4AZ5A

Differential inhibition of the tandem gh20 catalytic modules in the pneumococcal exo-beta-d-n-acetylglucosaminidase, strh
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
434
structure length
434
Chain Sequence
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
publication title Inhibition of the Family 20 Glycoside Hydrolase Catalytic Modules in the Streptococcus Pneumoniae Exo-Beta-D-N-Acetylglucosaminidase, Strh.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 172
structure length 434
sequence length 434
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2012-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 4az5A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4az5A01
2YKKA 2ZX9A 1CXIA 4W7WA 4H04A 4WF7A 2G3JA 3MUY1 4TX6A 3RMEA 3AICA 3OLEA 3VDCA 1E43A 1J9YA 4M29A 4W89A 3MSGA 2VX6A 3GH7A 4D6EA 4DUVA 2AMGA 1C7TA 3IANA 5FD0A 4CVWA 2VCAA 2XGIA 3MV11 4TUFA 4WLCA 1L0PA 1LL4A 3GDBA 3VIKA 4P8WA 4GQRA 3PTMA 3WNMA 4P7RA 3CHDA 1W32A 4HMDA 1V3KA 1PPIA 3BMWA 1U33A 3PBGA 2YL5A 3L2MA 1GNXA 3T2PA 1ZJBA 3RM9A 4KGJA 3DC0A 1UR4A 4MNLA 3W27A 4W8AA 2MANA 2WZHA 3UR8A 1LG1A 4MB3A 5JIWA 2FGZA 3VPLA 1OD8A 3ZT6A 2CETA 4OZOA 3ZSTA 1KQZA 1W1YA 1JYWA 2D22A 2JFEX 3BSHA 5LA2A 5ABGA 3IJ8A 3GH4A 1FP8A 4M81A 1H11A 1NOUA 3N1AA 1SMDA 1VFOA 1EGZA 1KBKA 2GVYA 1VEOA 2CYGA 2VQTA 2WVTA 1PIGA 2VL4A 4GI8A 4WSKA 1V6XA 1KQYA 1IV8A 2DGAA 1JDCA 3FXYA 3RM8A 1I1XA 1H0IA 2D0GA 2FH6A 1ISZA 1FOBA 2C8NA 3ARRA 1XH2A 4U33A 2IUZA 3VIJA 8CGTA 4IM4A 5CGMA 2XWDA 3HN3A 3T0DA 3EDJA 1NWRA 4GINA 4W86A 4JZ5A 5CLWA 4P8XA 2E8ZA 1JFXA 3CUHA 1MW1A 4QAWA 4PMUA 1X6NA 1EHNA 1ZBWA 3AMLA 3VGDA 1JNDA 1W2PA 1DTUA 1HJQA 4IPNB 4GZIA 3EDKA 2BXZA 3O9NA 1H1NA 1J10A 2CXGA 5HBFA 2WK2A 1W1TA 5EFDA 2YA0A 2GJPA 3ZIZA 4EKJA 1K9FA 1HVQA 5I77A 4R27A 4ZXOA 2OYMA 1JZ6A 2E0PA 2DSZA 5A94A 1JYNA 3W37A 1JYXA 1W3KA 3OLGA 5F7UA 1BF2A 2X09A 5HOSA 2DIJA 1E3ZA 5E09A 4BQ4A 7A3HA 1I75A 4PCTA 2JEPA 1RH9A 3AIRA 2VRQA 2VZSA 3CZLA 4B15A 4CCCA 4E8CA 3SUWA 5M3WA 1FH9A 4CCEA 4P7OA 4JAWA 4UQAA 4F8XA 1JXKA 2D3LA 2CIPA 4H8VA 4Z2HA 1UH3A 4PN2A 5D4YA 2YBUA 3I3DA 1VJZA 1V0MA 4PMDA 2BS9A 4LXFA 2GUYA 1CBGA 2E9LA 2X0HA 3ZR5A 3W6MA 2PB1A 1EDTA 3BAWA 1FFQA 3A6OA 2DH3A 1EH9A 1E6QM 5M17A 4HOZA 1WZMA 2OWWA 4EE9A 1GCYA 3PN8A 3CHCA 3MUZ1 5D9NA 3WNKA 1ISWA 2GDUA 5BXSA 3WL1A 3VGFA 2XFYA 2CHNA 7CGTA 2YDSA 1R7AA 3UETA 4ATLA 1EQCA 5GNYA 1TVNA 1Y7VA 3CZKA 2QMKA 4ZENA 1MFUA 2VZVA 1GOWA 2W92A 3UERA 3VX1A 3OG2A 5AYIA 2QPUA 2WLYA 4V27A 1SYTA 2EPMX 1OGGA 4PMRA 1V0KA 3K8MA 5CPSA 1WZLA 1IZKA 4OKDA 1VB9A 3WH7A 3THDA 1LJYA 4AZCB 1DWIM 3FHQA 1XHGA 1OIFA 1K9EA 1ZBVA 2J7DA 2UY5A 2W61A 1CGYA 3WEZA 2J7EA 4M1RA 4YPJA 4NZCA 3DHPA 1IZJA 1BVZA 5JBFA 4UFLA 4C7DA 4W93A 1JD7A 4D6DA 1BPLB 1W3LA 5CSYA 4XZWA 2J7FA 1W2VA 3W25A 5A6MA 1UD4A 4UFIA 2ZWYA 4HU0A 2XM1A 2X05A 1WPCA 3L4UA 1GQLA 3W26A 1MQRA 1CWYA 2JF7A 2X2YA 3WQVA 4K68A 2WANA 5CQ1A 3POHA 1XSIA 2J25A 1B1YA 2X8RA 1DWJM 3PZGA 3AHVA 1B3VA 1C91A 1K6AA 4MPKA 1GVYA 2CITA 5E70A 2WVVA 4MAZA 4U5IA 5JBEA 4QP0A 3VNZA 4HOWA 4TVCA 3D5HA 2ZUWA 3B8SA 3AOFA 1UQYA 3FHAA 1KCKA 1EO7A 4CCDA 2XVLA 3KWXA 2BV9A 3EBVA 1HXJA 3I3BA 4OIFA 4DM1A 4RE2A 5D9MA 3W4RA 5A2AA 1N82A 1OCQA 4PTVA 3CMJA 1MXDA 2VR5A 3GTNA 2CERA 1V3JA 4UR9A 2CHOA 3UEQA 5I0DA 1W9XA 1MWOA 3T0BA 1NOWA 3ZM8A 1HP4A 1UR2A 3OLIA 3GNRA 1QHPA 4X0NA 3CH9A 1XSJA 3QGVA 2WBGA 2Y8KA 5I5RA 3KE0A 2GJXA 3ARZA 4J28A 3SUUA 1UD2A 2G4FA 5BCAA 1Q4NX 3T09A 4LYQA 4X9YA 3UG3A 1KXTA 1TZ7A 3NDZA 1LG2A 3NJ3A 2WVUA 2VQUA 2XFRA 4AWEA 2NSXA 2XSBA 2J74A 3VINA 5HPOA 2JNKA 3BGAA 1JIBA 4U3CA 4UQDA 1G0CA 3N12A 3DYOA 4HZ6A 1P6WA 3AYRA 1E4NA 4WKHA 4HA4A 4P7QA 1UA7A 2V3DA 6A3HA 1G9HA 3CZ8A 5BXRA 4PMVA 4OBSA 3WFLA 3RIKA 4OJYA 3AI0A 4Z2IA 4JL1A 4S3JA 1CNVA 3VIHA 2ZUUA 3SIMA 5E6ZA 1NWTA 2VZUA 3BXWA 4PMQA 3U7BA 1CGWA 2G8ZA 3A4XA 4D6IA 3W82A 3ARXA 4M82A 1VFMA 3S2CA 3SCPA 1TA3B 4JFSA 1XCWA 3AIBA 2Y5EA 2JIEA 4JKLA 1BGGA 2YOCA 2O9RA 2E9MA 5D9PA 1KWKA 1TE1A 1US3A 2GDVA 3BCDA 4Z2KA 1OBAA 1B31A 1GPFA 5IFPA 2YA2A 4DWSA 1WAWA 2YJQA 4FLOA 2D2OA 3E1F1 5A6LA 4P8VA 2BXYA 4CN6A 3ZT7A 3K4AA 3UCQA 5BRQA 4LX4A 5LA0A 3OB8A 3DYPA 1NOFA 2AOSA 1E56A 3UG4A 3T2OA 3PZOA 1GUVA 4P7NA 3AMDA 2CKSA 1VENA 2O92A 2VT0A 4BQ2A 2BY2A 5I79A 1VRXA 1KGXA 3VGGA 2VUYA 1TR1A 1PAMA 1XV8A 3MUIA 1TVPA 6CGTA 1V6WA 2G3IA 1UHVA 5CPQA 1W1VA 4ZFMA 1Q6GA 3WUBA 2W5FA 3CZEA 3ZMRA 1A47A 3W38A 4U5KA 4W87A 2WMIB 1EDGA 5A8PA 2E40A 3RCNA 4B16A 4R5EA 1B3WA 2YLLA 1TUXA 5FKYA 1JYVA 3GBDA 1QNRA 3AQUA 1D2KA 3VDAA 3L2LA 2YA1A 4AXNA 3WDHA 1EQPA 3J7HA 1QNPA 4A3YA 1BYDA 1ZL1A 1R85A 3ZSSA 1DWAM 4AZHA 4PSRA 3N9KA 2OSYA 2GK1B 4UQEA 1WB0A 1WDRA 1GW1A 2ZIDA 3CBWA 1KFWA 1QBAA 1E6XM 3ZT5A 3CMGA 3W0KA 4HA1A 4AEEA 1E5JA 1KXVA 4HMEA 1XC6A 3MMUA 5CSUA 1JF6A 3AIQA 2BVTA 2WC4A 3IK2A 1JZ3A 1R8LA 1W9UA 3ARVA 1OGSA 3BAYA 1QNSA 2E3ZA 4U31A 3VNYA 1FHLA 2NW0A 4C7GA 1E55A 5FIPA 1TCMA 3A3HA 1XD1A 1JAEA 4JKMA 2DSVA 5A8OA 3LPOA 2J7BA 4UFHA 1JNEA 4EAMA 1QI3A 1PX4A 1XGZA 4J3XA 1JL8A 1YQ2A 1PIFA 1V6YA 2XG9A 3VIFA 2XVKA 2PWEA 4UZUA 4D72A 4JL2A 3AHXA 4U2ZA 4BZYA 3K46A 3LMYA 3L4ZA 1UR8A 2E9BA 1W9PA 2O9PA 1QVBA 1BSIA 1X1NA 4XZBA 5JBDA 1Q6CA 2WMHA 2F61A 4XV0A 3MSDA 4M24A 4J3SA 4MTVA 3RJXA 2WMKA 1HKIA 1HP5A 3VKKA 1H41A 3TTOA 3W28A 3L4YA 2ZX5A 1KB3A 2ESCA 4MDOA 3DHUA 1VF8A 2A3AA 3NSMA 1WZAA 2DQXA 4ATDA 2EPKX 1JZ5A 5KZ6A 4CKQA 2BVDA 1C7SA 1HT6A 1UD6A 1V3LA 5FOOA 4D6GA 4AZIA 5I3DA 2WWCA 1RPKA 3GZAA 4MB5A 1H49A 1ZU8A 2WHMA 2CBJA 3POCA 4BQ3A 2CNCA 4AY1A 3SCNA 4DWSD 4NSBA 1NH6A 1CZ1A 2OSWA 4H2CA 1FH7A 4Y7EA 3CUGA 2DH2A 4L4OA 3SCRA 2CCRA 2OYKA 5I78A 1B3XA 2PC8A 4AZ5A 1JDDA 3EDEA 4HOXA 3WEOA 3OA5A 2FGLA 3WBEA 2TAAA 2V5CA 2AAAA 5CPTA 3ECQA 4ACZA 4AIEA 4DWSC 1QOXA 1UKPA 4AC1X 2JEQA 3BMVA 1D7FA 2VI0A 3OBAA 2W91A 3AIWA 1F4AA 3MMWA 4MNKA 3PZQA 1W9VA 2ZXQA 2VX5A 1BYAA 3AROA 1ISXA 5EFFA 5I23A 4HP5A 1XRVA 3PTKA 4GXPA 3NUKA 2VX7A 4UOJA 1MXGA 4FZOA 2WLZA 5IFTA 1BTCA 2VURA 3WQ4A 4QFUA 3WUGA 1H3GA 1J11A 1GJWA 1BGAA 5EBAA 2XIIA 2EQDA 2X1IA 2WZEA 1QI2A 4AZCA 2PF0A 5D8ZA 1NP0A 2DSWA 3VD9A 4UFJA 4FLRA 1Q6DA 4W8BA 2YDRA 2IXUA 1UD5A 2UY2A 3WDJA 2GJRA 1JD9A 1JI1A 4E2OA 2OSXA 1QPKA 4TTGA 1DHKA 4P8UA 5DT5A 2BHUA 5BYWA 3SCTA 3NIYA 1W1PA 4E8DA 3VD7A 1OT2A 1WE5A 3PTQA 4YN5A 3CPUA 4D6JA 1CDGA 1JF5A 1HVXA 3TP4A 5GPRA 4Q22A 2Y24A 5IHSA 3N15A 3T08A 4PTXA 1E9LA 1K9TA 1WKYA 3LPFA 5BXTA 4UFKA 5ABEA 5ECUA 1E0XA 4CU7A 1OIMA 2A3CA 2ZWZA 3EDDA 5D8WA 3FW6A 1E1FA 1E73M 4PMNA 1BLIA 2BNJA 2ZUTA 5I6SA 1C92A 1CGUA 3ALFA 2BY0A 3TTQA 4UOQA 2YL8A 4LQ1A 4F9JA 1IT0A 4B9YA 5BRPA 4F66A 1ZB5A 5ABFA 2EXOA 4NF7A 1MW0A 5E0CA 1MQPA 2ZXDA 4H7VA 3A4AA 3OGVA 3WIJA 4C7FA 1MW2A 1V0LA 1QHZA 2VVSA 2WW5A 5C8BB 5IDIA 1J0ZA 1R86A 2JIWA 1XH1A 4Z2GA 3WUFA 3CUIA 3ZOAA 4QDMA 3GM8A 1QNQA 2WYSA 3L4WA 2J8FA 3WMSA 1FA2A 2O9TA 3I3EA 4D6CA 2PWGA 3WQ8A 5M5DA 3BAKA 1E72M 3VIPA 3CZGA 3VDHA 1ODUA 1B9ZA 1US2A 1PBGA 1G01A 1TFVA 1H4PA 3AJ7A 4PSPA 3AS0A 1VAHA 1UWUA 2WZIA 3ARTA 3BLPX 1LQ0A 2WHJA 1M04A 3F4VA 1AQMA 3SCVA 3OZPA 3OIHA 5FL1A 3RJYA 2JALA 1EO5A 2J7HA 2FHBA 1CXEA 1W91A 4FLQA 2WBKA 2PWHA 1H09A 5DT7A 1GONA 3WDRA 5EMYA 3K4DA 5HXMA 3ARWA 1E70M 1FHDA 3ZJ6A 3WL0A 5CG0A 5IXEA 3ALGA 4JFTA 2UWFA 1V6VA 1KGUA 1E6NA 1NWSA 1BAGA 3PZTA 4X0VA 3AS3A 3BCFA 3AXXA 2VTFA 3VO0A 1L8NA 1NM9A 4HPHA 2EEXA 2YIHA 2PWFA 1GQIA 3VIIA 3AMGA 5AY7A 3KL3A 4N0RA 3NSXA 5A95A 4HU8A 4JFVA 1ECEA 1VEPA 4J3UA 3AXIA 2CBUA 5A6BA 2DDXA 4QLKA 2XVNA 1PEZA 2VZTA 1UWQA 1ZJAA 4PTWA 2EJ1A 4NRSA 2CKRA 6TAAA 3N11A 3MUAA 2WC3A 1UUQA 2D3NA 4JKKA 2ZOXA 3MKKA 1X6LA 3ARYA 4AZBA 2RGMA 1XD0A 1QNOA 4GI9A 3GNPA 1V6UA 1OM0A 1U30A 1QBBA 2OLHA 5CLTA 3WH8A 2EPNA 5A3HA 2GFTA 2XJ7A 2PMRA 3G6LA 1W9BM 1V0NA 2FDMA 2XPKA 4H8UA 4AD5A 2HISA 4PUEA 5A6AA 2ZUVA 2WMIA 4AD2A 2V3FA 4AMCA 2B31A 2OWCA 1LL6A 3VOCA 4BS0A 4AD4A 1GOOA 1J0IA 2F2HA 1ISVA 3A4WA 2VNCA 1C8XA 4WSJA 3WD2A 1XYZA 2VO5A 2WVVB 2YL9A 4M8UA 2D0FA 3SURA 3U7VA 4GZJA 3AHZA 4AIUA 4DM2A 1WZKA 3VU2A 1QI4A 3N18A 3ARUA 3WF4A 1CXFA 1V3HA 2CBIA 3VUPA 2C0HA 4L4PA 2D0HA 3WQWA 2CEQA 1E6SM 2Q8XA 4CN4A 1E40A 3BAJA 1HF6A 2ZX6A 2QLYA 3RDKA 2YBTA 5I24A 1GHSA 1UH4A 4AZGA 2VR4A 1CTNA 5E0FA 3UR7A 3VVGA 1J01A 2WVSA 3M46A 4HPGA 4TOQA 1R87A 5BROA 4BQ5A 3WNPA 4ATWA 2XGBA 3CUJA 1CXHA 3ARPA 2DSKA 1VBUA 2GSJA 1LF1A 4KRTA 3NYDA 2J7GA 1ODZA 5I2UA 3WN6A 1AMYA 1HKKA 3LPGA 2UY4A 3OGSA 3VX0A 1B90A 4TVDA 3AYSA 4PUDA 3GH5A 2GJXB 2WKLA 2ZX8A 2NT0A 1GOIA 4U3AA 1J0JA 1V02A 1WO2A 2NT1A 3WH6A 4PMXA 4XX6A 2BHZA 4AIOA 1U2YA 5HDRA 2WMFA 4KRUA 3M07A 3PZNA 1UWSA 1O6IA 3F5JA 3GXMA 2WMJA 1V3IA 4ZEPA 3B9EA 1ZBKA 1E4IA 2VCBA 4IUGA 4BF7A 3ZO9A 3BAIA 4FK9A 3WH9A 1XSKA 1SR0A 4B3LA 1G5AA 3ZJ7A 1LWJA 3WF2A 4AD3A 3VDBA 4RL3A 2BFGA 1WDPA 5DFAA 3TONA 1VFUA 1C8QA 1JZ2A 1BYBA 4ZE4A 1C93A 2J62A 2E4TA 4CU8A 3TOPA 2W66A 3AZSA 3MU7A 3N17A 4MDPA 2XM2A 2G3MA 7TAAA 5A6BD 3SUVA 3W53A 1K9DA 1HL8A 3AHYA 4QCEA 3U57A 1CGTA 2ZUSA 4IPLA 2WMGA 2Z1SA 2ZXBA 2W63A 3PZ9A 2Y4SA 3SCOA 1BQCA 3ARSA 5A69A 2DIEA 1HKMA 2OWXA 1E71M 1CXLA 1W3JA 3SEPA 4V2XA 4RE3A 1CENA 1G1YA 1HKJA 1UKOA 3PZUA 1UD3A 1UR9A 4DWSB 1R7OA 5A6JA 3NDYA 5GNXA 3DECA 4W7UA 2D1ZA 3SCQA 3WY1A 3QR3A 4M80A 3WKZA 1JI2A 2WXDM 3MV01 2EBNA 2VCCA 4WK9A 3O6AA 1YHTA 1E4LA 3WF1A 5HPCA 2XWEA 1O7AA 4CD8A 2WHKA 4D6FA 1FFRA 4XUYA 4UNIA 1RP8A 1S46A 1VBRA 2PBGA 3AMKA 4PTMA 4TXEA 3F5KA 4HA3A 2EO7A 3WD4A 5DO8A 1PX3A 2A3BA 3WNOA 4AW7A 5A6SA 3THCA 2XFFA 3WD3A 3ZJ8A 4YHEA 1M03A 5A8MA 2ZUMA 4PCSA 1ITXA 3EDFA 2W67A 3CIVA 3AIVA 2VRJA 4J7RA 1JXJA 1UQZA 2BVYA 3VIOA 5CGTA 2XYLA 4FZPA 4UQCA 3W24A 4OUEA 3T2QA 4F9DA 4WJXA 4W84A 1CLXA 3NCOA 4J27A 1WCGA 3A47A 1UWIA 1KXHA 3L4TA 3WQ5A 4KGLA 3WMBA 1OINA 4MAVA 4BCEA 3RILA 4EK7A 2VZOA 2EPOA 1H0GA 2WCSA 1KR1A 4FMVA 1QHOA 5E6YA 1HJXA 3VTRA 4GKLA 1JZ4A 1QI0A 3KEHA 9CGTA 1UR1A 3ARQA 3QOMA 4Z2LA 1E6ZA 1GOKA 2PI6A 5CJ5A 1C90A 1MQQA 4PRWA 4UFMA 3VM5A 5A1AA 3WQ6A 4MADA 1B30A 4JHOA 4W8LA 1CLVA 5A2BA 2A3HA 3EMQA 2ZXAA 3AZRA 5A6KA 4GQQA 5A8NA 5BWFA 4DUXA 2IXVA 3SUSA 1CGVA 4N42A 3UESA 1UD8A 2ZX7A 3AISA 1HJWA 4D1JA 4PBGA 4TVUA 2PBOA 3IAQA 1VFFA 1KGWA 5M03A 2Y8VA 3VIGA 2HVMA 3AMCA 1JZ7A 2WSKA 1HL9A 2J8GA 3VMOA 2CBVA 2ZUNA 3EYPA 3QHNA 4D1IA 1EXPA 1HJUA 3LPPA 3WELA 3AS2A 1E4MM 3CO4A 4LGXA 3VD5A 2WNWA 4W5UA 5CXPA 4BA0A 1J0YA 4FLSA 3VM7A 1BYCA 1BVNP 1LL7A 2XUCA 3FAXA 3RPMA 1AVAA 4D71A 4LYRA 2DT2A 3AZTA 1DWGM 3M6DA 1PZ3A 5AC5A 3O2LA 3WF0A 1QI5A 4U2YA 5GNZA 3WNNA 2A3EA 2DT1A 4B3KA 5DMYA 1SFSA 3GYCA 3L4XA 4CD4A 1ZS2A 1E15A 1UYQA 3CGTA 3GBEA 2XIBA 1LWHA 3ZJKA 3NSNA 1OWQA 1MW3A 4Z2JA 2FHFA 4DUWA 1CECA 1MVYA 4J3VA 4PYSA 3K1DA 1NP2A 3K8LA 4TX8A 4PMOA 1BG4A 1I1WA 2XVPA 4CD5A 4AZ7A 4S3KA 2W62A 3AXHA 5JUVA 1BG9A 3WBAA 1QW8A 3TTSA 1E6PA 2JE8A 4XB3A 5D9OA 4W7VA 1GOMA 4ZXLA 4CU6A 4ACZB 4FF5A 2DPEA 1JZ8A 1GJUA 3BLKA 1OB0A 3GXIA 1HNYA 3M7SA 1CEOA 4GO8A 3B9AA 1B3YA 1LLOA 1M53A 5LA1A 2DEPA 1B0IA 2Z1KA 1HJSA 1AQ0A 2QMJA 4ACYA 2J7CA 4UTFA 3G6MA 1HIZA 5A8QA 2J47A 4HMCA 4W5ZA 1GZJA 3OLDA 1ZBCA 2DT3A 4P7LA 1UH2A 1ITCA 1UWTA 3CUFA 2J4GA 4UCFA 5AYBA 3KL5A 1V08A 4OOZA 1B2YA 2WHLA 1V03A 3VGHA 3VIMA 3MANA 4JFWA 4HZ8A 8A3HA 1UZ1A 4WKFA 5KEZA 4ML4A 3WNLA 3KL0A 1EIBA 1M7XA 1MFVA 1SMAA 1QW9A 2D20A 1HJVA 3CZJA 1UWRA 1BFNA 1OT1A 3ZR6A 2WCAA 3OGRA 3L4VA 4JCMA 4A4AA 4NI3A 4PMYA 5DEZA 3OZOA 5FL0A 4WKAA 1UA3A 2J77A 3AHTA 4OBRA 5E9AA 3CLWA 4GI6A 3VGBA 1GORA 2XTKA 3FAWA 3WF3A 3WFZA 1DP0A 1EOKA 1GOQA 2Y2WA 3CHEA 1E0VA 4AISA 4CN1A 3VGEA 1J12A 2JF6A 2WPGA 4OOUA 2J75A 3AIUA 2VJXA 4H41A 4LPCA 1OGBA 5AC4A 2UY3A 1TG7A 1A3HA 2VOTA 3PZIA 2G41A 3QHOA 1MYRA 1OD0A 4MB4A 4V28A 2VRKA 3WDIA 4IISA 1Q6FA 4CUCA 4GO9A 1EOMA 1AQHA 1VEMA 3K8KA 2OZNB 2V38A 1UKSA 4JFUA 1RP9A 1J0HA 1PZ2A 1DWHM 5ABFB 2BY3A 4HTYA 2YLAA 3VMPA 2WSPA 2O9OA 1UOKA 1KCLA 1H5VA 5FCZA 4KMQA 3WMCA 1TA3A 3HU7A 1JDAA 2C7FA 4UQ9A 3WH5A 2VC9A 1PX8A 4H8HA 5TD4A 1KBBA 2V3GA 1D3CA 2QPSA 4AZ6A 5DF0A 1JG9A 1CPUA 4Q7NA 1JGIA 3GXDA 4W85A 4UOZA 3WD0A 3GXFA 4ZE5A 3SUTA 3BC9A 3WDQA 1ESWA 2D23A 2E8YA 4AD1A 5C71A 2DSUA 2WC7A 4RE4A 1E0WA 1OSEA 4AEFA 5GQBA 4E4PA 1W3HA 3D3AA 2VMFA 2VX4A 2X0YA 2D24A 2WB5A 4J3WA 3EMCA 4YHGA 1C8YA 4M56A 4W88A 5CZKA 1NQ6A 3PHAA 2QF8A 3N04A 3MS8A 4LYPA 3RO8A 4JHZA 1WP6A 2VVNA 2WCGA 1UZ4A 1XYFA 1KXQA 2FH8A 3VD3A 3TA9A 1NARA 2RGLA 1TMQA 1J0KA 1E6RA 5HNNA 4PEEA 4F79A 1M01A 2W4XA 4JCLA 1FP9A 2BHYA 2XHYA 5ABHA 2OO2A 2QV4A 3WEMA 5IHRA 3IJ7A 4CGTA 3FNDA 4QCFA 4URIA 5JIPA 2WAGA 2QHAA 3IJ9A 3SCWA 3T0AA 1H2JA 1W9DM 3VD4A 3DYMA 3SCUA 2GK1A 4GIAA 4GPNA 5EB8A 4TTUA 1CXKA 2ZE0A 2J79A 1UKQA 3FY1A 4JIEA 2YDQA 1GQJA 2J78A 2WM0A 1C3FA 3QHMA 3VMNA 2DT0A 4A3HA 1UG6A 3JUGA 4MNJA 1UR0A 1GHRA 1ISYA 4D6HA 3VILA 3BAXA 4KH2A 3UG5A 3KZSA 4MNMA 3B9DA 3CTTA 2ZICA 4UZSA 3W29A 3WUEA 1Q6EA 4MB1A 2OYLA 5C70A 1CGXA 1WNOA 5BXPA 3S6TA 2CESA 3RM4A 1PJ9A 3IAPA 4AD0A 1GQKA 3HJEA 3GNOA 1B3ZA 3MMDA 2F8QA 5A2CA 1GVIA 1DEDA 4AYSA 1F4HA 3U5UA 1E5NA 1JFHA 1BHGA 2CPUA 2EPLX 3HMCA 3WENA 3WD1A 1RD6A 3BH4A 1EHAA 3ZQ9A 1KWGA 3F5LA 4CVUA 1VJSA 3FN9A 1XCXA 2XSAA 1JAKA 1EA9C 2PWDA 4CD7A 2BY1A 1E1EA 1CYGA 4KWUA 1G94A 3WDPP 1CIUA 3WSUA 1HX0A 1V3MA 3W6LA 2WWDA 3PZVA 4QLLA 2V5DA 3N13A 2YL6A 4EANA 4WIWA 2XVGA 3SCSA 4HZ7A 4MJ4A 4J3TA 3APGA 4UQBA 4QLJA 1Z32X 4B9ZA 4GZEA 1J18A 3TTYA 4NRRA 2V3EA 4MJ2A 1V02E 1VIWA 1XH0A 5LYRA 1WDQA 4PMZA 3AIEA 4CD6A 1E3XA 3PZMA 1FH8A 3QOKA 3MO4A 1NWUA 3W81A 3CHFA 1HN1A 2G3NA 2FHCA 1UKTA 3U5YA 1EDQA 3BSGA 1KR0A 1WDSA 3AS1A 3II1A 3AFBA 1DWFM 2WKGA 3EMZA
chains in the Genus database with same CATH superfamily
1SO6A 2YKKA 2ZX9A 4XK2A 1RY8A 4ZQNA 1IWAA 1GT8A 2ASHA 3RMEA 2HDJA 3F4DA 1MMFA 3OLEA 1RSCA 4HNLA 5BU9A 2ISSA 1DQWA 1F6PA 2HMCA 4E2DA 4IOTA 1J9YA 3DZ1A 3W7QA 3MSGA 4MVAA 2VX6A 1N55A 3GKAA 4OU1A 1VC4A 4CVWA 3PWIA 3UZXA 1KBLA 3PAJA 1QAPA 2VFHA 3V1PA 3HV8A 4YTTA 2DZTA 4WOZA 4TUFA 4HNNA 4FXJA 5DCDA 4RZBA 2P0OA 2WV8A 3UJRA 3MI2A 3OZMA 3EPOA 3VA8A 1TJ2A 1V3KA 4KESA 1K7EA 4UTWA 1U33A 3BO9A 1GNXA 3T2PA 1W8SA 2OGYA 4KGJA 1UR4A 4LRTA 3IGUA 3T8QA 3W27A 4W8AA 4BKNA 4XO6A 2GGIA 1ZRQA 5EU9A 1X1ZA 1OD8A 2I57A 1IEXA 2CETA 3ZT6A 4IWQA 2V30A 2QULA 4M6UA 4OZOA 4GUHA 3ZSTA 1RBLA 1GVRA 3IK4A 1XIJA 2BASA 4JXCA 2D22A 2A7PA 2Y88A 1FP8A 2RDWA 1EL3A 1EGZA 1KBKA 4XAYA 2GVYA 3NVDA 2VQTA 3QQ0A 1LT7A 3NO5A 1KQYA 2DGAA 3GU2A 1JDCA 3RM8A 3DHDA 4EX4A 2FH6A 1ISZA 4S1FA 5LHFA 4IM4A 4LS2A 1TX0A 4JTLA 2PEVA 5J5RA 2Y70A 1T6MA 3DAQA 4JWDA 3C0JA 2E8ZA 1JFXA 1MW1A 4IMFA 4PMUA 3M0HA 1QMLA 2PDFA 2VM8A 1EPXA 1HJQA 3S5NA 4XQ6A 3EDKA 3MHUA 1TPWA 5EPDA 3STPA 3QPZA 5EFDA 1TE6A 3H22A 2GJPA 3ZIZA 3QZAA 2VGFA 3VOIA 5FF4A 1VPYA 5I77A 4R27A 2OR2A 1FWBC 2E0PA 3LCFA 2OBLA 3TR2A 4LCSA 1JYXA 4BFAA 1BF2A 1OVDA 2G0WA 4IMGA 2DIJA 5E09A 3NQ7A 1JQXA 1W3IA 3L23A 4WQ6A 3DI0A 3VEBA 2JEPA 4Z0SA 4PUUA 1J2WA 2VRQA 2PTYA 4E8CA 3D4ZA 4NUWA 2C16A 4NPHA 4S3EA 4UTMA 1X04A 1JXKA 2FICA 2X2GA 1O1ZA 4H8VA 3H2FA 4PO2A 5C5BA 1XLEA 1V0MA 3UNTA 1ZGDA 4WR3A 1CBGA 2E9LA 3NQ8A 4I9TA 2VEMA 3CEUA 1FFQA 3A6OA 5CEWA 2PTZA 2B4GA 1WYIA 3EPNA 4IICA 5IDZA 5KZMA 5SWUA 4JLCA 4HOZA 1QXLA 1KRCC 1D8CA 1XLJA 1R9XA 4XAGA 1ISWA 1R5YA 3WL1A 4WGHA 3PK7A 3O3NB 2CHNA 4ES4A 1VQTA 4QE1A 2QNEA 5GNYA 1Y7VA 2DZVA 3OOQA 3G5EA 1MFUA 3GS6A 3SDOA 1PKYA 1LRNA 4NZ5A 4RPQA 3C8NA 2FGBA 1J2BA 2V0OA 1DJXA 4BY3A 3GZ3A 2QPUA 1OYCA 2EPMX 1DIKA 2PODA 3TQVA 3EX4A 1WZLA 4R7JA 3VNIA 1YIXA 4Q8UA 3WH7A 4TMCA 3RO6A 4L4MA 2V68A 1DWIM 5F4XA 4AB4A 4O0KA 3L21A 1XR2A 4RDYA 2HPIA 1Q6RA 2PMQA 1O94A 2OEKA 3KZPA 3VNKA 3HF3A 3LXAA 1A5SA 3RR4A 3BV4A 4UFLA 3T40A 3QZ6A 4C7DA 1RXOB 3REQA 1QU4A 3GTHA 3IACA 4KFNA 1BPLB 2XIQA 2VFEA 5I3FA 3DUGA 4XZWA 2J7FA 1IEVA 3DDMA 1UD4A 1SSGA 3RX4A 1J4EA 2ZWYA 4HU0A 4E4FA 3KDRA 3L4UA 1K3UA 3W26A 1CWYA 2I9EA 4H4IA 3WQVA 4K68A 2WANA 3TK7A 4RDWA 3POHA 2FVLA 4YVXA 1XSIA 3W73A 1B1YA 3PZGA 3C8FA 4DNMA 1K7FA 3RF9A 2RDTA 2CITA 4YIWA 1MRAA 3BUIA 4B91A 5E70A 2V9DA 4X3ZA 2XH4A 5G2WA 3GG0A 4TVCA 1RQBA 3B3DA 4A8NA 1QT1A 1UQYA 1S5MA 3A23A 1KCKA 1EO7A 4GABA 2HE5A 4QG8A 2Q8ZA 4B5TA 3Q37A 3LCLA 4OIFA 4OTKA 4IWOA 1QX1A 2QIWA 1OCQA 3BARA 1UASA 1V3JA 4UR9A 4BI7A 2DUAA 1D7KA 3UEQA 5I0DA 2C1HA 4FAMA 3D3FA 3NYZA 3OLIA 3DG6A 3GNRA 4RCXA 2GGGA 1XSJA 2CC0A 4DPPA 4PCPA 3BLFA 1R38A 4NAFA 4JTEA 2DVUA 3SUUA 1U1HA 2NXGA 4GUIA 1E0TA 1L2QA 5DBTA 4UC5A 2PRMA 4OUIA 3ZFHA 2D4CA 2Y8UA 3ABQA 4L7ZA 3FDGA 4NAEB 1S2CA 3QW3A 4IHCA 1JIBA 2R14A 1OX4A 3T48A 4POCA 3LQGA 4GUFA 1G0CA 2RAGA 4NNBA 1TWZA 4WKHA 3W2LA 3PPGA 5AVNA 2IQTA 3WFLA 5BOEA 4YTQA 3RIKA 2EKGA 1AL7A 3UCCA 4AFYA 2QJGA 3AI0A 1ME9A 5HNRA 1JDEA 3TC7A 3QFWA 3QBUA 4CQDA 2D2HA 4IW0A 4UNKA 1NWTA 3BXWA 3ZS4A 2C1GA 4PMQA 1XIEA 1F74A 3A4XA 4JICA 3RCYA 3ARXA 1VHCA 3SCPA 1YEYA 1V93A 1XCWA 1BGGA 1A50A 9XIAA 3C2OA 3HGRA 5D9PA 3BLIA 4Q7IA 3R8GA 2GDVA 2QR6A 3BCDA 4Z2KA 4JEQA 1H62A 4EZUA 2NX3A 1QK0A 3E1F1 1W1IE 4C5ZA 3K4AA 3UCQA 4LX4A 4CQAA 2DZXA 3LM7A 1FY6A 4LAOA 3RLVA 2WJEA 3OB8A 3SOGA 1TMLA 3DYPA 3PFMA 1NOFA 3CQIA 1E56A 3JU2A 3PZOA 1GUVA 3EWZA 2G95A 1UR3M 4HPXA 4WDUA 3DKJA 3B8DA 1VRXA 3SGUA 1TR1A 2X1SA 3HPSA 5J5DA 1DOSA 5CGQA 3KHDA 2OODA 3WQDA 3W38A 2QEZA 1GGOA 4Z1AA 1YBQB 1LBFA 5A8PA 3GG1A 1B3WA 1UROA 2PTWA 4LYKA 4OHQA 4K7VA 1OG6A 4HU3A 3AQUA 2ISFA 3VDAA 3ATYA 1VBGA 4AXNA 4EZTA 3WDHA 1EQPA 1RVKA 4DYEA 1ZL1A 4LV9A 2VWSA 4DYKA 4AX7A 4L9ZA 3UY8A 2OSYA 3MHFA 2GK1B 4HNCA 3PANA 1MRQA 1TYGA 3CBWA 1PSCA 2VC5A 4E38A 3CMGA 1XC6A 5CSUA 3ABHA 4HQVA 1F5ZA 1JZ3A 1FDZA 2VFFA 3EOEA 3PULA 2E5DA 1OGSA 4ZA0A 2GYIA 4I7VA 3VNYA 4JX4A 1NF0A 2NW0A 1A5CA 1TCMA 3TWAA 1IT8A 2F6KA 3LPOA 4IMAA 3EB3A 1ZNNA 4JIQA 3IVUA 1QI3A 1JL8A 1YQ2A 3MQTA 2UV8G 1HTYA 4FX8A 4JL2A 3GTFA 2FIQA 4F2TA 3L4ZA 1UR8A 3WBXA 2X3WA 4QG9A 4WCJA 1ML1A 3IJDA 5JBDA 2F61A 3KAWA 3RJXA 3LCGA 1HP5A 1MNZA 3U8GA 5D37A 3W28A 2ZX5A 1QRQA 2FZDA 4XKYA 2B7PA 1LCOA 3CTLA 3LBOA 1YE4A 2EPKX 3HGJA 1YDVA 1L2UA 1C7SA 3QR1A 3K30A 1F6YA 4W9TA 3S2NA 1DIOA 4D6GA 5I3DA 4MB5A 3QH2A 3LBCA 2A21A 1ZU8A 1TQJA 1YNYA 3POCA 1UIOA 1XLFA 3SCNA 4EZVA 5DRIA 1NH6A 1CZ1A 4C6QA 4GIYA 3FK4A 3MSRA 2DH2A 3OHMB 2NXHA 4Q8VA 1ZQ5A 1TWIA 2CCRA 4AZ5A 3F7WA 3ZYZA 4GJIA 2OFJA 3WBEA 4TU1A 4HR1A 2V5CA 4X2RA 3O15A 3ECQA 1Y65A 4F3HA 2YCKX 4ACZA 3FA4A 3EAUA 5HMEA 1UKPA 2VI0A 2RJGA 3AIWA 3MMTA 4MNKA 1W9VA 2ZXQA 1BYAA 3OVGA 2VGIA 4MSSA 4F00A 4LVBA 2PTXA 5C55A 1XRVA 2OTDA 3CC1A 2QV5A 1HG3A 4JD4A 4FIQA 2QIIA 5I3IA 1UMYA 4XZHA 4WD0A 2Y1HA 4EWJA 1RZMA 4QFUA 2O0I1 3P5ZA 1GJWA 2FB2A 1KRBC 1Z89A 1GNTA 1QI2A 5EMLA 1RCQA 3VD9A 2AMXA 1A5NC 3HIJA 2R1NA 1DQXA 2NV1A 2UY2A 1JD9A 2Y62A 4TTGA 2F84A 5BYWA 1KFCA 1P0DA 3NIYA 3M7WA 1OT2A 3PTQA 2PP1A 3UWWA 1ICQA 1UWAA 4A3RA 3AAMA 7TIMA 1HVXA 3QSRA 1FTXA 3TP4A 5GPRA 4KKXA 5IHSA 4I6VA 3FGCA 1M41A 3BQ6A 3ERCC 2FPTA 2PGEA 5BXTA 4UFKA 5ABEA 1KD0A 4GYJA 5ECUA 1ZP4A 2E67A 3U48A 5FSDC 4HK7A 3P0WA 4DZIA 4MFDA 4GHRA 1S3TC 2NUYA 1FWCC 1AW1A 3ALFA 1HKWA 4UMCA 4F9JA 4B9YA 1IEQA 1ZB5A 4Q4MA 3PJXA 3GX9A 5E0CA 4OWGA 3V3WA 1QW7A 3IWPA 3A4AA 4NX0A 1SZGA 4FS9A 1QHZA 1H61A 4UUIA 1XDLA 1V4YA 1U5HA 2A7RA 5IDIA 5ECVA 4FF7A 4UR8A 4K8EA 1FDJA 4ZR8A 2GUBA 2OLAA 1XH1A 4Z2GA 1J5TA 3WUFA 4IXHA 2CZEA 3BVTA 3JVAA 4C6JA 3WQFA 1EJSC 3TEVA 2J8FA 1DJQA 5DMLA 3EX6A 4JQ3A 3D52A 4R5GA 4D6CA 2P10A 2PWGA 1OF8A 5C5BB 3BAKA 4PULA 4GACA 3QLLA 2EKCA 1DJGA 4ZOEA 1JQVA 3VFLA 1XLDA 4PL2A 2PLJA 5TIMA 1GYLA 1SZFA 2RT6A 1EB3A 3LK6A 5LNWA 1PBGA 3KUMA 3AJ7A 4PSPA 4EXAA 3AS0A 1VAHA 2WZIA 4UWMA 3W72A 4JGDA 3F4VA 1AQMA 4DBWA 3G0XA 2BG5A 4C6OA 3HZ3A 2J7HA 1LOQA 3DESA 1ICPA 3ONBA 2PWHA 3L2IA 3S2MA 2AKZA 3K4DA 3CXOA 3ARWA 2OB3A 3ZJ6A 3WL0A 2F6XA 4ZQMA 2UWFA 3LV5A 1EX1A 1JRCA 2XGZA 3AS3A 4LB3A 4C6KA 4DLFA 1XYMA 4R5LA 1L8NA 1NM9A 3F4CA 1OCJA 3EEZA 3AMGA 1SZEA 4N02A 1BVWA 3UY7A 1S1RA 3MYOA 4N0RA 5G4HC 3NSXA 4DI8A 3STFA 3R5EA 1VEPA 4D8ZA 3N9RA 3AXIA 4FHAA 2DDXA 3L12A 2HE8A 4ATMA 2VZTA 1ZJAA 2ZRWA 1AH3A 3DX3A 6TAAA 3GKFA 3QGAC 3MUAA 1PVNA 1UUQA 1OJXA 1QNVA 4M6PA 3A9BA 3AALA 3ARYA 4JTUA 4AZBA 3SJ3A 1OYAA 1F05A 1MEIA 3UVAA 3R43A 4N6EA 4QGCA 1VS1A 3DH7A 4WY0F 1V6UA 3REQB 1QBBA 1WKEA 5CLTA 3OPSA 3BGJA 1RALA 1YTDA 2NQZA 2X0SA 3ZR4A 3DBNA 4J1OA 2PMRA 1XKJA 3G6LA 2XPKA 2ZYFA 5BOFA 4R9OA 4QSHA 1W5PA 4XAZA 1R3QA 2ZUVA 4QM1A 3ITGA 2WMIA 4ZB0A 1XRSA 5HQMA 1F8MA 3CAWA 4BS0A 4AD4A 2R94A 1GOOA 1T5AA 1DTNA 1PYMA 3A4WA 4ML9A 4WSJA 2E77A 2Y7FA 2VO5A 3PBVA 2YL9A 4M8UA 3AHZA 4DM2A 2DVTA 2OQLA 1NY1A 2CEQA 3QKEA 4CN4A 2PTDA 3BAJA 1HF6A 1BXCA 1WKFA 2IW0A 1Z3NA 4S3FA 4JTFA 2ND0A 1GHSA 5ABTA 1CTNA 3SY1A 5BRBA 2WVSA 3M46A 3KTXA 4UB9A 3WLIA 4LAZA 2MNRA 1PKNA 1XCFA 4PBFA 1IHIA 1VPXA 1FWIC 3GXPA 1PKLA 3HQOA 1OFDA 2Z28A 4LT9A 4KRTA 3TXZA 2J7GA 5I2UA 1AMYA 1HKKA 3LCHA 3LPGA 4RXGA 1DJWA 3OGSA 1F61A 1I2OA 1B90A 2PU0A 3B0PA 4PUDA 4TIMA 3GH5A 2EWFA 4NAFB 1O95A 4WJEA 4DYJA 5HMSA 1JJKA 2AQVA 3MW7A 2NT1A 4XX6A 3GDMA 4KRUA 1GYMA 3F5JA 3JZEA 3HPXA 1F9CA 1IGSA 3RAOA 3B9EA 1ZBKA 3W83A 2PDWA 3ZO9A 2OQYA 3N19B 4FK9A 1EP3A 1XSKA 1KBIA 3IVSA 4IQEA 1K8YA 3M6YA 5G1TA 4IFKA 2LLEA 4O53A 4GWEA 1LWJA 2BFGA 1TTQA 3EWWA 4GFIA 1XGEA 4YU1A 4DPQA 4O1AA 4ZE4A 1OG0A 3CMFA 2PDCA 2R8WA 3TOPA 3TVAA 3MU7A 3N17A 4MDPA 2G3MA 3O3MB 7TAAA 3DX0A 3W53A 1RJPA 5EYWA 1CGTA 1MJGA 3A21A 4AWSA 1VCGA 5H8MA 2JNSA 1HKMA 5TKYA 3C3NA 2OWXA 1CXLA 2Z7GA 2R1PA 4M5PA 3SEPA 1O5RA 1WUEA 1CENA 4EPDC 1UD3A 3HA1A 3WZ0E 4V1YA 5K7JA 4ZFCA 3WY1A 3GU1A 1XRTA 3MV01 3RYSA 4WK9A 3R0UA 3M47A 3O6AA 4GQBA 1JR1A 2XWEA 3CV7A 2WHKA 3HOJA 3GUGA 4XUYA 1RLCL 1M9HA 3FYYA 1S46A 1WBHA 2QGYA 3U2EA 2QFFA 5AECA 3T47A 4JN6A 1ME8A 1XFCA 2EO7A 4LUYA 2VXNA 4HY9A 3BICA 3WNOA 5A6SA 4DUOA 5DN1A 1SVDA 3W2MA 2ZADA 3FJ4A 2W67A 1WDWA 4GYPC 1E9ZB 1K1DA 4J7RA 3NQBA 4EXQA 3DFQA 3GDRA 3D6NA 3IARA 3RR1A 4C65A 1Y0EA 3T2QA 4WJXA 4W84A 1CLXA 3NCOA 2P3ZA 4HSNA 4BK9A 1UWIA 1KXHA 4NJIA 2VEIA 3S1WA 3T55A 2ZCGA 2OO6A 4BCEA 4HN8A 3VZZA 1W1A1 1IWBA 4K1WA 1Z69A 2NUWA 1A5AA 5E6YA 4IGMA 1QO2A 1YYAA 1UR1A 4FR1A 1U1JA 2GJLA 3EB4A 1L9WA 4WGXA 5CJ5A 4IF2A 1EGVA 5A1AA 3KP1A 3M3WA 1FWWA 3CHVA 1CLVA 4B2DD 2A3HA 1EFZA 3AZRA 5A8NA 5BWFA 4DUXA 1AFSA 1CGVA 4GMEA 5I3GA 1S2AA 1R0MA 3WJSA 4JIRA 3UZJA 1KGWA 2Z2AA 3NGFA 1K4GA 1NDZA 1UP3A 2J8GA 3UWQA 2ZUNA 2GQ3A 3EJUA 4QS5A 4D1IA 1EXPA 3LPPA 2X30A 3R10A 3ZLFA 2F18A 3WLNA 1V79A 2X1TA 4MY8A 2PP3A 3FAXA 4XKYB 4PCFA 4D71A 4LYRA 3AZTA 3M6DA 2HVOA 1I2NA 3WLRA 3LLXA 2D2GA 3PUDA 2TSYA 4HHHA 3H4XA 3RITA 3FLUA 4BF9A 4ZOAA 3L4XA 3WJYA 5KETA 5U4NA 1OYBA 2A0NA 3P5YA 3S6OA 4JR5A 3KCLA 1RJQA 1KTBA 1LWHA 1KC7A 3N4FA 3NSNA 2HRWA 1LORA 1MW3A 3GG7A 3GNNA 4Q8OA 4MZYA 4DUWA 5LNVA 1KV8A 4PYSA 1ZCCA 1NP2A 4LALA 1F3EA 1SZNA 4PMOA 1FRBA 3MJYA 4JTQA 4CD5A 3T46A 2FVMA 1YNPA 3AXHA 4FO4A 4HR1B 1S5NA 3WBAA 2D69A 4D8JA 1MO0A 4ZXLA 4CU6A 4ACZB 3LZ5A 1D3GA 2DPEA 3BLKA 2C0AA 5FACA 4ZZ9A 1HNYA 3W1TA 3UD6A 1ZALA 2XN2A 3A24A 3GI7A 5LA1A 1B0IA 1HJSA 1WQ5A 4G1NA 1UPMB 4UTFA 1EYWA 3F4WA 5CC6A 3W1MA 4MGGA 3RX3A 1UH2A 3VOHA 3SQLA 1GTEA 1S5TA 3MHGA 2J4GA 1V08A 3MKVA 3L3OM 1V03A 4Q7BA 5XIAA 4HZ8A 4BWLA 4WKFA 4ML4A 4IP7A 4H6IA 1JGMA 1M7XA 3NXLA 1DE6A 4UTTA 3UT0A 3OGRA 3C0SA 2JKPA 2QDHA 5DEZA 3DIPA 3KOYA 4GC3A 5FL0A 3HPFA 3D47A 1UA3A 2J77A 2QPXA 3CLWA 4GI6A 4NHVA 3WFZA 2I14A 1A5OC 1EOKA 3CHEA 2FMOA 1XP3A 2MUCA 3VGEA 4LPCA 2VJXA 3WMLA 4ZSUA 1A3HA 3PZIA 4N9DA 2R6OA 4YCOA 3WCZA 4DBDA 4MB4A 3TLLA 1F07A 4NZJA 2CFFA 3WDIA 5KZDA 2RKXA 4UNLA 4CUCA 4J4KA 3K8KA 3KVLA 2V38A 1GG0A 4ZODA 4A22A 4JEJA 3SQMA 2VEFA 4HTYA 1K4HA 3LHVA 3NPVA 3BVVA 1TA3A 1EYEA 2HVNA 2A7NA 3LLFA 3E74A 4DN1A 4H8HA 3HAJA 4QR6A 4AZ6A 5HQLA 3CV1A 1CPUA 1Y8BA 4Q7NA 4O19A 2FFCA 3AJXA 3GXDA 4UOZA 2QAFA 4LNYA 1KM6A 3W1AA 2VD9A 2J88A 1ESWA 5C71A 1R5EA 3GIPA 3K5XA 2QCHA 4FOUA 4H8NA 2A5HA 1YWMA 4HIBA 5DQPA 1NDWA 4NQIA 4IGNA 2D24A 3QNJA 3IJ6A 4J3WA 1MUCA 5CZKA 1NQ6A 6REQA 3MBFA 1WDZA 4A21A 3DDFA 3RO8A 1WP6A 1IE7C 3VD3A 1TMQA 5B7ZA 4H6EA 1EA0A 5HNNA 4F79A 5FJUA 2WPBA 4GISA 2BHYA 5ABHA 1PXGA 4C6PA 3G1VA 4DNHA 5AYYA 4CNSA 3IJ7A 1URUA 4URIA 3IJ9A 4KWOA 4UBPC 4EOUA 2R1MA 2YXXA 3R4IA 1NFGA 2ZKMX 4HSHA 3O1NA 1YADA 4KRZA 3WK0A 3DFNA 2WM0A 3M0MA 4A3HA 4R9XA 2PLCA 3T8LA 3FFSA 4MY1A 4A29A 4O4WA 2DV0A 1H63A 3E0IA 3EXRA 3BAXA 4Q8NA 1M65A 5A8GA 3DG3A 3N2MA 3WUEA 1Q6EA 4MB1A 3V0SA 1E9YB 3N2CA 3I6TA 2OYLA 2NQJA 1WNOA 5BXPA 5AHNA 1KFLA 2Z26A 3H6OA 2RAKA 3PP7A 3HJEA 1QATA 1B3ZA 2F8QA 2CXEA 2NV2A 1DEDA 1TCDA 1S1PA 1S2TA 2XIOA 2OO0A 3U5UA 4Q4PA 1P0NA 1XKYA 3GVQA 4BWLC 3NZQA 2EPLX 3DC8A 1XCXA 1JAKA 3SRKA 4CD7A 2PWDA 2BY1A 2P5NA 3NL6A 1CYGA 4ZQOA 1H7OA 5CZSA 1CIUA 4AXKA 1LT8A 2CZVA 1HX0A 4IWWA 3W6LA 3E2RA 4CNPA 2V5DA 3HQNA 1KRMA 1EZ2A 4Z1YA 4EANA 3KAOA 3SGGA 2EG8A 3VNJA 1G67A 4J3TA 4YXGA 2ADAA 1DKWA 4QLJA 3FEMA 4B9ZA 1SFTA 4NRRA 4JX6A 2NVDA 4PMZA 3AIEA 4ZCWA 1E3XA 2Q09A 3MO4A 3BSMA 3W81A 4TMBA 1QWUA 3CHFA 1UKTA 2V69A 2X40A 1EDQA 3BSGA 1JCJA 1KR0A 3PC0A 3MVIA 3V35A 4M6QA 3W76A 1VPQA 2IPGA 3PVFA 2G3JA 4IWPA 3ZLGA 4C6EA 3VDCA 3VKDA 3TNBA 1LROA 4P61A 4XZ9A 3HGSA 5C9XA 1JPIA 2OQHA 4D6EA 1W5NA 2P1FA 1C7TA 1RA0A 3URAA 1PB0A 1NIUA 2VCAA 4KETA 3MV11 5KSWA 2X1RA 1L0PA 3GDBA 2ZRXA 1X38A 3VIKA 3LN3A 3M0XA 3LD5A 1WXYA 3OP2A 3P67A 4K7YA 3TYZA 2DZWA 4GQRA 3W7CA 4EZWA 4H3DA 4HMDA 1PPIA 1OCNA 2F38A 3QN3A 3TJIA 2YL5A 3L2MA 4MYXA 3RM9A 4GNJA 4E5TA 4GCAA 4B5VA 3UR8A 2INFA 4MB3A 2FGZA 3VPLA 1XX1A 2QJHA 4IFKB 3UJ2A 3G24A 3HFYA 3S5SA 4G9PA 2EG6A 1JYWA 3CLMA 5LA2A 3BL3A 3O8AA 1S5VA 1N8IA 2OCZA 2PDYA 4GNVA 4MHBA 1NOUA 1V7AA 4ONVA 1VEOA 1PIGA 2ANUA 2VL4A 2XSXA 5AHFA 1NEYA 3M41A 5DBUA 2FZ9A 8TIMA 3ERPA 1RD5A 5CPLA 3G3DA 3W74A 1FOBA 4ZO7A 5D2YA 8CGTA 1LQ7A 2XWDA 2X3VA 3T0DA 1NWRA 4GVGA 4GY7A 5CAKA 3TX9A 3UWZA 5CLWA 3CUHA 5C9RA 3HPAA 2X5CA 1V6TA 3GFYA 4Z08A 1EHNA 5HQEA 1KM1A 2QT3A 3AMLA 3VGDA 2REQB 4ENLA 3QY6A 1W2PA 1NVMA 4BEUA 4ALDA 2F1BA 2I17A 2BXZA 3BLLA 4NXSA 5HBFA 3QW4B 1V8EA 2Y7EA 4XVDA 1REQA 1TZZA 1K9FA 1HVQA 2V5JA 1IXNA 2CLFA 3TR9A 1TSIA 3W86A 1JYNA 3KTSA 1W3KA 3OLGA 5F7UA 1GVFA 3CV6A 1TTPA 2X09A 3RLHA 3R58A 4LUTA 3M0VA 4AVMA 1EWEA 4LH8A 1GKRA 3C7NA 3EA1A 4K2SA 3AIRA 2F7OA 5C2CA 1C29A 4QQUA 1DIDA 2I5GA 3CM4A 4CNNA 1K03A 3SYVA 4JAWA 2C15A 3EJTA 4UQAA 5CBBA 2CIPA 3KS5A 1AW5A 4PN2A 2CLKA 2YBUA 2BS9A 4M0XA 1EJVC 3KRUA 4D8AA 1EDTA 2Z2BA 2Y6ZA 1C9WA 1AZ2A 1E6QM 1WZMA 2OWWA 4EE9A 4FX6M 4XKMA 6PTDA 5I3JA 2B7NA 3NL2A 2HK0A 2XFYA 4DVOA 4C60A 1R7AA 3GG8A 4LSBA 3UETA 3BPWA 5BZAA 2FDSA 3ZZ1A 3CZKA 2QMKA 4ZENA 4GD0A 1AD1A 2W92A 3UERA 2ZC8A 4FSAA 2W0UA 5AYIA 4H8SA 1J93A 1SYTA 1OA1A 2HSAA 1JPHA 4ZO9A 2PZ0A 4JS3A 5A5WA 3E0WA 1V0KA 4BHYA 3NQ6A 3NOEA 4JY8A 1ADDA 1B4KA 1SJBA 3P60A 3H2MA 2ZVIA 2CU0A 3THDA 1LJYA 1E0UA 4AZCB 3UWYA 3HQ1A 4IPPA 5CZJA 3T4CA 3FHQA 3KVKA 1K9EA 2J7DA 2UY5A 4DBEA 1CGYA 1EC9A 2E6YA 1TPH1 1R2TA 2PDHA 3EPMA 4M1RA 2FTWA 4NZCA 1VYSX 3DHPA 3IIOA 3M9YA 6XIAA 1BVZA 5J04A 1PV8A 1W0MA 1JD7A 4D6DA 1W3LA 1DORA 5CSYA 3BUBA 3O3OB 5G4EA 3LRKA 4DO7A 1UUOA 5EA9A 1KFKA 3BURA 4UFIA 3B8IA 4KT2A 5BNKA 1H50A 1W31A 3SY5A 3EA3A 1QWNA 2VEGA 1DWJM 4EZRA 1B3VA 1XBXA 4GQGA 4B5NA 1W1ZA 2Z25A 4LVGA 1GVYA 1Z41A 2BLEA 1F2JA 2WVVA 3GUWA 4QP0A 1JEZA 3S5ZA 3E49A 3VKJA 3TYCA 1EUNA 3WG6A 3FHAA 4HKPA 5KITA 4A35A 1QUMA 4ZQCA 4WY0A 2GQAA 1SQ7A 3WFAA 1HXJA 1V7YA 1SU8A 3R1ZA 1E9IA 3LB0A 3W4RA 3E38A 1N82A 4H6KA 2VR5A 3GTNA 2QYGA 3KBVA 3EJRA 3BJSA 2CHOA 3ZWTA 1TQSA 2YZ5A 5I07A 2OT0A 3T0BA 4TV5A 3LY0A 1UR2A 1QHPA 4X0NA 3CH9A 3QGVA 2WBGA 2Y8KA 1S2WA 1W3TA 2G3FA 5L6UA 2V5LA 4J28A 5BCAA 3W7EA 4LYQA 3FX4A 3LEPA 1TZ7A 1UBSA 1LG2A 3NJ3A 2EJAA 1A0CA 2XFRA 4NIRA 4PUJA 3TTEA 4AWEA 3Q0KA 2XSBA 1RAKA 4EZNA 3G2GA 3S6DA 4MUZA 3VINA 5HPOA 3JR2A 4BEQA 4US5A 1YRRA 3WLMA 4UTKA 2ISWA 3MYPA 3LQLA 3AYRA 1E4NA 1VFLA 4HA4A 3AC0A 2V3DA 4P7QA 4PGLA 4PMVA 4IQJA 2CLEA 4R5JA 2XH2A 1Q85A 3TUUA 2V6AA 4Q8WA 3IIZA 1Y5XA 5E6ZA 3S0CA 3THAA 1W54A 3TKFA 1CGWA 4CQ8A 4ZTYA 3MKCA 3ES7A 4M82A 1TA3B 4XD3A 2RH9A 3AIBA 2Y5EA 1BD0A 4JKLA 1VJIA 3ISIX 2O9RA 2PRLA 4O1CA 3NPUA 1KLYA 3CPGA 1B31A 3NZGA 3T6CA 2V67A 3QC3A 2YJQA 4FLOA 4FALA 4MUPA 4ILSA 5A6LA 2GF4A 4P8VA 2BXYA 4CN6A 1UJPA 1R47A 4LY8A 3R8RA 1KM0A 5K9DA 5LA0A 2AOSA 3S2JA 1RBAA 2WSYA 1TJ0A 3HGOA 3AMDA 2V2HA 1B5TA 4BQ2A 2VT0A 2BY2A 4H00A 1KGXA 2NZLA 2PF8A 2ZZ7A 1FQ0A 2QUMA 2VUYA 3AU6A 2YXOA 3TV8A 6CGTA 5FESA 3UNDA 1V6WA 1I45A 2NLIA 5K4ZA 4AAJA 3T78A 4ZFMA 1Q6GA 3CZEA 3ZMRA 3S3GA 4V33A 4R5EA 4L61A 1TUXA 3IEBA 1XLLA 3DFTA 1LWIA 5FKYA 2HBVA 5EL1A 2ZRZA 3LG3A 2FJUB 4N9BA 2OZ0A 4WXYA 3L2LA 2YA1A 1UP0A 2DZSA 3M0JA 3W2KA 3J7HA 4R7OA 4EVZA 4DZAA 4A3YA 1R85A 5C9UA 2X16A 4JDYA 3E6EA 4NNCA 4EF9A 2QXLA 4JHMA 1WOBA 1Q13A 4FOKA 1WB0A 3OIXA 3CT7A 1Q6QA 3ZT5A 3L3PA 3W0KA 1E5JA 1KXVA 3MMUA 3AIQA 5CG7A 1R8LA 1W9UA 4NG3A 5IBXC 2V81A 3ARVA 3BAYA 3W9ZA 4U31A 5REQB 5MF5A 3DDGA 2VEPA 3A3HA 3V18A 4UR7A 4AYGA 3EB2A 5I02A 2YGYA 2J7BA 4UFHA 1TX2A 4XSMA 4XWUA 3CV5A 1XGZA 3UA4A 3LNMA 3JW7A 3VIFA 4UIOA 4A6GA 2EX3B 3OWGA 1Q6LA 1SJAA 4CNUA 5G2IA 4US5D 2DFAA 1B54A 4LVDA 4K3ZA 3I39X 2GSHA 1W9PA 1X97A 1QVBA 4WOQA 4YYCA 2ALDA 1X1NA 4JTTA 4MTVA 3SSJA 1QPOA 3VKKA 3BVWA 3I4EA 2NQHA 3TTOA 1ZJIA 3WLJA 4PFMA 4HTBA 1KB3A 2ESCA 2X41A 3DHUA 2A3AA 3FA5A 3NSMA 2A2IA 1VYRA 2ABBA 2DQXA 2I1OA 5LIWX 4ATDA 1UZHA 4CKQA 3EJQA 3WLHA 3W6YA 3PPFA 3EKZA 1OZMA 2ZZ5A 1UD6A 5CAHA 1V3LA 2WWCA 3GZAA 5DMMA 4WDXA 4MKSA 3QMTA 2E6DA 2CBJA 3Q45A 3VKCA 4R5IA 2CNCA 4F48A 4NSBA 4Y9NA 1EEPA 1O5KA 1CB7B 3HM7A 4Q8TA 3LI1A 1FH7A 3UXAA 3CUGA 3T7VA 5HNUA 4L4OA 3SCRA 2RAJA 3GNDA 1HKVA 1JULA 3FSUA 5I78A 5FJOA 3TN6A 4KPLA 1VBJA 4JN7A 3GXTA 4OQVA 3QZEA 3LA4A 4HOXA 4ERGA 1A5KC 2FGLA 4KS0A 2AAAA 5CPTA 3ZEDA 5A6TC 3OJGA 4AIEA 2PE4A 3WQPA 2TYSA 4AC1X 4F0SA 5BWAA 1W3NA 1O7DB 3OBAA 2DP3A 4O1DA 4O13A 2VX5A 1XGDA 4NJGA 2ZDSA 4UTLA 3LRLA 3PTKA 4MG4A 4GXPA 3FKKA 3NUKA 1RJRA 1ITUA 1MXGA 1SW0A 4NZFA 3WQ4A 4B5UA 1EGMA 4J40A 1J11A 3PG8A 3P81A 1BWKA 4UFJA 4RPPA 1U83A 4PUNA 3H7UA 4W8BA 3PPCA 4JTKA 3DFHA 3DGBA 3UYIA 3WX7A 5HWMA 1PTAA 2GJRA 3ME3A 3NL3A 1QR7A 1PHWA 1EKOA 3UZZA 1JRBA 1OFRA 3SCTA 5FF0A 1W1PA 3VD7A 1WE5A 4ZB2A 1QDSA 4YN5A 2LM0A 3Q2DA 3CPUA 3O6DA 3PNZA 2NQ9A 3CUXA 3MCOA 1XBYA 1OADA 4Q22A 1E9LA 2Y7DA 3CNYA 1WKYA 3C2EA 3R2GA 3B40A 4FI4A 2ZTJA 1E0XA 1OIMA 1W1B1 3W7DA 2A3CA 2BMBA 3CVRA 1VCVA 3FW6A 1E1FA 1E73M 5HR6A 4K39A 2Q6ZA 2GPTA 2BNJA 1M7OA 5I6SA 2YW4A 2BY0A 2OXNA 1ZLPA 4DF0A 3L0GA 4LQ1A 3LXBA 5BRPA 5FJRA 2RAIA 3DYTA 2Z4GA 2AQOA 1REQB 2X7WA 4NF7A 1MQPA 2A1YA 3V4BA 1V0LA 2VVSA 2HZGA 3H2CA 2PZNA 2WW5A 3QKZA 5C8BB 1GVQA 2VGGA 3A9IA 1EF2A 4LUTB 1XG3A 4JYFA 5EY5A 1XBZA 2QCNA 1QNQA 1I0DA 3HG4A 2WYSA 2QCGA 3EX2A 2R9RA 2WYIA 4G1KA 4E2VA 3I3EA 5F2LA 1MUMA 4MJMA 2Z6IA 4YTRA 1XBVA 3EWCA 4KBXA 3M16A 3UZWA 3VIPA 4AVNA 4L1GA 2G37A 3HJZA 3CZGA 1GKPA 1ODUA 1US2A 3R7MA 1GEHA 4MKNA 2OKTA 1LQAA 3VKHA 4H6HA 2DQWA 2A3LA 4YNGA 3ARTA 2PWVA 1X98A 2WHJA 3CQJA 2H3DA 3SCVA 1L6GA 2JALA 2FHBA 1OA0A 3MI3A 3P82A 1E9VA 4P2VA 4R53A 5HXMA 5EMKA 4R88A 4AIBA 4ERIA 1YW1A 3SQSA 4JFTA 4NVTA 1V6VA 1IF2A 1KGUA 1NWSA 3H26A 1IR1A 1NAL1 5GJMA 2FKPA 4X0VA 3QY7A 2DUXA 3VO0A 1XYCA 4HPHA 2P0IA 5AY7A 3H7VA 3UGVA 1UZDA 4JNMA 3A5VA 4GLEA 2BWGA 5A6BA 3LM3A 3UWVA 1UWQA 5EMJA 2MI7A 1P43A 2CKRA 3G0UA 3N11A 1H60A 5G1MA 2VC7A 3CJPA 4DJDA 1HL2A 3PFRA 4TX9A 2OU4A 2RGMA 3NZPA 4ROPA 1QNOA 3SBFA 4GI9A 3GNPA 3DX4A 1PS9A 2ZZ3A 2OLHA 4CQBA 3B4UA 2EPNA 1P5BA 2GFTA 3LGGA 1QK2A 3P0XA 4QIUA 4LFYA 2FDMA 4AD5A 1GZ1A 2A4AA 2RUSA 3LNPA 3IUDA 3I01A 4S38A 4AMCA 1XIIA 2Q3OA 4EZQA 3ITYA 3E5BA 1A49A 1J0IA 1SPQA 2F2HA 4PUWA 4PTDA 4JNZA 2Q8LA 4ASTA 5DX7A 4IL0A 3WD2A 1XYZA 1XG4A 1F3WA 2J24A 2WVVB 4H9VA 5D04C 2D0FA 4GZJA 4AIUA 1WZKA 7XIMA 3N18A 4E3TA 3ARUA 1CXFA 2YYTA 2QJNA 1KTNA 1OFQA 1Z48A 3NZ1A 3COTA 2Y5SA 1C9DA 2ZX6A 3BUDA 1MNSA 2QLYA 4C1KA 4AZGA 3UR7A 5E0FA 5BROA 4BQ5A 4ATWA 4IIEA 1CXHA 3ARPA 1LF1A 2C3ZA 3QTPA 2XIMA 1ODZA 4S3DA 3WN6A 5LXEA 5CJMA 3UP8A 3M0LA 3VX0A 1RQEA 1OAOA 1P0EA 4HSOA 2WKLA 2YCIX 2F7QA 1P0BA 5E0KA 4U3AA 5JMUA 3WH6A 4PMXA 3UXKA 4AIOA 1U2YA 4ZB5A 3B0VC 3MB9A 3L5AA 4H7CA 3JZUA 2DZUA 3LXCA 2WMJA 1LBMA 1V3IA 4ZEPA 3PY2A 1E4IA 2P88A 3S1XA 1IIGA 1J79A 4DBUA 2EFKA 3PM6A 3DPOA 1MZHA 3ZJ7A 3WF2A 4AD3A 3N2TA 3VDBA 3C6CA 5JH1A 3I4KA 1C8QA 1XM3A 5HR7A 2J62A 3WYZA 5AN7A 4B5SA 4CU8A 1W5OA 4QQ3A 5A6BD 3W2UA 4IM3A 4QNEA 1BSLA 3AHYA 3PPHA 1QPNA 1UPXA 4IPLA 4JY9A 4DJDD 1XIBA 2Y4SA 2BXVA 3BANA 1BQCA 3SCOA 4A05A 1E71M 3VXGA 1ELSA 4JTIA 1EZWA 4V2XA 4RE3A 1G1YA 1HKJA 4ZL1A 3SB0A 1UR9A 1XLCA 1R7OA 2XU2A 3DECA 1UP2A 2GQ8A 3SCQA 1S38A 1DYSA 3TQKA 2ZBTA 4JQ4A 3WKZA 3N9SA 1HFBA 2EBNA 1DV7A 1RK5A 2NX1A 4J3ZA 1H7WA 1U1UA 1QFEA 3L9CA 4DJDC 1YHTA 1O7AA 4CD8A 2POTA 4WXZA 3QYSA 3ZWSA 1UIPA 1I8JA 2DJXA 1UMLA 3TW6A 1NELA 1RP8A 3XINA 2X3XA 1JCXA 4TQTA 3AMKA 5FAGA 2A6LA 4PTMA 1FWJC 1XIMA 4H9TA 4PTNA 1PX3A 4AW7A 3WD3A 2YDAA 5D33A 3W87A 2PGFA 1XIDA 5A8MA 3EOLA 3VZXA 4Z1CA 3B9OA 5LXXA 1X7IA 4KFOA 1LLZA 3IGHX 2ZA2A 3AIVA 1JXJA 4O18A 1CX9A 1TJ1A 3EWUA 3CU2A 1UQZA 3DOPA 2BVYA 5CGTA 2XYLA 4FZPA 4JDBA 1TTIA 4V15A 5GVJA 3SFWA 5FI8A 3G0SA 1W6TA 4N9EA 2VC6A 1Q5MA 5FJJA 3H7RA 1SO4A 4J27A 1RLDA 1WCGA 4XUGA 3H8AA 3UJFA 3L4TA 4AU0A 3WMBA 2HXUA 4MAVA 3O6CA 3B51X 3E9AA 3TC6A 2DVXA 2VZOA 5E84A 2EPOA 1H0GA 1KR1A 4QE4A 3GHUA 3A12A 3K1GA 4FMVA 4JN4A 4A8RA 3A3WA 3ANYA 3W7RA 3TN3A 1QI0A 3KEHA 2PGRA 3ARQA 3QOMA 4ZQRA 4Z2LA 1GOKA 1F8IA 2FLIA 3HB9A 2AQWA 4IQDA 4KERA 2PI6A 2PGWA 4MWAA 4IMCA 1C90A 1MQQA 4UFMA 3VM5A 1IEIA 3OZYA 3DPPA 4MADA 5C7HA 1B30A 2FYMA 4QISA 4QXIA 5A2BA 4NJHA 3EMQA 2ZXAA 1EXBA 5TQLA 2IXVA 3SUSA 2BOEX 3OYZA 5D03A 3VYLA 1X39A 3AISA 1HJWA 3XISA 4D1JA 1EJXC 4PBGA 3TA6A 4FPSA 4OBTA 5M03A 1KFEA 3MDWA 3UW6A 1GK8A 3GE7A 2Y8VA 4GVHA 3AMCA 7REQB 1SFJA 4YL2A 3VMOA 1QWKA 2CBVA 1I2RA 2G97A 3BG3A 1AG1O 3FJLA 3QHNA 2HEJA 2OX1A 3CO4A 4LGXA 5CXPA 4BA0A 4FLSA 3VM7A 1BVNP 2PPGA 2XUCA 3RPMA 2FQIA 4IJRA 3BOFA 1FWSA 3GNXA 2DT2A 2QCDB 5MKGA 3CL6A 3O2LA 3WF0A 5GNZA 2DT1A 4HJFA 2E5BA 5TAOA 3GAKA 1X8FA 4CD4A 4PUKA 1ZS2A 3WBWA 3B8TA 1E15A 3JS3A 2VP8A 4ICCX 2FB3A 3CGTA 3G9GA 1B3OA 5FEPA 1I6NA 3I7QA 1JUEA 2QJMA 1OWQA 3PTDA 1KM4A 4OE7A 4J3VA 1ZFJA 1A5MC 3NG3A 4HK6A 3RRAA 1HQTA 2XVPA 3PNUA 3F4NA 3N6JA 4L56A 5TF0A 3QE6A 1QW8A 1E6PA 2JE8A 4W7VA 3LLLA 4FF5A 2WO5A 1OB0A 3NDOA 3TW9A 5CJNA 3GXIA 1FCVA 1CEOA 4GO8A 3B9AA 3GRIA 1M53A 6ENLA 2OEMA 3BV7A 2DEPA 1TJRA 1XRFA 3BG5A 4F40A 2QMJA 1EEXA 3OO2A 2J7CA 1HIZA 1JCLA 3CQKA 3NAVA 1Y5WA 3OLDA 2DT3A 1JCNA 1RV8A 3R25A 5JQ9A 3QMRA 3SM0A 5KMYA 2WHLA 3N14A 1R9ZA 1UZ1A 1ENUA 4UTWC 3QY8A 2G96A 4O52A 1MFVA 3MJMA 3WJWA 2FMNA 5CH9A 3L66A 1BFNA 1OT1A 1U22A 3G1HA 3HBLA 3CB3A 3DFPA 3L4VA 4JCMA 4PMYA 2WJZA 4HYRA 2H6RA 4OBRA 5E9AA 5T9BG 2XTKA 3PUOA 3B53X 4L1WA 4E3VA 3UA3A 5K2ZA 2OBMA 4CN1A 2Z00A 4L6HA 2WPGA 4OOUA 5ENLA 3AIUA 2Z1BA 2IQDA 2UY3A 3RX2A 3QHOA 2ZZ2A 2VRKA 9RUBA 4IISA 2GAFD 1LP6A 3V36A 4IG2B 2C1IA 5D2TA 1JUKA 5H91A 4YVVA 3TQ0A 2PDPA 3HURA 3Q65A 4UMAA 3PF3A 3VMPA 2WSPA 2O9OA 4WSHA 3NL5A 3EWDA 5FCZA 4DF2A 4QJ3B 1PTGA 1OF6A 3B8WA 2C7FA 1IYXA 2GVLA 3LTYA 1PX8A 4ZMGA 2V3GA 2QPSA 3OHIA 4KFPA 1JG9A 4I90A 4S23A 1ICSA 4W85A 3TXVA 3WD0A 2PCEA 3GXFA 2HJPA 1TV3A 3BC9A 4M3PA 4AQLA 2E8YA 1NDYA 4GKTA 3U2CA 2WC7A 4LAMA 3QTGA 4N2YA 4P5UA 3USBA 3QFEA 3KLLA 1E0WA 1PO9A 4O57A 4Q4KA 5U7SA 1BQGA 2CWNA 3D3AA 1GTHA 2VMFA 4WPCA 3B04A 1L6YA 4W88A 4G5DA 5FEWA 3SN4A 4XZLX 1KKOA 4HB7A 1R6WA 3MS8A 3LLDA 1WXJA 1KXQA 2FH8A 2PLKA 2RGLA 1J0KA 3TYUA 2DU2A 1K70A 4PEEA 3IUHA 5B7YA 4B90A 2QDGA 2WNQA 3I7RA 2XHYA 2HBXA 2ZE3A 3C3UA 2DORA 2OO2A 2QV4A 3UU0A 3WJXA 1T99A 4QCFA 1V77A 3UXDA 4HHMA 2WAGA 3SCWA 1H2JA 2VDHA 5CZ0A 3TDFA 4L6DA 5JXQA 2QUNA 4GPNA 4X2PA 3UWUA 4PRTA 5EB8A 5AFDA 1CXKA 2J79A 4EZYA 2Q3RA 2Z2UA 1UKQA 4JIEA 3LV6A 1P0KA 2C79A 1OZQA 1GWJA 3JUGA 4MNJA 3NOYA 4JIHA 1UR0A 4D6HA 3STEA 3V0UA 4NJJA 1F7BA 2EGZA 1TQUA 3QQ1A 3UG5A 4K37A 1TPB1 1WDDA 3BOXA 4HYVA 4XO7A 3VOFA 1CGXA 2DY3A 3G8RA 4IGSA 1RCOB 3S6TA 2CESA 3RM4A 4AD0A 1GQKA 4RNHA 1GVIA 5BU6A 1XWYA 1E5NA 3PWGA 3BJTA 3G1XA 3WENA 4JTHA 3WD1A 1RD6A 3VCRA 1TPFA 3QV7A 2J66A 1ALDA 1VJSA 2TRSA 1YXYA 5I3HA 1E1EA 2EF9A 4KWUA 2YFOA 3HG5A 3WDPP 3DX1A 5LGXA 2WZTA 3QV6A 5CCZA 3PS7A 1UC5A 2VYOA 4DYLA 2GWNA 3TE9A 4NP7A 1P7TA 1HUVA 2J8TA 4XIMA 4GNKB 7ENLA 4GZEA 4IIDA 3TTYA 4MJ2A 3FJ6A 3FJNA 2HV5A 4L80A 5HWJA 3EKLA 3GVWA 3PZMA 4KCTA 1NWUA 5FJPA 3W07A 2HS6A 1HN1A 2G3NA 5GJNA 4GRSA 3U5YA 4EACA 1LTDA 2ALRA 1TQTA 4S3BA 2Y0FA 3EMZA 3LHTA 3PB2A 4GYFA 4W7WA 3UYCA 2NQLA 4H04A 4TX6A 4PC8A 1AODA 1E43A 4C6NA 3KDNA 4Z42C 1PCWA 4M29A 4W89A 5HJXA 3R8HA 1TPUA 3GH7A 4O4VA 4DUVA 5H8PA 1ZSXA 2AMGA 2DJLA 3IANA 4DELA 3PBWA 1XS2A 2BTMA 3FV9A 2DZAA 1LRQA 2FFIA 3CQ0A 2PDUA 3KFTA 4N4QA 5AC8A 3N34A 4GA8A 4WLCA 2XZ9A 4JX5A 2JKEA 2I56A 4P8WA 1ZTVA 4P7RA 3CHDA 1P1MA 1W32A 4EZOA 1SO3A 3Q84A 3QPEA 3PBGA 1XLAA 1DVJA 3OODA 4KW2A 2Z24A 4F0LA 2F2KA 3GK0A 2MANA 2WZHA 1LG1A 4PA8A 2Z0NA 4MIMA 4PFHA 4KWSA 1KQZA 3CAVA 1W1YA 3BSHA 4AHQA 5ABGA 3EX1A 4Y96A 1RQHA 1H11A 4C5YA 3N1AA 2R24A 3RPDA 3I6RA 4H7ZA 3UJEA 1U5VA 1VFOA 4CQCA 1PWMA 4RE0A 4QITA 2BGQA 1YXDA 4S3AA 1K8CA 1IV8A 2OJPA 1TV2A 1H0IA 1HO4A 2D0GA 1RBOB 4O16A 4L9XA 1XH2A 4U33A 2IUZA 5D30A 5CGMA 3HN3A 3F1QA 3EDJA 4JZ5A 3HO8A 3VFCA 2PAJA 4O8AA 1X6NA 1GVOA 4GE8A 3BUVA 2KX9A 4GZIA 3H2OA 3CK5A 3U6WA 3CZSA 2Y89A 3O9NA 1H1NA 1J10A 2CXGA 4M51A 4YWSA 4K38A 4GOAA 2WK2A 1W1TA 5EMMA 3W7MA 5HJYA 3GTXA 2OVLA 1B57A 3HQPA 1OC7A 1M3UA 4ADTA 3RUBL 1TR9A 2QS8A 2QJIA 3W22A 4GY1A 2OYMA 3WLPA 4DJEA 1DIEA 5A94A 4H1ZA 1R34A 5HOSA 1Q7MA 3C86A 3Q58A 7A3HA 1I75A 4PCTA 2IKJA 4C6FA 3ES8A 1RH9A 2BGSA 2PD5A 2VZSA 1XIGA 2EFLA 3CZLA 4B15A 1VFTA 4UTJA 3S46A 4DBSA 2QUTA 5M3WA 4MMWA 4CCEA 4HPJA 4HNTA 2OZTA 3E96A 5GJPA 1LQ2A 3NPWA 1XLGA 4M7SA 4Z1DA 3I3DA 3TZNA 4PMDA 3CB8A 4LXFA 2X0HA 1U00A 1SR9A 2PB1A 4HT3A 1VBHA 3DFYA 4Y9AA 2GVEA 4XBKA 2DH3A 3P3BA 3RG6A 1EH9A 4A2RA 5D2VA 3K4WA 3FDKA 2GOUA 2EAWA 3MUZ1 5D9NA 1FHVA 4E0CA 1JCMP 3VGFA 3GDKA 7CGTA 2YDSA 1TIWA 5M2FX 1KM5A 2YW3A 4ATLA 1EQCA 4MWAB 1TVNA 3E2SA 4GBDA 2VDGA 4M19A 1TV8A 3EWXA 1Q7ZA 4GUJA 2ELBA 4RDVA 2VZVA 4CEUC 3ZXWA 1KKRA 3GXNA 3VX1A 1I60A 1EJTC 1VYPX 4L6OA 3OG2A 5IM51 2WLYA 4V27A 2N3KA 4NQ1A 1Z44A 4PMRA 3WLQA 3K8MA 3IRDA 4ZOCA 5CPSA 2H8XA 5HWNA 1IZKA 1RUSA 5LNSA 1VB9A 3UXIA 1NFBA 4GJJA 1IXOA 2YR1A 3I65A 4IM2A 4E81A 5AC6A 3PUEA 1XHGA 1ZBVA 3EOUA 2OT1A 3NQMA 3RU6A 3WEZA 2J7EA 4YPJA 1TQWA 5MKGB 1H1ZA 1FX6A 5JBFA 1GW9A 3TSBA 3M0IA 4LCQA 4W93A 2WJDA 1A4MA 4Q6XA 1PCKA 2AKMA 1N7KA 2BVWA 3EGJA 2W79A 2SFPA 3VCCA 3L67A 2I16A 3W7NA 3IIXA 2QW5A 3OU8A 4NILA 4JWEA 2ACSA 4NASA 2XM1A 2J27A 4GX8A 4INFA 1GQLA 2PP0A 1MQRA 3WLSA 3VC6A 1AA1B 3S8HA 3M0KA 4I5RA 5I09A 3THUA 3UR2A 4UMBA 4MPKA 3E2VA 1YXCA 2OOGA 3LGEA 4U5IA 4HOWA 3VNZA 3D5HA 1Y2OA 2ZUWA 3B0UX 3UQNA 4DJED 1XJBA 4N9CA 4QRNA 4CCDA 1X96A 4Z17A 2XVLA 3KWXA 4CQ9A 3U0HA 4X22A 2AGKA 3I3BA 2PFHA 5D9MA 5F4WA 3TQPA 1A80A 3ABRA 3UPWA 5A2AA 4PZVA 2CWXA 1W5QA 4HPNA 3TFCA 5LIUX 4IUOA 4DJEC 3TSDA 1W9XA 1HP4A 2IMRA 3G1DA 4RK8A 3V5FA 3VNMA 3FIGA 2G50A 5I5RA 3KE0A 3NO3A 2GJXA 1NDVA 4XZMX 4JTSA 1BEUA 1UD2A 2G4FA 3T09A 3W02A 4X9YA 1FCBA 1KXTA 3CWHA 3MP3A 2VQUA 1ZWWA 4LF1A 2J74A 3C2FA 1RHCA 3S5OA 4U3CA 1XIHA 1MSSA 3TSMA 5LNUA 2CZ5A 3EJPA 5EGRA 3N12A 3DYOA 4HZ6A 4OFCA 4YLWA 1P6WA 3BK0A 3NZRA 3OA3A 2Q71A 4C6CA 5J8LA 1G9HA 4GC4A 4LANA 1ZCOA 2CLIA 4Q32A 4QJ5B 4XTIA 4OJYA 4Z2IA 3W2JA 4JL1A 3I04A 4RW3A 1CNVA 4NY2A 2QJJA 2ZUUA 3SIMA 3F2CA 3U7BA 4I8YA 4CNTA 2J9XA 1SO5A 4UTUA 3W82A 4WRHA 5AYZA 3BLEA 3S2CA 3PSWA 4G7FA 4JFSA 5HA7A 5F2MA 2E68A 2YOCA 4YS1A 5FJIA 1KWKA 3VDGA 3TZFA 1VZWA 2BOFX 1G7VA 1KA9F 3WK1A 1OBAA 7ODCA 4OT7A 2I7GA 1NQKA 1GPFA 2HPMA 2D2OA 1GZGA 4U10A 4JIPA 1YNQA 3ZT7A 3NA8A 1K8XA 5DELA 1XFBA 2V2DA 3UG4A 3T2OA 4P7NA 4JBRA 4M7TA 2O92A 1VENA 5I79A 5HAOA 1DPMA 1Q45A 3VGGA 3G22A 4GUGA 1EC7A 3BLOA 1XV8A 1PAMA 3MUIA 4R34A 1TVPA 5AOUA 3PBYA 3ZVIA 2Z0OA 1W1VA 2GGJA 2ZVRA 2Z0IA 3WUBA 2W5FA 1ONEA 4W87A 4LW7A 1EDGA 1S39A 3RCNA 4OECA 3KP0A 2ZTKA 4B16A 4R33A 1AH4A 3SO7A 4UTIA 3C61A 5LGZA 3ITOA 3GBDA 1JYVA 3WO8A 1D2KA 3EA2A 4DO5A 4LU0A 3PLTA 2W6RA 3G77A 3M5YA 3NVTA 3AUOA 1P1XA 1VKFA 1QNPA 1GOXA 3G1YA 3O05A 1DXFA 4FXFA 4PSRA 3N9KA 1O5XA 1FHUA 2YFNA 1ZYLA 3KCJA 4UQEA 1KFWA 1QBAA 1BF6A 2E09A 4AEEA 2Z29A 4HMEA 2QCEA 2WC4A 1OFEA 3IK2A 2GL5A 3BW4A 4GGBA 3W7OA 1WAUA 1QNSA 2E3ZA 5D32A 3ENLA 1FHLA 2ACQA 4IZGA 4S2CA 5AHEA 4C7GA 5FIPA 1XD1A 3P8JA 1JAEA 2NWSA 4JKMA 2E1WA 3PBUA 5A8OA 3W7PA 2VFGA 3SI9A 1OFPA 1JNEA 4J3XA 1LOLA 2QVHA 2REQA 1PIFA 1X1OA 2XVKA 4D72A 1RA5A 4LB4A 2QKWA 3K46A 5D09A 3LMYA 4ADUA 3CPRA 2E9BA 3CKDA 2O9PA 3LGDA 2GZXA 1BSIA 4XVEA 3TN4A 3BG9A 4XZBA 5C0QA 4M1BA 3MSDA 4M24A 4J3SA 1R3RA 3KXQA 3K13A 3V0TA 1H41A 3NQVA 3DENA 3H21A 3DFSA 1P7TB 4N6FA 4MDOA 1D9EA 1WZAA 1DKZA 4ZGYA 2BP1A 3TNOA 3HAHA 1HGWA 2NVCA 1JZ5A 3T81A 2H9AB 4LS0A 3VNDA 5FOOA 5BOOA 3UR5A 1RPKA 3LHUA 1UJQA 2A6NA 2DZPA 4QX4A 2WHMA 3P74A 3U4FA 3RRXA 4DWDA 2INZA 2GWGA 1FWGC 2OPJA 4LBRA 3VKAA 4Q4SA 1UBPC 1MUWA 2YBVA 1B3XA 2BX7A 2PC8A 1JDDA 3L0KA 5DCEA 3RV0A 2TAAA 4I7UA 3MA8A 1I0BA 3DXIA 1QOXA 2JEQA 3BMVA 3CO8A 1D7FA 3NFUA 1F4AA 1J96A 3G18A 3PZQA 1LYXA 3AROA 4O12A 1ISXA 2Y85A 5EFFA 2RDXA 3CL8A 1E1DA 1R9YA 2GSEA 4UOJA 4UDXX 4AWUA 4HK5A 1WV2A 3G1SA 3WUGA 1BGAA 2W3ZA 2FZMA 2EQDA 2X1IA 3FEQA 3ID7A 2WZEA 4AZCA 1I4TA 2PF0A 5D8ZA 1NP0A 2DSWA 1K77A 3AO0A 3B0YA 4FLRA 1Q6DA 1PUDA 3ITLA 3T1GA 1NSJA 2YDRA 2UZ9A 2HNEA 2IXUA 1UD5A 1Z8AA 4MLJA 3GTIA 1JI1A 4ROQA 2OSXA 1QPKA 4ZO8A 1DHKA 4P8UA 5DT5A 1TELA 3KRZA 2BHUA