4AZ9A

Crystal structure of phox homology domain of human sorting nexin 24
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
111
structure length
111
Chain Sequence
GTENLYFQSMEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SORTING NEXIN-24
publication title Crystal Structure of Phox Homology Domain of Human Sorting Nexin 24
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 29
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 4az9A00
1XTNA 1KMDA 2RAKA 4IKBA 2AR5A 2V6VA 4IKDA 1H6HA 2REAA 2I4KA 4OXWA 4P2JA 4PQPA 3HPBA 3HPCX 2REDA 1XTEA 1GD5A 1O7KA 3LUIA 2YPSA 1KQ6A 2CZOA 2V14A 3P0CA 4BGJA 4HASA 2DYBA 4PZGA 4P2IA 2WWEA 2RAIA 4IKBB 4AKVA 3FOGA 3DYTA 2ETTA 2CSKA 2IWLX 4PQOA 1OCUA 4AZ9A 2L73A 3IQ2A 2RAJA 4ON3A 1OCSA
chains in the Genus database with same CATH superfamily
1XTNA 1KMDA 2RAKA 4IKBA 2AR5A 2V6VA 4IKDA 1H6HA 2REAA 2I4KA 4OXWA 4P2JA 4PQPA 3HPBA 3HPCX 2REDA 1XTEA 1GD5A 1O7KA 3LUIA 2YPSA 1KQ6A 2CZOA 2V14A 3P0CA 4BGJA 4HASA 2DYBA 4PZGA 4P2IA 2WWEA 2RAIA 4IKBB 4AKVA 3FOGA 3DYTA 2ETTA 2CSKA 2IWLX 4PQOA 1OCUA 4AZ9A 2L73A 3IQ2A 2RAJA 4ON3A 1OCSA
chains in the Genus database with same CATH topology
1XTNA 1KMDA 2RAKA 4IKBA 2AR5A 2V6VA 4IKDA 1H6HA 2REAA 2I4KA 4OXWA 4P2JA 4PQPA 3HPBA 3HPCX 2REDA 1XTEA 1GD5A 1O7KA 3LUIA 2YPSA 1KQ6A 2CZOA 2V14A 3P0CA 4BGJA 4HASA 2DYBA 4PZGA 4P2IA 2WWEA 2RAIA 4IKBB 4AKVA 3FOGA 3DYTA 2ETTA 2CSKA 2IWLX 4PQOA 1OCUA 4AZ9A 2L73A 3IQ2A 2RAJA 4ON3A 1OCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XTN A;  1KMD A;  2RAK A;  4IKB A;  2AR5 A;  2V6V A;  4IKD A;  1H6H A;  2REA A;  2I4K A;  4OXW A;  4P2J A;  4PQP A;  3HPB A;  3HPC X;  2RED A;  1XTE A;  1GD5 A;  1O7K A;  3LUI A;  2YPS A;  1KQ6 A;  2CZO A;  2V14 A;  3P0C A;  4BGJ A;  4HAS A;  2DYB A;  4PZG A;  4P2I A;  2WWE A;  2RAI A;  4IKB B;  4AKV A;  3FOG A;  3DYT A;  2ETT A;  2CSK A;  2IWL X;  4PQO A;  1OCU A;  4AZ9 A;  2L73 A;  3IQ2 A;  2RAJ A;  4ON3 A;  1OCS A; 
#chains in the Genus database with same CATH topology
 1XTN A;  1KMD A;  2RAK A;  4IKB A;  2AR5 A;  2V6V A;  4IKD A;  1H6H A;  2REA A;  2I4K A;  4OXW A;  4P2J A;  4PQP A;  3HPB A;  3HPC X;  2RED A;  1XTE A;  1GD5 A;  1O7K A;  3LUI A;  2YPS A;  1KQ6 A;  2CZO A;  2V14 A;  3P0C A;  4BGJ A;  4HAS A;  2DYB A;  4PZG A;  4P2I A;  2WWE A;  2RAI A;  4IKB B;  4AKV A;  3FOG A;  3DYT A;  2ETT A;  2CSK A;  2IWL X;  4PQO A;  1OCU A;  4AZ9 A;  2L73 A;  3IQ2 A;  2RAJ A;  4ON3 A;  1OCS A; 
#chains in the Genus database with same CATH homology
 1XTN A;  1KMD A;  2RAK A;  4IKB A;  2AR5 A;  2V6V A;  4IKD A;  1H6H A;  2REA A;  2I4K A;  4OXW A;  4P2J A;  4PQP A;  3HPB A;  3HPC X;  2RED A;  1XTE A;  1GD5 A;  1O7K A;  3LUI A;  2YPS A;  1KQ6 A;  2CZO A;  2V14 A;  3P0C A;  4BGJ A;  4HAS A;  2DYB A;  4PZG A;  4P2I A;  2WWE A;  2RAI A;  4IKB B;  4AKV A;  3FOG A;  3DYT A;  2ETT A;  2CSK A;  2IWL X;  4PQO A;  1OCU A;  4AZ9 A;  2L73 A;  3IQ2 A;  2RAJ A;  4ON3 A;  1OCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...