4AZ5A

Differential inhibition of the tandem gh20 catalytic modules in the pneumococcal exo-beta-d-n-acetylglucosaminidase, strh
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
434
structure length
434
Chain Sequence
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
publication title Inhibition of the Family 20 Glycoside Hydrolase Catalytic Modules in the Streptococcus Pneumoniae Exo-Beta-D-N-Acetylglucosaminidase, Strh.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 172
structure length 434
sequence length 434
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2012-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 4az5A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4az5A01
2GDVA 1NWUA 3K8KA 5DO8A 3VD9A 2WBGA 3M46A 4PCTA 4YN5A 5E0CA 1XGZA 4V2XA 4F66A 3SCUA 2X2YA 1E6QM 3CZEA 4U5IA 4EAMA 3KEHA 2BHYA 4D6HA 4FLSA 1GPFA 1J01A 2RGMA 4HA1A 2DSZA 3U57A 3T0AA 1C8QA 1NP2A 2FGLA 1BYCA 3I3DA 3WUFA 3VD5A 3T0DA 2V3EA 2BXYA 4D6GA 3AZTA 1BAGA 4HPHA 1NARA 4HZ8A 2QMJA 2VT0A 2BXZA 3OB8A 1GQKA 1E43A 5JBFA 1FA2A 2D3LA 4FLRA 2JF7A 5BXTA 3ZT7A 1ZBWA 4KMQA 5FD0A 2ZUUA 1W3LA 1JYWA 2GFTA 1HN1A 2DT3A 1W2VA 2DQXA 2J75A 3AOFA 3VX0A 2QPSA 1AQHA 1CTNA 2YA2A 2WZEA 3WQ5A 1KGWA 1HT6A 1QNQA 3WEOA 5C70A 3KL0A 1DWIM 3ARUA 4CN4A 3ECQA 4W7WA 1KR1A 1CEOA 1HVQA 2NT0A 3UG4A 1PPIA 3HU7A 2YA0A 4WF7A 3M7SA 3W28A 3OGVA 3SCVA 3W37A 1NWRA 5A8MA 3BLKA 3CUIA 3WNNA 1ESWA 3DHUA 3RJYA 1I1WA 2C0HA 2ZXBA 3A4WA 2ZXAA 3MUY1 3TOPA 3RMEA 4TX6A 2QLYA 4FZOA 3OBAA 4PTXA 2OSXA 3VD7A 5JUVA 1GJWA 1US3A 3KZSA 1BGGA 3BLPX 1MW0A 1V0MA 5I24A 3AZSA 4N42A 4PTWA 3WY1A 1V02A 4AXNA 4UZUA 3WBAA 2GJPA 4KH2A 4PMRA 1GOMA 2F61A 2JIWA 4ZENA 1UD5A 5E09A 4TTUA 1QW9A 3GNRA 3AIEA 3AISA 4TUFA 1XHGA 3WUBA 4JHZA 4MNLA 2OYLA 1XCXA 3DYMA 1JD7A 1OBAA 1QBAA 3VUPA 1BTCA 3L2MA 1KCKA 2O92A 1BQCA 1E6RA 4K68A 1Q6CA 3QGVA 3GBDA 3NSMA 1K9DA 2YDSA 2XPKA 4QDMA 3ZQ9A 1TFVA 1ZJBA 4Z2IA 1D2KA 1WDSA 4CU6A 3AROA 3GH7A 1LG2A 1C7TA 3WMSA 3BCFA 3WMCA 2D24A 1VFOA 4X0NA 1W91A 3VVGA 1LF1A 1V3HA 2Z1KA 8CGTA 2VTFA 3L4ZA 1GONA 4Y7EA 4LPCA 1MWOA 5A8PA 1J0ZA 1QW8A 2E9LA 3ZOAA 4MNMA 5GPRA 4C7FA 1RPKA 4M24A 1B3YA 3FAXA 4CKQA 2BY2A 5CSYA 4LQ1A 4UTFA 1JFXA 5A95A 1MW2A 1E73M 3ZO9A 3VO0A 1M04A 3OLDA 2ZX9A 2JEQA 2ZX8A 4J3WA 5BROA 3RIKA 5A2CA 1CZ1A 2G4FA 2YBTA 1HNYA 1UYQA 1QI2A 3W6LA 4AZ5A 2J62A 3AS3A 3K46A 1QNSA 3WDPP 1JZ4A 2VNCA 2ZOXA 3ZJ7A 5BWFA 2WMFA 4FLQA 1HP5A 4TVCA 2BHZA 1J9YA 4PEEA 2NSXA 4AC1X 1LLOA 4MDOA 2YKKA 3CTTA 4OUEA 1E5NA 3VDHA 4AZGA 4QP0A 2DGAA 1PZ2A 4S3KA 2NT1A 2UY4A 1G5AA 3GTNA 4HZ6A 3WIJA 4OKDA 1JYVA 2DH3A 2Y8VA 2IXVA 1KBKA 2VVSA 3WN6A 4MADA 1C93A 1H0GA 2VURA 7CGTA 2OO2A 2OSWA 2J7CA 2NW0A 3UEQA 1WCGA 1BYDA 2OWCA 4GI6A 1HX0A 1A47A 1CENA 1MW3A 3SCNA 3RDKA 3N04A 4M56A 4HMDA 1TCMA 3T2PA 1X1NA 3N1AA 3N18A 3GXIA 2O9PA 1R85A 1E0WA 3SUSA 2XHYA 1JL8A 4CD5A 1J0HA 3NUKA 1SYTA 4QFUA 1ODUA 3CHDA 1LWJA 3EMZA 4IPLA 1PBGA 1UH2A 4XB3A 2O9RA 1SFSA 4CU8A 1ISVA 4CGTA 3VDBA 4J7RA 1UR1A 5JIPA 4DUVA 3M6DA 1E3ZA 3RPMA 2J7FA 3VX1A 4IM4A 2J77A 2ZUVA 3AHZA 5A6JA 4H7VA 1KXTA 3AFBA 4J27A 3NJ3A 4P8XA 4PSPA 5E70A 3CBWA 4L4OA 1E55A 4IUGA 1C8YA 1W9PA 1C7SA 1G1YA 1QVBA 1UR2A 3WF4A 3VGDA 3SCWA 3WMBA 1C91A 1ISZA 3WD3A 3EDKA 2Z1SA 1GQIA 2GK1B 3L4YA 4JHOA 5HNNA 5AC5A 3BMVA 4PMDA 3KL5A 3VGGA 4W85A 1JF6A 2XVKA 4EK7A 3U7BA 1UKQA 4AYSA 5A6LA 2G3NA 4NF7A 1TUXA 3IJ7A 3MANA 4Z2JA 4GQRA 4DM1A 1HXJA 2WVUA 1M7XA 4R5EA 3CZGA 3WD1A 3CUGA 3RCNA 2X0HA 1E6PA 1UA3A 4D1JA 3TTOA 4ZEPA 2W62A 4AZ6A 4P7RA 1EGZA 5CSUA 2J8FA 3IJ8A 4AD5A 4UZSA 3GNOA 4UQ9A 3ZT6A 4AIOA 2BY1A 2QPUA 1B3VA 2EEXA 1QHZA 4E8DA 1UWIA 4F79A 3QHMA 1GVIA 4H41A 3EMQA 1C3FA 2GK1A 1N82A 4AD3A 4Z2HA 3MUAA 1ZBKA 2FDMA 1V6WA 1E15A 3I3EA 1VJZA 3KL3A 3VDAA 4U2ZA 2G8ZA 4A3HA 4P8UA 1UD6A 2A3BA 1KXVA 2WCGA 3EDJA 2ZIDA 4HTYA 4BS0A 1DEDA 5I23A 2CBVA 1P6WA 5D9OA 4DWSC 1B3WA 1HIZA 1Q6FA 2VCBA 3O2LA 2XVGA 4PMNA 4P7NA 4D72A 2D0HA 4PMUA 3JUGA 4OBRA 3A4AA 4PTVA 3WQ8A 3W4RA 4AD4A 1OD8A 3A6OA 2E8YA 4X9YA 4W7VA 1NWSA 1XC6A 1BG4A 4ACYA 1JDCA 3DYPA 4WKFA 3WF0A 2UY3A 2VZOA 2WHLA 1UR9A 2QHAA 3F5LA 1VEMA 3VPLA 5HOSA 4AZBA 1K9TA 1WE5A 3NIYA 4P8VA 3VGEA 2ZUNA 3SCQA 3EDFA 3N15A 1H0IA 1UKOA 2YOCA 5M03A 1UWSA 3I3BA 4QLJA 1W1YA 3WUGA 3W53A 4UCFA 3MV01 3WNPA 2JEPA 3PTQA 8A3HA 3OGSA 4GO8A 1EIBA 3WEZA 1TZ7A 3OLGA 1PX3A 4ZXOA 2XWDA 3W38A 1KQYA 1UKTA 5HBFA 2X1IA 5EFDA 1W2PA 2A3AA 2JF6A 3ZR6A 1OWQA 1CXKA 2DH2A 4OIFA 5A3HA 1PIGA 4AD2A 2VX5A 3K4AA 1ZS2A 2VRJA 4W7UA 1FH8A 3AIWA 4UOQA 1JXKA 3WNMA 3U5UA 2WLZA 5EFFA 3BCDA 1AQMA 1HJXA 5E6ZA 1L8NA 3WNOA 1GNXA 1TMQA 2G3MA 1NM9A 1GHRA 2WKGA 1MXDA 1JZ8A 3FW6A 4DUXA 1W1VA 5KEZA 5A6SA 1H4PA 1OD0A 2PWDA 2EQDA 1J18A 1QI5A 4QLKA 2YJQA 1EQCA 3B9EA 3RILA 1KGUA 1UH3A 2EPKX 3AICA 3SUUA 2WHKA 4CN1A 3CUFA 3AMKA 4PTMA 2CYGA 4HZ7A 1V3IA 2XYLA 3SUTA 2V3FA 2DEPA 1W1PA 2J7EA 1CDGA 1ZBVA 1UWRA 4JKKA 1WAWA 5JIWA 4NI3A 1BYBA 4JAWA 4W89A 4E4PA 1QI3A 4MJ2A 3MS8A 2AMGA 3ZJKA 3QR3A 4M29A 1FOBA 3FNDA 4KWUA 4PYSA 4MTVA 2CIPA 3WUEA 3LPOA 4WK9A 1E40A 1XRVA 3APGA 1ITCA 4C7GA 1QOXA 2ZWYA 1Y7VA 1UWUA 1EDQA 4IPNB 2J7GA 1WDPA 5E0FA 2FHFA 2XIIA 3OZPA 3QHOA 2XIBA 2J4GA 4AD0A 3WDRA 4UOZA 3NCOA 2WCSA 1UD4A 4ML4A 4W86A 5HXMA 2HISA 1YHTA 5I0DA 4MDPA 3PBGA 3WFZA 4YPJA 2OSYA 1AVAA 1KB3A 2VRKA 2ESCA 3A3HA 4W87A 3TONA 4FK9A 2W63A 2ZX6A 4FLOA 1JXJA 2WMHA 4MNKA 3WNLA 4HOXA 1MYRA 4LX4A 1LQ0A 3VD4A 1ISWA 3BSHA 3WQ6A 1H49A 4NZCA 5AC4A 2W4XA 1DWGM 1GZJA 3EBVA 3N13A 4CCDA 2G41A 3PZ9A 3ARYA 2GVYA 2WM0A 4OBSA 1XH1A 1CGYA 4A4AA 4MNJA 3T2OA 4MJ4A 3VIKA 1IT0A 3ARWA 5EBAA 2WPGA 1B2YA 4CU7A 4TOQA 4WIWA 1UD3A 3ZJ8A 1CLVA 3AIUA 2O9TA 1XYZA 3BH4A 2ZE0A 3LPFA 3BXWA 4PMQA 3UR8A 3GH4A 2PWEA 1UD2A 3FAWA 3ZT5A 3F5JA 4UOJA 2GSJA 2A3HA 1EO7A 3GDBA 4RL3A 4CD4A 2CPUA 2EPOA 3SCOA 4J3TA 4AZCB 3FN9A 1KBBA 3AIBA 1GHSA 4V27A 3MV11 3G6MA 4KRUA 3D5HA 2WB5A 3PZQA 1W3HA 5BXSA 1OIFA 3A4XA 3CHFA 2CESA 4H2CA 3VTRA 1E6SM 3AHYA 4NRSA 3WEMA 1E4NA 5JBEA 5BYWA 4UNIA 2AOSA 1MW1A 5C71A 2X0YA 5A1AA 5CXPA 3AHVA 2FH8A 3PN8A 2OYMA 2WXDM 1NQ6A 2FHCA 4P8WA 1CNVA 3TP4A 1J0JA 2VX7A 3CO4A 5IXEA 1DWJM 1H5VA 5AYBA 2UY2A 3OIHA 1TR1A 4XUYA 1XD1A 1CGVA 1HKIA 4ZFMA 1HJQA 2BY0A 2BVTA 3TTYA 1U30A 2WVTA 3VMOA 2D20A 4PBGA 1CXIA 3VIPA 2DIEA 2XGBA 3T08A 2XWEA 1JDDA 2WZHA 3AIRA 1KFWA 4UFMA 3AMCA 1E4MM 2VR5A 1VJSA 3NDYA 4JFTA 4DM2A 4PUDA 3HN3A 4H8VA 2YLLA 1M53A 1VFUA 1W3KA 4GZEA 5CQ1A 1J0YA 1JYNA 4Q7NA 1H1NA 2TAAA 3HMCA 4M81A 4D6FA 3VNYA 2BV9A 2YL5A 4CVWA 3CHCA 2DSVA 2MANA 1B0IA 3WFLA 2WMJA 2CHNA 4UFJA 2XM1A 5A6AA 4TXEA 1KGXA 1KQZA 2EPMX 1HJUA 1Q6DA 1PZ3A 5FCZA 2JE8A 4BCEA 1XCWA 2UWFA 3CZLA 2WC7A 4PRWA 3W25A 4UQDA 2EXOA 2AAAA 5CJ5A 5LA0A 2D3NA 4J3UA 3IANA 1BGAA 3AXXA 2WCAA 1XH2A 2G3JA 2WC3A 4PMZA 1W3JA 5M17A 2W67A 4DWSD 3OLEA 3PZTA 1K9FA 1AMYA 3W0KA 3W26A 3ZM8A 2X8RA 2ZUMA 2IUZA 4PSRA 2WWDA 1LL7A 3BGAA 1G0CA 2UY5A 5D9NA 3ZJ6A 1CXHA 5DF0A 1HJWA 4QLLA 4W5ZA 4HOZA 4E8CA 3VGFA 1ZJAA 1E1EA 4D1IA 5I78A 1K6AA 3K1DA 2BFGA 2CXGA 5CPTA 3LMYA 2C7FA 2DSUA 2XG9A 1NOWA 2D0GA 2V5DA 3W6MA 1PEZA 2WHMA 2Y4SA 1WZKA 3AZRA 3L4VA 4WKHA 3GM8A 2VVNA 4D6DA 3SEPA 2F2HA 1XYFA 2DDXA 2J74A 5FL1A 5D9PA 2E9MA 1EXPA 5A6BA 2J79A 5IHRA 1CGUA 2VUYA 4H04A 2F8QA 5GNXA 3MMUA 2W91A 2ZICA 1Z32X 4WJXA 2CHOA 4AZIA 1E56A 3UCQA 4U5KA 4W8LA 1OB0A 1FHDA 2A3CA 5BXPA 3RO8A 1V3KA 5D9MA 4U33A 3ARXA 1NWTA 1E9LA 2DSKA 2RGLA 3QHNA 1FH7A 3AI0A 2GJRA 1XH0A 1DWHM 3BAWA 4D6CA 1UR4A 3UESA 1B30A 1VF8A 5CGMA 1KXQA 1WZAA 2YL9A 2WMIB 1VBUA 1B9ZA 1EA9C 4H8UA 4HP5A 4N0RA 4BQ2A 4AD1A 1UR8A 3VIHA 5I3DA 3OZOA 3SCSA 1HKKA 1OT2A 3CMJA 2VZSA 3LPGA 3E1F1 3ARTA 4XV0A 3LPPA 2A3EA 1V6YA 1HVXA 3RM9A 2PWGA 3CHEA 3VMPA 4JL1A 5A94A 2WYSA 4RE2A 4P7LA 1CXLA 3RJXA 1E72M 4J3VA 1ISXA 3FHQA 2WAGA 2CCRA 1GORA 1G94A 1OCQA 3O9NA 1KWGA 2V5CA 1ZU8A 3RM8A 1MFUA 4GZIA 4RE3A 2WNWA 3SUVA 4GINA 4ZE4A 3OLIA 1TE1A 1UQZA 1WDQA 1U2YA 4NSBA 5LA2A 3WDJA 2WMIA 4ZE5A 4M1RA 6CGTA 1V3MA 1CBGA 3AIVA 2X05A 4BA0A 1PIFA 3BAXA 2VJXA 1QNPA 1JZ2A 2E9BA 1UZ1A 2OYKA 4CD6A 4AY1A 2VQTA 2DPEA 5DT5A 5A8QA 1HF6A 1UG6A 3CMGA 3VMNA 1JFHA 1KCLA 3UR7A 3VIJA 2JNKA 2J78A 3L4UA 3AMLA 4TX8A 5A69A 4QCEA 3TTQA 2VX4A 4JKMA 3SCTA 1BYAA 4LYQA 4Z2KA 3AS2A 4U2YA 4KRTA 2D23A 2WWCA 4H8HA 2W66A 2Y8KA 1VFMA 5ECUA 1RD6A 4C7DA 3NSNA 5LYRA 4BQ3A 1WZMA 3CIVA 1GOQA 2WMKA 4ACZB 3BSGA 2OZNB 2CETA 3F4VA 3F5KA 1X6NA 1V6XA 9CGTA 4V28A 4P7OA 3BAIA 4HPGA 2XGIA 5ABFB 1CGTA 1EH9A 1WO2A 2WANA 3PZMA 2W5FA 3AQUA 2PMRA 5I5RA 1JZ5A 1V03A 3EMCA 5A8NA 5EB8A 1D7FA 5IDIA 2YDRA 5GNZA 1ZBCA 3DECA 4CN6A 1KR0A 1V6VA 3FY1A 2EPLX 4JKLA 4GKLA 4AIUA 5IFPA 1JG9A 4R27A 2YLAA 4JCLA 1TVPA 1J0IA 3VU2A 1RH9A 2PB1A 1BFNA 7A3HA 1BVNP 4ACZA 1B31A 3ALGA 4J28A 5C8BB 1F4HA 1WNOA 4Z2LA 1E6XM 1R8LA 5ABFA 1TG7A 4QCFA 4PMXA 3OA5A 2VZVA 3WH5A 3T2QA 1ZL1A 1US2A 2XVPA 3IAQA 3WENA 2YBUA 4NRRA 4MB4A 4MAVA 2WSPA 4J3XA 5CG0A 4B15A 3GYCA 4JZ5A 1MXGA 1BLIA 4B16A 1R7AA 1F4AA 1XSIA 4B9ZA 3CZ8A 2ZWZA 3ARQA 3CUJA 5A2AA 3MUIA 2VCAA 2PWFA 1DWFM 1L0PA 1TVNA 1ODZA 2ZX5A 3T09A 1CXEA 1CECA 2W92A 2HVMA 3POHA 1LJYA 1IZKA 1KXHA 4M82A 4M8UA 3N12A 3THCA 3L4XA 1VAHA 2DT2A 1WB0A 5DFAA 1C90A 4PMYA 4PUEA 1J10A 1JDAA 3WBEA 5ABHA 5IHSA 3UG3A 1VIWA 2J7HA 2ZUTA 4PMOA 4TVUA 4XZWA 1E6ZA 4LYRA 1V0KA 3WH6A 1OGSA 4JIEA 1JZ3A 3MSGA 4XZBA 2FHBA 3PTKA 1CGWA 4DWSB 2VC9A 3GNPA 1GUVA 5HPCA 1YQ2A 3AS0A 1XSJA 2Y5EA 4ZXLA 1H41A 1UD8A 3VIMA 1R7OA 1CGXA 1MQRA 1TA3B 4GO9A 1S46A 3AYRA 3ZIZA 2WMGA 1FP9A 1UOKA 2OWWA 1NP0A 1CIUA 3WSUA 5I2UA 1GOKA 2QMKA 5I77A 1V08A 2WHJA 3K4DA 4DUWA 2VMFA 3WH8A 1UKSA 4B3KA 1ITXA 2VOTA 1U33A 2OWXA 4CCEA 1M01A 3WL0A 2BS9A 2EO7A 2O9OA 3L2LA 5CPQA 2J7BA 1W1TA 2PWHA 1QHOA 3OG2A 5ABGA 1Q4NX 3AXHA 4XX6A 2J25A 1J0KA 4WSKA 4UQCA 3ZSSA 4D6EA 1VBRA 4ATDA 3WNKA 2BY3A 4DWSA 1UZ4A 2CBJA 4AW7A 3ARZA 2J47A 2E4TA 3W27A 3DYOA 2D2OA 3IJ9A 4AISA 4TVDA 5E6YA 1TA3A 2XUCA 1K9EA 3B9AA 1GW1A 3ARVA 1E3XA 3WQWA 2WVVB 4JL2A 1NH6A 4JCMA 4UFIA 3AHTA 1D3CA 2VI0A 1QBBA 4OJYA 3SCPA 2ZXQA 1QI0A 1W9UA 2FH6A 4MB5A 3CLWA 2Q8XA 4P7QA 3VD3A 1CXFA 3HJEA 5CLTA 5DMYA 4QAWA 1I75A 2XFYA 1DTUA 1HJSA 1MQQA 1UUQA 2D1ZA 3CH9A 4HA3A 4U3AA 1JZ7A 1V3JA 3UG5A 3CGTA 1EQPA 2DIJA 1UH4A 4CCCA 2JIEA 3BAYA 3GBEA 4RE4A 2DSWA 1XV8A 1UA7A 1HL9A 5GQBA 1IZJA 3W82A 3WD4A 1V0NA 3MMWA 1DHKA 5LA1A 2E8ZA 4W84A 5TD4A 1EOMA 4LXFA 3THDA 3B9DA 3L4TA 4IISA 3S6TA 2GDUA 1LWHA 2WVVA 3POCA 3W24A 3PZUA 2DT1A 1PAMA 4UQAA 2PI6A 4CD8A 3TA9A 1VFFA 5A6KA 4B3LA 5CLWA 5D8ZA 3ZSTA 1VENA 3VGHA 3ARSA 3PZGA 4W5UA 5DT7A 1UQYA 3VGBA 2WBKA 5E9AA 4MB3A 1JI1A 3N17A 4Q22A 4HMCA 4UFLA 4F9JA 4CVUA 1JD9A 3VDCA 3BMWA 3N11A 3MSDA 1BPLB 3VINA 2VRQA 2XVNA 1BSIA 3GXMA 1IV8A 4AZCA 4CD7A 1LL4A 3IK2A 3BC9A 1HJVA 1HP4A 3CZJA 3N9KA 2J7DA 1E71M 5FIPA 3K8LA 3WELA 1WKYA 2WVSA 4UQEA 2VZTA 1XD0A 1HKJA 2XVLA 2YDQA 2XFRA 1FHLA 4OOUA 1E4IA 1ZB5A 3VIIA 1BVZA 2WK2A 3M07A 4AEEA 1GQJA 1GQLA 1H3GA 3BAJA 1XSKA 3AXIA 2CNCA 4GQQA 1PX8A 1FH9A 2JFEX 2QF8A 1V6UA 4YHEA 3VIGA 1JAEA 5BRQA 2VQUA 1HL8A 3PHAA 4HOWA 1E1FA 2BNJA 3DHPA 3VNZA 3PZIA 3ZMRA 4FMVA 2VL4A 1C8XA 5HPOA 4AEFA 4D6JA 2CKSA 3AMGA 3SIMA 4BZYA 1H09A 2DT0A 5JBDA 4M80A 1NOFA 4W8AA 5DEZA 3WKZA 1VB9A 5CPSA 1CWYA 3WD2A 1WPCA 2WW5A 2EJ1A 4B9YA 1EDGA 1W9BM 1OGGA 1QHPA 2G3IA 1LL6A 1V3LA 3NYDA 5FL0A 1EHNA 3AIQA 2OLHA 1CLXA 1GOIA 2VR4A 2VX6A 3VIFA 1BG9A 3GZAA 4EANA 1W9VA 2CERA 3VM5A 1J11A 4HA4A 1DWAM 2CBIA 1W9XA 4KGLA 3GH5A 4BQ4A 5FOOA 1ECEA 1EOKA 3MU7A 3PZVA 3GXFA 2WSKA 2V3DA 2XJ7A 4GXPA 3TTSA 2YIHA 1B1YA 3W81A 1UHVA 4AMCA 3WF1A 3ZR5A 2ZX7A 5KZ6A 3QOKA 3BAKA 3J7HA 4FF5A 1UKPA 3NSXA 2CEQA 1RP8A 2BHUA 3KWXA 2ZXDA 1NOUA 1UWTA 3ARPA 5A2BA 1OT1A 1I1XA 1OM0A 3OGRA 3CUHA 2BVDA 1FP8A 3UETA 2Y24A 2CBUA 2WZIA 5BCAA 2GJXB 3VKKA 2V3GA 3K8MA 1OIMA 3WQVA 3VM7A 2PF0A 4UR9A 3QOMA 1PJ9A 1V0LA 5FKYA 2YA1A 1ISYA 4GPNA 5AYIA 1W9DM 2D0FA 3PTMA 2GUYA 5D8WA 4F9DA 3AS1A 1BF2A 2W61A 3IAPA 3WH7A 3WF2A 2WKLA 2XTKA 2X09A 1OINA 1B3ZA 4W93A 4MB1A 2V38A 1LG1A 1E4LA 1DP0A 4BQ5A 1Q6EA 1EDTA 1CYGA 1UR0A 4KGJA 3U5YA 1QPKA 4Z2GA 1OSEA 3S2CA 3VIOA 3WL1A 5I6SA 1B3XA 2EBNA 3WDQA 2PBOA 4PN2A 3D3AA 5ABEA 1O6IA 7TAAA 1J12A 2GJXA 4LYPA 1E0VA 4MPKA 2PBGA 1CPUA 3EYPA 2QV4A 1Q6GA 1E6NA 4U3CA 4F8XA 3A47A 1G01A 1JNEA 4ATLA 4U31A 1FFRA 1JZ6A 4ATWA 5BXRA 4JFSA 3T0BA 1X6LA 1WDRA 4GI9A 1MVYA 4BF7A 1H2JA 4LGXA 3WQ4A 2IXUA 4X0VA 4JFVA 1KWKA 1W32A 4D71A 4YHGA 3PZOA 2EPNA 2CKRA 2XSBA 4WSJA 1R86A 4W8BA 1BHGA 1B90A 3WD0A 3UERA 2E0PA 3II1A 1QI4A 3U7VA 1JAKA 1MFVA 3CZKA 5CGTA 3SURA 3WDIA 2E40A 6TAAA 4HU0A 2PC8A 3WF3A 4GZJA 1M03A 2J8GA 2D22A 5D4YA 1VEPA 1JIBA 4AZ7A 5HDRA 1O7AA 1QNRA 3WH9A 4UFKA 4UFHA 2WLYA 2XM2A 4FZPA 4J3SA 1E0XA 3MKKA 1AQ0A 1C92A 1JGIA 4EKJA 2B31A 1MQPA 4GIAA 3AHXA 3EDDA 3VILA 4HMEA 1GJUA 4E2OA 2YL8A 3SCRA 2BVYA 2C8NA 5GNYA 4HU8A 5EMYA 4PCSA 2XFFA 5IFTA 1A3HA 1OGBA 4TTGA 5I79A 4URIA 4AZHA 4D6IA 1H11A 1PX4A 3EDEA 1GCYA 2CITA 4OZOA 4AWEA 4A3YA 3NDZA 5A8OA 3B8SA 4MAZA 3KE0A 1JF5A 1G9HA 1R87A 1VEOA 1QNOA 3L4WA 1WZLA 3WDHA 1JNDA 4PMVA 4UQBA 5A6MA 3VOCA 1GOOA 2VCCA 1HKMA 5A6BD 1RP9A 5F7UA 3DC0A 4GI8A 1FFQA 3AMDA 4WLCA 1VRXA 3GXDA 3FHAA 6A3HA 4CUCA 1EHAA 3AYSA 3SUWA 5M5DA 4WKAA 1SMAA 2FGZA 2JALA 3RM4A 1GOWA 3MUZ1 2E3ZA 2YL6A 1SMDA 2WC4A 2Y2WA 3MMDA 5BRPA 1GVYA 5CZKA 4OOZA 4JFUA 4W88A 1JI2A 3ALFA 3AJ7A 4AIEA 3W29A 1WP6A 2ZUWA 1SR0A 3FXYA 1E5JA 3MO4A 3G6LA 1E70M 4L4PA 1UWQA 1EO5A 3ARRA 1JYXA 2VZUA 3CPUA 4S3JA 4JFWA 2XSAA 5M3WA 3PZNA 1V02E 4EE9A 2VO5A 5AY7A 3O6AA 2ZUSA
chains in the Genus database with same CATH superfamily
1BF6A 2UZ9A 3B52X 4OE7A 3VD9A 4KCWA 3VC5A 3N9SA 3Q4DA 4JX5A 3C3UA 2V63A 5E0CA 1XGZA 1XIJA 4V2XA 1GG1A 1ONWA 4LBUA 4MUZA 5T8GA 3HV9A 1E6QM 5G1TA 4EAMA 1J2WA 1PO9A 4H6QA 1SZFA 1XYBA 3O63A 2Y5JA 2CHRA 3NO1A 1A5KC 2RGMA 3U57A 4AF0B 3MKVA 2VWSA 2FGLA 4FNUA 3V18A 2V3EA 4D6GA 4ENLA 2R1NA 3G3MA 2PU0A 4B4HA 3F4WA 3LN3A 4QS5A 4NZ4A 1GQKA 4MPQA 2D3LA 3SQSA 3MHGA 2ALDA 3DFOA 4H01A 1QPQA 1OEPA 4IIGA 4GC3A 1HN1A 4QM1A 3O15A 3NPWA 1W2VA 4DJFA 2DQXA 3DEQA 1AQHA 1KGWA 5AC6A 1QU4A 1DWIM 3NOEA 1CEOA 1VJIA 4FF7A 3S0CA 3N9RA 3KDOA 3HU7A 3FVMA 2FJKA 3OGVA 3SCVA 4HYBA 1FCUA 2GVLA 3CC1A 5A8MA 4Z1CA 3C8NA 1R34A 3RJYA 2IKGA 4NKCA 4JNZA 2ZXBA 3BLLA 1K03A 2YXOA 2QLYA 4FZOA 3F2BA 2OR2A 4Y96A 5EMMA 3VD7A 1U1UA 1BGGA 3BLPX 1MW0A 3MI2A 3ZR4A 4Q32A 5ECVA 2F18A 4AXNA 1R47A 3W7DA 4UZUA 4H9TA 3WBAA 2OMAA 4KH2A 1ME9A 3U3HA 4CCZA 1PKLA 2HNHA 3P2VA 4JXCA 4ZENA 1SJAA 3EA3A 1P6CA 1DJHA 5E09A 1ZAIA 2Z2BA 1OYAA 4XD4A 4Q4MA 1MSSA 3WLQA 3C0JA 3W22A 2EAWA 4TUFA 1XHGA 2DZPA 4PRRA 2ALWA 4GNKB 3WLMA 1E6RA 1Q6CA 3W2LA 3B8DA 4A6GA 1Q7MA 4ECLA 5EMUA 2YDSA 4AXKA 5G4EA 1XYAA 1X8CA 4ZOCA 5CC5A 3UZXA 1WDSA 4CU6A 2C16A 5HA7A 1KD0A 3QMTA 1IHIA 3L5AA 1LG2A 3T8LA 5F2GA 2DW7A 4F01A 3WMCA 1VFOA 1W91A 1PYFA 1V79A 1I6NA 3PANA 4EPKA 2NQJA 1DXFA 1EF2A 4DO6A 4TQTA 1O60A 3GUGA 5A8PA 1SSGA 2PDWA 3BOLA 3PBWA 5DN1A 1WOBA 3TMQA 4C5ZA 4MNMA 1ZLPA 1T7LA 4C7FA 4HKPA 1RPKA 4UTHA 1HZYA 3CB8A 3FAXA 2MI7A 2IQTA 3P67A 4QNEA 4IQLA 3ZVIA 4ZL1A 2BY2A 4JNYA 4O0KA 1LRQA 1MW2A 3I7QA 1IWAA 3I7RA 3QMSA 4LOCA 3WK0A 3TAOA 3BDKA 4DBSA 2ZX9A 3CH0A 3CQIA 5D32A 2Q8ZA 3TJLA 2JEQA 3KFTA 2ZX8A 4J3WA 5BROA 5CPMA 2DORA 2J62A 3G2GA 4LU0A 5KETA 3R8RA 1R3VA 5AYZA 2ZOXA 5JQ9A 4GUJA 1UB3A 4FLQA 1UP3A 1EX1A 4YMZA 1XGDA 2BHZA 1J9YA 3HG4A 4PEEA 2NSXA 4EPEC 4AC1X 1LLOA 4LB3A 3CTTA 4OUEA 4DY1A 3ONCA 2GYIA 4JBRA 3PF3A 3RLVA 1V77A 2HV5A 4DJDD 1JYVA 3NDOA 2IXVA 2AMXA 4PL2A 3WN6A 4MADA 4EXAA 5BWAA 1H0GA 1I9CB 4DUOA 3CEUA 3LCWA 1TVLA 1I0DA 2FJUB 2OWCA 2VWTA 3L0KA 5AECA 2OELA 4LANA 1FWCC 2OT0A 1HX0A 1A47A 5CBJA 1CENA 3TMLA 4N4PA 4X2RA 3RDKA 5F1VA 2HMCA 3VNDA 4HMDA 4BF9A 4Q4KA 2R8WA 1E0WA 3NVDA 3NUKA 1ODUA 4QHRA 2PD5A 1GT8A 1OX5A 3NZ1A 3GY1A 5H91A 4XB3A 1LQAA 3QFEA 2B4GA 4CGTA 5CC6A 1UR1A 4HJFA 5KINA 5JIPA 2OW6A 4B90A 3VX1A 3STFA 2BOFX 2VGBA 2X41A 5A6JA 4H7VA 1KXTA 2JKEA 3R43A 4OECA 3C56A 4PSPA 1E9VA 4L4OA 5LXEA 1C8YA 2A21A 1UR2A 4C6KA 3KTSA 3SCWA 3WMBA 1EJXC 3TN3A 4BKNA 1K7FA 3JU2A 2Z1SA 4Y9AA 5HNNA 4JIRA 4XSMA 1S3TC 2WKJA 2V5BA 3BLBA 2X3XA 3VGGA 4WDWA 4W85A 1UKQA 3M5ZA 2YXXA 2QZRA 3LZ5A 3SR7A 1XIEA 2G3NA 1TUXA 4JWDA 4ZR8A 4GZ7A 1XLCA 4DM1A 2WVUA 4R5EA 3NQ8A 4LCRA 1SO4A 4REQB 3RCNA 2X0HA 1E6PA 3M16A 5G2WA 4P7RA 3IJ8A 4H83A 4AD5A 3TWAA 4EZQA 2HRWA 4UQ9A 4AIOA 2VHLA 1RD5A 1SU5A 3VOGA 2C3ZA 4IJRA 4KQNA 4H41A 5EMJA 2QDDA 2WNQA 1ADDA 1C3FA 1N82A 4WY0B 4AD3A 4KWOA 3M47A 4Z2HA 3MUAA 3I3EA 1VJZA 4F0HA 4XZNX 3W7IA 2QCLA 3P93A 1LLZA 4A3HA 4P8UA 3ABSA 3T0TA 1KXVA 3EDJA 4KS0A 4NXSA 1DEDA 4NSWA 1H7OA 2A85A 5I23A 1N8FA 2CBVA 1SPQA 1P6WA 5D9OA 1KKRA 1Q6FA 2QVHA 2VCBA 3KDNA 2F9RA 4PMUA 5LNVA 1TQUA 3CV1A 2CZEA 1G69A 3KX6A 5H2ZA 4PTVA 4HR1B 1JPHA 3L21A 3TUUA 3A6OA 1NAL1 3NXFA 3H24A 3LD5A 4C6LA 4C1LA 1ZFJA 3WQCA 1YX1A 2WHLA 4EOUA 2W9MA 3VPLA 3GK0A 4NX0A 3GHUA 4AZBA 1K9TA 4GBDA 1WE5A 3SCQA 3H2MA 3S4TA 3N15A 3GDLA 1XW8A 1UKOA 2O7SA 2PDLA 5M03A 4JHMA 3B0YA 3S9IA 4A3RA 1W1YA 1A5UA 3W53A 4I9MA 3WCZA 3B03A 4GO8A 4S2BA 3DPOA 3E2SA 2GL5A 2TRSA 4QDWA 4AVMA 3WEZA 1FWRA 5D2YA 4RZ6A 4H9MA 1W5QA 2X1IA 4LBSA 2WSRA 5XINA 1HO4A 2VENA 1MUMA 4DB7A 2BGNE 1XPGA 2VRJA 4GQGA 2QGHA 1IT8A 4W7UA 4IMEA 4KW2A 4UR8A 3GD6A 3E38A 2GAFD 3UWZA 1XX1A 3R10A 1ZALA 2WLZA 3NEHA 5G4HC 3BCDA 1F76A 2O56A 1L8NA 1TMQA 3SSZA 4C6OA 3GG0A 1OG0A 1ZZMA 1W0MA 1GHRA 3IIXA 4IQDA 3H22A 4RUBA 3P61A 2E5DA 4I6KA 1S38A 2PWDA 4QLKA 2QDEA 3SUUA 3AICA 2EPKX 4CN1A 3EEGA 1TWDA 4PTMA 2CLKA 4HZ7A 1M5WA 2J7EA 1UWRA 2QF7A 4HYRA 6ENLA 1J4EA 1AA1B 1TWIA 4NI3A 4FNPA 4E4PA 1QI3A 2QJGA 4MJ2A 1I2OA 3ZJKA 1OC6A 5LHEA 1FOBA 4JWCA 2B7OA 2QVNA 1E0UA 1FWJC 2ISWA 4MTVA 3UGVA 3WLNA 4JYDA 3CV5A 2FGBA 4WK9A 4M0XA 1E40A 3EB2A 1Y7VA 3T4CA 1UWUA 3C2RA 1ZWWA 1BKHA 3UR2A 1WDPA 1P5BA 1I49A 1RVKA 4AD0A 3WDRA 1Q66A 1EZWA 2W79A 2EX3B 2WCSA 4ML4A 3GDRA 2G95A 2E7FA 2TODA 3UVAA 3MMTA 2GVEA 2PDNA 2IPGA 1TQTA 3AAMA 3CAVA 2ESCA 3A3HA 4W87A 3OVQA 2REQA 3UPWA 1H51A 3LCGA 2W63A 2ZX6A 4FLOA 3S5YA 4S23A 2HE5A 1U1HA 2WMHA 4LB4A 3VD4A 3BSHA 1DVJA 5AC4A 1GZJA 3N19B 1LQ2A 3N13A 4CCDA 3PZ9A 4PL1A 2GVYA 2WM0A 5CCZA 1M7OA 1CGYA 4MNJA 2PDUA 1IT0A 2I16A 4ZQRA 4HJWA 2WPGA 5FF3A 1YE4A 3ABQA 1QW7A 4WIWA 1CLVA 4H9VA 3UR8A 1UD2A 3FAWA 3W1UA 1WV2A 3NL6A 2A3HA 2V68A 3MUXA 4L6HA 4AHPA 4RL3A 1A4LA 4E2DA 1ADSA 3G1SA 3WJZA 4BI5A 3Q94A 1H60A 3AIBA 5JVLA 4GRSA 3I6RA 4KRUA 2QUUA 5AHMA 2X3WA 3D5HA 4R5LA 2WB5A 3PB2A 4KEMA 2Z2UA 1OIFA 4R7WA 3A4XA 4RV8A 3UXKA 5LGXA 3WEMA 5JBEA 1E4NA 4PBFA 4UNIA 3NPUA 5CZSA 1PVNA 1NFPA 1XXXA 5CXPA 1X04A 2FH8A 2HBVA 3PN8A 1JCXA 1P0BA 2OYMA 3G1VA 3NL2A 2FHCA 2HEJA 1P43A 2VX7A 5IXEA 2WYIA 1DWJM 1EGMA 1H5VA 3SRKA 1XD1A 2D4CA 3M5YA 1P0EA 1EEPA 1CGVA 2BY0A 2BVTA 2D20A 3HO8A 1AW2A 1X38A 2POZA 3RHGA 2XGBA 5M2FX 2XWEA 1NU5A 2WZHA 3AIRA 3GC2A 3OBKA 4RZ4A 3NDYA 4JFTA 4DM2A 2YLLA 5CQ1A 2QCDA 1F3EA 2OQYA 2TAAA 3I04A 2BV9A 3IGSA 3ZLFA 2GGIA 2CHNA 4OBTA 4LWWA 3L5LA 1XLLA 1ZTVA 1KQZA 4DCNC 2O7QA 1JCLA 3KOZA 1Q6DA 4F0LA 2WC7A 3CZLA 3IPWA 4UQDA 2FPTA 4I9TA 1FWIC 3EOSA 4IT1A 3W85A 4KRZA 2D3NA 1V8EA 4RX0A 2PGRA 1BGAA 1YWMA 5TBOA 3EWWA 3CPRA 1LBFA 1XH2A 3UU0A 3LSBA 4PMZA 4DWSD 3O1NA 4XVDA 3W0KA 1YADA 3URAA 1UP2A 3RO6A 1WUFA 2X8RA 2ZUMA 4ZO8A 3ZM8A 4PSRA 1XIBA 4EP8C 3G1RA 3CXOA 4PCNA 1HJWA 1GYMA 4QLLA 1EJ7L 1WOAA 1E1EA 4KFOA 5JXQA 2FTYA 3CAWA 5CPTA 2CXGA 3W84A 4OVXA 3W6MA 3P80A 5D2WA 4B5NA 1YPIA 2WHMA 4X61A 4QROA 3AZRA 1SM9A 2F2HA 1M3UA 1XYFA 2R1KA 4WJEA 5FL1A 2E9MA 2CZ5A 1EXPA 5A6BA 5IHRA 4D8LA 3O7UA 3TEVA 4LRTA 2W91A 2ZICA 2EG8A 1F73A 1V5XA 1E56A 2PUZA 1LROA 1V3KA 1GEQA 3FFSA 5XIMA 2DSKA 3REQA 4DAFA 2RGLA 1TQXA 3QHNA 2XH4A 2GJRA 3GRIA 3BL3A 5FJUA 1XS2A 1YEYA 1VBUA 3NZGA 4HP5A 3LK6A 4N0RA 1GN9A 1UR8A 3FJLA 3LRLA 3OZOA 1OT2A 3SJNA 4ATMA 3E1F1 3LPPA 1TSIA 3IWPA 1V6YA 4ADSA 1HVXA 3RM9A 4RE2A 1S2TA 4P7LA 4L56A 1E72M 4YWSA 1GW9A 1V7AA 3G0SA 2CCRA 1GORA 3T4AG 1HKVA 3O9NA 5FESA 2HXTA 4RW3A 3RM8A 4GZIA 3N6QA 4RE3A 2BDQA 1A4MA 4GINA 4ZE4A 2F7OA 4RW5A 1WDQA 1U2YA 5LA2A 5HWMA 4EZUA 3QH2A 4NZJA 4ZOAA 4M1RA 4FNSA 3AIVA 1CBGA 1S5NA 1PIFA 4BK9A 4NHVA 3VI2A 1TQVA 3TC7A 1ZYLA 3T7VA 2J27A 2E9BA 2Y63A 3CKDA 2OYKA 3OZMA 5G1YA 3HAIA 4FXSA 4AY1A 1L8PA 5A8QA 3VMNA 3ZVHA 3PWIA 4KIKB 5A69A 1OFOA 4QCEA 3TTQA 3N6HA 2UV8G 3SCTA 4LYQA 4PFHA 1VS1A 1L9WA 1KCZA 3UJEA 3TZNA 2Y8KA 4C7DA 2YW3A 4BQ3A 2AL2B 3QNIA 4WDXA 2OZNB 2CETA 3FA4A 4IX0A 3C7NA 3VUSA 4V28A 4HPGA 2BOEX 1KFLA 2A7RA 3ZS4A 1JULA 4R85A 3TXVA 3PZMA 1LLWA 1JZ5A 1V03A 5EB8A 4UBPC 4B91A 1D7FA 5GNZA 2OFJA 1E1CA 3WLHA 1DIDA 1V6VA 4NYYA 1KLYA 4AIUA 5IFPA 2FZMA 2YLAA 4JCLA 3P3BA 3PJWA 3QGAC 4C6NA 3FXGA 2PB1A 3IIOA 1BVNP 2RDXA 3UXDA 5MKGB 2PGWA 5AZ0A 5C8BB 1WNOA 4GYFA 7XIMA 1R8LA 1A5CA 5ABFA 2X2GA 3H70A 4AHQA 3OA5A 1FHVA 2VZVA 1F6PA 3TN6A 3RNDA 1US2A 1TV5A 3WENA 2PPGA 1BD0A 3B97A 4R33A 2WSPA 1GWJA 4G7EA 4L65A 1MXGA 1QR7A 2VP8A 2A7NA 4B16A 1XSIA 3CZ8A 4DJED 3M0LA 4IM2A 3ARQA 2P0IA 1CXEA 3E2QA 3VE7A 1F5ZA 1KXHA 3NR0A 3N34A 1C90A 4A29A 3WLIA 1SZNA 1J10A 2J9ZA 3ONBA 1JDAA 3MA8A 3U48A 3UG3A 2J7HA 2ON3A 1Q2SA 4TVUA 3MJYA 1NFGA 1QNVA 3WH6A 1OGSA 4JIEA 2VDIA 2DZAA 2D2JA 4DWSB 2VC9A 1GUVA 2WJZA 3ERCC 3AS0A 4G7FA 1V7YA 4QXIA 3ICJA 1OA0A 1S46A 4LAUA 2P8BA 3AYRA 4F00A 1NP0A 3D2FA 1ITUA 2BG5A 5FLEX 1GOKA 3BURA 4MY9A 5KSWA 3RYSA 1TJ1A 4BI6A 4MM1A 4DUWA 3VKDA 3RRAA 3WH8A 4B3KA 2PTWA 3TYZA 4XAFA 1D8CA 3TN5A 3L2LA 3PNZA 3OYZA 4DBWA 4XX6A 3AXHA 1TV7A 2HSAA 4WSKA 5DBTA 4RZBA 4UQCA 1VBRA 4YTUA 4ATDA 3UP8A 1UZ4A 2J47A 1JJKA 3CAZA 3TQVA 4KWVA 3DYOA 4N9BA 3IJ9A 2Z24A 3QZ6A 5B80A 5DXXA 2XUCA 3QY6A 1GW1A 4QIUA 1XYMA 3F7JA 1F61A 3QTPA 1EC7A 2C1HA 3QR0A 4Q4RA 2AQWA 4OV9A 4UFIA 3KAVA 2VI0A 4G6QA 1S5TA 4LUTA 4Q33A 4FZSA 1EJVC 9XIMA 2O4QA 4MB5A 2FZBA 3BG9A 1HJSA 2H8XA 2Y88A 4HA3A 1V3JA 2ZKMX 5HMEA 1Z6KA 5C2CA 1EQPA 1CI1A 4ZCWA 1SO6A 1KA9F 2HS8A 2DSWA 1XV8A 4KCTA 2OKTA 1OYCA 1UPXA 1G4SA 4JIIX 2E8ZA 1EOMA 4QSHA 4LXFA 4S3FA 1RAKA 3S6TA 3ZLHA 1HG3A 2GDUA 1LWHA 3QKZA 1VPYA 2I5IA 2ISFA 2P10A 3POCA 1VRDA 4J3ZA 3PZUA 2DT1A 1SJCA 4WCJA 4CD8A 3TA9A 1BEUA 3KS5A 3E74A 4HZMA 3GX9A 3OYXA 1O4UA 4C1KA 3SOGA 5CLWA 5I3JA 3M3WA 4DYEA 1MEWA 3BOXA 4W5UA 3PZGA 5DT7A 1UQYA 2Q13A 3VGBA 3BPWA 4MB3A 2YB4A 4LH8A 1YE6A 3DENA 4Q22A 3T40A 3W1XA 4HMCA 4UFLA 4F9JA 3A4JA 4J5NA 3VDCA 3BMWA 3N11A 1F2JA 2CXEA 1BPLB 3W87A 1WKEA 3W7KA 2XVNA 1BSIA 3GXMA 1KBLA 4CD7A 1GKRA 3BK0A 1LL4A 3IK2A 4YVXA 4C6PA 3G5EA 5J04A 1HJVA 3UD6A 1A5MC 1HP4A 9RUBA 4WOQA 3FYYA 3OVGA 2QNEA 4FI4A 1K8CA 3SJ3A 3C2EA 1SW0A 2WVSA 2VZTA 4L61A 3KP1A 1PE1A 2YDQA 2XFRA 1DYSA 2PODA 2WK2A 3EX4A 1SFLA 2E67A 1GQJA 1I4DA 4DRSA 2GVJA 2ZVIA 2QXLA 4A05A 1NDVA 2CNCA 1YNQA 1SQ7A 4H8SA 1KTNA 2JFEX 5JMUA 2I1OA 1PV8A 4BNEA 4YHEA 2W27A 3CTLA 3K5XA 3DOPA 4HOWA 3EXTA 3HFYA 1LT8A 3S8HA 2BNJA 3MZNA 3VNZA 2WYHA 2VL4A 1C8XA 3JS3A 5HPOA 1W17A 1VFSA 2ODOA 1W5MA 4JGDA 2ZBTA 2R1MA 2HPMA 3GG1A 5IBXC 4M80A 3HZ3A 3WKZA 1VB9A 1A5AA 3W72A 3WD2A 4GY7A 1TPFA 4CNTA 2YCLB 4JTJA 4NY2A 3V1HA 1V3LA 5M1TA 3AIQA 1GOIA 2VR4A 3GNNA 3R94A 5E0KA 1BG9A 3AJXA 2AGKA 3LGEA 4HA4A 1SW7A 3CL6A 1G4EA 2CBIA 1BWLA 3GH5A 3QJAA 5FOOA 1ECEA 4JYEA 4AIBA 2R6OA 1XI3A 3WJWA 2V3DA 4DIAA 2OOFA 2YIHA 3G0UA 2ZX7A 5KZ6A 3QOKA 3BAKA 1NF0A 1O5KA 3H2AA 4FF5A 5HQLA 3O6CA 4UC5A 5LIYX 1RP8A 1P7TB 1UASA 2ZXDA 3ARPA 4JN4A 1OT1A 1OM0A 3W75A 3B8TA 2CBUA 2WZIA 4NL1A 6XIMA 4O19A 2PF0A 1X1OA 3BGGA 1PJ9A 3B51X 4KKXA 1P48A 1XM3A 4Q4SA 1M68A 3MUCA 4F9DA 1BF2A 1U22A 3WH7A 3NQMA 3WF2A 1Z8AA 3KTCA 3TFCA 2XTKA 1B4KA 3RXZA 4M6VA 2V38A 2QCGA 3DBNA 3R89A 5FJJA 1F6YA 1XL9A 1EDTA 4CQAA 2VYOA 1M65A 1QPKA 3S2CA 1GTHA 3GO2A 1XIGA 2NUWA 4CLMA 3UWYA 1VYRA 2PBOA 3OODA 5KTLA 1J12A 2GJXA 2ASHA 3L0GA 2VUNA 3ES8A 4ERAA 1Q6GA 1B5TA 2Y85A 4IUOA 3UBPC 3FEMA 3CL7A 1G01A 3WLJA 4AKVA 1UR3M 1XLEA 3NNTA 4JFSA 5CSRA 4E0CA 3U2ZA 1MVYA 1EA0A 1O68A 4LGXA 2WPBA 1UZDA 4HN4A 4G1NA 3WQ4A 1AMKA 1WXZA 5BOFA 4WPEA 2IXUA 4HSOA 4IFKB 4DZAA 3M1ZA 4MG4A 4GHRA 2ACUA 3KAOA 4YHGA 3PZOA 4I5RA 4C6IA 2ZCGA 3TJ4A 3WD0A 4G6CA 2V0OA 1QI4A 4GFIA 4IMAA 5BU6A 3WDIA 6TAAA 2PWUA 3H7VA 3HAHA 4JICA 3GHSA 4NJJA 2D22A 1S1PA 1VEPA 3GW3A 1JIBA 5AFDA 5HDRA 1O7AA 2YW4A 4UFHA 1S5MA 2XM2A 1XJBA 4FZPA 2QUMA 3MKKA 2YIBA 5T9BG 2HK1A 3G9GA 1JGIA 2Z29A 3GR4A 1VD6A 7ENLA 2GJLA 3D47A 4KF1A 1MQPA 4GIAA 3KBVA 4QRNA 4S3BA 4E6MA 5C5YA 3LV6A 1H7NA 5FF2A 4E2OA 1HGWA 5AKQA 3SCRA 2OZ0A 2BVYA 4EZYA 2FB3A 1K8ZA 3GFXA 5EMYA 3T07A 5EL1A 3XINA 1Y8BA 2PWVA 3BLEA 5I79A 4URIA 4AZHA 3RR1A 1PX4A 3EDEA 4FX7A 5F1UA 2OEKA 3UWQA 3L4WA 4GXMA 4WHBA 1JNDA 5TQLA 4C91A 3K4WA 2V5LA 3HPSA 4ZSTA 4OGZA 1I4LA 1TQJA 3AMDA 4WLCA 2EGZA 1VRXA 3BMXA 1REQA 3SN1A 1SMAA 3RM4A 3TQPA 3ME3A 1KM1A 4O50A 2E3ZA 3G1DA 3PR2A 2PDXA 1EKOA 3W01A 2ZZ2A 1R9XA 3I68A 5CZKA 1QK2A 5J8LA 1XIHA 4W88A 1U00A 3AJ7A 4AIEA 4E2VA 1HO1A 1RQHA 1L6SA 1E5JA 2QUTA 4HYWA 3MO4A 2TYSA 4H19A 1VYPX 1Z89A 4WDTA 4S3JA 3QLDA 1XC4A 2IQ0A 2PF8A 1I2NA 1V02E 4L80A 4HK5A 1W31A 3O6AA 1U5VA 2DZSA 4IJCA 1W56A 2GDVA 3W7HA 4CNSA 3HPFA 1IEVA 1PWMA 4A22A 4YN5A 2XU2A 2PZ0A 3ITTA 1K02A 3H2OA 3CO8A 3F1QA 2X2YA 4U5IA 4Q8PA 1RPXA 2BHYA 3WQOA 1JQXA 4FLSA 1GPFA 5I02A 1RLDA 1XIDA 1PDYA 1L6GA 4HBKA 4Y8EA 1C8QA 3R12A 2CZDA 1BYCA 3WK1A 3WUFA 5BMXA 4UNLA 2R9RA 1VIZA 3KZPA 3LX9A 3XIMA 4HNNA 4HPXA 3IVTA 1BAGA 1KM6A 4JQ1A 2QR6A 3D4YA 2BXZA 3OB8A 1E43A 1FA2A 3ELFA 2QV5A 2JF7A 2YI8A 5BXTA 3S47A 3TC3A 3CWOX 4DZIA 4ZTYA 3AOFA 3VX0A 2QPSA 3GDMA 2IKJA 2PLCA 3LNPA 3ECQA 1HVQA 2NT0A 1MUCA 4ZO7A 1PPIA 4FNQA 4G2DA 1POJA 2A79A 2QAPA 3LCLA 3W37A 3JZEA 1NWRA 4YCOA 3CUIA 1Z48A 3B9NA 3LLXA 3VDGA 5EKYA 3DHUA 1I1WA 1O7DB 5AVHA 1S2CA 3MC5A 4LFYA 4I8YA 1EJUC 3MUY1 2PLKA 3BE7A 3DX4A 3BW3A 1LRNA 2PZNA 2OEJA 4INFA 2HNEA 2OSXA 1KTBA 3DFTA 1GJWA 1US3A 3M0YA 1VH7A 3KZSA 3DXIA 2C14A 1RBAA 2WNNA 1TTPA 3AZSA 4N42A 1FWDC 3WY1A 1AG1O 2J88A 5CJMA 4KBXA 3TNOA 6REQA 4OWGA 2GJPA 1PTDA 3FA3A 3PC0A 3U9IA 3A5VA 1OX6A 2HPIA 1MNSA 4S2CA 2Z7KA 4WGHA 2BVWA 1JDFA 1EX5A 2QDGA 4ZQOA 3AISA 2H6RA 4MNLA 2OYLA 1XCXA 3DYMA 4O1AA 1UUMA 3VUPA 3LLFA 3ITGA 2PS2A 4ZQMA 3SZ8A 3TNBA 3LYEA 2NXHA 4K68A 3QGVA 3AXKA 1UP0A 3RG6A 3NSMA 3OTRA 1ICPA 2Z0OA 3MBDA 1F3WA 2ZYFA 1NJJA 3S2JA 1KFEA 1TPEA 1VQTA 2D24A 8CGTA 5FACA 1YPFA 1BRLA 2CLPA 2Y7EA 4UNKA 4LPCA 2XN1A 5JU6A 1J0ZA 4JPGA 3VA8A 2NQLA 3FGCA 4JDYA 3ZOAA 1FHUA 1NTHA 1XLDA 2XIOA 1LOSA 3IARA 3F4DA 3LY0A 5CSYA 4UTFA 3PJXA 1JFXA 4NQ1A 2ZE3A 4O1EA 1R3YA 4I7UA 3TAKA 3UJFA 2ZTJA 3ZO9A 2E77A 1P1MA 3BLFA 1HGYA 5DX7A 4XIMA 1KNWA 1VP5A 5CZTA 1RR2A 3OVPA 4H2HA 1ELSA 1JCNA 1PDZA 4I90A 2OX1A 1JEZA 3HQPA 2CFFA 4NXKA 3ABOA 1OFBA 4KWWA 3VKBA 3OO2A 1QNSA 3WDPP 1XLJA 3W7JA 1YTEA 2QW5A 3CU2A 3BQ5A 3FCPA 3ZJ7A 3GI7A 1HP5A 3SIZA 3EWUA 3A3WA 1EJTC 1E5NA 2X1UA 1DJQA 3V3WA 2DGAA 1PZ2A 4ML9A 2UY4A 1G5AA 4YIWA 4HZ6A 5CZJA 3WIJA 1TYGA 4OKDA 2OJPA 3TW6A 1JDEA 3H4WA 2Y8VA 3H2NA 3QVQA 3W1NA 4V33A 3BUIA 1E0TA 2V82A 4Y9PA 2OO2A 1AD1A 2OSWA 3QY7A 3UEQA 1WCGA 3RLUA 4DELA 2VOMA 3T55A 3F4CA 3SCNA 1XKYA 3IACA 3S1XA 3D51A 4GA8A 1WDWA 1ECQA 3T2PA 4RNJA 1X1NA 3N1AA 2Z1BA 1UPMB 3GXIA 3CYJA 3W2UA 2OGYA 2XHYA 1RK6A 1J0HA 1SYTA 4QFUA 3KS6A 3CHDA 3EMZA 1N7KA 4US5A 3ZYZA 2OW7A 5J5DA 3ABZA 2O9RA 1SFSA 1ME8A 4J7RA 3EWCA 4DUVA 2W0UA 3SADA 3KBNA 3K1GA 1E3ZA 4O16A 3UCDA 2J7FA 4IM4A 3AHZA 4P8XA 4IWWA 1THFD 5E70A 2B0MA 3CT2A 4GACA 1E55A 1G1YA 4Q7BA 2PDMA 4NG3A 3A22A 4PGLA 1ISZA 1Q6OA 4NPHA 5DCEA 3LMFA 1GQIA 3L4YA 4JHOA 1HUVA 2VFHA 5AC5A 3WG6A 3HQ1A 3LI0A 3T42A 4P2VA 1JF6A 2XVKA 4EK7A 3UWUA 4AYSA 5A6LA 3BUBA 1R33A 3DX0A 1NY1A 2P50A 3MANA 4Z2JA 2TMDA 4DXXA 4JQ2A 4E5TA 5BMWA 4Q4OA 3TW9A 4D1JA 2W62A 1EGZA 2J8FA 3LMZA 2QQ6A 3LRMA 3GNOA 1KFBA 5I3FA 3P82A 5FIGA 3C6CA 4F3HA 4I9JA 1MRQA 5CPOA 4E8DA 4O54A 3IGUA 3KLKA 4F79A 5FJIA 1PKMA 2XIJA 2CWXA 1S2VA 5H1WA 2GK1A 3NO5A 4WXZA 2CZFA 1A5NC 2Y70A 5IDZA 3E9AA 1DE5A 2V2HA 4K39A 2ONEA 3URNA 2G8ZA 1EBGA 4M7SA 3F03K 1UD6A 4IMCA 4J1OA 2WCGA 4EIVA 3ZWSA 1ZCOA 1YLVA 4IWOA 2HE8A 3O2LA 2XVGA 3A4AA 4AD4A 1QCWA 2PP3A 3P5ZA 2FDSA 3U2OA 4W7VA 4DJFC 4AU0A 3JW7A 1NWSA 4X63A 4IWQA 1JDCA 2BB0A 2UY3A 3WF0A 2E25A 3NAVA 3V0SA 3GIYA 3PFRA 1GTEA 2I14A 2ZRZA 3QSTA 1TZ9A 3NIYA 4P8VA 3T49A 3VGEA 3MKCA 3MI6A 1S2AA 4HB7A 1H0IA 4IFOA 2YOCA 5IRPA 2RDWA 1XBZA 1UWSA 3I3BA 4QLJA 1DHPA 2JEPA 8A3HA 2X7WA 1EIBA 3EKZA 4HMNA 3OLGA 4BWLC 1PX3A 4ZXOA 1KQYA 3N3MA 5HBFA 1TRIA 2A3AA 3NQ7A 1CXKA 4UMBA 4LCQA 5CZ0A 2DH2A 5A3HA 4AD2A 1ZS2A 1FH8A 2Q12A 3WNMA 3PUGA 1NELA 3U5UA 1IT7A 3LI1A 2XH2A 1L6YA 2CLIA 1GNXA 2FYVA 2YCJA 1XLAA 5G2IA 1NVMA 3KVKA 1NM9A 2VFIA 1MXDA 2A6NA 4DZ5A 4DUXA 2DVXA 3I6EA 1W1VA 5KEZA 5A6SA 1H4PA 1SU7A 1OD0A 2EQDA 1QI5A 4GIYA 2YJQA 1EQCA 3ES7A 1QDSA 1SUFA 3EPNA 1PWLA 2E1DA 3AMKA 4ROPA 3SUTA 3QEZA 4HK6A 2DEPA 4EXBA 1W1PA 4MWAA 1CDGA 1YDVA 3STEA 4N9EA 3CQ0A 1QWUA 3IV3A 2F2KA 1FWNA 3TYEA 4W89A 1YBQA 4S3CA 1MEIA 1M9HA 2AMGA 5FJRA 2REQB 4QAIA 1OCNA 3LPOA 3F2DA 3APGA 1ITCA 3DX5A 1J6OA 4LNYA 2JBMA 1EDQA 4IPNB 2J7GA 4OQVA 1PZ1A 2FHFA 2XIIA 1AW1A 3QHOA 3CZNA 4WD0A 1OFQA 4FXJA 4M5PA 3H2EA 3NCOA 1UD4A 1IEWA 5HXMA 1YHTA 3LERA 4JTSA 3ITOA 1K1DA 5CC3A 4ZSUA 3G24A 2ZZ7A 5LHFA 2OSYA 1KB3A 4HCHA 3NQBA 1S2UA 5I00A 4DBUA 2NVDA 5JH2A 2YPIA 2ZADA 4FK9A 2ACSA 1JXJA 3LS9A 1QPOA 4MNKA 3M0JA 1MYRA 3TC6A 1W5PA 3O3OB 1CB2A 4CNNA 3ITYA 3IJ6A 3RU6A 2VKZG 2W4XA 4A8IA 1UBSA 3EBVA 1RSCA 1AL7A 3T46A 3LCHA 1KM3A 2PRHA 2HXUA 3ZXWA 3BARA 5KITA 3ATYA 1V6TA 3UZJA 3S9YA 2V30A 3G22A 1XP3A 4QTGA 3VXGA 1KKOA 4A4AA 3M5XA 2PDJA 3FJ4A 3ARWA 4BEQA 4AB4A 3W86A 4EZSA 5HNRA 2LLEA 3ZJ8A 2VELA 4H1ZA 3AIUA 2PRLA 3BH4A 3LPFA 4JN6A 3USZA 4PMQA 2X30A 2X3VA 1XLKA 2PWEA 2VEGA 4HNTA 4EZRA 3SGUA 2DJLA 3ZT5A 3F5JA 1LOQA 3LHYA 5I7GA 2GSJA 1EO7A 5K4XA 5DMLA 5K7JA 4FALA 3DERA 1DL3A 2WZTA 4J3TA 1CCWB 3MW7A 4Q7IA 4V27A 3MV11 3G6MA 1TJPA 2X7VA 4O57A 4DN1A 4RPQA 1EP3A 3LNMA 4J9JA 4MJMA 3CHFA 2CESA 4H2CA 4XWUA 4B4FA 5BOEA 1E6SM 2GQ9A 4NRSA 4RZ5A 3OQ8A 3RF9A 1AJZA 5BYWA 2FFIA 2AOSA 2XH7A 2QCDB 1MW1A 4C6FA 2X0YA 3AHVA 3HURA 1YXCA 4XD5A 1NQ6A 1TELA 3EX1A 4ZB2A 3TJIA 7PTDA 3P5YA 4LVDA 4RDWA 4X2PA 3RLHA 1E2UA 1KFKA 3DPQA 1HKIA 1HW6A 4KETA 1HJQA 1T8XA 3PUOA 3TTYA 1U30A 3DHDA 3UR5A 4E2BA 1XIIA 1BTMA 2DIEA 2ZC8A 1XGEA 1KFWA 3D6NA 3AMCA 4PUKA 3TIMA 1XDJA 4PUDA 3UXLA 5FEWA 4O28A 1W3KA 3DFHA 4Q7NA 3C86A 1H1NA 3LRKA 4M81A 4D6FA 2PTZA 5TNVA 2YL5A 1H7WA 3T44A 4LAKA 4NNAA 1B0IA 3WFLA 2WMJA 2XM1A 5A6AA 5KZMA 4TXEA 3VNLA 4J2MA 2Q3OA 2JE8A 1PHWA 1QPNA 3NURA 2EXOA 2AAAA 2OGJA 1ZSXA 3P14A 3EA1A 3A98A 2AKZA 3EJPA 1NDZA 1BKSA 4GVIA 1XQKA 2G3JA 3R2GA 2OO6A 1UC5A 4K7VA 1YKWA 1AMYA 1EUNA 4ZBCA 1DIOA 3KW3A 2WWDA 4NJIA 4Z1BA 4DF2A 2E5CA 3BGAA 2UY5A 3RUBL 1O5RA 4BF5A 1OADA 3L9CA 4HOZA 3VGFA 3REQB 3EXSA 5I78A 1K6AA 4RXFA 2C7FA 3PY2A 4I7WA 4QGCA 2DSUA 2XG9A 4O15A 2V5DA 4EPDC 2YI9A 2Z8YA 2Y4SA 4ZO9A 1WZKA 3L4VA 1EUAA 3GM8A 4MF4A 3VEBA 3E0FA 5F4XA 1CGUA 1GOXA 2F8QA 5XIAA 3TA6A 1NSJA 3QSRA 1Z32X 3HF3A 3NQCA 5HNTA 2ACRA 2DZVA 3TR9A 2WM1A 2I9UA 4JX4A 1XLFA 1P0DA 3I10A 4R7OA 4AWUA 1OB0A 1FHDA 2A3CA 3RO8A 4PMJA 1OYBA 5D9MA 1J8VA 4Q4QA 1G4PA 2ATMA 1E9LA 4K36A 3TLLA 3APYA 3U6WA 3HGJA 5FSEC 2F6XA 4GVGA 3WLPA 3BAWA 1UR4A 3OIXA 5CGMA 1DKYA 1KXQA 2P3ZA 3SFKA 3T9PA 3I65A 3BVWA 4EZOA 3QE6A 3TYUA 4EZZA 4AD1A 3VIHA 3SCSA 2YZ5A 4S38A 1QASA 1I2PA 5AC8A 4XV0A 2ZZ5A 1EP2A 2NV2A 2PWGA 1WQ5A 3KRUA 3RJXA 1CXLA 4HNUA 4LY8A 4BR1A 1LQ7A 2HVOA 1LDCA 1ZU8A 3N2XA 4ZOBA 1RY0A 2Y0FA 1MFUA 3BVTA 3SUVA 4HN8A 1TE1A 2VFDA 3BTNA 1QATA 3EPMA 4F2BA 4ZE5A 1IIHA 4QEEA 1V3MA 1Q65A 3KVJA 1TQWA 3A12A 2ATSA 3BAXA 3NOYA 1QNPA 4M19A 1E51A 1QK0A 1SFJA 2NXGA 5CG7A 4MLJA 4Y9NA 1BQGA 3JRKA 1UG6A 2RUSA 1XCFA 3FKKA 4GJJA 1K7XA 2G97A 3WJYA 2JNKA 4TX8A 1E1CB 3NGFA 3C61A 3UYCA 2VX4A 3CMFA 5C54A 5FEPA 1W1B1 3IRDA 3DH7A 2BOGX 4Z2KA 2PLMA 1BXCA 5DMNA 3HPAA 2D23A 1VFMA 3KWSA 3QPYA 4LUYA 1UJQA 1RD6A 1EBHA 2J13A 5HAOA 1P0NA 1G6CA 1WZMA 3EJRA 3F4VA 5EU9A 4HIBA 4H4IA 1X03A 4O1DA 1V6XA 3RX3A 4AEOA 4HTBA 5ABFB 4IPJA 1CGTA 3EOEA 2VGGA 5I5RA 1HKWA 3DKJA 3A13A 4FR6A 1RCQA 2HROA 3W74A 5A8NA 3D2EA 4XBSA 2CLEA 1UIOA 4CN6A 4O12A 4K6AA 4POCA 3FY1A 4I9AA 3OK8A 4G7EB 4JKLA 4AVFA 4LUSA 3KCOA 3FSTA 4CQDA 3PAJA 3GXPA 1F6KA 3TXZA 3FV9A 4Q6XA 1TVPA 2Z28A 3H2CA 4M51A 3CIWA 2D69A 1BFNA 7A3HA 4ACZA 3EKLA 1POKA 3I39X 1FY6A 3NXLA 4GUHA 1F4HA 3NEVA 1E6XM 1A3XA 5K4ZA 4DPPA 1TG7A 2DP3A 1YRRA 2VXNA 3BWWA 2VC7A 1URUA 2PDYA 3IAQA 2A7PA 4NRRA 5CG0A 4B15A 4UR7A 4JZ5A 1WDZA 1CB7B 3B8VA 1KFJA 2OX4A 2ZWZA 4HU3A 3CUJA 1PIIA 3MVIA 3MUIA 2V2DA 1DWFM 1L0PA 1TVNA 2ZX5A 5C55A 1RZMA 4QS6A 2PCQA 3IV8A 3N12A 3ID7A 1LTDA 1VAHA 2Z00A 2DZXA 2DT2A 5FJPA 1I45A 4PMYA 1UMLA 2BXVA 2GGJA 4IX2A 3WBEA 1M7JA 4AMAA 2ZUTA 4PMOA 4ALDA 1ADOA 4XZWA 1LOLA 1V0KA 4MZYA 3E49A 1VLWA 1I4NA 4DI9A 2FHBA 4GIEA 3GNPA 4YL2A 1YQ2A 1XSJA 3LCIA 4F48A 3L12A 4GO9A 2Q3RA 1PCKA 1UOKA 1U83A 1CIUA 2XINA 4NASA 1GG0A 4EWJA 1H7PA 2JGYA 1U5HA 4LUTB 3CWHA 4Z42C 2QFFA 4QJ3B 1MDLA 3K4DA 4XZHA 1FXQA 3DHFA 1UKSA 2EWFA 5FF7A 1ITXA 3QQ0A 2O9OA 3VFCA 4YNGA 5AYXA 5CPQA 2J7BA 1W1TA 3UWEA 4AY7A 3ZSSA 4D6EA 3KXQA 3WNKA 2CBJA 4JLCA 1TPWA 3PPFA 3W27A 2C71A 2D2OA 4ONVA 4YCPA 3H8AA 2Z0IA 4MY1A 5BZAA 1TA3A 1JPKA 3QXBA 4PB3A 3ARVA 5AB3A 3UNTA 3EOUA 4L4MA 2NUXA 3DC8A 4JCMA 2FZNA 1B3OA 4FHAA 2ZXQA 1QI0A 3B06A 1A53A 2XISA 2C6QA 1N55A 2H90A 4KPLA 2Q8XA 3UJ2A 1PTAA 3SO7A 1RLCL 3THQA 5CLTA 5DMYA 1I75A 1MQQA 2D1ZA 4MFDA 2WINM 2OQHA 2D2GA 1FCQA 2DIJA 3CGTA 1UH4A 4ZODA 1TO3A 2JIEA 2OVLA 3DI1A 1QPRA 3PM6A 1OF8A 3GBEA 3QZAA 4F4RA 1UA7A 4TU1A 1HL9A 3E96A 2JKPA 1KRBC 2GSHA 3W82A 5BW6A 4B5UA 4PUMA 4ICCX 3MMWA 4BWLA 2PSNA 4IHCA 3CB3A 5C7HA 4LVAA 4IISA 2WVVA 1PAMA 3MHFA 4IZGA 3W7NA 3HMJG 4JTRA 3SN4A 2H9AA 2CLFA 3ZSTA 2YGYA 4KFPA 3ENLA 1VENA 3CV7A 1S2WA 4O1CA 3ARSA 2QULA 5E9AA 2J66A 1SO5A 1MZRA 2B7PA 2R14A 3GC4A 2GGEA 3LU2A 4HNVA 2XGZA 4CVUA 4M6PA 2GGHA 3MSDA 1JGMA 1H7XA 1IV8A 2OT1A 3BC9A 5CBBA 2Z7GA 3M5VA 5DANA 3THUA 3CZJA 2EFLA 3SBFA 2V67A 1WKYA 4UQEA 1KBIA 3O0FA 2D1LA 2XVLA 1ZB5A 1F8MA 3M07A 2GGGA 5AHFA 3LHTA 8XIAA 3GB6A 1XSKA 2OBLA 3GHRA 1EF3A 1FBAA 4DWDA 1FH9A 1FWEC 3LLLA 1C9DA 3VIGA 5BRQA 2VQUA 3PHAA 4L9YA 1WKDA 5LKYA 2J6VA 1EFZA 2WQPA 8XIMA 2CKSA 5A5WA 3SIMA 4BZYA 3A9IA 2GVGA 4YTRA 1NOFA 3FYOA 2C79A 5CH9A 4B5XA 4O0QA 1EDGA 1EJRC 1OGGA 2RAKA 5C7VA 1QHPA 3DYTA 2G3IA 4A8LA 1GVQA 3NGJA 2DIKA 4WSHA 5E9XA 3BW2A 1A50A 3MJMA 1GKPA 4LBRA 3VIFA 1W1IE 3IS4A 3PWGA 4NT0A 3VM5A 1RXOB 3S2LA 3S1GA 1KM2A 3BZGA 1W9XA 2J6XA 2CC0A 1EOKA 3PZVA 3GXFA 2WSKA 2XJ7A 4GXPA 3TTSA 3W81A 4AMCA 3J7HA 5LXXA 3N3TA 4O11A 3TYDA 2CEQA 3OG3A 5A2BA 2KX9A 1F3TA 3W1MA 4NJKA 4F0SA 3G18A 4JN7A 3W76A 2GJXB 4IG2A 3VKKA 2V3GA 1OFEA 1FDJA 1QWGA 3K8MA 1Q6RA 3BZJA 5HR6A 5FKYA 1ISYA 3AWOA 3A9BA 4A35A 5AYIA 1KFCA 1PS3A 1W9DM 2IPJA 2ZRYA 2QCCA 3OZYA 2GF4A 1DKXA 4JTQA 1Q3NA 2Y6ZA 3IAPA 2DUZA 3VOJA 4IIEA 4PUWA 2QXWA 3HV8A 4GNVA 3UZZA 5D38A 3PPHA 1OINA 5D37A 5CBIA 4W93A 4C6MA 3CK5A 1E4LA 1DP0A 3U5YA 5I6SA 3WL1A 4K1WA 4MMWA 2INZA 1H61A 2Z25A 3O6YX 4RKAA 5ABEA 1KM4A 4PN2A 4R9XA 1O6IA 2R82A 3UWWA 1Q5MA 2YCEA 1E0VA 3HGRA 4JOMA 4RLIA 1CPUA 2QV4A 3A47A 4U4MA 3IVSA 1N2VA 3BVXA 1EL3A 1FFRA 1O12A 1JZ6A 1O95A 4ATWA 4YTTA 5BXRA 5D2XA 4LS2A 3HAJA 1LP6A 1MEHA 1OZQA 1KO0A 3PP7A 2INEA 1KTCA 4NILA 4MYAA 5CAKA 2GDQA 1DPMA 4JFVA 1KWKA 2RAJA 1XIMA 4R53A 4UTWA 2ZZ3A 3CM4A 3N14A 2PEVA 4L6DA 3UF9A 4WSJA 4W8BA 4V1XA 3BUQA 3WYZA 3IUDA 3NG3A 3P81A 1FKWA 4LUJA 1IXPA 4GJ1A 2DVTA 1JAKA 1MFVA 1XYLA 5CGTA 4CEXC 3SURA 2E40A 1V93A 1MXSA 3V5FA 5F2LA 4GZJA 3W00A 3L2IA 1M03A 4HNLA 4NAFA 2ADAA 2AGTA 2QUVA 1QNRA 2INFA 1YDOA 3WH9A 3AU6A 2WLYA 3B40A 4J3SA 1E0XA 3P62A 1AQ0A 4JD4A 2B31A 2YB1A 1REQB 2Y1HA 1DOSA 4HMEA 2G3FA 2FQIA 1GJUA 1ALDA 1BXBA 3QPEA 4PCSA 2XFFA 4W4QA 1FWSA 4I3GA 1Z44A 3TJXA 3W1RA 1OGBA 4TTGA 4C6CA 3W7RA 3BLIA 1J6PA 4O0ZA 4AX6A 4XZ9A 3GIQA 5A8OA 4MAZA 4LC6A 3LZ3A 1QUMA 1G9HA 5AZ1A 1WZLA 4RNFA 3LBMA 5A6MA 4PCPA 1HKMA 5HUOA 3GU1A 2Z6IA 1RP9A 2DZUA 5C6MA 4GI8A 3LDVA 3QGKC 3OJGA 5H8UA 1ZNNA 3GXDA 2PDKA 6A3HA 2HDJA 2JKAA 4CUCA 3AYSA 3EOOA 2IS7A 4LF2A 2V9DA 2JALA 3EA2A 5EYWA 2QCEA 4N6EA 3MUZ1 3UJRA 1TX0A 1SMDA 3FOKA 5I03A 3IK4A 3G1AA 3HG5A 5LIUX 1WP6A 3VZYA 2GZXA 2FVKA 3N6JA 2NX1A 3ABHA 2OLAA 3FXYA 2ISDA 3V16A 3W7EA 3RGTA 3T48A 3ARRA 4XD6A 2EF9A 5KZEA 2I7GA 3CPUA 1U5JA 1TZZA 4NZ3A 4QITA 3S9ZA 2ZUSA 3D0CA 5DO8A 3M46A 4P5UA 4PCTA 3GVQA 2PY6A 2E6AA 2FTWA 4FXFA 3GW0A 3CAQA 4F66A 3SCUA 3KEHA 4Y90A 1XBYA 1XRSA 4MIMA 1MO0A 1OK4A 2RT6A 4IP4A 4HA1A 3DFPA 1VPXA 1UIPA 5HULA 3T0AA 4JQAA 4IL2A 1NP2A 1X1ZA 3W7QA 3I3DA 2QJMA 4E81A 1LRTA 1Q45A 1RJPA 1Q4WA 3T0DA 2BXYA 3OVRA 3QW4B 4Z1YA 1C29A 4HZ8A 2QMJA 2VT0A 3P6LA 2Y7GA 2E6YA 1JCTA 3BUPA 5A6TC 4FLRA 3ZT7A 4KMQA 3RPTA 5FD0A 1W9MA 2ZUUA 4NNBA 1W3LA 1XFCA 1UOZA 4GYJA 1JYWA 2BSLA 3A24A 1KV8A 4I1QA 2EJAA 5REQA 1UJPA 5DY2A 2J75A 4AFYA 9XIAA 2C19A 2EHHA 3SRFA 1CTNA 1GYNA 2WZEA 6REQB 3WQ5A 3U8GA 5C70A 1QNQA 1UWAA 1Y5XA 1JCJA 4CN4A 5I07A 1D7KA 4O52A 4DNHA 1SGJA 2YA0A 4WF7A 5I06A 3M7SA 3W28A 3M41A 4A8NA 1Q13A 3C8FA 3H53A 4QG6A 5LNWA 4HVXA 1TIMA 1WKFA 3SW6A 5C9RA 2F7PA 3S83A 3TOPA 2AL1A 3RMEA 4IGHA 3EB4A 3OBAA 4ASTA 2CW6A 2Q6ZA 4KESA 1TR9A 2OTDA 4WQ6A 1V0MA 1GJPA 1GVSA 4ILSA 5I24A 3OU8A 5HMFA 3DESA 4XO6A 3GUWA 1RJQA 2F61A 3TSBA 4Y2WA 1D8WA 2JIWA 1UD5A 1TV3A 1TTQA 3ER9B 3FGCB 4ZO6A 2GA9D 1JD7A 2QIWA 3KRBA 1KCKA 2O92A 3DGBA 4GFSA 1BQCA 3GBDA 5JH1A 3KOWA 3WLSA 2QJIA 3GLCA 4MZ1A 4GMEA 1TFVA 1ZJBA 2EFKA 3H54A 5AHIA 4MY8A 1TWZA 1D2KA 3DAQA 4LSBA 4AWSA 3AROA 3VE9A 1C9WA 2D2HA 3PB0A 3WJSA 1A5BA 3WMLA 3WMSA 3BCFA 4X0NA 1R0MA 4UMAA 3VVGA 1V3HA 1F07A 3W1TA 3L4ZA 4Y7EA 3BOFA 4G56A 3FIGA 4LS1A 2XZ9A 2E9LA 4JTTA 2Y8UA 4GGHA 3UZYA 2F7QA 1B3YA 3VC6A 2JK2A 4ES4A 4YYCA 4KIRA 1Q8JA 1E73M 3CAKA 1M04A 3GS6A 3OLDA 1AH3A 1LYXA 1JUBA 1VFLA 1WAUA 3MYOA 3RIKA 1N8IA 5A2CA 3BCJA 2G4FA 2YBTA 1HNYA 1QI2A 3W6LA 2GQAA 1TJ2A 3KBMA 3VOHA 3K46A 1QO5A 3CT7A 1JZ4A 3Q0KA 4V15A 2VNCA 1R38A 2WMFA 2BWGA 1PSCA 4TVCA 1FTXA 1AQFA 1TMHA 5L9FA 2YKKA 1IIGA 2WZMA 4QP0A 4JTIA 4A3QA 5LZLA 3GTNA 5AHNA 3W7PA 1R46A 3LV5A 5BOOA 2DH3A 2NWSA 1FWFC 2VVSA 3TKFA 1TPB1 3HOJA 7CGTA 2OCZA 1CX9A 3QFWA 1G67A 1BYDA 3ZZ1A 1SSDA 3WK3A 4H6EA 3VOIA 1I4TA 3F2CA 3ZLGA 4QX4A 3H2FA 1MW3A 1IEXA 1F9CA 5MHBA 1F8IA 3W1PA 4FX8A 7TIMA 2GUUA 3MSRA 3V36A 6XIAA 4QQUA 2RJGA 3N18A 3VOFA 2O9PA 1R5EA 3R13A 1JL8A 4MJZA 4YU1A 2ZRWA 4HYVA 4DVOA 3UWVA 4IPLA 3OHIA 1QWNA 2NV9A 1M6JA 4LCSA 1UH2A 2SFPA 1W6TA 4CU8A 1SZRA 1J79A 1Y5WA 5HMDA 1SU8A 3Q84A 3M6DA 3CV2A 2I5QA 5LIKX 2Z0NA 3RPMA 4Q8TA 4QJ5B 2C18A 2ZUVA 2FIQA 4DJEA 4J27A 3NJ3A 3NZPA 5HINA 2O0I1 4NZ5A 1K77A 3CBWA 2QCHA 1W9PA 1HFBA 3WF4A 4H6HA 4XUGA 3VGDA 4IMFA 1IEQA 3QW3A 2O0TA 1C91A 3WD3A 2QS8A 4GGBA 2GK1B 1TPUA 2OZTA 3E0IA 1BWVA 3H26A 3BMVA 1FWWA 3QY8A 1ML1A 3KRZA 3W7GA 1RJRA 3U7BA 4DQWA 2W6RA 3STGA 1Z3NA 1XLHA 1KLZA 3PSWA 1M7XA 1TE6A 3CZGA 4IIFA 3BG3A 3L5MA 3CUGA 4Y6GA 1X96A 4NX5A 3SYVA 5G1MA 1UA3A 3TTOA 5CSUA 3GVRA 3LHWA 4UTMA 2BY1A 5C9ZA 4CQCA 4DX3A 1Q63A 4ADTA 1DJGA 1QHZA 2A5HA 4C1NA 4NQIA 3A64A 3QHMA 4JIPA 1GVIA 4IIDA 3PULA 3N2BA 4CEUC 1ZBKA 2FDMA 5H8MA 1V6WA 5D03A 4F2UA 2FZDA 2Y61A 5IM51 4U2ZA 4GD0A 3RK8A 1XUUA 4MFEA 3DFSA 1IEIA 2A3BA 4BS0A 3D3FA 1RCXB 3QV6A 2NZLA 1B3WA 2NWRA 2H3BA 4FS9A 4MHBA 4D72A 3JUGA 2ND1A 1RVGA 3FD9A 4OBRA 2B7NA 1Q6LA 1BG4A 4ACYA 2O55A 3DYPA 1R6WA 4WKFA 4HHPA 3PVFA 2YCKX 3G0XA 4IFKA 5AYYA 1Q7ZA 4NU7A 2LXYA 2EG6A 3F5LA 3OHMB 3DPPA 3T05A 4DYJA 5HOSA 4O14A 4IPIA 4Z0SA 2ZUNA 3EDFA 3N2TA 5FF4A 1F05A 3IIPA 3ZEDA 5C5BA 1T6MA 6ALDA 3S1VA 3TN4A 1X8FA 3WUGA 3MV01 3WNPA 3O07A 3PTQA 2Q8LA 3P8IA 1OZMA 2PFHA 3SN0A 1W3TA 1TZ7A 3ABRA 1M41A 2XWDA 5GJMA 2OPJA 1XUZA 4Z0JA 2A6LA 5AVNA 1W2PA 2JF6A 1HTIA 3ZR6A 1ME7A 4OIFA 1PIGA 1O94A 1Z41A 4MLRA 3O6DA 1A0EA 4EF9A 1ZENA 4MWAB 3STPA 4E4UA 3GXNA 4E8GA 1FXPA 3B9OA 4QE4A 3QA8A 3M43A 1YBQB 1WDDA 4WZHA 1NEYA 3NM1A 4TO8A 2G96A 3EWDA 5E6ZA 3GTFA 1GZ1A 2G3MA 4B9QA 2P3EA 4S3DA 5DY3A 4GYPA 1O66A 1X6UA 1Q2RA 3FW6A 2MUCA 4F40A 4B2DD 3Q65A 1AW5A 3QV7A 5FA5A 5EMLA 3G77A 4GIRA 3B9EA 3STCA 3RILA 1UH3A 3UY7A 2P8CA 2WHKA 3CUFA 3NZRA 5EA9A 2P76A 2V3FA 5K3VA 1WAWA 3MYPA 3D52A 1ZAJA 5JIWA 1H5YA 2NUYA 3AALA 3S1UA 3BJFA 3BVUA 3M0MA 4EZTA 3MS8A 2X0SA 3W2NA 4ZB5A 3LTPA 4M29A 4PYSA 3R6IA 3D4ZA 2CIPA 5HNUA 4I8DA 3LM7A 2OG9A 3E6EA 1W8GA 1B54A 1TPH1 3HTWA 1IR2A 4XKMA 1B4EA 4C7GA 2ZWYA 3W70A 4UWMA 2DUAA 4NJHA 2QJNA 4QG8A 5E0FA 3QWEA 2CLHA 3OZPA 2XIBA 2J4GA 4UTKA 4GNJA 3N25A 4H7CA 3P84A 4UOZA 1H1ZA 2HISA 3N2CA 1DJWA 5I0DA 3O3MB 3E02A 4AYGA 5T26A 3WFZA 4GUGA 1XFBA 1ZRQA 4F0RA 1YMYA 4YPJA 3LA4A 1AVAA 3NO3A 3TONA 4O13A 1KW1A 2NVCA 2Y7DA 4XQ6A 3IGXA 1EGVA 1X98A 3GFZA 4QG9A 1ISWA 3WQ6A 4JY9A 4AHOA 1H49A 3UGRA 4IXXA 2B7QA 4FXRA 2G41A 1WXYA 4DEFA 1KRAC 5C9UA 4DF1A 3BJTA 4AVOA 1RA0A 1XH1A 4R34A 3T2OA 4MJ4A 3VIKA 3MY9A 3YPIA 1B2YA 4CU7A 4Y9OA 1PS9A 3DG3A 1H1YA 1UD3A 3TE9A 4GUFA 3HGSA 1XYZA 5G5IA 3PUDA 2ZE0A 3GH4A 4L5ZA 3KCLA 2E6FA 5KZDA 3W83A 2DW6A 3UCCA 4FA3A 3MDUA 4IP5A 3FK4A 5F4WA 3SCOA 4XO7A 4AZCB 3FN9A 1US0A 4AC7C 1DXEA 1FDYA 3WQGA 1GHSA 4LAMA 2AKMA 3VABA 1AJ2A 1W3HA 2F38A 2N3KA 1OG6A 3T0CA 3CUZA 3N2MA 3VTRA 2J9XA 1QMLA 3UXAA 4WPCA 1LT7A 4GUIA 4LS0A 4UTIA 3IGHX 3LHZA 2W3ZA 1Q8AA 1Z69A 2WXDM 3AC0A 3TP4A 4ZQCA 4RXGA 3WX7A 3EZ4A 1J0JA 4CNPA 2HTMA 4TMBA 5AYBA 4I5XA 3OIHA 1TR1A 2V69A 4O4WA 3W07A 3EPOA 2AAMA 1P6BA 3WQEA 1G7UA 3VMOA 4PBGA 1CXIA 1BXNA 3VIPA 1D9EA 4PRTA 2J8TA 4GK8A