4AYPA

Structure of the gh47 processing alpha-1,2-mannosidase from caulobacter strain k31 in complex with thiomannobioside
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
434
structure length
434
Chain Sequence
TPEDWKALAADVRSEFQWAWQGYVAKAWGKDEINPVSGTSRSFFIEGHDLGLSLVEALDTLWIMGLDAEFQAGVDWVKANLSFDVDGNAQVFETNIRLVGGLLSAHLASGDPVLLAKARDLADRLAKAFEASPHGLPWRYVNLRTGAVSDPETNLAEIGTYLSEFGVLSQLTGERKYFDMAKRAMRHTLDRRSKIGLMAANIHAMTGAFTSRNASIDVYADSFYEYLWDAWALFGDEDCKRWAVECVDAQLAHQAKRYDGRLWFPMVDFETGAVTGTAQSELAAYYAGLLGQVGRKAQGDDYLASFTYLQATFGVIPESIDVTTGQPRRKHTGLRPEYPDACLNLWLIDRDPRYRRLAAIHYREMKATSRAAFGYTALKDITTRPMTQDDNCPGYWWSEQMKYYYLLFSDTPRIDYGQLQLSTEANVLRGFRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MANNOSYL-OLIGOSACCHARIDE 1,2-ALPHA-MANNOSIDASE
publication title The Reaction Coordinate of a Bacterial Gh47 Alpha-Mannosidase: A Combined Quantum Mechanical and Structural Approach.
pubmed doi rcsb
source organism Caulobacter sp.
molecule tags Hydrolase
total genus 177
structure length 434
sequence length 434
ec nomenclature ec 3.2.1.113: Mannosyl-oligosaccharide 1,2-alpha-mannosidase.
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01532 Glyco_hydro_47 Glycosyl hydrolase family 47
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4aypA00
1CEMA 5M7IA 3WKIA 3S4CA 1KWFA 2WYNA 5CD2A 2NVPA 4AYPA 3WKGA 4JJJA 1GAHA 1FBWA 1G9GA 2JG0A 3QXFA 2EACA 4XUVA 2AHFA 1FO3A 1VD5A 2B4FA 3RX5A 2OKXA 2ZBLA 2VN4A 2D8LA 1KREA 5M7YA 3H7LA 3ON6A 4CE7A 5DGRA 1JS4A 1DOGA 5GW7A 1WU5A 2GH4A 2RI9A 1V7XA 3QT9A 2GZ6A 4J5TA 3ACTA 3QT3A 2DRRA 3VXDA 3D3IA 3WKFA 1H12A 3S4BA 1UG9A 1GA2A 1H14A 3QSPA 3EZ8A 3RENA 5CA3A 5E2JA 3ANKA 4AYOA 3W7XA 2A8ZA 3QWTA 1GAIA 1G87A 1XWTA 2FV1A 2JJBA 3X17A 3WKHA 3WIQA 1RQ5A 3RX7A 4TXTA 1IA6A 1X9DA 1AGMA 1KRFA 3H3KA 3QG0A 2AHGA 3S4DA 2DROA 4L0GA 1FMIA 2CQTA 2CQSA 1LF6A 1HCUA 2YIKA 3QXQA 4WVCA 1FCEA 3WIRA 4FUSA 3S4AA 3P2CA 1FP3A 2EABA 1KKTA 3WC3A 4Z4JA 1WZZA 3GLYA 1H54A 3RSYA 3E73A 3ACSA 3QFYA 5KKBA 3W7TA 2RI8A 3ANJA 4CJ0A 4ZH5A 2QNOA 5CZLA 1NXCA 3QPFA 3W7WA 3WUXA 1XWQA 3QDEA 2EADA 1V7WA 2DRSA 3W7SA 1XW2A 3QRYA 3TF4A 1V5CA 2ZZRA 4TF4A 1F9OA 2FBAA 1LF9A 4AYRA 1WU6A 2FUZA 5GY3A 3RRSA 4DODA 4Z4LA 4CJ1A 2DRQA 3EQAA 4WU0A 1DL2A 1V5DA 2XFGA 2JF4A 3W7UA 3W5MA 1KSCA 1NC5A 3GT5A 1F9DA 1FBOA 1IA7A 2D5JA 3H2WA 1G6IA 3E6UA 1L2AA 1H13A 1UT9A 3PMMA 4Q2BA 3VW5A 2EAEA 3A3VA 4KTPA 5DGQA 4DOEA 4EL8A 3GZKA 3W5NA 3ANIA 1ULVA 3T33A 4ZG8A 1GLMA 2F6DA 1FAEA 1FO2A 2FV0A 3RX8A 2P0VA 3QFZA 3AFJA 1CLCA 2Z07A 1TF4A 2VN7A 1L1YA 1G9JA 2AFAA 1K72A 4WVAA 1KS8A 4L6XA 5MEHA 3CIHA 2RGKA 1AYXA 3K11A 1WU4A 4KTRA 4AYQA 4WVBA 1KSDA 1V7VA 1KFGA 3WIWA 4Q88A 1IS9A
chains in the Genus database with same CATH superfamily
5M7IA 1HX9A 3HXDB 3AFLA 4DI5A 5CD2A 3LZ9A 2I07B 3SFXB 2F0YB 1GAHA 1FBWA 3QXFA 4ZRQA 2AHFA 1FO3A 2OKXA 2VN4A 1OJOA 4M76A 3ON6A 4CE7A 5DGRA 1WU5A 3DSWB 4D94A 3QT9A 1H39A 1X1IA 3QT3A 2DRRA 4OZWA 3M74A 1HXAA 3S4BA 1FT1B 2FUQA 3W7XA 5ILYA 1LOHA 1DCEB 4FJQA 2FV1A 2JJBA 2WCOA 3M00A 3M77A 1RQ5A 3CU7A 4GTRB 4TXTA 3Q75B 1IA6A 4F13A 4MU9A 1AGMA 1GXMA 3QG0A 2WY8A 2WINB 1D8DB 3QXQA 4WVCA 1FCEA 1CB8A 3SQCA 1FP3A 4ZRPA 1KKTA 3WC3A 1C82A 3E73A 3QFYA 4GL3A 1N4QB 2H6FB 2E24A 3W7WA 5ILDA 4MMHA 1V7WA 4GTTB 1XW2A 2E22A 1O1RB 1V5CA 3E34B 1NL4B 3C72B 4AYRA 5GY3A 2J5CA 1HM3A 5JPNB 1DL2A 1V5DA 2XFGA 2JF4A 3W5MA 5AGDA 4EHMB 3GT5A 4F10A 1HN0A 1G6IA 1L2AA 2V8IA 3D5RA 5DGQA 3A3VA 1GSZA 1NI1B 2BRWA 3ANIA 3T33A 5IL8A 1GLMA 1GXOA 3RX8A 2P0VA 3OXUA 3QFZA 3AFJA 1CLCA 4NEIA 1L1YA 2PMVA 1LTXB 3Q79B 2V8KA 4V1SA 1W3YA 3CIHA 2RGKA 3A0OA 1WU4A 4Q88A 4YDOB 1TNUB 1QBQB 3WKIA 3EUVB 3S4CA 1KWFA 4AYPA 4MMIA 1G9GA 2JG0A 1N23A 4XUVA 1MZCB 2B4FA 3P5RA 1GXNA 2ONGA 2ZBLA 1KREA 4ONTA 4C1SA 1RWGA 3H7LA 1D8EB 3KSLB 5GW7A 1N94B 2RI9A 2B39A 1FT2B 1F9GA 2BRVX 1HXCA 4OZVA 1R76A 5FO8B 3N0FA 1TNZB 1H14A 4GTSB 3RENA 3Q7FB 1O1SB 3ANKA 4AYOA 1N22A 4GTMB 1EGUA 3QWTA 1XWTA 3WKHA 1X9DA 3HXFB 5IK6A 1KRFA 3S4DA 2AHGA 5IL3A 2DROA 4RNQA 4D4DA 3WIRA 4YCRA 3S4AA 2FUTA 1GHQA 4Z4JA 3M02A 1KZOB 1H54A 3M75A 4BOJA 2V3PA 5KKBA 1JCRB 1N4RB 1HM2A 1XWQA 3D5SA 3QRYA 3TF4A 1N4PB 1RWFA 1TNYB 2ZZRA 3PYAA 1F9OA 4OK4A 3HXEB 1S63B 3S9VA 3KLSA 3RRSA 4DODA 2DRQA 3EQAA 2WY7A 4WU0A 1N7PA 1N7QA 1KSCA 1H3AA 1KZPB 3M71A 5JPMB 1H3CA 2R2LB 3G6JB 1UT9A 3PMMA 4Q2BA 4KTPA 1N4SB 1LD8B 4KKIA 5IKHA 1OJNA 3PYBA 2F6DA 3SAEA 1HMWA 1G9JA 2ZISB 4WVAA 1TN8B 4LIXA 1AYXA 1O6QA 1X1HA 3SFYB 1KFGA 3WIWA 3VSNA 4GTOB 2ONHA 4BOKA 5GZKA 2ZIRB 2A73B 3SDTA 5ILJA 2G02A 5EATA 1QAZA 2NOJA 2WYNA 3Q7AB 4V1RA 2NVPA 2BB5A 5FO7B 2V3NA 3PZ3B 3P5PA 3NNBA 3SDRA 1O5MB 1LXKA 2H6GB 3E30B 2EACA 1UMPA 5ILIA 1SQCA 3RX5A 1RW9A 1VD5A 1QQFA 1JS4A 4L9PB 1DOGA 1HMUA 1H36A 1V7XA 3E80A 5ILHA 2GZ6A 3DSVB 1O1TB 3D3IA 1O6RA 3WKFA 1UG9A 1RWAA 5E2JA 4GTPB 5FO9B 2A8ZA 2H6HB 1GAIA 2BEDB 1N1ZA 2XQWA 3X17A 3WIQA 3RX7A 3SDUA 2PN5A 1QSJA 3H3KA 4KKJA 4L0GA 1RWCA 2CQTA 1LF6A 5FOBB 1HCUA 2YIKA 3DPYB 2BBCA 3KSQB 3RSYA 1FPPB 5IK0A 3W7TA 3PZ1B 2RI8A 3ANJA 2BRPA 2QNOA 5CZLA 1J0MA 5DHKA 5EASA 2EADA 4MBGB 1N21A 1TN7B 2H6IB 3DRAB 3Q73B 2SQCA 4TF4A 2XWJB 1WU6A 2FUZA 3M7CA 3NFVA 3W7UA 3Q78B 1FBOA 3PZ4B 1JCQB 3H2WA 4LNGB 4EL8A 1OJMA 3GZKA 1N20A 3OEDA 1W6JA 1SA5B 3E37B 1FO2A 1O6HA 2Z07A 3EU8A 1X81B 4L6XA 1TN6B 1W6KA 4KTRA 3K11A 1N1BA 1V7VA 3M76A 2X03A 1IS9A 3E33B 1CEMA 2GOXA 3EU5B 4D4AA 2WDAA 3DSXB 3WKGA 4JJJA 2V8JA 5IM1A 3E7JA 2D8LA 5M7YA 3G4FA 3HXCB 4GAXA 3M7BA 2WIIB 2GH4A 3SDQA 4J5TA 3ACTA 1H35A 3DSTB 3VXDA 1H12A 2XWBB 1GA2A 3QSPA 3EZ8A 5CA3A 2Q1FA 4FNVA 1LD7B 1G87A 1TNBB 1LXMA 1N95B 1C3DA 1S64B 1RWHA 4YDEB 1FMIA 5DHIA 2CQSA 5ILZA 1N24A 1H3BA 4FUSA 3P2CA 2EABA 1N9AB 1WZZA 3GLYA 4QT9A 3RJ3A 1H37A 3M78A 3ACSA 3HXBB 5ILKA 4GTVB 3PZ2B 3E32B 4CJ0A 5IKAA 4ZH5A 1NXCA 3QPFA 4OK2A 3WUXA 4E1YA 5JMDA 2BB6A 3M7EA 3QDEA 2DRSA 3W7SA 3M73A 1TNOB 4FXGB 1N7NA 4D4BA 1F1SA 2FBAA 4OJZA 1LF9A 1N7OA 3DSSB 4Z4LA 2G0DA 4CJ1A 1J0NA 1SA4B 3M01A 3K7XA 3M7LA 1NC5A 5IK9A 3VSMA 1F9DA 4D4CA 1IA7A 2D5JA 1O79A 3E6UA 2IEJB 1H13A 1HZFA 1I8QA 3G4DA 4GTQB 3VW5A 2EAEA 3SDVA 4DOEA 4FXKB 1N7RA 1OJPA 3W5NA 4LNVA 1ULVA 4ZG8A 1FAEA 2FV0A 3KQ4A 5JMFA 1TF4A 2VN7A 2AFAA 1JCSB 1K72A 3M72A 1HXGA 5EAUA 1KS8A 4ZH1A 1X1JA 5MEHA 1HV6A 4AYQA 3DSUB 4WVBA 1KSDA 4LNBB 5C05A 3N0GA
chains in the Genus database with same CATH topology
5M7IA 3HXDB 5CD2A 2I07B 3SFXB 2F0YB 1GAHA 1FBWA 3QXFA 4ZRQA 2AHFA 1FO3A 2OKXA 2VN4A 4M76A 3ON6A 4CE7A 5DGRA 1WU5A 3DSWB 4D94A 3QT9A 1H39A 3QT3A 2DRRA 3M74A 3S4BA 1FT1B 3W7XA 1DCEB 2FV1A 2JJBA 3M77A 1RQ5A 3CU7A 4GTRB 4TXTA 3Q75B 1IA6A 4MU9A 1AGMA 1GXMA 3QG0A 2WY8A 2WINB 1D8DB 3QXQA 4WVCA 1FCEA 3SQCA 1FP3A 4ZRPA 1KKTA 3WC3A 3E73A 3QFYA 4GL3A 1N4QB 2H6FB 3W7WA 1V7WA 4GTTB 1XW2A 1O1RB 1V5CA 3E34B 1NL4B 3C72B 4AYRA 5GY3A 5JPNB 1DL2A 1V5DA 2XFGA 2JF4A 3W5MA 5AGDA 4EHMB 3GT5A 1G6IA 1L2AA 2V8IA 3D5RA 5DGQA 3A3VA 1GSZA 1NI1B 3ANIA 3T33A 1GLMA 1GXOA 3RX8A 2P0VA 3OXUA 3QFZA 3AFJA 1CLCA 1L1YA 2PMVA 1LTXB 3Q79B 2V8KA 4V1SA 3CIHA 2RGKA 1WU4A 4Q88A 4YDOB 1TNUB 1QBQB 3WKIA 3EUVB 3S4CA 1KWFA 4AYPA 1G9GA 2JG0A 4XUVA 1MZCB 2B4FA 3P5RA 1GXNA 2ZBLA 1KREA 4ONTA 4C1SA 3H7LA 1D8EB 3KSLB 5GW7A 1N94B 2RI9A 2B39A 1FT2B 1R76A 5FO8B 1TNZB 1H14A 4GTSB 3RENA 3Q7FB 1O1SB 3ANKA 4AYOA 4GTMB 3QWTA 1XWTA 3WKHA 1X9DA 3HXFB 1KRFA 3S4DA 2AHGA 2DROA 4D4DA 3WIRA 4YCRA 3S4AA 1GHQA 4Z4JA 4BOJA 1KZOB 1H54A 3M75A 2V3PA 5KKBA 1JCRB 1N4RB 1XWQA 3D5SA 3QRYA 3TF4A 1N4PB 1TNYB 2ZZRA 3PYAA 1F9OA 3HXEB 1S63B 3S9VA 3KLSA 3RRSA 4DODA 2DRQA 3EQAA 2WY7A 4WU0A 1KSCA 1H3AA 1KZPB 3M71A 5JPMB 1H3CA 2R2LB 3G6JB 1UT9A 3PMMA 4Q2BA 4KTPA 1N4SB 1LD8B 4KKIA 3PYBA 2F6DA 3SAEA 1G9JA 2ZISB 4WVAA 1TN8B 4LIXA 1AYXA 1O6QA 3SFYB 1KFGA 3WIWA 4GTOB 4BOKA 5GZKA 2ZIRB 2A73B 3SDTA 2G02A 2NOJA 2WYNA 3Q7AB 4V1RA 2NVPA 2BB5A 5FO7B 2V3NA 3PZ3B 3P5PA 3SDRA 1O5MB 2H6GB 3E30B 2EACA 1UMPA 1SQCA 3RX5A 1VD5A 1QQFA 1JS4A 4L9PB 1DOGA 1H36A 1V7XA 2GZ6A 3DSVB 1O1TB 3D3IA 1O6RA 3WKFA 1UG9A 5E2JA 4GTPB 5FO9B 2A8ZA 2H6HB 1GAIA 2BEDB 2XQWA 3X17A 3WIQA 3RX7A 3SDUA 2PN5A 1QSJA 3H3KA 4KKJA 4L0GA 2CQTA 1LF6A 5FOBB 1HCUA 2YIKA 3DPYB 2BBCA 3KSQB 3RSYA 1FPPB 3W7TA 3PZ1B 2RI8A 3ANJA 2QNOA 5CZLA 2EADA 4MBGB 1TN7B 2H6IB 3DRAB 3Q73B 2SQCA 4TF4A 2XWJB 1WU6A 2FUZA 3M7CA 3W7UA 3Q78B 1FBOA 3PZ4B 1JCQB 3H2WA 4LNGB 4EL8A 3GZKA 3OEDA 1W6JA 1SA5B 3E37B 1FO2A 1O6HA 2Z07A 3EU8A 1X81B 4L6XA 1TN6B 1W6KA 4KTRA 3K11A 1V7VA 3M76A 1IS9A 3E33B 1CEMA 2GOXA 3EU5B 4D4AA 3DSXB 3WKGA 4JJJA 2V8JA 2D8LA 5M7YA 3HXCB 3M7BA 2WIIB 2GH4A 3SDQA 4J5TA 3ACTA 1H35A 3DSTB 3VXDA 1H12A 2XWBB 1GA2A 3QSPA 3EZ8A 5CA3A 1LD7B 1G87A 1TNBB 1N95B 1C3DA 1S64B 4YDEB 1FMIA 2CQSA 1H3BA 4FUSA 3P2CA 2EABA 1N9AB 1WZZA 3GLYA 4QT9A 3RJ3A 1H37A 3M78A 3ACSA 3HXBB 4GTVB 3PZ2B 3E32B 4CJ0A 4ZH5A 1NXCA 3QPFA 3WUXA 2BB6A 3M7EA 3QDEA 2DRSA 3W7SA 3M73A 1TNOB 4FXGB 4D4BA 2FBAA 1LF9A 3DSSB 4Z4LA 2G0DA 4CJ1A 1SA4B 3K7XA 3M7LA 1NC5A 1F9DA 4D4CA 1IA7A 2D5JA 1O79A 3E6UA 2IEJB 1H13A 1HZFA 4GTQB 3VW5A 2EAEA 3SDVA 4DOEA 4FXKB 3W5NA 4LNVA 1ULVA 4ZG8A 1FAEA 2FV0A 3KQ4A 1TF4A 2VN7A 2AFAA 1JCSB 1K72A 3M72A 4ZH1A 1KS8A 5MEHA 4AYQA 3DSUB 4WVBA 1KSDA 4LNBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CEM A;  5M7I A;  3WKI A;  3S4C A;  1KWF A;  2WYN A;  5CD2 A;  2NVP A;  4AYP A;  3WKG A;  4JJJ A;  1GAH A;  1FBW A;  1G9G A;  2JG0 A;  3QXF A;  2EAC A;  4XUV A;  2AHF A;  1FO3 A;  1VD5 A;  2B4F A;  3RX5 A;  2OKX A;  2ZBL A;  2VN4 A;  2D8L A;  1KRE A;  5M7Y A;  3H7L A;  3ON6 A;  4CE7 A;  5DGR A;  1JS4 A;  1DOG A;  5GW7 A;  1WU5 A;  2GH4 A;  2RI9 A;  1V7X A;  3QT9 A;  2GZ6 A;  4J5T A;  3ACT A;  3QT3 A;  2DRR A;  3VXD A;  3D3I A;  3WKF A;  1H12 A;  3S4B A;  1UG9 A;  1GA2 A;  1H14 A;  3QSP A;  3EZ8 A;  3REN A;  5CA3 A;  5E2J A;  3ANK A;  4AYO A;  3W7X A;  2A8Z A;  3QWT A;  1GAI A;  1G87 A;  1XWT A;  2FV1 A;  2JJB A;  3X17 A;  3WKH A;  3WIQ A;  1RQ5 A;  3RX7 A;  4TXT A;  1IA6 A;  1X9D A;  1AGM A;  1KRF A;  3H3K A;  3QG0 A;  2AHG A;  3S4D A;  2DRO A;  4L0G A;  1FMI A;  2CQT A;  2CQS A;  1LF6 A;  1HCU A;  2YIK A;  3QXQ A;  4WVC A;  1FCE A;  3WIR A;  4FUS A;  3S4A A;  3P2C A;  1FP3 A;  2EAB A;  1KKT A;  3WC3 A;  4Z4J A;  1WZZ A;  3GLY A;  1H54 A;  3RSY A;  3E73 A;  3ACS A;  3QFY A;  5KKB A;  3W7T A;  2RI8 A;  3ANJ A;  4CJ0 A;  4ZH5 A;  2QNO A;  5CZL A;  1NXC A;  3QPF A;  3W7W A;  3WUX A;  1XWQ A;  3QDE A;  2EAD A;  1V7W A;  2DRS A;  3W7S A;  1XW2 A;  3QRY A;  3TF4 A;  1V5C A;  2ZZR A;  4TF4 A;  1F9O A;  2FBA A;  1LF9 A;  4AYR A;  1WU6 A;  2FUZ A;  5GY3 A;  3RRS A;  4DOD A;  4Z4L A;  4CJ1 A;  2DRQ A;  3EQA A;  4WU0 A;  1DL2 A;  1V5D A;  2XFG A;  2JF4 A;  3W7U A;  3W5M A;  1KSC A;  1NC5 A;  3GT5 A;  1F9D A;  1FBO A;  1IA7 A;  2D5J A;  3H2W A;  1G6I A;  3E6U A;  1L2A A;  1H13 A;  1UT9 A;  3PMM A;  4Q2B A;  3VW5 A;  2EAE A;  3A3V A;  4KTP A;  5DGQ A;  4DOE A;  4EL8 A;  3GZK A;  3W5N A;  3ANI A;  1ULV A;  3T33 A;  4ZG8 A;  1GLM A;  2F6D A;  1FAE A;  1FO2 A;  2FV0 A;  3RX8 A;  2P0V A;  3QFZ A;  3AFJ A;  1CLC A;  2Z07 A;  1TF4 A;  2VN7 A;  1L1Y A;  1G9J A;  2AFA A;  1K72 A;  4WVA A;  1KS8 A;  4L6X A;  5MEH A;  3CIH A;  2RGK A;  1AYX A;  3K11 A;  1WU4 A;  4KTR A;  4AYQ A;  4WVB A;  1KSD A;  1V7V A;  1KFG A;  3WIW A;  4Q88 A;  1IS9 A; 
#chains in the Genus database with same CATH topology
 5M7I A;  1HX9 A;  3HXD B;  3AFL A;  4DI5 A;  5CD2 A;  3LZ9 A;  2I07 B;  3SFX B;  2F0Y B;  1GAH A;  1FBW A;  3QXF A;  4ZRQ A;  2AHF A;  1FO3 A;  2OKX A;  2VN4 A;  1OJO A;  4M76 A;  3ON6 A;  4CE7 A;  5DGR A;  1WU5 A;  3DSW B;  4D94 A;  3QT9 A;  1H39 A;  1X1I A;  3QT3 A;  2DRR A;  4OZW A;  3M74 A;  1HXA A;  3S4B A;  1FT1 B;  2FUQ A;  3W7X A;  5ILY A;  1LOH A;  1DCE B;  4FJQ A;  2FV1 A;  2JJB A;  2WCO A;  3M00 A;  3M77 A;  1RQ5 A;  3CU7 A;  4GTR B;  4TXT A;  3Q75 B;  1IA6 A;  4F13 A;  4MU9 A;  1AGM A;  1GXM A;  3QG0 A;  2WY8 A;  2WIN B;  1D8D B;  3QXQ A;  4WVC A;  1FCE A;  1CB8 A;  3SQC A;  1FP3 A;  4ZRP A;  1KKT A;  3WC3 A;  1C82 A;  3E73 A;  3QFY A;  4GL3 A;  1N4Q B;  2H6F B;  2E24 A;  3W7W A;  5ILD A;  4MMH A;  1V7W A;  4GTT B;  1XW2 A;  2E22 A;  1O1R B;  1V5C A;  3E34 B;  1NL4 B;  3C72 B;  4AYR A;  5GY3 A;  2J5C A;  1HM3 A;  5JPN B;  1DL2 A;  1V5D A;  2XFG A;  2JF4 A;  3W5M A;  5AGD A;  4EHM B;  3GT5 A;  4F10 A;  1HN0 A;  1G6I A;  1L2A A;  2V8I A;  3D5R A;  5DGQ A;  3A3V A;  1GSZ A;  1NI1 B;  2BRW A;  3ANI A;  3T33 A;  5IL8 A;  1GLM A;  1GXO A;  3RX8 A;  2P0V A;  3OXU A;  3QFZ A;  3AFJ A;  1CLC A;  4NEI A;  1L1Y A;  2PMV A;  1LTX B;  3Q79 B;  2V8K A;  4V1S A;  1W3Y A;  3CIH A;  2RGK A;  3A0O A;  1WU4 A;  4Q88 A;  4YDO B;  1TNU B;  1QBQ B;  3WKI A;  3EUV B;  3S4C A;  1KWF A;  4AYP A;  4MMI A;  1G9G A;  2JG0 A;  1N23 A;  4XUV A;  1MZC B;  2B4F A;  3P5R A;  1GXN A;  2ONG A;  2ZBL A;  1KRE A;  4ONT A;  4C1S A;  1RWG A;  3H7L A;  1D8E B;  3KSL B;  5GW7 A;  1N94 B;  2RI9 A;  2B39 A;  1FT2 B;  1F9G A;  2BRV X;  1HXC A;  4OZV A;  1R76 A;  5FO8 B;  3N0F A;  1TNZ B;  1H14 A;  4GTS B;  3REN A;  3Q7F B;  1O1S B;  3ANK A;  4AYO A;  1N22 A;  4GTM B;  1EGU A;  3QWT A;  1XWT A;  3WKH A;  1X9D A;  3HXF B;  5IK6 A;  1KRF A;  3S4D A;  2AHG A;  5IL3 A;  2DRO A;  4RNQ A;  4D4D A;  3WIR A;  4YCR A;  3S4A A;  2FUT A;  1GHQ A;  4Z4J A;  3M02 A;  1KZO B;  1H54 A;  3M75 A;  4BOJ A;  2V3P A;  5KKB A;  1JCR B;  1N4R B;  1HM2 A;  1XWQ A;  3D5S A;  3QRY A;  3TF4 A;  1N4P B;  1RWF A;  1TNY B;  2ZZR A;  3PYA A;  1F9O A;  4OK4 A;  3HXE B;  1S63 B;  3S9V A;  3KLS A;  3RRS A;  4DOD A;  2DRQ A;  3EQA A;  2WY7 A;  4WU0 A;  1N7P A;  1N7Q A;  1KSC A;  1H3A A;  1KZP B;  3M71 A;  5JPM B;  1H3C A;  2R2L B;  3G6J B;  1UT9 A;  3PMM A;  4Q2B A;  4KTP A;  1N4S B;  1LD8 B;  4KKI A;  5IKH A;  1OJN A;  3PYB A;  2F6D A;  3SAE A;  1HMW A;  1G9J A;  2ZIS B;  4WVA A;  1TN8 B;  4LIX A;  1AYX A;  1O6Q A;  1X1H A;  3SFY B;  1KFG A;  3WIW A;  3VSN A;  4GTO B;  2ONH A;  4BOK A;  5GZK A;  2ZIR B;  2A73 B;  3SDT A;  5ILJ A;  2G02 A;  5EAT A;  1QAZ A;  2NOJ A;  2WYN A;  3Q7A B;  4V1R A;  2NVP A;  2BB5 A;  5FO7 B;  2V3N A;  3PZ3 B;  3P5P A;  3NNB A;  3SDR A;  1O5M B;  1LXK A;  2H6G B;  3E30 B;  2EAC A;  1UMP A;  5ILI A;  1SQC A;  3RX5 A;  1RW9 A;  1VD5 A;  1QQF A;  1JS4 A;  4L9P B;  1DOG A;  1HMU A;  1H36 A;  1V7X A;  3E80 A;  5ILH A;  2GZ6 A;  3DSV B;  1O1T B;  3D3I A;  1O6R A;  3WKF A;  1UG9 A;  1RWA A;  5E2J A;  4GTP B;  5FO9 B;  2A8Z A;  2H6H B;  1GAI A;  2BED B;  1N1Z A;  2XQW A;  3X17 A;  3WIQ A;  3RX7 A;  3SDU A;  2PN5 A;  1QSJ A;  3H3K A;  4KKJ A;  4L0G A;  1RWC A;  2CQT A;  1LF6 A;  5FOB B;  1HCU A;  2YIK A;  3DPY B;  2BBC A;  3KSQ B;  3RSY A;  1FPP B;  5IK0 A;  3W7T A;  3PZ1 B;  2RI8 A;  3ANJ A;  2BRP A;  2QNO A;  5CZL A;  1J0M A;  5DHK A;  5EAS A;  2EAD A;  4MBG B;  1N21 A;  1TN7 B;  2H6I B;  3DRA B;  3Q73 B;  2SQC A;  4TF4 A;  2XWJ B;  1WU6 A;  2FUZ A;  3M7C A;  3NFV A;  3W7U A;  3Q78 B;  1FBO A;  3PZ4 B;  1JCQ B;  3H2W A;  4LNG B;  4EL8 A;  1OJM A;  3GZK A;  1N20 A;  3OED A;  1W6J A;  1SA5 B;  3E37 B;  1FO2 A;  1O6H A;  2Z07 A;  3EU8 A;  1X81 B;  4L6X A;  1TN6 B;  1W6K A;  4KTR A;  3K11 A;  1N1B A;  1V7V A;  3M76 A;  2X03 A;  1IS9 A;  3E33 B;  1CEM A;  2GOX A;  3EU5 B;  4D4A A;  2WDA A;  3DSX B;  3WKG A;  4JJJ A;  2V8J A;  5IM1 A;  3E7J A;  2D8L A;  5M7Y A;  3G4F A;  3HXC B;  4GAX A;  3M7B A;  2WII B;  2GH4 A;  3SDQ A;  4J5T A;  3ACT A;  1H35 A;  3DST B;  3VXD A;  1H12 A;  2XWB B;  1GA2 A;  3QSP A;  3EZ8 A;  5CA3 A;  2Q1F A;  4FNV A;  1LD7 B;  1G87 A;  1TNB B;  1LXM A;  1N95 B;  1C3D A;  1S64 B;  1RWH A;  4YDE B;  1FMI A;  5DHI A;  2CQS A;  5ILZ A;  1N24 A;  1H3B A;  4FUS A;  3P2C A;  2EAB A;  1N9A B;  1WZZ A;  3GLY A;  4QT9 A;  3RJ3 A;  1H37 A;  3M78 A;  3ACS A;  3HXB B;  5ILK A;  4GTV B;  3PZ2 B;  3E32 B;  4CJ0 A;  5IKA A;  4ZH5 A;  1NXC A;  3QPF A;  4OK2 A;  3WUX A;  4E1Y A;  5JMD A;  2BB6 A;  3M7E A;  3QDE A;  2DRS A;  3W7S A;  3M73 A;  1TNO B;  4FXG B;  1N7N A;  4D4B A;  1F1S A;  2FBA A;  4OJZ A;  1LF9 A;  1N7O A;  3DSS B;  4Z4L A;  2G0D A;  4CJ1 A;  1J0N A;  1SA4 B;  3M01 A;  3K7X A;  3M7L A;  1NC5 A;  5IK9 A;  3VSM A;  1F9D A;  4D4C A;  1IA7 A;  2D5J A;  1O79 A;  3E6U A;  2IEJ B;  1H13 A;  1HZF A;  1I8Q A;  3G4D A;  4GTQ B;  3VW5 A;  2EAE A;  3SDV A;  4DOE A;  4FXK B;  1N7R A;  1OJP A;  3W5N A;  4LNV A;  1ULV A;  4ZG8 A;  1FAE A;  2FV0 A;  3KQ4 A;  5JMF A;  1TF4 A;  2VN7 A;  2AFA A;  1JCS B;  1K72 A;  3M72 A;  1HXG A;  5EAU A;  1KS8 A;  4ZH1 A;  1X1J A;  5MEH A;  1HV6 A;  4AYQ A;  3DSU B;  4WVB A;  1KSD A;  4LNB B;  5C05 A;  3N0G A; 
#chains in the Genus database with same CATH homology
 5M7I A;  3HXD B;  5CD2 A;  2I07 B;  3SFX B;  2F0Y B;  1GAH A;  1FBW A;  3QXF A;  4ZRQ A;  2AHF A;  1FO3 A;  2OKX A;  2VN4 A;  4M76 A;  3ON6 A;  4CE7 A;  5DGR A;  1WU5 A;  3DSW B;  4D94 A;  3QT9 A;  1H39 A;  3QT3 A;  2DRR A;  3M74 A;  3S4B A;  1FT1 B;  3W7X A;  1DCE B;  2FV1 A;  2JJB A;  3M77 A;  1RQ5 A;  3CU7 A;  4GTR B;  4TXT A;  3Q75 B;  1IA6 A;  4MU9 A;  1AGM A;  1GXM A;  3QG0 A;  2WY8 A;  2WIN B;  1D8D B;  3QXQ A;  4WVC A;  1FCE A;  3SQC A;  1FP3 A;  4ZRP A;  1KKT A;  3WC3 A;  3E73 A;  3QFY A;  4GL3 A;  1N4Q B;  2H6F B;  3W7W A;  1V7W A;  4GTT B;  1XW2 A;  1O1R B;  1V5C A;  3E34 B;  1NL4 B;  3C72 B;  4AYR A;  5GY3 A;  5JPN B;  1DL2 A;  1V5D A;  2XFG A;  2JF4 A;  3W5M A;  5AGD A;  4EHM B;  3GT5 A;  1G6I A;  1L2A A;  2V8I A;  3D5R A;  5DGQ A;  3A3V A;  1GSZ A;  1NI1 B;  3ANI A;  3T33 A;  1GLM A;  1GXO A;  3RX8 A;  2P0V A;  3OXU A;  3QFZ A;  3AFJ A;  1CLC A;  1L1Y A;  2PMV A;  1LTX B;  3Q79 B;  2V8K A;  4V1S A;  3CIH A;  2RGK A;  1WU4 A;  4Q88 A;  4YDO B;  1TNU B;  1QBQ B;  3WKI A;  3EUV B;  3S4C A;  1KWF A;  4AYP A;  1G9G A;  2JG0 A;  4XUV A;  1MZC B;  2B4F A;  3P5R A;  1GXN A;  2ZBL A;  1KRE A;  4ONT A;  4C1S A;  3H7L A;  1D8E B;  3KSL B;  5GW7 A;  1N94 B;  2RI9 A;  2B39 A;  1FT2 B;  1R76 A;  5FO8 B;  1TNZ B;  1H14 A;  4GTS B;  3REN A;  3Q7F B;  1O1S B;  3ANK A;  4AYO A;  4GTM B;  3QWT A;  1XWT A;  3WKH A;  1X9D A;  3HXF B;  1KRF A;  3S4D A;  2AHG A;  2DRO A;  4D4D A;  3WIR A;  4YCR A;  3S4A A;  1GHQ A;  4Z4J A;  4BOJ A;  1KZO B;  1H54 A;  3M75 A;  2V3P A;  5KKB A;  1JCR B;  1N4R B;  1XWQ A;  3D5S A;  3QRY A;  3TF4 A;  1N4P B;  1TNY B;  2ZZR A;  3PYA A;  1F9O A;  3HXE B;  1S63 B;  3S9V A;  3KLS A;  3RRS A;  4DOD A;  2DRQ A;  3EQA A;  2WY7 A;  4WU0 A;  1KSC A;  1H3A A;  1KZP B;  3M71 A;  5JPM B;  1H3C A;  2R2L B;  3G6J B;  1UT9 A;  3PMM A;  4Q2B A;  4KTP A;  1N4S B;  1LD8 B;  4KKI A;  3PYB A;  2F6D A;  3SAE A;  1G9J A;  2ZIS B;  4WVA A;  1TN8 B;  4LIX A;  1AYX A;  1O6Q A;  3SFY B;  1KFG A;  3WIW A;  4GTO B;  4BOK A;  5GZK A;  2ZIR B;  2A73 B;  3SDT A;  2G02 A;  2NOJ A;  2WYN A;  3Q7A B;  4V1R A;  2NVP A;  2BB5 A;  5FO7 B;  2V3N A;  3PZ3 B;  3P5P A;  3SDR A;  1O5M B;  2H6G B;  3E30 B;  2EAC A;  1UMP A;  1SQC A;  3RX5 A;  1VD5 A;  1QQF A;  1JS4 A;  4L9P B;  1DOG A;  1H36 A;  1V7X A;  2GZ6 A;  3DSV B;  1O1T B;  3D3I A;  1O6R A;  3WKF A;  1UG9 A;  5E2J A;  4GTP B;  5FO9 B;  2A8Z A;  2H6H B;  1GAI A;  2BED B;  2XQW A;  3X17 A;  3WIQ A;  3RX7 A;  3SDU A;  2PN5 A;  1QSJ A;  3H3K A;  4KKJ A;  4L0G A;  2CQT A;  1LF6 A;  5FOB B;  1HCU A;  2YIK A;  3DPY B;  2BBC A;  3KSQ B;  3RSY A;  1FPP B;  3W7T A;  3PZ1 B;  2RI8 A;  3ANJ A;  2QNO A;  5CZL A;  2EAD A;  4MBG B;  1TN7 B;  2H6I B;  3DRA B;  3Q73 B;  2SQC A;  4TF4 A;  2XWJ B;  1WU6 A;  2FUZ A;  3M7C A;  3W7U A;  3Q78 B;  1FBO A;  3PZ4 B;  1JCQ B;  3H2W A;  4LNG B;  4EL8 A;  3GZK A;  3OED A;  1W6J A;  1SA5 B;  3E37 B;  1FO2 A;  1O6H A;  2Z07 A;  3EU8 A;  1X81 B;  4L6X A;  1TN6 B;  1W6K A;  4KTR A;  3K11 A;  1V7V A;  3M76 A;  1IS9 A;  3E33 B;  1CEM A;  2GOX A;  3EU5 B;  4D4A A;  3DSX B;  3WKG A;  4JJJ A;  2V8J A;  2D8L A;  5M7Y A;  3HXC B;  3M7B A;  2WII B;  2GH4 A;  3SDQ A;  4J5T A;  3ACT A;  1H35 A;  3DST B;  3VXD A;  1H12 A;  2XWB B;  1GA2 A;  3QSP A;  3EZ8 A;  5CA3 A;  1LD7 B;  1G87 A;  1TNB B;  1N95 B;  1C3D A;  1S64 B;  4YDE B;  1FMI A;  2CQS A;  1H3B A;  4FUS A;  3P2C A;  2EAB A;  1N9A B;  1WZZ A;  3GLY A;  4QT9 A;  3RJ3 A;  1H37 A;  3M78 A;  3ACS A;  3HXB B;  4GTV B;  3PZ2 B;  3E32 B;  4CJ0 A;  4ZH5 A;  1NXC A;  3QPF A;  3WUX A;  2BB6 A;  3M7E A;  3QDE A;  2DRS A;  3W7S A;  3M73 A;  1TNO B;  4FXG B;  4D4B A;  2FBA A;  1LF9 A;  3DSS B;  4Z4L A;  2G0D A;  4CJ1 A;  1SA4 B;  3K7X A;  3M7L A;  1NC5 A;  1F9D A;  4D4C A;  1IA7 A;  2D5J A;  1O79 A;  3E6U A;  2IEJ B;  1H13 A;  1HZF A;  4GTQ B;  3VW5 A;  2EAE A;  3SDV A;  4DOE A;  4FXK B;  3W5N A;  4LNV A;  1ULV A;  4ZG8 A;  1FAE A;  2FV0 A;  3KQ4 A;  1TF4 A;  2VN7 A;  2AFA A;  1JCS B;  1K72 A;  3M72 A;  4ZH1 A;  1KS8 A;  5MEH A;  4AYQ A;  3DSU B;  4WVB A;  1KSD A;  4LNB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...