4L4VB 4LIQH 1T4KB 3X13B 1B88A 3VFUB 3DV4A 3VXSB 5DMJB 3PF2A 1EEQA 2RGSA 5C0IB 3CMOH 4R3SA 5BVPL 3W5NA 5DJZA 5E4EB 4LLQB 3S3DB 1KFAH 1CE6A 2NPLX 4YO0A 2H9GB 5C08E 1RJYB 3HMXH 2MCG1