4AZ3B

Crystal structure of cathepsin a, complexed with 15a
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
155
structure length
155
Chain Sequence
MDPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Novel Beta-Amino Acid Derivatives as Inhibitors of Cathepsin A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords LYSOSOMAL PROTECTIVE PROTEIN 32 KDA CHAIN
total genus 40
structure length 155
sequence length 155
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 2012-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12670 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4az3B00
4AZ3B 4AZ0B
chains in the Genus database with same CATH superfamily
1U65A 1D3AA 5THXA 4M0PA 2FXIA 5I4CA 1ZU5A 2L0XA 2FN9A 2L17A 1RXCA 4QHTA 4EW6A 5DGCA 3F67A 4WH0A 4IVRA 3RSOA 3B3JA 5ARDA 1NFQA 2G7MC 5I9BA 3IQGX 4DG8A 3P0RA 3N86A 2J48A 1FPMA 5TQ0A 2VP0A 3AFIA 3UXMA 3A2NA 1RXVA 4ZMSA 3QW4B 2EW1A 3H11A 4ZT2A 5LN1A 3T7CA 2OLKA 2I3ZA 2H4YA 2P27A 5KNDD 4YAEA 4XGIA 2G4VA 1YIOA 3T5GA 3ZK8A 1N9KA 1H1LB 1Y8RA 1ZBDA 1PEYA 1ZGGA 2QTMA 1R7RA 5I9NA 5JYEA 1W5FA 2A5JA 4M55A 2WF5A 4P5DA 2CNWA 2A92A 3ZZ0A 3G8YA 4URVR 3K96A 3P45A 5H3HA 3PK0A 1GFSA 4JC4A 4YROA 1CZHA 4X71A 4V2IA 2DYKA 4JYBA 1X1SA 4QQKA 2ZRJA 2P69A 3R24A 2Y4OA 4J0CA 3TRHA 5HJEA 2ACVA 3ZZNA 2Z4TA 3VYRB 1ID8A 2ODAA 1FXWA 4DMHA 3BCUA 1JHOA 3E1SA 3KOWA 2OFWA 4NECA 1NI4B 3DYBA 1PTKA 3UMYA 3DR5A 1E61A 3MUNA 4UHHA 2HEIA 4G65A 5AHWA 5EIHA 4XWOA 3BBLA 3K6RA 2W6MA 3L0DA 3MOSA 3MW8A 1YA8A 4JLNA 4DLPA 3M7IA 2VK1A 4KMOA 4FOSA 1TRKA 4PSAA 3VZBA 1AXEA 4W8GA 1L4MA 2FU5C 4EJSB 2J4DA 2GD0A 4YMSA 3RTEA 3N6XA 5B1YA 1WPGA 1FJHA 4ZYLA 1ECLA 1JIIA 5AK4A 2BFEA 5FBVB 2FK8A 2NVBA 4DUPA 1MQSA 1QGAA 2EG9A 3BXPA 3ONNA 5ARCA 1HLDA 1NVWQ 2GYWA 3L8YA 1IHDA 3D2AA 3UPDA 4Q39A 3SQLA 3VTAA 4RU1A 2H11A 3MWEA 4P5PA 1ZIPA 3ZHVA 2PT9A 4MSUA 2IX3A 3EA0A 4X8MA 4C88A 3T54A 3A1DA 1DRUA 1CUHA 4XB1A 3H9EO 2XKAA 4BX8A 3HVJA 3IUSA 4LY9A 3TH5A 3WQSB 5K0GA 4TQAA 4DUZB 4I4TA 4BNGA 1R9NA 4Z7JA 4E2FA 4GAEA 4XWTA 3JR7A 1I2ZA 1LK5A 4QPNA 3N59A 3NHJA 3N07A 2FX5A 4WOPA 2C98A 4DLXA 1XYVA 3NHPA 3HXPA 3PCXA 2ZPUA 5HCIA 4DYDA 4UM9B 2OGUA 1VB3A 4ZFNA 5KNCH 5LU9A 4IOKA 1TT5B 2PY6A 4KDRA 4C0BA 1H6CA 2P0YA 1U7DA 1UM9B 1YKGA 1K6IA 2PNFA 3JAWA 3PC6A 4IM7A 4K2HA 4KI0A 4RTNA 1A7KA 2H4JA 3TW8A 2LD4A 2FVXA 1V8ZA 1IG3A 2MINA 2YYYA 4KPYA 1D03A 5CDTA 4NYJR 2G3YA 3F73A 4MQLA 4TXJA 3ZJVA 2PTHA 2Z2KA 1ZM4A 2E48A 5JCJA 1V5IA 5ECWA 4C0XA 3LTNC 3ME5A 5IDQA 1VMEA 5EZYF 4KXXA 4OXYA 2W00A 1NJ1A 4E09A 1PFVA 3DQZA 2JFUA 2XUOA 4FK8A 5IWCA 1BXZA 1OWNA 4Q00A 2QG6A 4JJKA 3WWDA 3OAAA 5ICMA 1OVMA 1NXPA 3OETA 2TMDA 4B6SA 2X86A 3QPDA 3HJFA 3G1WA 1TZBA 1ND6A 1M6WA 2GGSA 4S1NA 1NYLA 2OAGA 3SNHA 1JR2A 4H3SA 4H1VA 1OYWA 2J41A 3HN2A 3LA8A 4MR9B 1SRRA 4Q9HA 4X94A 2PAFA 3M8KA 2AN1A 4MJ3A 4UUOA 5EHNA 4BE7B 4DDVA 2KW5A 5ALFA 4LWZA 3HVHA 1RXYA 2VWQA 3ZGVA 1FYXA 4GICA 4XUGB 1F8XA 3OZWA 2VJQA 3KJZA 2VLBA 3LBFA 4G01B 4NLLA 5AK6A 4HTAA 2XHZA 1K63A 4Z0PA 1TF7A 1MC8A 2QTGA 2IZZA 2IYUA 3DLPX 1F5NA 1D7OA 3C7CB 1HE8B 4JBGA 3IV9A 1FMCA 3ANTA 3SBEA 4Q6WA 1OH5A 2CV2A 1OC4A 4OH1A 3GAFA 1RJFA 2EX0A 1IBCA 1QK5A 4XEUA 2YXDA 1T2AA 1XF1A 4LZZA 4YWJA 4CLOA 1XZDA 3LJKA 3WRYA 1NBOA 1DXQA 2A88A 2X9VA 3I6BA 1V8OA 3WYCA 3AL0C 4RD0A 3TTXA 4AY5A 1QHXA 5FXMA 1V47A 1T24A 2XSZA 2YV5A 4OREX 4BLTA 2B34A 4Z4HA 1CUUA 2C7PA 4LYJA 1DAKA 4UHKA 4UFOA 5I51A 2R0QC 1NW4A 4QQ8A 5C1IA 1JQ5A 3LPMA 1IN6A 3C3CA 1RXIA 1IPEA 1XRRA 3K4HA 2PSJA 2RKOA 3LIIA 4G1FA 4P2BA 1DMRA 2HBYA 4LCEA 4WXYB 4BHTA 4FWBA 1GN9A 4D3YA 1A4IA 4D0LB 1V8PA 1TMGE 3C5CA 2HRDA 3QX8A 5CG1A 2UU9B 5SV2A 4B71A 1YJAA 5E7IA 3Q98A 4R2MA 4JR1A 2NTNA 3H5LA 4IX9A 5AJWA 4Z9XA 2ODEA 1W5BA 3P0JA 3EOBI 3UFXA 4G5FA 4A26A 4Q1EA 2VRBA 1RPNA 1SU6A 3AVTA 3HZHA 4C4OA 5AI4A 1UWKA 1MRZA 3EVBA 2O57A 4MUKA 1RWMA 4QOEA 3VOAA 1TYBE 3PCTA 4X93A 4MUGA 3IP3A 4FYPA 6REQA 4QSMA 5EOVA 1STOA 1ATIA 1E3EA 1KEZA 4Z8YA 3JRNA 3TO5A 1GA6A 2R65A 1R1DA 3IFSA 2J0VA 3ZWWA 2CVFA 4HYEA 2PU5A 1CUEA 3OQHA 1YRWA 2GF2A 4QEKA 1SZJG 3NJRA 3WNZA 3X2FA 1KAOA 2Q6OA 5LYYA 4GUAA 3U7GA 3H84A 2YBEA 1O9GA 3NO4A 4Q4LA 4F45A 2XMCA 4CKEA 2IPLA 1YR1A 2VTDA 2BDEA 2I55A 3WV5A 1T8PA 2E6UX 2W6QA 2IKQA 2WV7A 3GOHA 3QW2A 3COZA 1Y1KE 3O4VA 3ZDBA 2CL5A 4R3NA 1ZM3A 2BFFB 2XB8A 2H8GA 2H17A 4OHUA 5ALHA 1P4AA 1LJLA 5GOTA 5GZ6A 1FFBA 1TF2A 1ZD9A 1GUBA 4NNPA 4P8RA 1VXRA 1L6IA 2G8LA 2RDMA 4KCGA 6YASA 1POWA 2QL6A 3Q3IA 4RDIA 2P2CA 1KZ9A 2DWQA 3Q3GE 2ORED 4M0DA 2R4TA 3BMCA 3QPCA 2Z2ZA 1J56A 4DRXA 4H1HA 2IY7A 3LCCA 3WMWA 4RTKA 1E2JA 3P2OA 5TPZA 3S2GA 5JH7A 3ADDA 8LDHA 2JAOA 2JFVA 5FBRB 3NEYA 1KDOA 3DPIA 1RWNA 3WNQA 3PLNA 1PZNA 3BGIA 4PQYA 5HBRA 1YVRA 4AUMA 1FP4B 4YI3A 1I4EB 2AN9A 1JEEA 1MPXA 3Q1LA 4X85A 4MV8A 2PBRA 1V1RB 2Z30A 3GDFA 2Q46A 4HUJA 2QQ0A 4YIHA 4TXMA 1RRFA 4G86A 2VNAA 3IXQA 1J97A 4XQGA 4XRRA 5ECYA 4HYQA 4FHGA 1YDMA 3OM8A 3PQFA 3EVCA 4CIXA 4OSOA 1P0CA 4OP1A 1MG0A 5DRTA 1E20A 1WMSA 1YUMA 4GYKA 4PHGA 2ACKA 2HBZA 4G4GA 1KKUA 4LPKA 1YK1A 1EDOA 1ZGCA 3OTGA 3WGYA 2ZI6A 2SHKA 1B41A 4BJHB 4J6EA 2IXGA 4PNEA 2HJHA 2MSDB 4Y0AA 4Z7OB 4QTTB 3C97A 2UV8A 2PRKA 4J91A 2ZRKA 4UDXX 3WAKA 2ZYGA 4C5CA 4KQMA 4KRFA 3R1IA 1G3MA 4J0HA 3OX4A 2PRJA 1J20A 3ZHRA 1U63A 4ENUA 3BHMA 1V16A 4BKQA 3BYZA 3U7QB 1YS4A 2ZR7A 4YH1A 2QAGC 1PTJA 2JHAA 3K9QO 3B70A 1G20A 2XODA 3M89A 4LBWA 1W36D 1DAPA 1AF4A 1B00A 2AOVA 4DJFC 4Q7QA 2ANBA 4J0KA 3LZDA 3F4LA 1O3YA 4IY1A 1DJOA 4M1TA 1I6LA 3TNJA 5KTTA 1QPZA 1M83A 4F91B 4QRHA 2OPHA 4RUKA 4LQDA 3L84A 3RHFA 1V7QA 1RCTE 1L4LA 3GROA 1RLTA 3V7WA 4AS3A 2YVKA 3KXIA 4PXAA 3GLIB 1T0PA 4YMVA 1SHTX 1S1MA 3HXTA 3TLAA 3HVKA 3EFOB 3TTYA 4E21A 1CY8A 2P2YA 3DO5A 2JD0A 4ACAA 1CDZA 4KX5A 3I92A 1RLIA 1FVHA 1U0RA 3DE0X 3ELBA 3QIAA 1QLJA 4O02B 3WTCA 4DCTA 4F6RB 2DU8A 3TGLA 1AY0A 2QYOA 4C03A 5EZYA 3EVZA 3HFJA 1IVYA 1I5RA 4YEDA 1AHNA 4E4YA 1SN7A 2RHLA 1W6RA 2VT6A 3DDNA 3LQKA 1FBNA 3Q8LA 2DG2A 3C48A 1O77A 4MVJP 4AXXA 4BB5A 1ONNA 2BPOA 2C0QA 2WIGA 2QW1A 2V5AA 3FYCA 3MJ4A 3NHWA 1F2UB 3MXTA 4RWEA 5EHQA 5HF6A 3D1LA 1GPYA 4OQZA 4W1SA 4KHPB 5KJCA 1KAGA 2R1TB 1GFIA 2VPWA 3I1JA 2GWRA 4OJYA 2A9VA 3DCYA 1WY7A 3IBFA 1GPJA 5IK2D 1ZVJA 4LXTA 5JDCC 1DJNA 4F0JA 4PRLA 4F71A 3NHKA 2NXNA 1SG0A 2O6LA 3ANNA 4N8EA 4RFLA 1MU0A 4RS3A 5AKIA 4RZSA 2HRRA 3JRXA 5EJFA 4YUAA 4Y1GA 1RQ7A 2BRUC 2WPDD 1GTMA 3CM0A 3HM2A 3L7MA 3WMFA 4MPRA 2IZ1A 4WZAA 3UN1A 4E31A 3KUXA 4N0EA 4L6AA 1N6RA 4PF1A 1KYIA 2BE9A 3GARA 3PPXA 3BVPA 3ZV6A 5I7EA 5K8IA 3G23A 2ZYIA 3HCCA 5IX8A 3AR9A 5C5EA 4QBHA 5I9TA 5HZGA 1PP4A 4MRVA 2BZGA 3R41A 1EXMA 3D54D 3UHOA 2HI0A 4JLSA 3DBLA 3T7SA 3HMQA 1EGMB 3MJEA 1L8AA 3O83A 3Q5EA 4DADA 3STWA 4JDPA 2DFKB 1AZLA 5B2EA 3N5KA 2JIZD 5AVQA 1WXEA 5JAOA 1VLHA 1Q0SA 1ZSVA 2VA9A 4HQLA 1OH8A 3DZHA 2ZRIA 5K05A 2PUAA 4FFBB 2H7VA 2AMYA 5FLEX 4WDRA 1HDEA 2J07A 5TDHA 5F2KA 4F56A 1B93A 2DHRA 5A7GA 1C9MA 3I37X 4URUR 4DWWA 1Y0BA 4IDPA 2BMWA 4G37A 1SK9A 1IEWA 2FN8A 3BDIA 3OQBA 3A25A 3RF6A 1WABA 3AVWA 2B78A 5GMOA 3NAZA 1F17A 4INOA 2M6KA 1NIJA 1M2GA 1PGQA 3HY6A 4R1PA 1WL8A 3KT3A 1RTTA 4DR6B 4X3PA 2XVXA 2GRAA 3N3BC 1VI6A 2JCVA 2I62A 1MB4A 4BVAA 4DJAA 1P7WA 2NZYA 3BD6A 3F5SA 2OHXA 4P33A 2GO1A 3NHYA 2TMGA 3MTBA 4DSNA 4MUHA 2H1OA 1NP3A 4B3IA 4MA4A 3SEQA 4M0EA 1U0GA 2I7DA 3GPDG 1VL1A 4UU1A 3GLIE 4I4CA 5BQPA 4IIGA 5TMBA 3T0FA 3JX9A 4U3JB 3N75A 3F78A 2A0UA 5C8VA 2FRXA 5L4LA 4B6PA 4B6RA 1N0IA 1YZYA 3OOWA 4MKFA 4ZPJA 5LQCA 3FFTA 3ILHA 3CKKA 1N77A 2JBAB 5DN9A 3MTAA 3O82A 4ZALA 2W2KA 3M2TA 2RCNA 3EUFA 4AY2A 3OTOB 2MT9A 1OZGA 3Q4GA 3T3IA 1BTOA 1XHEA 4IQGA 4W5QA 1JLSA 4EY8A 1L7MA 1C41A 1YVEI 2VCYA 5A4FS 4N76A 2C2BA 4BNDA 2OMEA 4K6OA 3B1XA 4WKNA 2G70A 8OHMA 1WP9A 5ILQA 4M1EA 2XDQA 1VI5A 1HT2E 3G0CA 4HRAA 4HVAA 4CW7A 5AKKA 4B0OA 3HV0A 5DHUA 1NYTA 4J7UA 1D2NA 1QVRA 2QX7A 1WQ4A 3TS1A 2NZXA 4CCYA 5BWLA 4PO8A 2UYOA 1WO8A 1KU6A 3VUEA 1N6LA 4JEMA 4YLGA 2ZT5A 3TBHA 3N2LA 4ZO6A 2UVPA 4LJRA 3HA7A 2O2JA 1RRKA 2OO3A 3PF9A 5L3QB 5AM1A 1TYAE 4JU8A 3OD1A 1O97D 1VKHA 4YP0A 4M9XA 1Q7CA 3DL4A 4XX0B 1W59A 3ONDA 4X7PA 3V00A 3WA6A 4AG6A 4L5JA 1A76A 1S8NA 4KN8A 3QENA 3PNMA 1NW7A 3IP1A 2IEZA 3IP8A 1E8MA 1UCFA 2P30A 2JPDA 1Y3AA 1R3DA 2JIQA 3HY4A 1NNLA 4D4LA 4RE6A 4YV1A 4CLOB 1O1YA 3KB1A 4HPXB 5FULA 4JI1B 4L4RA 4C2AA 5IAGA 4XB2A 2QY6A 3X3HA 1EFPB 3OIFA 1A9TA 1DAIA 2WUFA 2A9QA 1MVNA 4S1PA 1NYQA 5CJPA 1DO8A 3A7DA 4FX5A 3U80A 4DWJA 4E5PA 5JJ5A 1QCYA 3IUQA 4O2BA 4URFA 3PCRB 4UBKA 1XVTA 1V43A 3H2ZA 3EGCA 2G82A 4KQEA 2EBWA 4V0NA 3SJUA 1PFGA 3AHHA 5I7HA 1YZLA 1YQUA 1WNTA 3EJWA 2GEUA 4KBGA 5KSYA 4UEJA 1KGSA 4ENTA 3AUXA 5FOUA 4PU0A 5H70A 2JKYA 5YASA 3OG9A 3RFCA 1WCV1 1GG2A 4JLMA 1Z5GA 1DQZA 1FVFA 4YRIA 1ULZA 4EGQA 4RLFA 5AVYA 1PDOA 3U44A 1RCFA 4QVGA 3CTPA 2CLIB 3BC1A 3ZGNA 2DY1A 3ZZUA 4XX1A 4N8SA 2Y0CA 3JQ7B 1YL7A 1LDYA 2Q07A 4WI1A 1G8YA 1Q0HA 2CBGA 2G9VA 5CX4A 1W44A 3WWOA 3CH6A 5D7NA 1DBSA 1PVVA 4BVLA 3EDRA 2J3LA 1J8DA 1X7YB 3ZIAA 4BYGA 1NP7A 4FE3A 4D8WA 3COPA 2WF7A 4UEQA 2ZI7A 4QNNA 3WRYC 2E6KA 3WQRA 2E4YA 1Z15A 4P4NA 1VSTA 2QOEA 1O4WA 1GPKA 1DIGA 2HIMA 2A86A 3CMCO 4R8KA 4ZZ2A 4IO0A 2Q2WA 4OLFA 1L7QA 3ANYB 4PWYA 4YNBA 4Q21A 1KZ1A 2LV8A 5L4SA 2CEKA 3MWGA 3CS3A 2DJIA 5ICCA 4MUYA 2P5UA 4LECA 1NRJB 4NCKA 5EJ2A 2OLEA 4JHLA 1Z7BA 4C6HA 3GFSA 2NZWA 5D87A 4L9RA 3CZQA 3UXHA 2DXIA 2GM3A 4E94A 5LM3A 1GKUB 2B4QA 2BEVA 4JJFA 3RAEC 4NBNA 4XJSA 1E7YA 2WA2A 1PJ4A 3G8BA 2ZG6A 4CG2A 4YJGA 3PGXA 4FYVA 3RWBA 3U61B 2NLOA 2OHHA 4N18A 1LQTA 4BFTA 5E4YA 3KUCA 3W04A 3U4HA 1N7IA 1WM1A 1WPXA 3PGKA 4E12A 5E2IA 3T3MB 4C3VA 5HGXA 4PZAA 5EYPA 2VBFA 2JLYA 4Q7KA 2X3UA 3FTCA 3KOOA 1C7QA 3DZCA 3QTLA 2PA0A 3A8TA 5DX0A 3UWMA 2FWPA 2A6PA 2H5EA 2VTBB 5B1SA 5LOVA 4RVNA 4MUBA 4DV2B 5AI9A 3REGA 2A1IA 5D01A 4DA9A 1TAUA 3FFXA 4Y7CA 1ZM2A 3LCMA 3QPVA 2GETA 3NALA 1VSVA 4TLMB 1DV2A 3C3MA 1C3OB 1ULSA 3FB4A 3GI1A 3KEMA 1N1DA 1EFLA 2Q6VA 1CUWA 3Q5GA 2DB3A 1VRWA 2BFCB 1Q16A 1EFUA 1B16A 1XFAA 2BR3A 2QYHA 3IHTA 1RXUA 1GUYA 3KELA 3MPOA 3SIPA 1GG8A 1FLDA 3D0RA 1W5SA 3PWKA 1NVXQ 2VRWA 5HFAA 2Q5JA 2VUTA 1XZQA 5IN4A 2C7RA 1YGPA 4CN9A 1WJGA 2XT0A 3MB8A 1TZ2A 3QYJA 4Q3EA 3PUJA 4GLOA 4BFYA 4CV1A 3AXTA 2FE4A 4E3ZA 3H9QA 3E9RA 1QWSA 4LOJA 3NFYA 1O94A 3K5WA 3MT8A 3KHUA 4CQMD 1P9OA 1UKZA 5SYNA 3W2IA 3Q2KA 4MWDA 2KBEA 3DMNA 3L46A 1GGJA 3B6EA 1L5GB 4BFXA 2IEDA 3JQAB 3BCHA 1ORTA 3C3DA 3ZTWA 5BNZA 3QM1A 4PSVA 5FRDA 1XPUA 4QM6A 1T36B 4MEBA 4TTQA 1NBME 3WLAA 3A28A 4JDUA 5TE9A 2B30A 1OIWA 1SCBA 3DE3X 1N5IA 3GU3A 4JASB 1X3SA 1C4WA 2HLPA 3GJ5A 3A4LA 4ZU3A 1CQWA 1ZNQO 3H5OA 3DE6X 1H4SA 3UJ3X 4BVBA 3JWPA 3SF8A 5BN3B 4TMFA 1CBUA 2RHDA 3C3WA 1TJ3A 3A6GA 2O3RA 2QSZA 2O3SA 3QLUC 2XCLA 2RHMA 4DNOA 5FA5A 4FDTA 2HWUA 1ILEA 1P7CA 2OCGA 3DEAA 4GFDA 4FMBB 3GGDA 4JUDX 3TRFA 2E5FA 4DM3A 4EO4A 2PWPA 4MRPA 5JQGF 5LQAA 2J5RA 3GAZA 1GUFA 5HKLA 4EG5A 5LMUB 1WB6A 1UOPA 4EOGA 2MYNA 3JQ6A 1M0SA 1QGUA 1UWCA 1B6TA 4E7OA 2A14A 1GU0A 1OOEA 4K6GA 2H2IA 5CIWA 2F1HA 1QC5B 2BISA 1VDMA 2ONYA 3VZRA 3T7JA 3C41J 5LP6B 1ZZEA 3CZCA 2DHQA 4LTMA 1I4WA 2PO5A 5BVGB 1WP4A 5AW7A 1UDAA 3FHTA 2ZYDA 1DRJA 3EGIA 2JGDA 1WMFA 1CZKA 3WHKA 2YCBA 4IDOA 4XARA 5A1TA 3C98A 1UP6A 2YXPX 3MM4A 1ZD8A 3QOFA 4FQ8A 4U7FA 4WY5A 5AVZA 5KQLA 1A8UA 2IYVA 3KK0A 1AMOA 2BUBA 3ZV7A 4UXHA 3QF7A 5JJIA 3ABZA 1FUUA 5IARA 3L1IA 3U4AA 2YZKA 1RQRA 2G6TA 1ABEA 1CIPA 3J81k 3EEYA 2CHQA 3VSDA 1OWLA 1DBIA 1F0YA 1MMFB 4FOLA 2FCAA 3S5JA 4TWZA 5KBYA 3E05A 2B8NA 5EP1A 3TSZA 4W6QA 1THMA 1QH1B 1QYDA 2QAGB 4R8LA 4MS4B 3B1JA 1FUEA 2FPIB 4EITA 5JCPA 2JAHA 1N2CE 2QL7A 3U4MA 2C4WA 2QJTA 2ZM6B 1PQ4A 2BGLA 3OTWA 1SMKA 2BMJA 2ECQA 2XECA 2C2OA 2AD1A 2JJYA 4RJIA 1CUAA 5CX1B 3QMPA 2GTPA 1UWVA 1JHRA 1I1OA 3BSFA 3I6ZA 1E0DA 4MUIA 1O08A 2W70A 3TOSA 4BQQA 1TO2E 1I4LD 4YAKA 5ANRB 3D4PA 2O8VA 5CT4A 3AHDA 2B2CA 4RAQA 4ME6A 1DEXA 3SFZA 2FSVA 2VEOA 1JJVA 3EARA 4IJUA 4RZXA 4QSHA 1SA0B 4BCDA 5FLXA 3U7HB 1CQIA 2BKXA 1V37A 4XVUA 5JXHA 3E9EA 3K0EA 2RHWA 4EG0A 4PYNA 5AKJA 1P0PA 3ND5A 4V3CA 1HT3A 2QM0A 1RKQA 1XKXA 3HCEA 1B1CA 4QJ5A 5BWBA 5IMSA 1U98A 1UJ4A 2RCYA 3AFHA 1PSWA 3NW9A 1KVQA 5A03A 4AQ7A 1L4GA 1OPXA 1YQQA 2AHOA 2DKOA 4JOBA 5IBQA 3SG0A 5GP1A 1NDQA 3ZI4A 2FJUA 5EMKA 1TEZA 2Q1TA 3SEAA 1GT6A 2KI5A 1SXQA 1JIXA 3K9BA 1XLWA 3KR2A 4DREA 3TIVA 3EVGA 1VMAA 2GX6A 4OOEA 4PS1A 3WISA 1H0RA 1NW8A 4WKPA 4QXMA 3K5HA 3HC7A 4RHCA 4ZGBA 2C77A 4DSUA 4BKUA 5CA1A 2QROA 3PXDA 4I0WB 4QOIA 2O1EA 2VC2B 5B12A 1XPOA 1GU1A 1I0LA 2NO5A 2V3WA 4NCIA 3CZRA 3RT7A 2XQVA 4R05A 3GUCA 2W22A 1NF2A 1RXSA 1NI4A 3EPRA 1YO6A 2D1QA 4H1UA 3FVRA 2CUTA 1LLUA 2Y67A 2QDKA 4XCVA 2PZ8A 2VJCA 4YJ3A 5GIOE 5LP6C 1I4TD 2O1WA 2IOFK 1M75A 1J39A 2XZLA 2MYUA 2JF0A 3FF4A 1JMVA 3QTBA 5LZ7A 2Q4DA 2WYOA 4GI2A 2AZXA 1HDZA 4M1WA 4MYRA 4UMEA 2CDAA 4WXPA 4CDNA 5JYDA 2VJOA 4OP3A 5HFJA 2FMXA 3V8QA 1U0SY 1ADJA 1MT0A 3BPSA 2REQB 4KMRA 3CX7A 4D2IA 4I6JA 5A6SA 3L7BA 1TUGA 3EFOA 3I34X 1OILA 3VVBA 3HCOA 4EPYA 3EDCA 3O4IA 3CUVA 3P32A 3PC4A 3GLFB 4XJTA 2IF2A 3ORRA 4FQ7A 3TL6A 2FVYA 1SJ9A 2FZ5A 3GGJA 2VSXA 2OCBA 5F7XA 2UUOA 4Y2QA 1H0HA 4QU8A 3NAGA 3T5MA 5KPJA 3E18A 2C7QA 4JXXA 2JGRA 4MRSA 1BJKA 4UHCA 3K0BA 3HV2A 4FINA 1NE7A 2PBLA 1OFUX 4MGZR 4JSRA 3PWSA 3BXFA 2XVAA 3CZ5A 4FGUA 4FNMA 2O0LA 1XLTA 2RGAA 3HJBA 1F60A 2WWGA 3AOEA 4O0LA 3RYIA 1NBEA 2NO6A 1E6LA 1OZAA 4XDHA 5JQWA 1K7FB 1F0NA 1PLKA 4FFRA 1X7XB 3DHVA 1Q15A 1QKIA 3GRKA 2GBFA 3LUPA 4OJTA 3W9SA 2GPNA 2PQ2A 3E58A 1PIWA 4L8GA 3ICVA 4ZVSA 1WULS 3CPSA 2QR2A 1SA0A 3MMSA 2WNHA 3ULKA 3VRHA 1ZCZA 4E46A 3LK7A 4QXAA 1TQHA 4IDGA 2QUJA 4FZRA 3IEMA 3AF3A 5JAPA 1B43A 3H19A 2C7VA 3C3KA 4HFRA 4RW0A 5EJGA 2IYWA 2PKXA 4LNUB 3W8DA 4D8TA 3NS7A 2QDXA 1GTG1 4P84A 5D1NA 3LRTA 4QELA 5I3ZA 4HNVA 4O8CA 2R47A 1J8YF 4FLEA 2HCTA 4DNXA 3KTAB 5AP9A 4DMKA 4MA0A 4R8RA 2X8BA 3SJCA 1K2VN 1OX6A 1M1YE 3COYA 4J6FA 2D7CA 4JEHA 5IFKA 1IJEA 2F2TA 3A9VA 2GN6A 1KI6A 3GIWA 2R25B 3OE4A 2ZFUA 1VM6A 2HMVA 2IUTA 3GVXA 4TRRA 3ZQKA 4RORA 5AW4A 4NYIQ 2WW8A 3LCUA 4YP6A 1ZH8A 4RMJA 1VJGA 2O2GA 1RKBA 7AT1A 1Y7HA 5TMPA 1SOVA 2MSLA 3DWEX 3FYDA 1FP7A 2DHDA 2BMFA 3L05A 1E2MA 3O9ZA 2X4DA 1NKSA 1JBKA 3L4BA 3OCCA 3ICWA 3R5JA 4K1XA 4P58A 4OQ4A 5K0FA 2PUHA 3CMMA 3VH2A 2EIXA 1XZMA 2G9NA 2DCUA 3OM9A 3P9NA 2D2EA 2XNJA 1FMLA 3WKAA 2YRWA 3EF1A 3FNRA 3E9YA 5HUQA 2BEWB 4IQ8A 1B2RA 4CFZA 3JAKA 3MN1A 2HKIA 3O2JA 5H0IA 4WUTA 1FFYA 1YI8A 3D31A 1G8JA 2JRLA 1MX9A 4OK6A 2VJPA 3G79A 3RFUA 3KKKA 3QFFA 4OI4A 1YDEA 3T3HA 5LCXA 2EFCB 3TOXA 1COZA 4PPNA 3S1LA 1GYQA 4C14A 4YRQA 5K3FB 3CZPA 1BX1A 3F96A 3QXJA 4FDVA 2AK3A 5FV4A 5LU8A 5DU2A 3HVRA 2J08A 2O20A 4FSHA 3O90A 1E69A 2IUUA 1J8VA 2Z9BA 3HU1A 1H4TA 2PRYA 1UBRS 4R0VA 4K9SA 1R16A 4F92B 2CK3D 2V58A 1J00A 1Z38A 4AT1A 1FU7A 4NG5A 4PXYA 4A1FA 1MJNA 3PJGA 4E1AA 4IG4A 5KYYB 3ACDA 1H1LA 1Y8RB 5DIZA 3HRIA 3SZGA 2XMSA 1P8JA 2J59A 3P19A 4J0JA 5FF9A 2JGKA 1FDVA 3O4RA 4BUCA 3M4JA 1G8AA 1NLYA 1QHSA 1Y3DE 2IDKA 2QG4A 2WFAA 3H3FA 1J9EA 3N0VA 4I99A 4Q4DA 5CBKA 3SVTA 4JI6B 4FHDA 3ZD8A 4PE5B 2A5YB 1IHXA 1PCXA 2HNAA 2E55A 3M5CA 1XFDA 3BH7A 1V96A 2VRNA 1PJ8A 4JJEA 3TZCA 1E1QA 1YV9A 2I7CA 1KMCA 4IMIB 5JZSA 1S8OA 4L6IA 1X8LA 5ALQA 2MCFA 2X58A 3ILSA 1EJ0A 1SU4A 4HBGA 1E5VA 1WSWA 3C6YA 4OXQA 4TVKA 5JJCA 3KSBC 1X1RA 4Y9TA 2P67A 3EZYA 4D3SA 1XCPA 1R4NA 1ORVA 1E9VA 2JJ8A 3LKDA 5KYWA 4CR8A 2VPQA 2XR1A 4B32A 1QVAA 3PGA1 4ANFA 2NVUB 4BFLA 1SFRA 2VF4X 4GO1A 4D6YA 1M1NA 1M2VA 1V39A 2H1SA 4C3OB 4EHDA 4O29A 4BAUA 3QZUA 4IP0A 3QPAA 1Y82A 1Q0ZA 2IIPA 1Z4OA 4QYMA 3U17A 4UJ5A 4YRPA 2O3UA 1GDHA 3A3YA 2ZJ4A 1RXWA 2NM0A 1ACLA 4KBYA 3QI7A 3NHZA 5B7GA 3BL8A 1TM3E 1RVV1 1MOPA 3DS8A 4KXLA 2FWRA 4GMHA 2C3YA 2OVFA 5EXXA 2QK4A 2CLDX 3PHCA 3L5KA 4HLNA 4NVRA 4TL6A 3RI3A 4NZPA 3H1EA 1M8KA 5L3RA 3DE5X 3Q0IA 4V39A 3AVXA 1CP3A 1G5IA 2XGSA 1U5BA 4FJ0A 4INAA 3CLSD 3T9BA 1L4YA 2C5BA 4PW0A 3KDPA 5A4IS 5KU7A 2EF0A 4CI0B 1AH2A 2WIAA 3A11A 2D2FA 4AUNA 5B6PA 4MYTA 3ZY4A 1O9BA 3UV6A 4DWVA 1HLPA 1JB9A 2BBSA 3PC2A 1KARA 3W6UA 2O7NA 2PKWA 2VA8A 5DM60 4QO7A 1ADYA 4L5IA 4NICA 2ZROA 3OZXA 1G1AA 4X24A 2BRUA 2W0SA 3AP3A 4L74A 1YRLA 3QNMA 5DHPA 3ZUPA 5KKCA 2R2GA 1HDYA 1PX0A 3UIEA 1PJQA 3TLGB 4TMZA 5CLGA 1L8XA 4RIFA 1Y4DE 1D6SA 5DHQA 1IM2A 1QIEA 1BDHA 3KSMA 5DB4A 3KD3A 4EW2A 3U6BA 2FUNB 2XSZD 1SOAA 2GAAA 4KQ2A 1WSBA 2RHTA 2PX8A 3IC5A 4PCAA 4DRYA 5FBLB 3UJ7A 4JK3A 4B8ZA 1DCFA 3NBXX 4CL0A 4C4PA 1NBWB 3KTAA 4HRXA 1V26A 3LGXA 4RSRA 3FBWA 4HH4A 3KHSA 2R86A 1Z0FA 4PLWA 5B3JC 4GE0A 4EY3A 5DYGA 4BO4A 1Z29A 4Y9SA 1IE3A 3SN6A 3UKJA 4Y2RA 1RYMA 1C1DB 3BKXA 1CJMA 2XMDA 3BWEA 4D9BA 1Y8AA 1SUWA 3PI7A 1SUCA 5BSRA 5JH7B 4JJZA 2IZ5A 2ODQA 3RC3A 3T1YB 1E6KA 5EKXA 4GMXA 5LP6F 5K6AA 1ZK4A 3R23A 4IIFA 4I9FA 4EENA 4U2DA 1C9DB 3IUPA 3W6PA 3AF6A 2OTCA 1HYBA 3AWIA 3NV9A 4IS3A 2Q8PA 3IB6A 2BSAA 3F8TA 5E1DA 3QBVA 2P4SA 3KLPX 1J99A 2FXVA 2C42A 3IELA 5TJHA 1DCMA 5K09A 2N3ZA 4J2TA 1LRKA 2WWFA 2HHJA 3ZBPA 1T5OA 3FTPA 1FFDA 3PFBA 1XALA 1G1MA 4MRAA 2P6OA 2IOFA 2ZYRA 4RPHA 2QTLA 1GPLA 5CXSA 4ZHQF 1DUVG 4X3OA 1C3EA 1LV7A 4LV8B 4UW9A 1PL7A 1HR0B 2PEYA 1GGHA 3KUKA 5FUYA 5C32A 4B3GA 2OV3A 1OBOA 4L27A 3G2KA 4EPXA 3GCDA 2H1HA 3GUYA 3IALA 4JVLA 2KLHA 4KITB 1C2TA 3OESA 1A2QA 3AV0B 3Q8MA 3L7KA 4GU5A 4K26A 1KY4A 3E84A 3P2KA 3SQNA 1AHIA 2I6TA 4O8ZA 3IH5A 1JLKA 4BNNA 1O96B 1I2CA 1W36B 4L8FA 1B6RA 2FGKA 4Y6QA 3KXKA 2KB0A 3HWRA 4COOA 1W6UA 3O8OA 4L7VA 1JEQB 1WZUA 3Q15C 1N4AA 2EEPA 5C2JB 2BTQA 3BB1A 3BULA 3SBOA 3AY7A 1KPIA 2JH3A 3NASA 3C8HA 5I8PA 1ZGHA 1EIZA 3RAPR 4FR5A 2AHRA 3A4MA 3IR7A 5DTRA 4D57A 4GZ3A 1C3XA 1P45A 1X14A 2F9MA 1E8NA 1Q7TA 3TIXB 5BV7A 5CM9C 1C8LA 3IQWA 2WBLC 1AM4D 3NGMA 1Q19A 2PSFA 5JSZB 1ZD5A 5KTNA 1HL7A 4K3VA 4FN5A 3MEQA 1WVIA 2V3VA 1ZZGA 5G4KA 4U4AA 1I1QB 3E7FA 4C7KA 3LF2A 4N6GA 1CY0A 1QO0D 2RGXA 1ZDMA 3KZ1E 4H4DA 1EWRA 4MPTA 3I6MA 2GEJA 1ADCA 4OU5A 1QP8A 4ZAVA 2QX8A 1VMIA 1TA9A 3WGTA 1UBCA 1SPBS 2TRSB 1ZRMA 2V1XA 3P9KA 4R31A 4W8HA 5CBPA 1ISHA 3DHNA 3GA5A 5J5AA 2BM0A 2LCIA 2W98A 3FCEA 1E60A 1JJAA 2C9OA 2HA4A 2HLDA 4JOQA 3U39A 4EUSA 5K8CA 1ZA1A 5HM8A 3QE3A 4DL9A 1Z8DA 3GLGA 1NSYA 2VH2A 5I9MA 3DP7A 2XA9A 4HKTA 5IJ9B 4UE2A 1FP1D 1FDIA 1OX5A 1E4VA 4CMIA 3F4KA 4C08A 2PMWB 1T9BA 1BWRA 4EI7A 5BQFA 4FGSA 4IKPA 1OGJA 1UKEA 4AURA 4ZHQA 4O4JA 3U9SA 3BHJA 4XX0A 1E1CB 1G5TA 4U00A 4BNTA 1VSQA 1T8WA 4HB0A 3DV2A 3GMTA 1Z4JA 1VXOA 3JQDA 4TQGA 3WV4A 2P2SA 1Q2UA 4FFLA 4PN3A 5AD1A 2RSLA 1GL3A 3CKYA 3ZGOA 4ZZ0A 2B98A 4YRRA 3QEMA 3SY8A 1AS3A 1ZN8A 1VZ3A 3MWDA 2I2CA 2GZMA 2VAXA 5K2MA 1PUJA 3M83A 1XZPA 4FFNA 4QT4A 3G2MA 3IIKA 3K70C 2G83A 3U09A 3HYSA 5F9MA 3EQZA 5FT9A 1GPAA 1ZN7A 1RU3A 1FZQA 5CPFA 3OTQA 4OI0A 3QVKA 3B3AA 4JJ4A 3B52X 3D8UA 4CETA 5F2EA 3S8EA 4MPDA 1H2ZA 4F8YA 3BGOS 5LBUA 4E4RA 1H05A 2B8TA 1K68A 4LSGA 1E2QA 3TKLA 3RG2A 1ZNZA 3ZZ1A 2WAYA 3MJVA 1Y6ZA 2Z1NA 5ITWA 2A0KA 2YHSA 1Z2NX 4YRLA 4GXTA 1V6AA 1GGMA 3NNSA 4Q1FA 1UMDA 5FNZA 3SZLA 5F5XA 4X0EA 3AM1A 4LFBB 2ERYA 2JATA 1JJIA 3A2MA 3HHPA 3I2YX 5IPFA 3CRRA 4N47A 2HSZA 5G53C 1ZJ5A 1DBVO 1N6HA 2D3WA 2R8BA 4L5AA 5DNWA 1BEZA 7ABPA 1P2FA 2BMAA 4RLHA 2WEKA 5EQTA 3R3HA 4YUZA 2ZTLA 3DD1A 1AQUA 1QYCA 5D84A 2V97A 3OD5A 4WNYA 5DHSA 4HNSA 3R5TA 4F3NA 4EUHA 4QPJC 1JX6A 3FBGA 1B1AA 4U5XA 5U4QA 3T38A 5BWCA 1WUHS 2D7JA 3AF5A 2HBRA 1VHWA 5COBA 1ML4A 2ZRQA 3O5AA 4NE9A 3TW0A 1CJSA 2V7PA 5FUWA 3ZIUA 1JUDA 2MSEB 2W58A 3E3OA 1O8BA 2I6SA 3A6ZA 1ZX1A 4I4TB 3M5WA 1QIIA 1E2FA 1NXVA 4R3UC 5GM1A 3MGCA 1QU3A 1GZ5A 1OLSB 4BNKA 1BXGB 1BHQ1 4KO8A 4PLYA 1UPTA 4JT9A 4R1LA 2QD1A 4E22A 1ZJ6A 2PZMA 3OP4A 1PTJC 1JDBB 4UOEA 3HXQA 4ZT5A 3QVSA 3ZXIA 2UAGA 1IBMB 5FUMA 2J3DA 2Y76A 1SK8A 4HYTA 1KYYA 1U7WA 2VT7A 5EERA 3SZ3A 2HYIC 2EFDB 2ZKIA 5DEOA 3O7WA 2W5UA 3CUUA 3K1YA 1CJTC 2KWIA 4RJJA 4WESB 4XWYA 3WSTA 4AWAA 4D42A 1UKAA 4ZI7A 1XNRB 3LXRA 5CK4A 2Q3CA 1AGRA 5ETJA 2QRHA 3PE4A 5KYGA 4ED9A 4MV3A 2Q9BA 4JB2A 2EXXA 2Y66A 5IAJA 3HCWA 4O08A 2EJBA 3E5MA 3VDXA 1L4UA 3EN0A 2IP4A 2WJJA 3KSZO 2D4AA 1NV9A 3DCNA 3DMYA 1TM5E 2D8AA 5E7MA 5FEMA 2Z83A 5CT8A 1RQ2A 1GSAA 5B4UA 1KOJA 1JR4A 5E2BA 2CDRA 2CV1A 3IEKA 1IY9A 4Z8XA 2EKBA 4A5OA 4ARZB 4EG3A 2R66A 4C78A 1GA1A 5CA1B 1PK9A 1E3DA 4IQ4A 1CRQA 4EI9A 3QEOA 5MFPA 4JXJA 2XMBA 1MIOA 3K5IA 4DZZA 3LX8A 3TLEA 4EX6A 4CBVA 1V4BA 3MRXA 3PFFA 3H16A 4NBUA 4CQJA 1X1CA 2WF9A 1X2BA 1ICEA 3I2IA 5EZQA 2XNDA 3ANLA 3NWPA 5AM5A 2O2SA 2P7HA 1A7JA 1KMIY 4AJIA 2WAOA 2WD7B 4ESVA 3ZS8A 4KQWA 1JSCA 2JHCA 5BN1A 1TAQA 1J2TA 3ETEA 3JD3A 3NX4A 4X1IB 4ESOA 3EPHA 1RI3A 4M1ZA 1KEUA 1SCUA 1ISPA 1VL0A 4BTVA 5DGDA 2VXBA 2VTBA 3LBAA 2GAIA 4QFBA 5EJAA 2V5UA 2F7SA 1ZFNA 3EF0A 3TG8A 4KGDA 5KC9A 1U2PA 2J7PA 1S9HA 5A5GA 4WBXC 5ALTA 4NBLA 2CNWD 1QH8A 2Z0MA 1A5TA 3GLTA 2GCNA 3H9CA 3ACBA 1JEJA 1P0IA 2CYCA 3S2SA 4CMIB 2A0XA 2V5VA 1P0MA 5HJ2A 2P8JA 1FQJA 2IS6A 1UBGA 4MRRA 2W2OA 4DLBA 4P31A 3QUQA 3SPXA 4DCMA 1SC9A 1U5BB 1X6VA 4OX9B 3AINA 1JFFA 2YWXA 1KDRA 1DOHA 3AEQB 5CA0F 3RUDA 1JFVA 2C3OA 2TSYB 4WCFB 3LYAA 1RIFA 2DETA 3ENWA 3GRFA 1MB2A 3OI7A 1XDWA 3ZBTA 1QP0A 2P6RA 4FYXA 1M76A 2VH5R 4M1YA 4RSHA 1E2KA 3IT0A 3S2EA 4PZPA 2YIMA 1AUOA 4K9DA 3SBDA 5AVKA 5AHRA 3WX0A 1JXAA 2XUKA 4AAYA 4WKBA 5EIOA 4B09A 1TLTA 2N75A 5JCZA 1LRLA 1F6DA 3IIMA 4HZIA 4R9SA 2ONZA 5B1EA 1KI6B 1CUDA 1VJTA 1KJQA 4I9NA 4BX9A 4FMCF 4EYSA 4H27A 3DTYA 3L1KA 1CR4A 1MQ9A 1ZXBA 1A9OA 1C9JA 2M2IA 1KO8A 2Z09A 2AN4A 1TW2A 1WBJB 2OV4A 2WFLA 4FFOA 4I55F 3RM3A 3V4ZA 3CVXA 2CF5A 2IYYA 1YR3A 2E3JA 3FHLA 4ND5A 4DCCA 3BJEA 3EGDB 2JGDB 4IQFA 1FNDA 2FPWA 2ZYSA 4IDNA 4E2XA 4ZQHA 3AY6A 5B2FA 2XOKA 4ZVLA 1QHNA 2OILA 1ZG3A 4K9QA 4WXHA 3NCHA 4BO8A 2QN1A 4RK4A 4ZVKA 4D9GA 3LUKA 1XCJA 1TT7A 1GSHA 3C2QA 3T4XA 3DZDA 3I9JA 4OHXA 5HIMA 2HTEA 3RVNA 5KTRA 3Q10A 1J22A 3K1TA 3OZSA 3WTBA 1WS6A 1Y8QB 1PR0A 1J24A 2D5IA 2GK4A 1VE3A 1GDDA 2HQRA 2ORYA 3E1GA 2FSVC 2WUDA 3HDJA 2QD5A 4JXKA 3FWKA 4DEXA 2I4NA 3UHAA 1FSPA 1MKYA 4CUJA 1XQYA 3H5AA 2PZLA 4PRKA 2Q2QA 1EE9A 2J7KA 1YE8A 2YW2A 1MT3A 4NATA 4NE7A 2P91A 3L1UA 4Q3KA 1YCFA 2ZP1A 2AQ8A 1KY5A 2FH5B 3GOQA 2D74A 4GR4A 1E89A 3AR4A 2P79A 4R8MA 4ZT6A 3RRYA 3SF8B 4ZI2A 2Q27A 3NJ8A 2F6RA 2GNOA 1E4EA 1YDGA 1XAIA 2TMYA 4N40A 2C07A 3OU2A 5FI0B 4KN6A 1Y9ZA 2EKQA 3WK5A 1G7CA 1PJ3A 3HE3A 3NRCA 4L57A 4QUEA 4FX2A 3JVDA 1NWCA 1MENA 1SHJA 3R6DA 3U26A 2ZIWB 1DBQA 5G1PA 4BN4A 2XNSA 1CXZA 3TFOA 3H7IA 3MMXA 2CNBA 1HY3A 4TZ6A 2XYPA 2AI2A 3GLUA 4P92A 3UK0A 4JVOA 5A7FA 1TQDA 2W6ZA 3GRRA 2ASEA 4HMQA 1KMHB 3PNLA 2PQ0A 1TJNA 5BSGA 3PXGA 5AYVA 1D1SA 4AF8A 1LBQA 3WGHA 3PVSA 3FGOA 1XXHB 4TPKA 4EL0A 5JD4A 5M04A 3G2QA 4U8HA 2HUPA 1P77A 2ONCA 3HKBB 1TKRA 3P52A 4X54A 3WKCA 2LWIA 2WSBA 3IULA 1E66A 4A6XA 4DHWA 3OZIA 4H6XA 5DBEX 2PMDA 4W7IA 4BLSA 4FWTA 4F4DA 4MV4A 1S8AA 2P4UA 3FZNA 4UQPA 2DSTA 3HADA 1G6OA 4IGIA 3GEHA 5CX1A 4CL3A 4OL0A 2AB0A 1KZ7B 3W3ZB 3EVNA 4TUYF 5LLSA 3BD8A 4UHBA 4PYKA 1I33A 3GLKA 3VR2A 1QTQA 5JFTA 2IHZA 1NE2A 3A6LA 3N70A 5KREA 1OI3A 2IGBA 3T7EA 5JNTA 5L3VA 3SS7X 1KQNA 1KEWA 1NONA 2F59A 1WUTA 3TLGA 5BMOA 1JPNA 2UVQA 5EJEA 1BHJA 1JJBA 2QW8A 1SRQA 3DDCA 3ZIDA 1TIBA 4DF3A 5A05A 3ZWMA 3Q7SA 1RYHA 3CX4A 2PX4A 1RNLA 3JWGA 5IT5A 1N5DA 5ALZA 5BUZA 1L0BA 4LSZA 3TX2A 1VHTA 4HCJA 3N28A 4X1KA 5ED4A 4DV4B 3TQCA 2YRFA 1GRQA 4AKSA 3AJRA 4ZRMA 3GPBA 1PR5A 4IMJB 1Y6GA 1V5GA 3UFBA 1C9EA 3WDKA 1X8KA 4RPCA 3B5IA 1XLTC 3L8FA 2R00A 3WLLA 4BAGA 4XD2A 2WTEA 4AXBA 3E9NA 1PVDA 1YR2A 2HCRA 2WJPA 1JNYA 3GLRA 3HQ4O 4G9BA 4INJA 4KRGA 3M6LA 2C4HA 1YVDA 1DZ3A 3IMKA 1F51E 2W2LA 3KJGA 4LZJA 4U6QA 3UZUA 3ZOZA 4EKIA 3V4RA 4FFVA 3W9YA 3MT9A 1ECJA 3R3WA 4WRRA 2QZJA 1Y1QA 3U0VA 6AT1A 4JBHA 3CVVA 3WBKA 5IASA 5E8JA 5ECDA 1CWUA 1JQLB 4U2FA 1E5QA 3QG1A 4CTOA 4LJ5A 1OY1A 3QU5A 5HE8A 3AQIA 2W37A 2WM8A 1FS4A 1NN3A 1XCLA 3VX4A 4CM4B 3L5OA 1XXHE 1YE3A 3BIWA 3CF6R 4MUEA 4ZCQA 3SDBA 1FXSA 4BBPA 1ZRNA 3CG4A 2YJGA 4JZKA 1LGYA 1DKRA 1T0UA 1R4NB 1R9MA 3BE4A 1W88A 4FJ1A 3CNNA 4ZQGA 1RDFA 1QRAA 3NXSA 1G66A 2QRKA 4ZRDA 1ODSA 4UVDA 5EA2A 5TGZA 1G20E 4DPLA 5JRDS 5AW2A 5HNKA 1LTKA 1RBQA 1QJ4A 1WUKS 1AN9A 3RBXA 1GRCA 3AP1A 5EGSA 1YASA 5EVJA 1BYIA 2NVWA 3ELYA 4R7GA 5G0SA 4JJIA 1V0JA 4MV9A 5E3HA 2AR9A 2HNBA 1E2DA 2PSHA 1Q20A 5AI6A 2ZSFA 4U02A 1K5HA 3GEPA 3MLBA 3RSLA 4DV1B 3THYA 4ZO9A 2AW5A 4O33A 4J76A 1SVUA 1TAGA 5EPEA 3U9TA 4MHSA 1GZ6A 2UZIR 4MKHA 1U0JA 3GBPA 1UK8A 2WIDA 3FDZB 3Q41A 2V8OA 4IINA 3HYTA 1NZJA 1ZGZA 2Y1WA 1EZZA 1KDVA 1GA4A 3KZXA 3OZ7A 1Z2OX 2DY0A 5HUJA 3L7IA 5JIBA 1YHYA 2ZRFA 4DJDC 1T2VA 3HN7A 3PLRA 2ZITA 3KEFA 4L3VA 1J8QA 3A0UA 3C85A 4LN1A 3UANA 2O0MA 4JB0A 5ILOA 2VEDA 3BZWA 3PGLA 1L5LA 1A2BA 1GM5A 3CFYA 3I04M 2WWTA 5D5HA 3REQB 4BWYA 1EXDA 1X7XA 1FMTA 1R6UA 1TMOA 1N3IA 3AUUA 3G8CA 1YS7A 3OTHA 1ZMXA 5JXJA 2ZB3A 4FUQA 1MGPA 1XYYA 3B7WA 3G8AA 3QTTA 1A4XA 1OFIA 1XVAA 3EYWA 4JOSA 4C9BA 5C4MA 1S9DA 2NU6B 1AO0A 1RJEA 3E3LA 3IYLW 3P4XA 3VU1A 3PQ3A 3A37A 1EUZA 4GKBA 4GL2A 3EBOA 1VSUA 2HEGA 2R7LA 4OF4A 1F4VA 3N5CA 3AM5A 3RARA 1F1JA 5I7AA 1F48A 4F9GA 4OPMA 2IXBA 4GVLA 3WJ7A 3KB6A 1A0OA 3NVKI 1I3LA 2N1MA 4P7FA 1LBEA 4UAVA 3TL3A 2IZ6A 1DXOA 3F6YA 4QXRA 1PQUA 2FQWA 1Z34A 4M37A 4OKNA 2VNIA 4UTZA 1O57A 4C21A 4KAJA 4QOSA 1M5TA 2V7VA 3LDUA 2OHOA 3LK6A 4ROTA 3TEFA 4RFSB 1XVIA 2BJVA 4ZPXA 3ZDAA 1NWHA 1OZ0A 1LPMA 2BMVA 1KC1A 2BEVB 3HKEB 1QAOA 3WMXA 4PX9A 3G9TA 3DVRX 5CCEA 1R5JA 4JAVC 4R2JA 2A1UA 1NHGA 1V3UA 3QLJA 2FFJA 2VJLA 3IAM6 3K0FA 4QRIA 1YRQA 3H0KA 5FL7A 3KQWA 5TT0A 1L7BA 1N8TA 1QH1A 2RHGB 3ZU6A 4HXGA 1N9GA 4RKEA 4ZZ3A 3CF2A 3TBFA 3CWCA 4TXHA 4G07A 3ZWCA 4DSZA 3KDSE 4D4IA 1VPTA 4D3ZA 1H94A 1KHHA 3EIFA 3PDIA 4HQKA 5E8RA 3CN7A 3ICPA 3TCKA 5L40A 2ZR9A 3OJWA 3ADKA 2FQXA 3WL8A 1EMDA 3OZAA 1VL2A 1WLSA 3I76A 2JBWA 1DXYA 1KIFA 2E7ZA 4J16C 4PVDA 3FYSA 1F2TA 2ATCA 3MRSA 4IIYA 4JWTA 4N82A 1NSTA 3NDIA 4RAOA 5EWLA 4HP8A 5JPCA 3CPEA 1ZOIA 2EBUA 3EDQA 4YRMA 1B0ZA 2PCJA 3NNNA 4CF5A 4Z0HO 5H8WA 4IBOA 2OCAA 1ESZA 1J0AA 4G4JA 3I5AA 3ZEIA 1RYZA 1G42A 4MS1A 2QSUA 2QD2A 2YIDA 3PFNA 4YAIA 2OLJA 1WIWA 3A1WA 3GGCA 3RSSA 2X8AA 3HFRA 2PLAA 3QEMB 2B1RA 4IV5A 3SYLA 3W7AA 4F9FA 5IH7A 4IJWA 4LMRA 1J0DA 3PQ7A 1F6WA 2EZUA 5AW3A 5LYJF 3A6FA 3LV8A 4ZKEA 2NZ2A 4NQRA 3VMFA 2FNAA 3CVWA 2HPHA 5E6UB 5C8DA 2ODPA 1NVAA 1QM5A 3FRIA 4PHHA 5ALWA 2V3CC 1N1MA 1V71A 1W29A 4HAVA 3F5QA 1PN3A 3TQSA 3ZWVA 4KNWA 3FFAA 4Y98A 3TSYA 2X4LA 5AJXA 5HQJA 2H29A 5HKOA 1LC0A 1OLUB 1UQRA 3I4LA 1YI0A 3S27A 4D4GA 3MELA 2QPLA 1ZHOA 2V4ZA 4IZIA 3VNVA 1XZJA 4FGWA 3N2GA 3Q6MA 3JYPA 4FBGA 3ECSA 2GAJA 4XPIB 3VBCA 1QYIA 3JYNA 4LDRA 3F2IA 4YC7A 5AWFC 3HKCB 3G7SA 2FFAA 1X7ZA 3HDGA 1JR3D 3ENZA 4MVJD 1G7SA 2VHZA 3JQBC 1VA5A 1M1YA 3FX2A 4UTOA 4HB3A 5DASA 2R4UA 3RIGA 3WDLA 2QXTA 2QTTA 4MARA 1GCGA 3RJMA 4EYQA 3O38A 1PZFA 3LFTA 2D1SA 3KEGA 4YP7A 3SMQA 3VHRA 2JL1A 1DTWA 4JC8A 3H11B 5GAJA 1PR3A 3SXUA 4DCPA 2QPOA 2CLMB 3CGWA 3M9LA 3P2IA 2UZ3A 5DYYA 3HJCA 3UAGA 5EL0A 3BILA 4EABA 3H1BA 4NTZA 4P53A 4M22A 5LC1A 5TF4A 3SOZA 1P2TA 4DNPA 1RCUA 3QWHA 3JYLA 2IE0A 3NVDA 3OZRA 5H16A 4CU5A 5FFMA 1D2MA 5ARBA 4LRWA 1O87A 3AKCA 1GNQA 1VE9A 1C0KA 5DN6A 2H2GA 2P9QA 2R6DA 4IDHA 3EIUA 3UOAB 1UADA 2GESA 3BWMA 1CYDA 3RAJA 3UXYA 3RVBA 4EGJA 4JBIA 1NVBA 4HDOB 4ERXA 2PT7A 2YXLA 4GZ6A 5AMXA 5CLIA 3WLJA 3R5SA 5BPFA 4QJIA 5FOSA 3ESZA 4XUEA 1EP3B 3C1TA 3CT4A 3BK7A 4TSRA 1KI7A 2FPLA 2JDID 4M7WA 1GN8A 1FDOA 3DGEC 1IY1A 2I29A 1R88A 1TF5A 4P38A 2QUAA 2CFIA 5P8WA 1T0BA 1NM5A 4GEGA 3ZE2B 3QOWA 3QIVA 2RHRA 4N03A 5L3QA 3OKPA 3O95A 1A4UA 2XNDD 4C3ZA 4CKWB 1F8GA 2IPMA 1N6IA 2I99A 4AP9A 3COSA 3KNZA 5IAAA 2XGMA 5JS6A 1MO6A 4D56A 4W82A 2CMDA 2W0MA 5AKXA 3RSCA 1G2IA 4L8VA 1DAGA 4A0FA 2A84A 3WB9A 2V0GA 3CO5A 3HO6A 1FNNA 1TI7A 1ZH4A 1VLQA 2IWHA 3UUFA 1S3IA 2GBPA 1NDUA 5J2UB 1J25A 5ALLA 1LH0A 4NEGA 3V1MA 2JIMA 1KFEB 1I7NA 4HNQA 1R12A 1XAJA 1DIOB 4HVTA 1G2PA 1HWYA 2HPAA 3KPVA 4KHZA 4F2WA 4HS9A 5C1BA 2VNJA 2BI7A 3SLRA 5BOSB 4UE6A 3BK1A 5IK2A 4C2UA 4EVQA 2FPIA 3FJYA 1UM9A 2P1ZA 5I9IA 4EA8A 5K0CA 3LCVB 1BVUA 1OVGA 3OO1A 4NJOA 1JTEA 5AVXA 4RF3A 4AQDA 2GUGA 2QG9A 3U1VA 4J1QA 5EPOA 3ZI0A 3VR6H 1D7AA 1D5WA 2I2BA 2WM2A 1QQ7A 2OQ2A 3TMAA 1NUUA 4K6FA 1SY7A 4JKOA 2NV6A 4H15A 1BEEA 2GN0A 1HFEL 1N4DA 1I2MA 1RRVA 2CXQA 4DLUA 4M0KA 3O1HB 1GPBA 5F7JA 4KPEC 1SAYA 2Y1LA 4IILA 2PD6A 2VPXA 1T4GA 1WXXA 1P39A 2J32A 2JCXA 4AX8A 5K4GA 1CE8B 2IHTA 3FJOA 1U9IC 3OOYA 4M9CA 4R1UA 5EZSA 4Q4AB 4OQYA 4GOJA 3I5UA 1QP7A 4HWSA 1FFGA 1ZIYA 3ER6A 4DOMA 4G8BA 2J4FA 4IIJA 2Q6LA 3MCUA 1CNMA 1DLJA 1I0ZA 5MN4A 2XYVA 4H60A 1B23P 5AXAA 3RE1A 4CT5A 3CU5A 4M83A 2NXJA 4AMUA 3WGMA 4J2OA 2YNMC 3W8RA 3WA7A 3B2EA 2YFQA 5COQA 1P8AA 3VJKA 5FX2A 1SBNE 3RW9A 3NDRA 4BQSA 3M1LA 4QTZA 3V55A 4BKPA 3VO9A 5C5CA 1W87A 4HYYA 3CLRC 4JELA 1EAMA 1SBTA 1Y48E 3FMFA 3L7JA 1Z28A 2O3TA 4ARBA 3KEQA 3R3XA 4II7A 3LW8A 1SXIA 3R3YA 2VCHA 1UBHS 2B20A 3LO8A 4ZHQB 1FMFA 2X5KO 4R9NA 4WE3A 2XRFA 4YP1A 1MUUA 2R1VA 2VYVA 3EGOA 4DUYB 4R0MA 1E3LA 1WE2A 1HE2A 2N0SA 3DD5A 4EHKA 3TB6A 2LGJA 3IESA 3TDNA 4H7DA 1K4MA 4WLEA 4CEIB 2I6XA 2QU7A 3D6MA 2BUAA 2BWJA 2BGRA 1SCJA 1VTKA 4PAOA 3U31A 1T3ZA 3L1HA 3I9FA 4Q66C 4V1CA 5HVNA 3IAUA 3LTEA 2NZUG 4I1VA 1AHPA 1T26A 4XQEA 4LJ6A 4QUDA 4YTEA 1YFLA 4HAIA 1YR9A 4I3GA 5GONF 1A9RA 4A2PA 2E85A 3GFPA 5LA6A 2QAIA 4L3OA 4DQ0A 2XY4A 2ID4A 1Y7LA 1TM2A 3TOCA 1YBMA 4JI4B 1XTQA 4HXFB 2B7CA 5LKAA 2NTEA 4EYKA 1IOWA 1BEUB 3D3JA 2HK7A 4JLVA 1YB6A 3FRJA 4PYOA 3KPWA 1Z68A 4FCVA 1UMDB 4RH1A 1KF0A 3U7EB 4B35A 3RK1A 421PA 2PDAA 2HWYA 1QB7A 2H4XA 2WK1A 3IURA 4PFQA 5UKDA 2ZU0C 4O5AA 5JADA 2EG5A 4Y1EA 3SBXA 1SUIA 3DAHA 1U9YA 4RD1A 1VE7A 3CVOA 4LJLA 1Z5UA 2QN2A 4D5GA 4F3TA 2ZT6A 3GLHE 4FB5A 2CD9A 2HM7A 3PJEA 3ZE9A 1AT1A 1FLVA 2FP3A 2R8YA 4ZJUA 1ZVVA 1JQEA 3TNDA 1CUJA 1FSFA 3P9IA 2M6RA 1NUPA 2GKSA 1QONA 2BCJQ 4CMKA 5LXTB 3I01A 1LK0A 1BS1A 3EZLA 3GXOA 4HG2A 4LIPD 3CINA 4JVSB 5H80A 4D3XA 1NN5A 2XF2A 4Q82A 3R5XA 4MMYB 2BMDA 2J6CA 1DX9A 2HF7A 3A1EA 3DOIA 4G0VA 1CQXA 1A72A 4L07A 3JWIA 3QLVC 1XRNA 2O0JA 2ODBA 1E1MA 2VRCA 2OY0A 2EWWA 1M2KA 4UUPA 1XF9A 4E88A 1WBBA 1C0LA 1QG2A 4HDRA 5HRUA 2XKKA 1IJBA 2IW3A 2FE1A 3NHSA 4IIVA 4RQAA 4DRXB 1G38A 1PHPA 1DQPA 3H4IA 3RBZA 4TT8A 1EK5A 1Q12A 1AD2A 2R48A 3W2GA 3PFKA 4LMAA 4AJOA 4MTLA 3SJ7A 3A70A 3BXOA 3IQXA 5GQSA 5AW6A 1H85A 1PJ2A 2O9JA 4K5QA 4KV9A 1JHMA 4LW8A 4DLAA 3CISA 2O2EA 3NWJA 1RLMA 4EO7A 3CZ9A 4A8JA 3HXKA 1P3JA 3HJTA 3AIIA 3FOBA 1HL3A 3IERA 1LLFA 3P4YA 4GZLA 5EQFA 3JYOA 2G67A 1E7MA 3C15C 5C9ZA 4XJVA 2YYSA 4AKEA 4UTVA 2BI4A 3UWDA 4M1KA 2JGEA 5A02A 3ASUA 2PGDA 4HNTA 1R0WA 1Z36A 2Y92A 3FLBA 3N2NA 3VPSA 2C20A 2XWJI 3UV3A 4OQNA 1E3WB 3DV0A 4H4EA 3E4DA 4BGUA 1XNQB 4I1YA 3OFVA 5LZ9A 5DBOA 4Y2SA 2G08A 2RIRA 3GT4A 1YA6A 1R50A 3D0OA 4ZV9A 4FI3F 4EMTA 5LWHA 2D7DA 3SZOA 1QO9A 3U4GA 1AA6A 1X8JA 1XPRA 2R8EA 1KZ6A 4B45A 1RPZA 1MP0A 1Z74A 4QBFA 2JGNA 5ITZB 1N6NA 1E2HA 4GOLD 1CFJA 3VKGA 2NTYC 4OYLA 4A0GA 3BORA 2GT1A 5FUQA 4AKHA 4ENVA 4EG7A 4YJ3F 3A1CA 1M6VB 3HO1A 1W93A 3MMZA 1IN4A 4KIJA 5F5LA 3DYVA 4MVJG 2VAMA 1FC0A 5I01A 1KR2A 3R6LA 1JLLB 4IF6A 4IH4A 4N4AA 4NMLA 3WWPA 2O2IA 4BN5A 1AC5A 3VPFA 2IYNA 3SSMA 1Y5IA 2QRVA 3FMOB 2X1LA 2YZMA 1Z12A 4HX5A 3I9V6 4TTTS 3UK1A 4RIIA 3USES 3JWJA 1QU2A 1Y9EA 3VMMA 4D8VA 1HNNA 4JSYA 2IP1A 2QP9X 2W43A 1CD5A 3FG9A 4G67A 3X1XA 4A8HA 1QHEA 3BXHA 5K01A 2XUDA 1DTSA 4OHZA 4DKXA 2YZ7A 3K8YA 1HUQA 1L7OA 4KYIB 1NBMA 1UC5B 4IDBA 1Z9BA 2QKYA 1U0HC 1XG5A 4HJRA 5G0WA 3O8DA 3EPLA 3RLIA 2PGJA 2OQVA 1RQNA 4ZU6X 1EBBA 2BV3A 3D8RA 3FNIA 3DLCA 5C31A 3EOZA 2WIFA 1V11A 1SKYB 3C4JA 2PH5A 1CPYA 1B8NA 3DYIA 2ZQ5A 1NVTA 2XZTA 1N6KA 3ADCA 1E2GA 4V02A 3IT3A 2R6GA 1YUNA 4GSYA 4J0QA 1QE5A 1U9JA 4WJKB 4XYGA 2D3TA 3L7YA 3OC6A 2NVUA 2XLCA 4ZVMA 1GG5A 1TA4A 4UMDA 3EQ9A 4WZAB 1KOFA 4LQCA 3RC2A 1JZSA 1SQ0A 3PPVA 3JCZA 2IX9A 5TXGA 4D81A 1RM0A 1Z88A 4AULA 4G0UA 4QOFA 3H8JA 3LG2A 1Y9JA 3LQQA 1LD3A 4C2TA 4TS9A 1G5PA 1RPJA 1TD1A 1UPFA 1YZUA 2ZB7A 4MV0A 2JAXA 4NQZA 4RENA 3V8NA 2CUNA 4EYOA 2FPPA 2W93A 4Y2GA 4WLNA 5EEHA 1YL6A 4E08A 4EG1A 5JI3E 1L7DA 4LUCA 2J0SA 4YK7A 1J1IA 1E3IA 3VGPA 3KVOA 4HQNA 4RKYA 3QYFA 3RREA 2B1JA 5EXSA 4C0SA 5EZ6B 2DP4E 1LRJA 4QFMA 1USVA 2IY9A 4CCSA 4RZ3A 2JLUA 3UOGA 1R0ZA 4JV5B 3ZPXA 2O8BB 4Q4JA 5M2QA 5BNWA 1CERA 2HJRA 2WMYA 2HDNB 4R40A 5JXWA 1V3TA 1VG1A 1XD2A 3S68A 1IB0A 1MDFA 1Y63A 2GKOA 3GJRA 4D9EA 3SS9X 2X6QA 1C0IA 1Z2CA 2ZTVA 2HJSA 2ISSD 5C8XA 3HR4A 4MWOA 3W9BA 5CB8A 2QNBA 2XV1A 1G0OA 4C6RA 6ADHA 1BKYA 3LC2O 4EJ0A 3B6JA 4FGKA 1NASA 1QAQA 2P6PA 2C2WA 2XUFA 1P4JA 2NNLD 4P7JA 2QRGA 3G7UA 4G5RA 2WF6A 4CTNA 2ORIA 1GPDG 4MWSA 3LAWA 3CLVA 1GTSA 4ENQA 5I4KA 1KPHA 4QUGA 1ZI8A 1A97A 1J6UA 1JQJC 2H06A 2ZAGA 4MYDA 3WLEA 5BYJA 4NFYA 1LDEA 1B6GA 1E1NA 4UUMA 4ARAA 4G1UC 1RRCA 1JFRA 1GQ2A 4IIJF 1RXEA 4HADA 2ZS7A 4PO1A 4QHYA 5ENDA 2QPAA 3IXLA 3ZYZA 1RC8A 1SD1A 1QH8B 3E22B 1RWQA 4JUIA 4RTLA 1C1DA 3G6WA 1K4KA 1PQPA 4EKGA 2Q4RA 1EVYA 1VE5A 1JHAA 3JQ9C 4H7PA 1OTYA 3UA3A 2HXSA 1IHYA 4O4LA 2GFIA 4BVEA 3ND6A 1HZJA 2XW6A 1YS1X 1YS6A 3PZBA 5SZIA 4CG1A 5LJLA 2CXUA 3K0FB 3V7FA 3OX2A 2W2NA 3FW1A 1SVWA 3LXXA 1EGHA 1P7ZA 3SM3A 1WQ3A 2WD7A 4GUDA 4HGNA 4YCSA 4CEHA 2Q3MA 5DTIA 1UAYA 2CHFA 2YICA 1GFWA 2XHEA 4XYEA 4CKBB 2OPBA 3KR1A 1C9KA 1B8UA 1NN1A 5CLHA 1U3FA 5KAMA 3IBCA 3PI6A 1YR7A 3D81A 2C8VA 4FP9A 4DR3B 3CCCA 4YT5A 2X2FA 1PT8A 3C45A 4X3CA 3WKEA 2BCGY 4ZT4A 1W94A 1CLUA 1J2YA 1P4HA 3R0JA 3HP1A 2GK6A 2P5TB 3OEEA 1CCWA 5CA1F 3N0XA 1A2OA 3U1TA 1ZAKA 4X1YB 5C46F 1Z6AA 3VYTB 1VLMA 2KLBA 4N39A 3E3AA 1V41E 3QVOA 2OEPA 2D59A 3KXDA 2YHIA 2R7MA 4KR0A 5ITSA 3NBZC 2MSWA 4DXAA 4PNZA 3HN6A 4KL8S 5IBRA 3UMCA 1QRDA 1G5HA 2AJCA 3F3YA 4ITUA 1UR5A 4EDHA 3D5QA 2JJ2A 4MEJA 4G5OA 1KAQA 2G9QA 5IDYA 3O6VA 1X92A 1N2SA 1UBJS 4QBKA 1Y4SA 5AQ1A 2IS2A 4WNIA 1GL9B 3RKRA 3WGOA 1EDZA 2CYBA 4H0NA 1CUBA 2YN4A 2PWZA 1WG8A 3V48A 3WS7A 4EQ6B 1BMDA 1OR8A 2AE1A 3NPMA 4HC4A 5GJVC 4BFCA 1V9CA 1IDOA 1L9XA 2HJWA 1AXRA 3QWAA 2A0YA 4A10A 3V4LA 3U62A 3KKOA 1QLHA 4QICA 1N5MA 1QDEA 1N0WA 2E87A 3ELDA 3L2OB 2RG7A 2PPVA 1J2EA 3LPCA 1Z5WA 3HNOA 4LZLA 3OFSA 3E2MA 5LB2A 1A8HA 1P0QA 3DE1X 4UCXA 3QVGA 1CY1A 1ISMA 3DBHB 5LA6B 4M88A 2ZRPA 5HRAA 2RI0A 4A16A 3P7MA 4NCNA 4UEOA 1G8PA 4CEJA 4UPDA 1SZDA 4E13A 1U8YA 2HCFA 2HF8A 1GZ7A 3FSGA 2YN2A 3FNBA 4HATA 4POOA 5JY6A 4JXZA 1XO1A 4HQOA 4IHKA 1UWLA 3EVDA 3WL7A 3WMRA 1HE1C 4KWCA 3ZGLA 4AMYA 2IYAA 1QG6A 3O94A 5HDQA 2FZVA 3PICA 2DPGA 4D44A 2I87A 3F4BA 3ZWBA 5CFRA 1KS9A 1ND5A 4BMOB 4DGQA 1PZXA 5ELXA 3BA1A 3EA5A 1NI3A 1R37A 4NHEA 3FCYA 1HDGO 2YX1A 2X4IA 3AR8A 1G4HA 1I9CA 2A8YA 2FFBA 2HLDD 1C3LA 2RGEA 5FBHA 2IH5A 3BZUA 3K72B 3NUGA 3PXAA 3B5EA 2FUG1 2A3RA 3DWGA 2C99A 3U9LA 2WZQA 3A6KA 1P17A 2IT1A 1BCSA 3E53A 3EG9A 4FI3C 4TMTA 1QRTA 4RV4A 5HILA 2Z4RA 3DLBA 2XQFA 3TQOA 1FQOA 3IEUA 5K3FA 4EF6A 2BC9A 5BQ5A 1PBNA 1H8ED 3UJ8A 2GA8A 3BGVA 3UJNA 4GGOA 1F7VA 4ZRNA 8MHTA 4Z6KA 1EG2A 3SQWA 2MYTA 4P83A 2WIJA 3TM4A 4YR7A 2PL5A 4MI1A 4DBZA 1L4BA 1GZVA 4QPZA 2HZBA 2NX2A 3T1VA 2GN4A 4MCHA 1VKJA 5FYQA 1CC1S 2DUMA 3DZJA 4WQMA 3GJTA 2LCFA 2OBXA 2VP9A 3OZTA 4MK4A 3UBTA 4IVNA 3BXGA 3WYAA 4QPDA 4GL4A 2XBUA 5BXYA 1EVEA 1MRSA 3BKWA 3QE4A 1H22A 2D5AA 3I9MA 4QJ3A 4MOWA 1YD7A 2EHJA 1ZO8A 2F1KA 4TV9F 4UBIA 2ZJZA 1V6CA 2J9ZB 3ER8A 3GP3A 5EVCA 4DPKA 1E79A 1ULAA 2ACWA 3CLUD 4NJMB 1IQPA 3TSWA 2IUYA 2CNNA 4AZ3B 4XRGA 2VAPA 5LQMA 1UJBA 1PV4A 2FPGA 1G21E 3V2IA 5LKRA 3OFJA 4M21A 1ONPA 4IKOA 4XPZA 1P3DA 3JPWA 2B69A 2XWSA 2DLNA 1ZN2A 4IIDA 2ZSDA 5FNVB 1JE1A 4BGIA 3KQQA 4MQFA 4O4JF 1OU0A 2ISQA 3SJZA 4NXNB 1XXLA 3K1JA 4D99A 2Q6TA 1HLGA 1QVWA 1KE1A 2A1UB 1BJRE 4BIMA 5A9RA 4PX2A 4J7CA 5KHLB 2BGUA 3ZD9A 2B5VA 5MF6A 1QHGA 4J29A 3N1UA 4LJYA 2ZE7A 2XCTB 3IQHX 1GGNA 2Q5FA 3D3QA 3KLNA 4JOCA 3T8YA 3ELWA 3LWZA 2P9JA 4GNKA 2G5CA 1MIHA 5T5QA 4A0HA 1EUCB 3LHIA 5BV0A 3FTQA 2FA9A 2H08A 2YNMD 3KBOA 4UZEA 4P08A 4V24A 5D7BA 5B3AA 2ZIXA 4J75A 3TLBA 5BRNA 3TSAA 1QFZA 4ZEMA 4TL7A 1KVRA 1KXJA 1SQFA 3KU4A 1BMTA 3MTDA 1X74A 3EMDA 4LC0A 4LMPA 3QX3A 4AZWA 2OUKA 2UUPA 4NULA 4NZNA 5HUHA 2C92A 2JS7A 4HI0E 3VO2A 1VBNA 3NIFB 1X87A 2GMWA 1EI9A 5JROA 4EELA 4QQFA 1E63A 5F1OA 2VTVA 4RTMA 3I2HA 3D8NA 3RTGA 2PUWA 2BE7A 2GASA 5FOXA 4YJHB 5LOVF 4KQGA 3GA7A 2H5IA 5DHFA 4FE4A 5F78A 3ROGA 1IEVA 5HF8A 3V32A 4WGGA 5C4GB 3ADBA 1IN7A 3K6SA 1I13A 2UZ1B 1IM8A 1U7XA 3TI9A 1PQYA 1OBHA 3RK4A 4X8OA 5JS2A 4EUNA 2BFDA 2FI1A 3EE6A 1FS5A 5BV1A 4LDPA 3SVLA 4UTRA 3O1IC 1DAEA 3ICOA 3WFJA 2CCKA 1M2HA 1M2JA 4AJJA 2RK4A 2RB4A 3R0XA 1XQ6A 4N3CA 1L9KA 3AFOA 4JP1A 4HEA6 3ZWQA 2UXCB 1QQ5A 1IUOA 2I03A 1KJZA 2QGFA 2ZB4A 3QP9A 4IUCS 1JKMA 2ZWOA 3R40A 2PZEA 3I6IA 5FUVA 4EAQA 2P3SA 5E4FA 1FA9A 1JVBA 3F71A 5CUQA 2FEXA 3A1VA 1ZY2A 3IEPA 2B1QA 5THQA 2V8BA 3G9QA 4RVUA 3M4YA 5GJCA 1P4SA 5IW8A 1XJWA 4I55A 4KQ9A 4OV6B 4BQIA 4D9CA 4HK4A 1G6Q1 3U0BA 1VJCA 2WHYA 2XE4A 4KSCA 1WX1A 3VC3A 5LR6A 3NATA 3DF9A 4LHYA 1E59A 4YAWA 4AKGA 3DOOA 3EIXA 3INRA 3PL1A 4PINA 3ZCPA 5BO5A 5AHXA 1JFSA 2I4RA 3HWSA 3MYRA 2GVZC 5IT0A 4IG9A 3V1TC 4NJMA 5EUMA 4J3NA 4EGFA 3DAGA 2WR8A 1UQTA 4ISBA 3UPUA 4Y3UA 4BJ3A 3AEKB 1U3DA 3LT0A 3AFNA 4E5KA 4TLAA 1AZSC 3O74A 4YGXB 1QUEA 1UBEA 1J8FA 1EBUA 2DSNA 1H9CA 3NOQA 1DSSG 2EQAA 2XXJA 3K7EA 3PHIA 4M98A 2FZGA 2I2FA 3LF1A 2ZSBA 1SIOA 2GZ1A 5M29A 5BPHA 2DFPA 2VTEA 2ZWAA 3BGSA 1R2QA 3I2KA 3Q0EA 4IIXA 1A8PA 4RHFA 4D9FA 3UPTA 4GHWA 5GJWC 4CRWB 5A3RA 4TYYA 1JDJA 2EOAA 4ERNA 3TUZC 4GX5A 5KYVA 1DFIA 4RD3A 1SXJC 3EASA 4JI3B 4UMFA 3KM0A 2ASVA 4ALKA 4O4LF 4HN2A 1LK7A 1P5RA 4R16A 3SLGA 3PEWA 4XM0A 2PUVA 5K1ZA 4B4DA 1CUSA 1II0A 4LGYA 4KBFA 1R4AA 3ORSA 4Q1BA 3FMVA 1T2FA 1YR8A 3BQMB 3VR5D 3IPYA 3O4JA 3ANMA 5JDCA 3EODA 3SJAA 4NL4H 1NXSA 3AW9A 1HOXA 2GVDC 2CXSA 2YBDA 4RPLA 3WL3A 3BG5A 1W2WB 2OR3A 3SD7A 1CS4C 4ATNA 3CNQS 4RF5A 4YLEA 5FD8A 4E6PA 2PGOA 5C1OA 3NIBA 3UA4A 1GITA 4OMUA 3WGQA 4EG8A 3IHKA 4XSHA 4D4HA 2L18A 1ZCFA 5J5VA 2G5GX 2VI5A 3VAYA 1JDTA 3WQHA 5CLJA 3OWXA 4CLEA 4EBBA 5F23A 3K2IA 2QRUA 4KOEC 3VH3A 1LV8A 1TYZA 4PPGA 4F3KA 1GZSA 1GTL1 3A4IA 3JALB 3W06A 3ZD7A 4EZEA 4YRZA 3JQ7A 1OLOA 1L4FA 2G5PA 1QXSA 2AG6A 4OVKA 3TB4A 3EDYA 2B25A 2DR3A 2ID9A 4YQZA 2QJFA 1D6MA 1ENPA 2QGNA 5D6NA 3BCSA 2JVJA 4IRUB 4YCDA 3HDHA 1M7BA 2PPLA 1O0SA 3ZCSA 3QBEA 4I1IA 2VWHA 1EZ4A 4R6WA 4ZJPA 3CLTC 4NC9A 1U02A 3OWOA 2XUPA 3OE5A 4KN9S 1PJCA 1AQJA 4OXKA 1OA1A 2FPSA 3BQ9A 3VV2A 2YHUA 4WTOA 4JA0A 1YRYE 3GJQA 1NBHA 2C5GA 3AERA 3LP8A 1XC7A 5KWVA 2NSLA 1FUYB 3UVEA 4JGGA 5K8JB 2A5DA 1MO5A 2XCSB 2FRDC 1N57A 1MABA 2J3KA 3M0EA 1YJCA 4Z4FA 2BBTA 2R1TA 3IVXA 3K9WA 4LF6B 2FUKA 2GCPA 1NJ2A 1U7UA 2BZ1A 2Y93A 3A06A 3JWHA 3N74A 3PKJA 4IV0A 2GHQA 2C5FA 2RB5A 3R8FA 3ND7A 3MG9A 3HEMA 4IMRA 5KINB 3NTUA 5ER9A 5L8VA 1L7XA 1XZNA 2QI9C 4IGEA 4JX8A 4LWQA 1CG6A 4MGYR 2Y2UA 4K9OA 4Y6SA 5TPZD 3ZH2A 1URPA 4IFTA 3JSXA 3S28A 3SR4A 4IHQA 4LEIA 1P2SA 4ZK6A 1HFWA 4NCHA 4C7XA 4ZYUA 2P8SA 4MV6A 4NBTA 2OFOA 4DXHA 5CMLA 3BE5A 1ZH6A 4KKXB 3P9YA 2OOKA 4G85A 3RV3A 5JD5A 2NO4A 2N47A 3JQFC 1CUYA 3SDZA 3L0OA 5DNAA 3G17A 5AVOA 4JLWA 4LRXA 3IDSA 2C1XA 5JQGB 3Q3JB 1H6DA 4IJ5A 3BE6A 3U81A 3H6GA 2JIBA 3PUWA 2AVDA 3PEEA 3T5CA 3RG8A 2V0CA 3GRVA 1SVOA 1GLVA 3HCRA 5ALMA 1D2EA 2X5XA 1ESEA 1QWOA 1I7PA 2K2QB 2BM8A 2WJVA 5HDBB 2D4HA 2Y0EA 3IMEA 1PV1A 4K87A 4LXHA 1U3UA 1GG9A 2XB2A 1N7JA 4JJAA 1E3TA 2AMFA 1U0FA 2QVGA 5JMOA 3S2UA 4GBGA 3KPYA 5IYZB 1YFJA 2JCYA 1GU7A 1HYGA 2ZRHA 5SY9A 5HX7A 3GVHA 3QEBZ 2XJ4A 1IMJA 1A9QA 1B8OA 1DHTA 1EVLA 1UPAA 2A33A 1K3UB 2HIGA 4WCDA 2VUIB 3SK0A 1DNPA 4F4UA 4ZYYA 2WTUA 1XMQB 1T9DA 4D41A 3WWYA 1WEKA 3LZCA 1FFSA 1KNQA 1KOGA 2VDMB 4OK5A 3QVUA 2O7RA 2AFVA 3AWDA 1C3OA 4QKQA 2VJYA 3GLHB 2PJUA 4HWRA 3WOVA 2DUUA 5J2UF 1S3GA 1TYCA 2H9AA 4Q9JA 3V1LA 1W9MA 2EAUA 3R09A 5GONB 4EHIA 1Z0ZA 1AKQA 4WADA 1R4MA 5DGXA 4RC9A 5AFSA 4DJTA 1V1MA 1Y3CE 4MRMB 2BGGA 1QGZA 3GDWA 4DJ5X 4YAOA 3M6FA 3MFQA 4G1VA 1C7JA 4TUYA 3WIBA 1KJJA 4LNUA 3RBAA 1P74A 1DDGA 3C3BA 3F5FA 1F8YA 1MR3F 4JP8A 1G7RA 3CF4G 3MRTA 4AJLA 4EJ2A 3N2KA 4IFIA 1UPBA 2FPKA 1K6MA 1PW5A 4E2ZA 1ZA2A 3KCQA 3ZDQA 1VRCA 4L28A 3KKPA 3BMCB 1ZPDA 2GZSA 4X84A 5I8ZA 2DUWA 3FPGA 3VSEA 2VXYA 3K73O 3ITKA 3QKTA 3W1VA 4JI5B 1KK2A 1WLYA 4ZAYA 4DMUB 3DHEA 1EFTA 3T35A 2NYUA 2XNHA 1EIWA 2P4HX 3GYBA 5LYJB 1LLDA 2PLNA 3TQRA 3STHA 1ZOSA 1HNXB 3CUTA 1XTIA 4EY4A 2O8CB 4WN9B 3HI6A 1J8MF 2X5NA 3LVQE 4OQDA 3O1JC 5JT1A 3WL6A 2RHHA 3HRHA 3L8MA 1TC1A 1NX9A 4K9MA 1MNQA 1DRVA 1U2ZA 1EFHA 3VDRA 3MTJA 1DU4A 3QFHA 3RGWS 2ZB2A 1Z0AA 4NV1A 4EB3A 4E03A 3SZMA 3V5NA 2EV9A 4V38A 3C1OA 2C2XA 5K3DA 2JBHA 1M2NA 3KWFA 3QFRA 4MIEA 1PJLA 1LVUA 2G77B 4PC2A 3AESB 2ZIZA 1Q44A 3FNHA 2PSDA 1SBCA 4JEIA 1WDMA 5AI0A 1OBCA 3RYFA 1PHRA 2Z5LA 3R5FA 3EXEB 4A03A 3IVCA 4JYZA 1ZS9A 1U99A 3O1LA 4KLCA 3RYHB 2YV3A 3DLIA 4RD2A 3BMNB 3AFMA 1XZAA 3ISVA 3TYXA 2GPSA 4Y0VA 1K75A 4GE3A 2Z58A 3FMGA 1RKXA 3ICCA 1J0CA 4HEHA 4MVJE 5D3MA 1ZONA 2BEUA 3NP9A 5G1NA 4KLAA 1Q7GA 2FQYA 2OGWA 3DHYA 2RI6A 4DM4A 6LDHA 4OJNA 1ULUA 3QXSA 4XJXA 2V4MA 1OYOA 3VSCA 1L7EA 3PKZA 4A7PA 3NDBB 2PUTA 2I3AA 2R4QA 3FDIA 3GBSA 4O3FA 5KYYA 1LDBA 4RPIA 2VNHA 3M81A 4A3SA 4M8LA 3JVEA 3ZCUA 4BECA 2AT1A 4V1CB 1L1EA 1UEJA 2FFHA 4LA4A 1TMYA 5H68A 3T1TA 3TOVA 4LYYA 2BEKA 4Q03A 1Y33E 5JR3A 3B1WA 4WFIA 4AIIA 4X66B 2GK3A 221PA 3L7AA 4B7UA 4F85A 1N6PA 1MO2A 2EERA 3CO0S 3G0GA 3HPRA 3PXXA 1T5SA 3AVOA 1LVHA 2H31A 3EW7A 3FYUB 2CHUA 2HXYA 2WKQA 4I14A 2Q1WA 1VI2A 1ZQ1A 1AQIA 2XCQA 1RMYA 1X15A 3BUSA 3LUDA 4ID3A 5AKHA 3AY0A 3CLRD 3RRBA 1NLZA 3V7YA 5JZBA 5LP6A 2FSGA 5CXUA 4PYRA 3DULA 3QU4A 2ZIVB 3C1UA 4EF5A 5KNLA 1YQ9A 5AM2A 3X1YA 2JEYA 3L4SO 1YBFA 1ZC3A 1SUAA 3ZX5A 4DLYA 4B83A 4BLOA 2YZNA 3VOBA 3B1FA 1B6SA 5IRCD 3MTQA