4AZJA

Structural basis of l-phosphoserine binding to bacillus alcalophilus phosphoserine aminotransferase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
360
structure length
360
Chain Sequence
b'VKQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLNTKVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSLMNVTFNLRNEELNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKENA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOSERINE AMINOTRANSFERASE
publication title Structural Basis of L-Phosphoserine Binding to Bacillus Alcalophilus Phosphoserine Aminotransferase
pubmed doi rcsb
source organism Bacillus alcalophilus
molecule tags Transferase
total genus 128
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 2.6.1.52: Phosphoserine transaminase.
pdb deposition date 2012-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4azjA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4azjA02
4Q76A 2QB2A 3FSLA 1GC2A 2PB0A 5M4BA 2BI9A 1ASEA 1AY5A 1SPAA 2D65A 3TCMA 1CS1A 4F5KA 4RIZA 1OHVA 1YAAA 1M6SA 3RUYA 2Z20A 4KYOA 2Z1YA 2Z9XA 1GEWA 1ARGA 3B1DA 4R5ZA 4CBRA 2BIAA 3JTXA 4JE5D 4UOYA 3TQXA 4IXOA 3ZRQA 2FQ6A 1SZSA 1D7VA 2OQXA 3ASBA 2BIEA 2DGLA 3AENB 2Z9UA 3NNKA 4F5IA 3H7FA 1N2TA 3KKIA 4LNJA 4JEXA 3MKJA 2Z9VA 5HDMA 1O62A 1AKBA 1DGEA 3DYDA 4P7YA 1AJRA 2ZYJA 4XJMA 3PD6A 4RJ0A 1VJOA 3QBOA 1AIAA 2YKUA 3FZ7A 3QHXA 4XJPA 1J32A 2R2NA 2C7TA 3MEBA 1FG3A 4O6ZA 1V72A 4ZM4A 1TASA 4WYAA 4DGTA 1ZOBA 2AY3A 2ZP7A 3QI6A 5EAVA 3RCHA 1AMAA 3GETA 4EU1A 2JJGA 3AELA 2D63A 1AY4A 4A0GA 2OKJA 3NYSA 4BA5A 3R4TA 2E7IA 3DC1A 3BCAA 1E5FA 4WD2A 1QGNA 1BJOA 2VIBA 1AAWA 3FKDA 3GR9A 4JEYA 4MGRA 2W7GA 3EIAA 3KE3A 3AV7A 5M49A 2W8VA 3OKSA 3RBFA 4K2BA 5JAYA 3WCOA 1LC5A 1TOKA 2X3LA 5EFSA 1C4KA 3DXVA 1E5EA 1CQ6A 4RAEA 5M4DA 4GEBA 1YJZA 1C7GA 4JEZA 4F5HA 3F9TA 1LKCA 3GZCA 4LW4A 3NU7A 4TN4A 3EZSA 4AOAA 1ECXA 2EGYA 1TOJA 2CSTA 2F8JA 4N0BA 2DKJA 2D7ZA 3WX9A 1BW0A 3UAKA 2PB2A 1AJSB 3PGYA 3FDDA 2AY5A 5DJ9A 5G4IA 2VMQA 2CJHA 2W7JA 2EZ2A 1JS3A 1S06A 3B46A 1MDXA 3P1TA 1TARA 1W7NA 3GZDA 1S08A 1SFFA 2E7UA 1O61A 1RV3A 2AEUA 2VGVA 1N8PA 1WYVA 2PO3A 4CBSA 1WKHA 1ASNA 3ECDA 2HP1A 2RFVA 3FVSA 3N0LA 2VMPA 4U2HA 3HL2A 1RVUA 3A2BA 3DU4A 9AATA 1KMKA 4IX8A 5DX5A 1SZUA 2HUIA 1TOEA 2X5FA 3AEMA 2AY1A 4P3MA 3DR7A 1PMOA 4WYEA 1Y4IA 1X2AA 2CH1A 2EO5A 1MAQA 3OP7A 4UHMA 1Z7DA 3DODA 4ITGA 4OYTA 1SVVA 1X0MA 4RKDA 4Y0HA 1IJIA 1JG8A 1IUGA 3DZZA 3NRAA 3QPGA 4GDYA 4OCAA 3GJUA 5EQCA 3MC6A 2W7FA 2HUFA 4KAMA 1CL1A 3PAAA 2BHXA 3FFRA 4MY5A 2R5CB 4RJYA 2O7CA 1AMRA 3BS8A 3NUIA 1WYUB 4M2KA 4WXBA 1XEYA 2JGTA 3WKSA 3ACZA 4ZWVA 2CINA 1C7OA 1DJ9A 3FQAA 1CZEA 2AY8A 1KKPA 1W7MA 3PDBA 3L8AA 1CJ0A 4E3RA 4WYCA 3CQ4A 1M4NA 1ORDA 2W8JA 1MDOA 3GWPA 1H1CA 3W1HA 2VI8A 2XBNA 1KKJA 2VGWA 3HQTA 1IX7A 5EIGA 3LG0A 2YCPA 2X8UA 3BCXA 3ZZJA 2TPLA 4BQ0A 1LC8A 1I29A 3I4JA 2JJHA 2CJDA 4K2IA 2R0TA 3ASAA 3NDNA 1WYTB 1GCKA 4CXRA 4HVKA 2QLRA 1G7XA 4GE7A 3A9YA 2BI1A 3KGWA 5D5SA 1I43A 1M0OA 1S07A 2BIGA 1ARTA 4PIWA 3BWNC 3LV2A 1JF9A 4M2MA 3B1EA 1I48A 1AAMA 5DB5A 5E3KA 2YKXA 2W7IA 3N75A 3UWCA 4IYOB 4U1TA 4UHOA 1GC3A 4N0WA 2W7KA 5AX8A 7AATA 4OC9A 3W1IA 2FYFA 1ASGA 2ZY3A 4Q31A 2D66A 3Q8NA 4XEWA 3RBLA 1BQAA 1G4VA 2BI3A 2VMTA 3IHJA 3QM2A 3K7YA 5EUEA 3RQ1A 1P3WA 2YCTA 1BKGA 3AENA 4R5FA 3FQ8A 2HUUA 1AX4A 1WSTA 1ARIA 1TOIA 4W1VA 1EQBA 3TFUA 3ZRRA 1BT4A 2FNUA 2ZY2A 3JZLA 1LC7A 2CH2A 4XJOA 4ITXA 1AKAA 4H51A 3P6KA 1B9IA 3FVUA 4ATQA 3MAFB 1AHFA 1AMQA 3LWSA 1IAYA 2W7MA 3FDBA 1H0CA 1D2FA 2E7JA 3H14A 1D7UA 2QB3A 2YHKA 5EUNA 1C7NA 1KL2A 1YJYA 2G6WA 1DFOA 2VMZA 3CBFA 3F6TA 4K2MA 5G09A 3TFTA 2Z1ZA 2E54A 2YKVA 5IWQA 1M7YA 3AEPA 4F5GA 1KL1A 3JWBA 2GMUA 5HHYA 3AOWA 5DJ1A 3CQ6A 4IY7A 1CL2A 4R8DA 3EI9A 3USFA 1TATA 3HVYA 1BJWA 1OHWA 4Y0IA 4BA4A 3L44A 3E6GA 1PG8A 4WB0A 3WZFA 3TATA 2OKKA 3II0A 2HOYA 4RLGA 2YRRA 2BI5A 5FT8A 2OGAA 8AATA 4ADCA 1B4XA 1M32A 1JS6A 1MAPA 4HF8A 4I8AA 4XAUA 3A8UX 3VK4A 4IXSA 2VGSA 3RI6A 4WXFA 2Z9WA 2VMWA 4AH3A 3A9XA 1WYVB 4E1OA 4W1XA 4OTLA 3BB8A 1TPLA 4KXKA 2GQNA 3AEJC 2QBTA 4FL0A 1ASDA 2V0YA 1IAXA 3JW9A 1ASBA 4ZDOA 5G0AA 3B1CA 1CZCA 2VGTA 1ASLA 2VMRA 3K40A 1GEYA 4OBVA 3G7QA 1ASMA 3FCRA 3HDOA 3VAXA 3BWOA 2DKBA 1V2EA 5G2PA 1DGDA 2ZSMA 3WGCA 2ZY4A 1SZKA 4FFCA 4LNMA 2VLHA 4IXZA 2Z61A 1LK9A 4W91A 4J5UA 2CB1A 4AZJA 4ISYA 3EZ1A 3FQ7A 1DJEA 4A6TA 4WYDA 3E2ZB 4GE4A 1QITA 1YNUA 2QA3A 2W8UA 4ZLVA 4E3QA 2NMPA 4LNLA 3ELPA 2OGEA 3FRKA 2ZSLA 3E77A 4ZWMA 4F5JA 3NYUA 4UQVA 4RKCA 2D64A 4JE5A 1UU1A 4L0OA 4GSAA 1GC4A 4DBCA 2EH6A 4MQQA 4MKJA 2W8TA 1QIRA 4Q75A 1VEFA 1IBJA 4MQRA 1YIZA 1ELUA 1AICA 1TOGA 4A0RA 1IX8A 1VP4A 1W3UA 4A6UA 1FC4A 1ZC9A 1O4SA 3NTJA 4ZDPA 2R5EA 5FT5A 3PJ0A 2GB3A 2YOBA 4CVQA 2VMSA 3CQ5A 3GBXA 1IVRA 2R5CA 4WYFA 1B5OA 5F8VA 3FVXA 2ZC0A 2WK8A 2ZJGA 4PFNA 4XQ2A 3B8XA 1WYUA 2VGZA 2VIAA 3DXWA 4JEVA 4ZM3A 4WLJA 4F5MA 3ZZKA 3IF2A 1YJSA 4J8LA 3EIBA 2JJFA 1N31A 2AEVA 1AHGA 2VMVA 2O1BA 2W7DA 4ATPA 1S0AA 1YOOA 3EI6A 2CY8A 3MADA 3N5MA 3COGA 3PDXA 4OMAA 2HOZA 4DQ6A 2VMNA 1ARHA 5F9SA 5C6UA 2EZ1A 3BC8A 1BS0A 3VP6A 5TF5A 2WK9A 1BQDA 4PVFA 2AATA 2D5YA 1ASCA 4F4EA 1C9CA 1WYTA 1Z3ZA 1W23A 1IX6A 1X29A 3LVJA 1J04A 4M2JA 2BI2A 2AY7A 3WCNA 4W5KA 4JEWA 1B9HA 4ZDLA 4WLHA 3PD6B 3G0TA 1PMMA 3W1JA 1AHYA 3VK3A 4LC3A 3AEOA 1PFFA 4W8IA 1AMSA 2BWPA 1UU0A 2C44A 2ORDA 3G8MA 3HMUA 3K28A 4A72A 1EJIA 1LS3A 1AHEA 1AKCA 1CQ8A 2AY4A 3HLMA 1WKGA 3ZRPA 1ASAA 2FN6A 3E2FA 4IYOA 1YIYA 1DTYA 2CJGA 2YRIA 2GSAA 5D95A 3RCHB 1QJ3A 1KMJA 3DR4A 1X28A 2BYJA 4ZSWA 3WKRA 4XK1A 5EUDA 4MKKA 1UU2A 2V1PA 4IW7A 1M0PA 4MQPA 4EMYA 2D61A 2VMYA 2WKAA 1RVYA 1BJOB 3LVKA 1UKJA 1G4XA 1GDEA 1XI9A 4TV7A 2JISA 2EPJA 4ZSYA 5J8QA 1G7WA 3I5TA 4WYGA 3WY7A 1QJ5A 1MDZA 2AY9A 2HZPA 3NUBA 2QMAA 3VOMA 3EI8A 3JWAA 4LW2A 3KGXA 3FTBA 4AZKA 2W8WA 5I92A 1D7RA 1GBNA 1AY8A 3BN1A 3JU7A 3MAFA 5HXXA 4A6RA 1AIBA 1LW5A 1O69A 1M0NA 1AHXA 1W7LA 2VMUA 4F5FA 2CTZA 2VMOA 1OATA 1OXPA 4WB0B 4E77A 4WBTA 1MGVA 2C81A 3I16A 3NYTA 4Y0DA 4EFFA 4F5LA 1QISA 3AATA 2ZY5A 2CANA 2VGUA 2FNIA 1FG7A 1OXOA 1RV4A 1GD9A 3F0HA 2AY2A 5E4ZA 5E5IA 3AEJA 3UE8A 1DJUA 2VLFA 4EB5A 3LVLB 1OHYA 3PIUA 2DR1A 2AY6A 4UHNA 4QGRA 3EUCA 2O0RA 2JG2A 3FFHA 4WP0A 3FD0A 5EAAA 1MLZA 2Q7WA 1AJSA 2X5DA 1V2DA 3EI7A 1U08A 3D6KA 3EI5A 3M5UA 1CQ7A 4ZASA 1SF2A 2W7LA 5K8BA 3ISLA 1B8GA 3GZDC 4RITA 3BCBA 2DGKA 4A0FA 4A0HA 2ZUKA 4ADBA 4B98A 4CXQA 4W1WA 1ZODA 3R9AA 5FT6A 2XH1A 3DRDA 3HT4A 5M46A 5BJ3A 2FM1A 4GRXA 3AOVA 3FZ6A 2W7EA 4GE9A 3VK2A 4BMKA 2C0RA 2BWOA 3AEMC 2VI9A 2YKYA 3PPLA 3QN6A 1T3IA 3LVMA 1ARSA 1M0QA 3ELEA 3E9KA 2BYLA 2HP2A 4JF1A 4BHDA 2WK7A 2BWNA 5BJ4A 1C0NA 3E2YA 1EG5A 2VMXA 3A9ZA 3ATHA 1QZ9A 1S09A 4AO4A 3QGUA 4NOGA 4Q6RA 1BJ4A 4MSOA 3WGBA 2Z67A 4ADEA 5LHAA 3NX3A 3LY1A 3PDBB 4B9BA 1BJNA 4WXGA 2JJEA 1D7SA 3E2ZA 2CFBA 2DOUA 4OBUA 2D7YA 4AO9A 4ZAHA 3BV0A 3PA9A 4XJLA 1V2FA 1ASFA 5G4JA 3MC6C 5EIGB 3T32A 5G2QA 4ADDA 4R2NA 4EB7A 1GC0A 3FZ8A 2HORA 1GEXA 2W7HA 3NU8A 5FT4A 4A00A 3GSBA 4TMRA 2DGMA 4JF0A 3MAUA 5LH9A 3MBBA 2HOXA 4RM1A 1MLYA 2YCNA 2GMSA 3WLXA 1I41A 2OATA 2BKWA 3HBXA 3CAIA 4OT8A 1DKAA 3BWNA 4PFFA 2VYCA 1LW4A 1ELQA 1B5PA
chains in the Genus database with same CATH superfamily
4Q76A 2QB2A 3FSLA 1GC2A 2PB0A 5M4BA 2BI9A 1ASEA 1AY5A 1SPAA 2D65A 3TCMA 1CS1A 4F5KA 4RIZA 1OHVA 1YAAA 1M6SA 3RUYA 2Z20A 4KYOA 2Z1YA 2Z9XA 1GEWA 1ARGA 3B1DA 4R5ZA 4CBRA 2BIAA 3JTXA 4JE5D 4UOYA 3TQXA 4IXOA 3ZRQA 2FQ6A 1SZSA 1D7VA 2OQXA 3ASBA 2BIEA 2DGLA 3AENB 2Z9UA 3NNKA 4F5IA 3H7FA 1N2TA 3KKIA 4LNJA 4JEXA 3MKJA 2Z9VA 5HDMA 1O62A 1AKBA 1DGEA 3DYDA 4P7YA 1AJRA 2ZYJA 4XJMA 3PD6A 4RJ0A 1VJOA 3QBOA 1AIAA 2YKUA 3FZ7A 3QHXA 4XJPA 1J32A 2R2NA 2C7TA 3MEBA 1FG3A 4O6ZA 1V72A 4ZM4A 1TASA 4WYAA 4DGTA 1KAFA 1ZOBA 2AY3A 2ZP7A 3QI6A 5EAVA 3RCHA 1AMAA 3GETA 4EU1A 2JJGA 3AELA 2D63A 1AY4A 4A0GA 2OKJA 3NYSA 4BA5A 3R4TA 2E7IA 3DC1A 3BCAA 1E5FA 4WD2A 1QGNA 1BJOA 2VIBA 1AAWA 3FKDA 3GR9A 4JEYA 4MGRA 4K05A 2W7GA 3EIAA 3KE3A 3AV7A 5M49A 2W8VA 3OKSA 3RBFA 4K2BA 5JAYA 3WCOA 1LC5A 1TOKA 2X3LA 5EFSA 1C4KA 3DXVA 1E5EA 1CQ6A 4RAEA 5M4DA 4GEBA 1YJZA 1C7GA 4JEZA 4F5HA 3F9TA 1LKCA 3GZCA 3N7NA 4LW4A 3NU7A 4TN4A 3EZSA 4AOAA 1ECXA 2EGYA 1TOJA 2CSTA 2F8JA 4N0BA 2DKJA 2D7ZA 3WX9A 1BW0A 3UAKA 3N4XA 2PB2A 1AJSB 3PGYA 3FDDA 2AY5A 5DJ9A 5G4IA 2VMQA 2CJHA 2W7JA 2EZ2A 1JS3A 1S06A 3B46A 1MDXA 3P1TA 1TARA 1W7NA 3GZDA 1S08A 1SFFA 2E7UA 1O61A 1RV3A 2AEUA 2VGVA 1N8PA 1WYVA 2PO3A 4CBSA 1WKHA 1ASNA 3ECDA 2HP1A 2RFVA 3FVSA 3N0LA 2VMPA 4U2HA 3HL2A 1RVUA 3A2BA 3DU4A 9AATA 1KMKA 4IX8A 5DX5A 1SZUA 2HUIA 1TOEA 2X5FA 3AEMA 2AY1A 4P3MA 3DR7A 1PMOA 4WYEA 1Y4IA 1X2AA 2CH1A 2EO5A 1MAQA 3OP7A 4UHMA 1Z7DA 3DODA 4ITGA 4OYTA 1SVVA 1X0MA 4RKDA 3N4SA 4Y0HA 1IJIA 1JG8A 1IUGA 3DZZA 3NRAA 3QPGA 4GDYA 4OCAA 3GJUA 5EQCA 3MC6A 2W7FA 2HUFA 4KAMA 1CL1A 3PAAA 2BHXA 3FFRA 4MY5A 2R5CB 4RJYA 2O7CA 1AMRA 3BS8A 3NUIA 1WYUB 4M2KA 4WXBA 1XEYA 2JGTA 3WKSA 3ACZA 4ZWVA 2WB6A 2CINA 1C7OA 1DJ9A 3FQAA 1CZEA 2AY8A 2QSRA 1KKPA 1W7MA 3PDBA 3L8AA 1CJ0A 4E3RA 4WYCA 3CQ4A 1M4NA 1ORDA 2W8JA 1MDOA 3GWPA 1H1CA 3W1HA 2VI8A 2XBNA 1KKJA 2VGWA 3HQTA 1IX7A 5EIGA 3LG0A 2YCPA 2X8UA 3BCXA 3ZZJA 2TPLA 4BQ0A 1LC8A 1I29A 3I4JA 2JJHA 2CJDA 4K2IA 3H9XA 2R0TA 3ASAA 3NDNA 1WYTB 1GCKA 4CXRA 4HVKA 2QLRA 1G7XA 4GE7A 3A9YA 2BI1A 3KGWA 5D5SA 1I43A 1M0OA 1S07A 2BIGA 1ARTA 4PIWA 3BWNC 3LV2A 1JF9A 4M2MA 3B1EA 1I48A 1AAMA 5DB5A 5E3KA 2YKXA 2W7IA 3N75A 3UWCA 4IYOB 4U1TA 4UHOA 1GC3A 4N0WA 2W7KA 5AX8A 7AATA 4OC9A 3W1IA 2FYFA 1ASGA 2ZY3A 4Q31A 2D66A 3Q8NA 4XEWA 3RBLA 1BQAA 1G4VA 2BI3A 2VMTA 3IHJA 3QM2A 3K7YA 5EUEA 3RQ1A 1P3WA 2YCTA 1BKGA 3AENA 4R5FA 3FQ8A 2HUUA 1AX4A 1WSTA 1ARIA 1TOIA 4W1VA 1EQBA 3TFUA 3ZRRA 1BT4A 2FNUA 2ZY2A 3JZLA 1LC7A 2CH2A 4XJOA 4ITXA 1AKAA 4H51A 3P6KA 1B9IA 3FVUA 4ATQA 3MAFB 2EYQA 2A1VA 1AHFA 1AMQA 3LWSA 1IAYA 2W7MA 3FDBA 1H0CA 1D2FA 2E7JA 3H14A 1D7UA 2QB3A 2YHKA 5EUNA 1C7NA 1KL2A 1YJYA 2G6WA 1DFOA 2VMZA 3CBFA 3F6TA 4K2MA 5G09A 3TFTA 2Z1ZA 2E54A 2YKVA 5IWQA 1M7YA 3AEPA 4F5GA 1KL1A 3JWBA 2GMUA 5HHYA 3AOWA 5DJ1A 3CQ6A 4IY7A 1CL2A 4R8DA 3EI9A 3USFA 1TATA 3HVYA 1BJWA 1OHWA 4Y0IA 4BA4A 3L44A 3E6GA 1PG8A 4WB0A 3WZFA 3TATA 2OKKA 3II0A 2HOYA 4RLGA 2YRRA 2BI5A 5FT8A 2OGAA 8AATA 4ADCA 1B4XA 1M32A 1JS6A 1MAPA 4HF8A 4I8AA 4XAUA 3N4RA 3A8UX 3VK4A 4IXSA 2VGSA 3RI6A 4WXFA 2Z9WA 2VMWA 4AH3A 3A9XA 1WYVB 4E1OA 4W1XA 4OTLA 3BB8A 1TPLA 4KXKA 2GQNA 3AEJC 2QBTA 4FL0A 1ASDA 2V0YA 1IAXA 3JW9A 1ASBA 4ZDOA 5G0AA 3B1CA 1CZCA 2VGTA 1ASLA 2VMRA 3K40A 1GEYA 4OBVA 3G7QA 1ASMA 3FCRA 3HDOA 3VAXA 3BWOA 2DKBA 1V2EA 5G2PA 1DGDA 2ZSMA 3WGCA 2ZY4A 1SZKA 4FFCA 4LNMA 2VLHA 4IXZA 2Z61A 1LK9A 4W91A 4J5UA 2CB1A 4AZJA 4ISYA 3EZ1A 3FQ7A 1DJEA 4A6TA 4WYDA 3E2ZB 4GE4A 1QITA 1YNUA 2QA3A 2W8UA 4ZLVA 4E3QA 2NMPA 4LNLA 3ELPA 2OGEA 3FRKA 2ZSLA 3E77A 4ZWMA 4F5JA 3NYUA 4UQVA 4RKCA 2D64A 4JE5A 1UU1A 4L0OA 4GSAA 1GC4A 4DBCA 2EH6A 4MQQA 4MKJA 2W8TA 1QIRA 4Q75A 1VEFA 1IBJA 4MQRA 1YIZA 1ELUA 1AICA 1TOGA 4A0RA 1IX8A 1VP4A 1W3UA 4A6UA 1FC4A 1ZC9A 1O4SA 3NTJA 4ZDPA 2R5EA 5FT5A 3PJ0A 2GB3A 2YOBA 4CVQA 2VMSA 3CQ5A 3GBXA 1IVRA 2R5CA 4WYFA 1B5OA 5F8VA 2G7JA 3FVXA 2ZC0A 2WK8A 2ZJGA 4PFNA 4XQ2A 3B8XA 1WYUA 2VGZA 2VIAA 3DXWA 4JEVA 4ZM3A 4WLJA 4F5MA 3ZZKA 3IF2A 1YJSA 4J8LA 3EIBA 2JJFA 1N31A 4H63Q 2AEVA 1AHGA 2VMVA 2O1BA 2W7DA 4ATPA 1S0AA 1YOOA 3EI6A 2CY8A 3MADA 3N5MA 3COGA 3PDXA 4OMAA 2HOZA 4DQ6A 2VMNA 1ARHA 5F9SA 2FKIA 5C6UA 2EZ1A 3BC8A 1BS0A 3VP6A 5TF5A 2WK9A 1BQDA 4PVFA 2AATA 2D5YA 1ASCA 4F4EA 1C9CA 1WYTA 1Z3ZA 1W23A 5KTBA 1IX6A 1X29A 3LVJA 1J04A 4M2JA 2BI2A 2AY7A 3WCNA 4W5KA 4JEWA 1B9HA 4ZDLA 4WLHA 3PD6B 3G0TA 1PMMA 3W1JA 1AHYA 3VK3A 4LC3A 3AEOA 1PFFA 4W8IA 1AMSA 2BWPA 1UU0A 2C44A 2ORDA 3G8MA 3HMUA 3K28A 4A72A 1EJIA 1LS3A 1AHEA 1AKCA 1CQ8A 2AY4A 3HLMA 1WKGA 3ZRPA 1ASAA 2FN6A 3E2FA 4IYOA 1YIYA 1DTYA 2CJGA 2YRIA 2GSAA 5D95A 3RCHB 1QJ3A 1KMJA 3DR4A 1X28A 2BYJA 4ZSWA 3WKRA 4XK1A 5EUDA 4MKKA 1UU2A 2V1PA 4IW7A 1M0PA 4MQPA 4EMYA 2D61A 2VMYA 2WKAA 1RVYA 1BJOB 3LVKA 1UKJA 1G4XA 1GDEA 1XI9A 2KFPA 4TV7A 2JISA 2EPJA 4ZSYA 5J8QA 1G7WA 3I5TA 4WYGA 3WY7A 1QJ5A 1MDZA 2AY9A 2HZPA 3NUBA 2QMAA 3VOMA 3EI8A 3JWAA 4LW2A 3KGXA 3FTBA 4AZKA 2W8WA 5I92A 1D7RA 1GBNA 1AY8A 3BN1A 3JU7A 3MAFA 5HXXA 4A6RA 1AIBA 1LW5A 1O69A 1M0NA 1AHXA 1W7LA 2VMUA 4F5FA 2CTZA 2VMOA 1OATA 1OXPA 4WB0B 4E77A 4WBTA 1MGVA 2C81A 3I16A 3NYTA 4Y0DA 4EFFA 4F5LA 1QISA 3AATA 2ZY5A 2CANA 2VGUA 2FNIA 1FG7A 1OXOA 1RV4A 1GD9A 3F0HA 2AY2A 5E4ZA 5E5IA 3AEJA 3UE8A 1DJUA 2VLFA 4EB5A 3LVLB 1OHYA 3PIUA 2DR1A 2AY6A 4UHNA 4QGRA 3EUCA 2O0RA 2JG2A 3FFHA 4WP0A 3FD0A 5EAAA 1MLZA 2Q7WA 1AJSA 2X5DA 1V2DA 3EI7A 1U08A 3D6KA 3EI5A 3M5UA 1CQ7A 4ZASA 1SF2A 2W7LA 5K8BA 3ISLA 1B8GA 3GZDC 4RITA 3BCBA 2DGKA 4A0FA 4A0HA 2ZUKA 4ADBA 4B98A 4CXQA 4W1WA 1ZODA 3R9AA 5FT6A 2XH1A 3DRDA 3HT4A 5M46A 5BJ3A 2FM1A 4GRXA 3AOVA 3FZ6A 2W7EA 4GE9A 3VK2A 4BMKA 2C0RA 2BWOA 3AEMC 2VI9A 2YKYA 3PPLA 3QN6A 1T3IA 3LVMA 1ARSA 1M0QA 3ELEA 3E9KA 2BYLA 2HP2A 4JF1A 4BHDA 2WK7A 2BWNA 5BJ4A 1C0NA 3E2YA 1EG5A 2VMXA 3A9ZA 3ATHA 1QZ9A 1S09A 4AO4A 3QGUA 4NOGA 4Q6RA 1BJ4A 4MSOA 3WGBA 2Z67A 4ADEA 5LHAA 3NX3A 3LY1A 3PDBB 4B9BA 1BJNA 4WXGA 2JJEA 1D7SA 3E2ZA 2CFBA 2DOUA 4OBUA 2D7YA 4AO9A 4ZAHA 3BV0A 3PA9A 4XJLA 1V2FA 1ASFA 5G4JA 3MC6C 5EIGB 3T32A 5G2QA 4ADDA 4R2NA 4EB7A 1GC0A 3FZ8A 2HORA 1GEXA 2W7HA 3NU8A 5FT4A 4A00A 3GSBA 4TMRA 2DGMA 4JF0A 3MAUA 5LH9A 3MBBA 2HOXA 4RM1A 1MLYA 2YCNA 2GMSA 3WLXA 1I41A 2OATA 2BKWA 3HBXA 3CAIA 4OT8A 1DKAA 3BWNA 4PFFA 2VYCA 1LW4A 1ELQA 1B5PA
chains in the Genus database with same CATH topology
4Q76A 2QB2A 3FSLA 1GC2A 2PB0A 5M4BA 2BI9A 1ASEA 1AY5A 1SPAA 2D65A 3TCMA 1CS1A 4F5KA 4RIZA 1OHVA 1YAAA 1M6SA 3RUYA 2Z20A 4KYOA 2Z1YA 2Z9XA 1GEWA 1ARGA 3B1DA 4R5ZA 4CBRA 2BIAA 3JTXA 4JE5D 4UOYA 3TQXA 4IXOA 3ZRQA 2FQ6A 1SZSA 1D7VA 2OQXA 3ASBA 2BIEA 2DGLA 3AENB 2Z9UA 3NNKA 4F5IA 3H7FA 1N2TA 3KKIA 4LNJA 4JEXA 3MKJA 2Z9VA 5HDMA 1O62A 1AKBA 1DGEA 3DYDA 4P7YA 1AJRA 2ZYJA 4XJMA 3PD6A 4RJ0A 1VJOA 3QBOA 1AIAA 2YKUA 3FZ7A 3QHXA 4XJPA 1J32A 2R2NA 2C7TA 3MEBA 1FG3A 4O6ZA 1V72A 4ZM4A 1TASA 4WYAA 4DGTA 1ZOBA 2AY3A 2ZP7A 3QI6A 5EAVA 3RCHA 1AMAA 3GETA 4EU1A 2JJGA 3AELA 2D63A 1AY4A 4A0GA 2OKJA 3NYSA 4BA5A 3R4TA 2E7IA 3DC1A 3BCAA 1E5FA 4WD2A 1QGNA 1BJOA 2VIBA 1AAWA 3FKDA 3GR9A 4JEYA 4MGRA 4K05A 2W7GA 3EIAA 3KE3A 3AV7A 5M49A 2W8VA 3OKSA 3RBFA 4K2BA 5JAYA 3WCOA 1LC5A 1TOKA 2X3LA 5EFSA 1C4KA 3DXVA 1E5EA 1CQ6A 4RAEA 5M4DA 4GEBA 1YJZA 1C7GA 4JEZA 4F5HA 3F9TA 1LKCA 3GZCA 3N7NA 4LW4A 3NU7A 4TN4A 3EZSA 4AOAA 1ECXA 2EGYA 1TOJA 2CSTA 2F8JA 4N0BA 2DKJA 2D7ZA 3WX9A 1BW0A 3UAKA 3N4XA 2PB2A 1AJSB 3PGYA 3FDDA 2AY5A 5DJ9A 5G4IA 2VMQA 2CJHA 2W7JA 2EZ2A 1JS3A 1S06A 3B46A 1MDXA 3P1TA 1TARA 1W7NA 3GZDA 1S08A 1SFFA 2E7UA 1O61A 1RV3A 2AEUA 2VGVA 1N8PA 1WYVA 2PO3A 4CBSA 1WKHA 1ASNA 3ECDA 2HP1A 2RFVA 3FVSA 3N0LA 2VMPA 4U2HA 3HL2A 1RVUA 3A2BA 3DU4A 9AATA 1KMKA 4IX8A 5DX5A 1SZUA 2HUIA 1TOEA 2X5FA 3AEMA 2AY1A 4P3MA 3DR7A 1PMOA 4WYEA 1Y4IA 1X2AA 2CH1A 2EO5A 1MAQA 3OP7A 4UHMA 1Z7DA 3DODA 4ITGA 4OYTA 1SVVA 1X0MA 4RKDA 3N4SA 4Y0HA 1IJIA 1JG8A 1IUGA 3DZZA 3NRAA 3QPGA 4GDYA 4OCAA 3GJUA 5EQCA 3MC6A 2W7FA 2HUFA 4KAMA 1CL1A 3PAAA 2BHXA 3FFRA 4MY5A 2R5CB 4RJYA 2O7CA 1AMRA 3BS8A 3NUIA 1WYUB 4M2KA 4WXBA 1XEYA 2JGTA 3WKSA 3ACZA 4ZWVA 2WB6A 2CINA 1C7OA 1DJ9A 3FQAA 1CZEA 2AY8A 2QSRA 1KKPA 1W7MA 3PDBA 3L8AA 1CJ0A 4E3RA 4WYCA 3CQ4A 1M4NA 1ORDA 2W8JA 1MDOA 3GWPA 1H1CA 3W1HA 2VI8A 2XBNA 1KKJA 2VGWA 3HQTA 1IX7A 5EIGA 3LG0A 2YCPA 2X8UA 3BCXA 3ZZJA 2TPLA 4BQ0A 1LC8A 1I29A 3I4JA 2JJHA 2CJDA 4K2IA 3H9XA 2R0TA 3ASAA 3NDNA 1WYTB 1GCKA 4CXRA 4HVKA 2QLRA 1G7XA 4GE7A 3A9YA 2BI1A 3KGWA 5D5SA 1I43A 1M0OA 1S07A 2BIGA 1ARTA 4PIWA 3BWNC 3LV2A 1JF9A 4M2MA 3B1EA 1I48A 1AAMA 5DB5A 5E3KA 2YKXA 2W7IA 3N75A 3UWCA 4IYOB 4U1TA 4UHOA 1GC3A 4N0WA 2W7KA 5AX8A 7AATA 4OC9A 3W1IA 2FYFA 1ASGA 2ZY3A 4Q31A 2D66A 3Q8NA 4XEWA 3RBLA 1BQAA 1G4VA 2BI3A 2VMTA 3IHJA 3QM2A 3K7YA 5EUEA 3RQ1A 1P3WA 2YCTA 1BKGA 3AENA 4R5FA 3FQ8A 2HUUA 1AX4A 1WSTA 1ARIA 1TOIA 4W1VA 1EQBA 3TFUA 3ZRRA 1BT4A 2FNUA 2ZY2A 3JZLA 1LC7A 2CH2A 4XJOA 4ITXA 1AKAA 4H51A 3P6KA 1B9IA 3FVUA 4ATQA 3MAFB 2EYQA 2A1VA 1AHFA 1AMQA 3LWSA 1IAYA 2W7MA 3FDBA 1H0CA 1D2FA 2E7JA 3H14A 1D7UA 2QB3A 2YHKA 5EUNA 1C7NA 1KL2A 1YJYA 2G6WA 1DFOA 2VMZA 3CBFA 3F6TA 4K2MA 5G09A 3TFTA 2Z1ZA 2E54A 2YKVA 5IWQA 1M7YA 3AEPA 4F5GA 1KL1A 3JWBA 2GMUA 5HHYA 3AOWA 5DJ1A 3CQ6A 4IY7A 1CL2A 4R8DA 3EI9A 3USFA 1TATA 3HVYA 1BJWA 1OHWA 4Y0IA 4BA4A 3L44A 3E6GA 1PG8A 4WB0A 3WZFA 3TATA 2OKKA 3II0A 2HOYA 4RLGA 2YRRA 2BI5A 5FT8A 2OGAA 8AATA 4ADCA 1B4XA 1M32A 1JS6A 1MAPA 4HF8A 4I8AA 4XAUA 3N4RA 3A8UX 3VK4A 4IXSA 2VGSA 3RI6A 4WXFA 2Z9WA 2VMWA 4AH3A 3A9XA 1WYVB 4E1OA 4W1XA 4OTLA 3BB8A 1TPLA 4KXKA 2GQNA 3AEJC 2QBTA 4FL0A 1ASDA 2V0YA 1IAXA 3JW9A 1ASBA 4ZDOA 5G0AA 3B1CA 1CZCA 2VGTA 1ASLA 2VMRA 3K40A 1GEYA 4OBVA 3G7QA 1ASMA 3FCRA 3HDOA 3VAXA 3BWOA 2DKBA 1V2EA 5G2PA 1DGDA 2ZSMA 3WGCA 2ZY4A 1SZKA 4FFCA 4LNMA 2VLHA 4IXZA 2Z61A 1LK9A 4W91A 4J5UA 2CB1A 4AZJA 4ISYA 3EZ1A 3FQ7A 1DJEA 4A6TA 4WYDA 3E2ZB 4GE4A 1QITA 1YNUA 2QA3A 2W8UA 4ZLVA 4E3QA 2NMPA 4LNLA 3ELPA 2OGEA 3FRKA 2ZSLA 3E77A 4ZWMA 4F5JA 3NYUA 4UQVA 4RKCA 2D64A 4JE5A 1UU1A 4L0OA 4GSAA 1GC4A 4DBCA 2EH6A 4MQQA 4MKJA 2W8TA 1QIRA 4Q75A 1VEFA 1IBJA 4MQRA 1YIZA 1ELUA 1AICA 1TOGA 4A0RA 1IX8A 1VP4A 1W3UA 4A6UA 1FC4A 1ZC9A 1O4SA 3NTJA 4ZDPA 2R5EA 5FT5A 3PJ0A 2GB3A 2YOBA 4CVQA 2VMSA 3CQ5A 3GBXA 1IVRA 2R5CA 4WYFA 1B5OA 5F8VA 2G7JA 3FVXA 2ZC0A 2WK8A 2ZJGA 4PFNA 4XQ2A 3B8XA 1WYUA 2VGZA 2VIAA 3DXWA 4JEVA 4ZM3A 4WLJA 4F5MA 3ZZKA 3IF2A 1YJSA 4J8LA 3EIBA 2JJFA 1N31A 4H63Q 2AEVA 1AHGA 2VMVA 2O1BA 2W7DA 4ATPA 1S0AA 1YOOA 3EI6A 2CY8A 3MADA 3N5MA 3COGA 3PDXA 4OMAA 2HOZA 4DQ6A 2VMNA 1ARHA 5F9SA 2FKIA 5C6UA 2EZ1A 3BC8A 1BS0A 3VP6A 5TF5A 2WK9A 1BQDA 4PVFA 2AATA 2D5YA 1ASCA 4F4EA 1C9CA 1WYTA 1Z3ZA 1W23A 5KTBA 1IX6A 1X29A 3LVJA 1J04A 4M2JA 2BI2A 2AY7A 3WCNA 4W5KA 4JEWA 1B9HA 4ZDLA 4WLHA 3PD6B 3G0TA 1PMMA 3W1JA 1AHYA 3VK3A 4LC3A 3AEOA 1PFFA 4W8IA 1AMSA 2BWPA 1UU0A 2C44A 2ORDA 3G8MA 3HMUA 3K28A 4A72A 1EJIA 1LS3A 1AHEA 1AKCA 1CQ8A 2AY4A 3HLMA 1WKGA 3ZRPA 1ASAA 2FN6A 3E2FA 4IYOA 1YIYA 1DTYA 2CJGA 2YRIA 2GSAA 5D95A 3RCHB 1QJ3A 1KMJA 3DR4A 1X28A 2BYJA 4ZSWA 3WKRA 4XK1A 5EUDA 4MKKA 1UU2A 2V1PA 4IW7A 1M0PA 4MQPA 4EMYA 2D61A 2VMYA 2WKAA 1RVYA 1BJOB 3LVKA 1UKJA 1G4XA 1GDEA 1XI9A 2KFPA 4TV7A 2JISA 2EPJA 4ZSYA 5J8QA 1G7WA 3I5TA 4WYGA 3WY7A 1QJ5A 1MDZA 2AY9A 2HZPA 3NUBA 2QMAA 3VOMA 3EI8A 3JWAA 4LW2A 3KGXA 3FTBA 4AZKA 2W8WA 5I92A 1D7RA 1GBNA 1AY8A 3BN1A 3JU7A 3MAFA 5HXXA 4A6RA 1AIBA 1LW5A 1O69A 1M0NA 1AHXA 1W7LA 2VMUA 4F5FA 2CTZA 2VMOA 1OATA 1OXPA 4WB0B 4E77A 4WBTA 1MGVA 2C81A 3I16A 3NYTA 4Y0DA 4EFFA 4F5LA 1QISA 3AATA 2ZY5A 2CANA 2VGUA 2FNIA 1FG7A 1OXOA 1RV4A 1GD9A 3F0HA 2AY2A 5E4ZA 5E5IA 3AEJA 3UE8A 1DJUA 2VLFA 4EB5A 3LVLB 1OHYA 3PIUA 2DR1A 2AY6A 4UHNA 4QGRA 3EUCA 2O0RA 2JG2A 3FFHA 4WP0A 3FD0A 5EAAA 1MLZA 2Q7WA 1AJSA 2X5DA 1V2DA 3EI7A 1U08A 3D6KA 3EI5A 3M5UA 1CQ7A 4ZASA 1SF2A 2W7LA 5K8BA 3ISLA 1B8GA 3GZDC 4RITA 3BCBA 2DGKA 4A0FA 4A0HA 2ZUKA 4ADBA 4B98A 4CXQA 4W1WA 1ZODA 3R9AA 5FT6A 2XH1A 3DRDA 3HT4A 5M46A 5BJ3A 2FM1A 4GRXA 3AOVA 3FZ6A 2W7EA 4GE9A 3VK2A 4BMKA 2C0RA 2BWOA 3AEMC 2VI9A 2YKYA 3PPLA 3QN6A 1T3IA 3LVMA 1ARSA 1M0QA 3ELEA 3E9KA 2BYLA 2HP2A 4JF1A 4BHDA 2WK7A 2BWNA 5BJ4A 1C0NA 3E2YA 1EG5A 2VMXA 3A9ZA 3ATHA 1QZ9A 1S09A 4AO4A 3QGUA 4NOGA 4Q6RA 1BJ4A 4MSOA 3WGBA 2Z67A 4ADEA 5LHAA 3NX3A 3LY1A 3PDBB 4B9BA 1BJNA 4WXGA 2JJEA 1D7SA 3E2ZA 2CFBA 2DOUA 4OBUA 2D7YA 4AO9A 4ZAHA 3BV0A 3PA9A 4XJLA 1V2FA 1ASFA 5G4JA 3MC6C 5EIGB 3T32A 5G2QA 4ADDA 4R2NA 4EB7A 1GC0A 3FZ8A 2HORA 1GEXA 2W7HA 3NU8A 5FT4A 4A00A 3GSBA 4TMRA 2DGMA 4JF0A 3MAUA 5LH9A 3MBBA 2HOXA 4RM1A 1MLYA 2YCNA 2GMSA 3WLXA 1I41A 2OATA 2BKWA 3HBXA 3CAIA 4OT8A 1DKAA 3BWNA 4PFFA 2VYCA 1LW4A 1ELQA 1B5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q76 A;  2QB2 A;  3FSL A;  1GC2 A;  2PB0 A;  5M4B A;  2BI9 A;  1ASE A;  1AY5 A;  1SPA A;  2D65 A;  3TCM A;  1CS1 A;  4F5K A;  4RIZ A;  1OHV A;  1YAA A;  1M6S A;  3RUY A;  2Z20 A;  4KYO A;  2Z1Y A;  2Z9X A;  1GEW A;  1ARG A;  3B1D A;  4R5Z A;  4CBR A;  2BIA A;  3JTX A;  4JE5 D;  4UOY A;  3TQX A;  4IXO A;  3ZRQ A;  2FQ6 A;  1SZS A;  1D7V A;  2OQX A;  3ASB A;  2BIE A;  2DGL A;  3AEN B;  2Z9U A;  3NNK A;  4F5I A;  3H7F A;  1N2T A;  3KKI A;  4LNJ A;  4JEX A;  3MKJ A;  2Z9V A;  5HDM A;  1O62 A;  1AKB A;  1DGE A;  3DYD A;  4P7Y A;  1AJR A;  2ZYJ A;  4XJM A;  3PD6 A;  4RJ0 A;  1VJO A;  3QBO A;  1AIA A;  2YKU A;  3FZ7 A;  3QHX A;  4XJP A;  1J32 A;  2R2N A;  2C7T A;  3MEB A;  1FG3 A;  4O6Z A;  1V72 A;  4ZM4 A;  1TAS A;  4WYA A;  4DGT A;  1ZOB A;  2AY3 A;  2ZP7 A;  3QI6 A;  5EAV A;  3RCH A;  1AMA A;  3GET A;  4EU1 A;  2JJG A;  3AEL A;  2D63 A;  1AY4 A;  4A0G A;  2OKJ A;  3NYS A;  4BA5 A;  3R4T A;  2E7I A;  3DC1 A;  3BCA A;  1E5F A;  4WD2 A;  1QGN A;  1BJO A;  2VIB A;  1AAW A;  3FKD A;  3GR9 A;  4JEY A;  4MGR A;  2W7G A;  3EIA A;  3KE3 A;  3AV7 A;  5M49 A;  2W8V A;  3OKS A;  3RBF A;  4K2B A;  5JAY A;  3WCO A;  1LC5 A;  1TOK A;  2X3L A;  5EFS A;  1C4K A;  3DXV A;  1E5E A;  1CQ6 A;  4RAE A;  5M4D A;  4GEB A;  1YJZ A;  1C7G A;  4JEZ A;  4F5H A;  3F9T A;  1LKC A;  3GZC A;  4LW4 A;  3NU7 A;  4TN4 A;  3EZS A;  4AOA A;  1ECX A;  2EGY A;  1TOJ A;  2CST A;  2F8J A;  4N0B A;  2DKJ A;  2D7Z A;  3WX9 A;  1BW0 A;  3UAK A;  2PB2 A;  1AJS B;  3PGY A;  3FDD A;  2AY5 A;  5DJ9 A;  5G4I A;  2VMQ A;  2CJH A;  2W7J A;  2EZ2 A;  1JS3 A;  1S06 A;  3B46 A;  1MDX A;  3P1T A;  1TAR A;  1W7N A;  3GZD A;  1S08 A;  1SFF A;  2E7U A;  1O61 A;  1RV3 A;  2AEU A;  2VGV A;  1N8P A;  1WYV A;  2PO3 A;  4CBS A;  1WKH A;  1ASN A;  3ECD A;  2HP1 A;  2RFV A;  3FVS A;  3N0L A;  2VMP A;  4U2H A;  3HL2 A;  1RVU A;  3A2B A;  3DU4 A;  9AAT A;  1KMK A;  4IX8 A;  5DX5 A;  1SZU A;  2HUI A;  1TOE A;  2X5F A;  3AEM A;  2AY1 A;  4P3M A;  3DR7 A;  1PMO A;  4WYE A;  1Y4I A;  1X2A A;  2CH1 A;  2EO5 A;  1MAQ A;  3OP7 A;  4UHM A;  1Z7D A;  3DOD A;  4ITG A;  4OYT A;  1SVV A;  1X0M A;  4RKD A;  4Y0H A;  1IJI A;  1JG8 A;  1IUG A;  3DZZ A;  3NRA A;  3QPG A;  4GDY A;  4OCA A;  3GJU A;  5EQC A;  3MC6 A;  2W7F A;  2HUF A;  4KAM A;  1CL1 A;  3PAA A;  2BHX A;  3FFR A;  4MY5 A;  2R5C B;  4RJY A;  2O7C A;  1AMR A;  3BS8 A;  3NUI A;  1WYU B;  4M2K A;  4WXB A;  1XEY A;  2JGT A;  3WKS A;  3ACZ A;  4ZWV A;  2CIN A;  1C7O A;  1DJ9 A;  3FQA A;  1CZE A;  2AY8 A;  1KKP A;  1W7M A;  3PDB A;  3L8A A;  1CJ0 A;  4E3R A;  4WYC A;  3CQ4 A;  1M4N A;  1ORD A;  2W8J A;  1MDO A;  3GWP A;  1H1C A;  3W1H A;  2VI8 A;  2XBN A;  1KKJ A;  2VGW A;  3HQT A;  1IX7 A;  5EIG A;  3LG0 A;  2YCP A;  2X8U A;  3BCX A;  3ZZJ A;  2TPL A;  4BQ0 A;  1LC8 A;  1I29 A;  3I4J A;  2JJH A;  2CJD A;  4K2I A;  2R0T A;  3ASA A;  3NDN A;  1WYT B;  1GCK A;  4CXR A;  4HVK A;  2QLR A;  1G7X A;  4GE7 A;  3A9Y A;  2BI1 A;  3KGW A;  5D5S A;  1I43 A;  1M0O A;  1S07 A;  2BIG A;  1ART A;  4PIW A;  3BWN C;  3LV2 A;  1JF9 A;  4M2M A;  3B1E A;  1I48 A;  1AAM A;  5DB5 A;  5E3K A;  2YKX A;  2W7I A;  3N75 A;  3UWC A;  4IYO B;  4U1T A;  4UHO A;  1GC3 A;  4N0W A;  2W7K A;  5AX8 A;  7AAT A;  4OC9 A;  3W1I A;  2FYF A;  1ASG A;  2ZY3 A;  4Q31 A;  2D66 A;  3Q8N A;  4XEW A;  3RBL A;  1BQA A;  1G4V A;  2BI3 A;  2VMT A;  3IHJ A;  3QM2 A;  3K7Y A;  5EUE A;  3RQ1 A;  1P3W A;  2YCT A;  1BKG A;  3AEN A;  4R5F A;  3FQ8 A;  2HUU A;  1AX4 A;  1WST A;  1ARI A;  1TOI A;  4W1V A;  1EQB A;  3TFU A;  3ZRR A;  1BT4 A;  2FNU A;  2ZY2 A;  3JZL A;  1LC7 A;  2CH2 A;  4XJO A;  4ITX A;  1AKA A;  4H51 A;  3P6K A;  1B9I A;  3FVU A;  4ATQ A;  3MAF B;  1AHF A;  1AMQ A;  3LWS A;  1IAY A;  2W7M A;  3FDB A;  1H0C A;  1D2F A;  2E7J A;  3H14 A;  1D7U A;  2QB3 A;  2YHK A;  5EUN A;  1C7N A;  1KL2 A;  1YJY A;  2G6W A;  1DFO A;  2VMZ A;  3CBF A;  3F6T A;  4K2M A;  5G09 A;  3TFT A;  2Z1Z A;  2E54 A;  2YKV A;  5IWQ A;  1M7Y A;  3AEP A;  4F5G A;  1KL1 A;  3JWB A;  2GMU A;  5HHY A;  3AOW A;  5DJ1 A;  3CQ6 A;  4IY7 A;  1CL2 A;  4R8D A;  3EI9 A;  3USF A;  1TAT A;  3HVY A;  1BJW A;  1OHW A;  4Y0I A;  4BA4 A;  3L44 A;  3E6G A;  1PG8 A;  4WB0 A;  3WZF A;  3TAT A;  2OKK A;  3II0 A;  2HOY A;  4RLG A;  2YRR A;  2BI5 A;  5FT8 A;  2OGA A;  8AAT A;  4ADC A;  1B4X A;  1M32 A;  1JS6 A;  1MAP A;  4HF8 A;  4I8A A;  4XAU A;  3A8U X;  3VK4 A;  4IXS A;  2VGS A;  3RI6 A;  4WXF A;  2Z9W A;  2VMW A;  4AH3 A;  3A9X A;  1WYV B;  4E1O A;  4W1X A;  4OTL A;  3BB8 A;  1TPL A;  4KXK A;  2GQN A;  3AEJ C;  2QBT A;  4FL0 A;  1ASD A;  2V0Y A;  1IAX A;  3JW9 A;  1ASB A;  4ZDO A;  5G0A A;  3B1C A;  1CZC A;  2VGT A;  1ASL A;  2VMR A;  3K40 A;  1GEY A;  4OBV A;  3G7Q A;  1ASM A;  3FCR A;  3HDO A;  3VAX A;  3BWO A;  2DKB A;  1V2E A;  5G2P A;  1DGD A;  2ZSM A;  3WGC A;  2ZY4 A;  1SZK A;  4FFC A;  4LNM A;  2VLH A;  4IXZ A;  2Z61 A;  1LK9 A;  4W91 A;  4J5U A;  2CB1 A;  4AZJ A;  4ISY A;  3EZ1 A;  3FQ7 A;  1DJE A;  4A6T A;  4WYD A;  3E2Z B;  4GE4 A;  1QIT A;  1YNU A;  2QA3 A;  2W8U A;  4ZLV A;  4E3Q A;  2NMP A;  4LNL A;  3ELP A;  2OGE A;  3FRK A;  2ZSL A;  3E77 A;  4ZWM A;  4F5J A;  3NYU A;  4UQV A;  4RKC A;  2D64 A;  4JE5 A;  1UU1 A;  4L0O A;  4GSA A;  1GC4 A;  4DBC A;  2EH6 A;  4MQQ A;  4MKJ A;  2W8T A;  1QIR A;  4Q75 A;  1VEF A;  1IBJ A;  4MQR A;  1YIZ A;  1ELU A;  1AIC A;  1TOG A;  4A0R A;  1IX8 A;  1VP4 A;  1W3U A;  4A6U A;  1FC4 A;  1ZC9 A;  1O4S A;  3NTJ A;  4ZDP A;  2R5E A;  5FT5 A;  3PJ0 A;  2GB3 A;  2YOB A;  4CVQ A;  2VMS A;  3CQ5 A;  3GBX A;  1IVR A;  2R5C A;  4WYF A;  1B5O A;  5F8V A;  3FVX A;  2ZC0 A;  2WK8 A;  2ZJG A;  4PFN A;  4XQ2 A;  3B8X A;  1WYU A;  2VGZ A;  2VIA A;  3DXW A;  4JEV A;  4ZM3 A;  4WLJ A;  4F5M A;  3ZZK A;  3IF2 A;  1YJS A;  4J8L A;  3EIB A;  2JJF A;  1N31 A;  2AEV A;  1AHG A;  2VMV A;  2O1B A;  2W7D A;  4ATP A;  1S0A A;  1YOO A;  3EI6 A;  2CY8 A;  3MAD A;  3N5M A;  3COG A;  3PDX A;  4OMA A;  2HOZ A;  4DQ6 A;  2VMN A;  1ARH A;  5F9S A;  5C6U A;  2EZ1 A;  3BC8 A;  1BS0 A;  3VP6 A;  5TF5 A;  2WK9 A;  1BQD A;  4PVF A;  2AAT A;  2D5Y A;  1ASC A;  4F4E A;  1C9C A;  1WYT A;  1Z3Z A;  1W23 A;  1IX6 A;  1X29 A;  3LVJ A;  1J04 A;  4M2J A;  2BI2 A;  2AY7 A;  3WCN A;  4W5K A;  4JEW A;  1B9H A;  4ZDL A;  4WLH A;  3PD6 B;  3G0T A;  1PMM A;  3W1J A;  1AHY A;  3VK3 A;  4LC3 A;  3AEO A;  1PFF A;  4W8I A;  1AMS A;  2BWP A;  1UU0 A;  2C44 A;  2ORD A;  3G8M A;  3HMU A;  3K28 A;  4A72 A;  1EJI A;  1LS3 A;  1AHE A;  1AKC A;  1CQ8 A;  2AY4 A;  3HLM A;  1WKG A;  3ZRP A;  1ASA A;  2FN6 A;  3E2F A;  4IYO A;  1YIY A;  1DTY A;  2CJG A;  2YRI A;  2GSA A;  5D95 A;  3RCH B;  1QJ3 A;  1KMJ A;  3DR4 A;  1X28 A;  2BYJ A;  4ZSW A;  3WKR A;  4XK1 A;  5EUD A;  4MKK A;  1UU2 A;  2V1P A;  4IW7 A;  1M0P A;  4MQP A;  4EMY A;  2D61 A;  2VMY A;  2WKA A;  1RVY A;  1BJO B;  3LVK A;  1UKJ A;  1G4X A;  1GDE A;  1XI9 A;  4TV7 A;  2JIS A;  2EPJ A;  4ZSY A;  5J8Q A;  1G7W A;  3I5T A;  4WYG A;  3WY7 A;  1QJ5 A;  1MDZ A;  2AY9 A;  2HZP A;  3NUB A;  2QMA A;  3VOM A;  3EI8 A;  3JWA A;  4LW2 A;  3KGX A;  3FTB A;  4AZK A;  2W8W A;  5I92 A;  1D7R A;  1GBN A;  1AY8 A;  3BN1 A;  3JU7 A;  3MAF A;  5HXX A;  4A6R A;  1AIB A;  1LW5 A;  1O69 A;  1M0N A;  1AHX A;  1W7L A;  2VMU A;  4F5F A;  2CTZ A;  2VMO A;  1OAT A;  1OXP A;  4WB0 B;  4E77 A;  4WBT A;  1MGV A;  2C81 A;  3I16 A;  3NYT A;  4Y0D A;  4EFF A;  4F5L A;  1QIS A;  3AAT A;  2ZY5 A;  2CAN A;  2VGU A;  2FNI A;  1FG7 A;  1OXO A;  1RV4 A;  1GD9 A;  3F0H A;  2AY2 A;  5E4Z A;  5E5I A;  3AEJ A;  3UE8 A;  1DJU A;  2VLF A;  4EB5 A;  3LVL B;  1OHY A;  3PIU A;  2DR1 A;  2AY6 A;  4UHN A;  4QGR A;  3EUC A;  2O0R A;  2JG2 A;  3FFH A;  4WP0 A;  3FD0 A;  5EAA A;  1MLZ A;  2Q7W A;  1AJS A;  2X5D A;  1V2D A;  3EI7 A;  1U08 A;  3D6K A;  3EI5 A;  3M5U A;  1CQ7 A;  4ZAS A;  1SF2 A;  2W7L A;  5K8B A;  3ISL A;  1B8G A;  3GZD C;  4RIT A;  3BCB A;  2DGK A;  4A0F A;  4A0H A;  2ZUK A;  4ADB A;  4B98 A;  4CXQ A;  4W1W A;  1ZOD A;  3R9A A;  5FT6 A;  2XH1 A;  3DRD A;  3HT4 A;  5M46 A;  5BJ3 A;  2FM1 A;  4GRX A;  3AOV A;  3FZ6 A;  2W7E A;  4GE9 A;  3VK2 A;  4BMK A;  2C0R A;  2BWO A;  3AEM C;  2VI9 A;  2YKY A;  3PPL A;  3QN6 A;  1T3I A;  3LVM A;  1ARS A;  1M0Q A;  3ELE A;  3E9K A;  2BYL A;  2HP2 A;  4JF1 A;  4BHD A;  2WK7 A;  2BWN A;  5BJ4 A;  1C0N A;  3E2Y A;  1EG5 A;  2VMX A;  3A9Z A;  3ATH A;  1QZ9 A;  1S09 A;  4AO4 A;  3QGU A;  4NOG A;  4Q6R A;  1BJ4 A;  4MSO A;  3WGB A;  2Z67 A;  4ADE A;  5LHA A;  3NX3 A;  3LY1 A;  3PDB B;  4B9B A;  1BJN A;  4WXG A;  2JJE A;  1D7S A;  3E2Z A;  2CFB A;  2DOU A;  4OBU A;  2D7Y A;  4AO9 A;  4ZAH A;  3BV0 A;  3PA9 A;  4XJL A;  1V2F A;  1ASF A;  5G4J A;  3MC6 C;  5EIG B;  3T32 A;  5G2Q A;  4ADD A;  4R2N A;  4EB7 A;  1GC0 A;  3FZ8 A;  2HOR A;  1GEX A;  2W7H A;  3NU8 A;  5FT4 A;  4A00 A;  3GSB A;  4TMR A;  2DGM A;  4JF0 A;  3MAU A;  5LH9 A;  3MBB A;  2HOX A;  4RM1 A;  1MLY A;  2YCN A;  2GMS A;  3WLX A;  1I41 A;  2OAT A;  2BKW A;  3HBX A;  3CAI A;  4OT8 A;  1DKA A;  3BWN A;  4PFF A;  2VYC A;  1LW4 A;  1ELQ A;  1B5P A; 
#chains in the Genus database with same CATH topology
 4Q76 A;  2QB2 A;  3FSL A;  1GC2 A;  2PB0 A;  5M4B A;  2BI9 A;  1ASE A;  1AY5 A;  1SPA A;  2D65 A;  3TCM A;  1CS1 A;  4F5K A;  4RIZ A;  1OHV A;  1YAA A;  1M6S A;  3RUY A;  2Z20 A;  4KYO A;  2Z1Y A;  2Z9X A;  1GEW A;  1ARG A;  3B1D A;  4R5Z A;  4CBR A;  2BIA A;  3JTX A;  4JE5 D;  4UOY A;  3TQX A;  4IXO A;  3ZRQ A;  2FQ6 A;  1SZS A;  1D7V A;  2OQX A;  3ASB A;  2BIE A;  2DGL A;  3AEN B;  2Z9U A;  3NNK A;  4F5I A;  3H7F A;  1N2T A;  3KKI A;  4LNJ A;  4JEX A;  3MKJ A;  2Z9V A;  5HDM A;  1O62 A;  1AKB A;  1DGE A;  3DYD A;  4P7Y A;  1AJR A;  2ZYJ A;  4XJM A;  3PD6 A;  4RJ0 A;  1VJO A;  3QBO A;  1AIA A;  2YKU A;  3FZ7 A;  3QHX A;  4XJP A;  1J32 A;  2R2N A;  2C7T A;  3MEB A;  1FG3 A;  4O6Z A;  1V72 A;  4ZM4 A;  1TAS A;  4WYA A;  4DGT A;  1KAF A;  1ZOB A;  2AY3 A;  2ZP7 A;  3QI6 A;  5EAV A;  3RCH A;  1AMA A;  3GET A;  4EU1 A;  2JJG A;  3AEL A;  2D63 A;  1AY4 A;  4A0G A;  2OKJ A;  3NYS A;  4BA5 A;  3R4T A;  2E7I A;  3DC1 A;  3BCA A;  1E5F A;  4WD2 A;  1QGN A;  1BJO A;  2VIB A;  1AAW A;  3FKD A;  3GR9 A;  4JEY A;  4MGR A;  4K05 A;  2W7G A;  3EIA A;  3KE3 A;  3AV7 A;  5M49 A;  2W8V A;  3OKS A;  3RBF A;  4K2B A;  5JAY A;  3WCO A;  1LC5 A;  1TOK A;  2X3L A;  5EFS A;  1C4K A;  3DXV A;  1E5E A;  1CQ6 A;  4RAE A;  5M4D A;  4GEB A;  1YJZ A;  1C7G A;  4JEZ A;  4F5H A;  3F9T A;  1LKC A;  3GZC A;  3N7N A;  4LW4 A;  3NU7 A;  4TN4 A;  3EZS A;  4AOA A;  1ECX A;  2EGY A;  1TOJ A;  2CST A;  2F8J A;  4N0B A;  2DKJ A;  2D7Z A;  3WX9 A;  1BW0 A;  3UAK A;  3N4X A;  2PB2 A;  1AJS B;  3PGY A;  3FDD A;  2AY5 A;  5DJ9 A;  5G4I A;  2VMQ A;  2CJH A;  2W7J A;  2EZ2 A;  1JS3 A;  1S06 A;  3B46 A;  1MDX A;  3P1T A;  1TAR A;  1W7N A;  3GZD A;  1S08 A;  1SFF A;  2E7U A;  1O61 A;  1RV3 A;  2AEU A;  2VGV A;  1N8P A;  1WYV A;  2PO3 A;  4CBS A;  1WKH A;  1ASN A;  3ECD A;  2HP1 A;  2RFV A;  3FVS A;  3N0L A;  2VMP A;  4U2H A;  3HL2 A;  1RVU A;  3A2B A;  3DU4 A;  9AAT A;  1KMK A;  4IX8 A;  5DX5 A;  1SZU A;  2HUI A;  1TOE A;  2X5F A;  3AEM A;  2AY1 A;  4P3M A;  3DR7 A;  1PMO A;  4WYE A;  1Y4I A;  1X2A A;  2CH1 A;  2EO5 A;  1MAQ A;  3OP7 A;  4UHM A;  1Z7D A;  3DOD A;  4ITG A;  4OYT A;  1SVV A;  1X0M A;  4RKD A;  3N4S A;  4Y0H A;  1IJI A;  1JG8 A;  1IUG A;  3DZZ A;  3NRA A;  3QPG A;  4GDY A;  4OCA A;  3GJU A;  5EQC A;  3MC6 A;  2W7F A;  2HUF A;  4KAM A;  1CL1 A;  3PAA A;  2BHX A;  3FFR A;  4MY5 A;  2R5C B;  4RJY A;  2O7C A;  1AMR A;  3BS8 A;  3NUI A;  1WYU B;  4M2K A;  4WXB A;  1XEY A;  2JGT A;  3WKS A;  3ACZ A;  4ZWV A;  2WB6 A;  2CIN A;  1C7O A;  1DJ9 A;  3FQA A;  1CZE A;  2AY8 A;  2QSR A;  1KKP A;  1W7M A;  3PDB A;  3L8A A;  1CJ0 A;  4E3R A;  4WYC A;  3CQ4 A;  1M4N A;  1ORD A;  2W8J A;  1MDO A;  3GWP A;  1H1C A;  3W1H A;  2VI8 A;  2XBN A;  1KKJ A;  2VGW A;  3HQT A;  1IX7 A;  5EIG A;  3LG0 A;  2YCP A;  2X8U A;  3BCX A;  3ZZJ A;  2TPL A;  4BQ0 A;  1LC8 A;  1I29 A;  3I4J A;  2JJH A;  2CJD A;  4K2I A;  3H9X A;  2R0T A;  3ASA A;  3NDN A;  1WYT B;  1GCK A;  4CXR A;  4HVK A;  2QLR A;  1G7X A;  4GE7 A;  3A9Y A;  2BI1 A;  3KGW A;  5D5S A;  1I43 A;  1M0O A;  1S07 A;  2BIG A;  1ART A;  4PIW A;  3BWN C;  3LV2 A;  1JF9 A;  4M2M A;  3B1E A;  1I48 A;  1AAM A;  5DB5 A;  5E3K A;  2YKX A;  2W7I A;  3N75 A;  3UWC A;  4IYO B;  4U1T A;  4UHO A;  1GC3 A;  4N0W A;  2W7K A;  5AX8 A;  7AAT A;  4OC9 A;  3W1I A;  2FYF A;  1ASG A;  2ZY3 A;  4Q31 A;  2D66 A;  3Q8N A;  4XEW A;  3RBL A;  1BQA A;  1G4V A;  2BI3 A;  2VMT A;  3IHJ A;  3QM2 A;  3K7Y A;  5EUE A;  3RQ1 A;  1P3W A;  2YCT A;  1BKG A;  3AEN A;  4R5F A;  3FQ8 A;  2HUU A;  1AX4 A;  1WST A;  1ARI A;  1TOI A;  4W1V A;  1EQB A;  3TFU A;  3ZRR A;  1BT4 A;  2FNU A;  2ZY2 A;  3JZL A;  1LC7 A;  2CH2 A;  4XJO A;  4ITX A;  1AKA A;  4H51 A;  3P6K A;  1B9I A;  3FVU A;  4ATQ A;  3MAF B;  2EYQ A;  2A1V A;  1AHF A;  1AMQ A;  3LWS A;  1IAY A;  2W7M A;  3FDB A;  1H0C A;  1D2F A;  2E7J A;  3H14 A;  1D7U A;  2QB3 A;  2YHK A;  5EUN A;  1C7N A;  1KL2 A;  1YJY A;  2G6W A;  1DFO A;  2VMZ A;  3CBF A;  3F6T A;  4K2M A;  5G09 A;  3TFT A;  2Z1Z A;  2E54 A;  2YKV A;  5IWQ A;  1M7Y A;  3AEP A;  4F5G A;  1KL1 A;  3JWB A;  2GMU A;  5HHY A;  3AOW A;  5DJ1 A;  3CQ6 A;  4IY7 A;  1CL2 A;  4R8D A;  3EI9 A;  3USF A;  1TAT A;  3HVY A;  1BJW A;  1OHW A;  4Y0I A;  4BA4 A;  3L44 A;  3E6G A;  1PG8 A;  4WB0 A;  3WZF A;  3TAT A;  2OKK A;  3II0 A;  2HOY A;  4RLG A;  2YRR A;  2BI5 A;  5FT8 A;  2OGA A;  8AAT A;  4ADC A;  1B4X A;  1M32 A;  1JS6 A;  1MAP A;  4HF8 A;  4I8A A;  4XAU A;  3N4R A;  3A8U X;  3VK4 A;  4IXS A;  2VGS A;  3RI6 A;  4WXF A;  2Z9W A;  2VMW A;  4AH3 A;  3A9X A;  1WYV B;  4E1O A;  4W1X A;  4OTL A;  3BB8 A;  1TPL A;  4KXK A;  2GQN A;  3AEJ C;  2QBT A;  4FL0 A;  1ASD A;  2V0Y A;  1IAX A;  3JW9 A;  1ASB A;  4ZDO A;  5G0A A;  3B1C A;  1CZC A;  2VGT A;  1ASL A;  2VMR A;  3K40 A;  1GEY A;  4OBV A;  3G7Q A;  1ASM A;  3FCR A;  3HDO A;  3VAX A;  3BWO A;  2DKB A;  1V2E A;  5G2P A;  1DGD A;  2ZSM A;  3WGC A;  2ZY4 A;  1SZK A;  4FFC A;  4LNM A;  2VLH A;  4IXZ A;  2Z61 A;  1LK9 A;  4W91 A;  4J5U A;  2CB1 A;  4AZJ A;  4ISY A;  3EZ1 A;  3FQ7 A;  1DJE A;  4A6T A;  4WYD A;  3E2Z B;  4GE4 A;  1QIT A;  1YNU A;  2QA3 A;  2W8U A;  4ZLV A;  4E3Q A;  2NMP A;  4LNL A;  3ELP A;  2OGE A;  3FRK A;  2ZSL A;  3E77 A;  4ZWM A;  4F5J A;  3NYU A;  4UQV A;  4RKC A;  2D64 A;  4JE5 A;  1UU1 A;  4L0O A;  4GSA A;  1GC4 A;  4DBC A;  2EH6 A;  4MQQ A;  4MKJ A;  2W8T A;  1QIR A;  4Q75 A;  1VEF A;  1IBJ A;  4MQR A;  1YIZ A;  1ELU A;  1AIC A;  1TOG A;  4A0R A;  1IX8 A;  1VP4 A;  1W3U A;  4A6U A;  1FC4 A;  1ZC9 A;  1O4S A;  3NTJ A;  4ZDP A;  2R5E A;  5FT5 A;  3PJ0 A;  2GB3 A;  2YOB A;  4CVQ A;  2VMS A;  3CQ5 A;  3GBX A;  1IVR A;  2R5C A;  4WYF A;  1B5O A;  5F8V A;  2G7J A;  3FVX A;  2ZC0 A;  2WK8 A;  2ZJG A;  4PFN A;  4XQ2 A;  3B8X A;  1WYU A;  2VGZ A;  2VIA A;  3DXW A;  4JEV A;  4ZM3 A;  4WLJ A;  4F5M A;  3ZZK A;  3IF2 A;  1YJS A;  4J8L A;  3EIB A;  2JJF A;  1N31 A;  4H63 Q;  2AEV A;  1AHG A;  2VMV A;  2O1B A;  2W7D A;  4ATP A;  1S0A A;  1YOO A;  3EI6 A;  2CY8 A;  3MAD A;  3N5M A;  3COG A;  3PDX A;  4OMA A;  2HOZ A;  4DQ6 A;  2VMN A;  1ARH A;  5F9S A;  2FKI A;  5C6U A;  2EZ1 A;  3BC8 A;  1BS0 A;  3VP6 A;  5TF5 A;  2WK9 A;  1BQD A;  4PVF A;  2AAT A;  2D5Y A;  1ASC A;  4F4E A;  1C9C A;  1WYT A;  1Z3Z A;  1W23 A;  5KTB A;  1IX6 A;  1X29 A;  3LVJ A;  1J04 A;  4M2J A;  2BI2 A;  2AY7 A;  3WCN A;  4W5K A;  4JEW A;  1B9H A;  4ZDL A;  4WLH A;  3PD6 B;  3G0T A;  1PMM A;  3W1J A;  1AHY A;  3VK3 A;  4LC3 A;  3AEO A;  1PFF A;  4W8I A;  1AMS A;  2BWP A;  1UU0 A;  2C44 A;  2ORD A;  3G8M A;  3HMU A;  3K28 A;  4A72 A;  1EJI A;  1LS3 A;  1AHE A;  1AKC A;  1CQ8 A;  2AY4 A;  3HLM A;  1WKG A;  3ZRP A;  1ASA A;  2FN6 A;  3E2F A;  4IYO A;  1YIY A;  1DTY A;  2CJG A;  2YRI A;  2GSA A;  5D95 A;  3RCH B;  1QJ3 A;  1KMJ A;  3DR4 A;  1X28 A;  2BYJ A;  4ZSW A;  3WKR A;  4XK1 A;  5EUD A;  4MKK A;  1UU2 A;  2V1P A;  4IW7 A;  1M0P A;  4MQP A;  4EMY A;  2D61 A;  2VMY A;  2WKA A;  1RVY A;  1BJO B;  3LVK A;  1UKJ A;  1G4X A;  1GDE A;  1XI9 A;  2KFP A;  4TV7 A;  2JIS A;  2EPJ A;  4ZSY A;  5J8Q A;  1G7W A;  3I5T A;  4WYG A;  3WY7 A;  1QJ5 A;  1MDZ A;  2AY9 A;  2HZP A;  3NUB A;  2QMA A;  3VOM A;  3EI8 A;  3JWA A;  4LW2 A;  3KGX A;  3FTB A;  4AZK A;  2W8W A;  5I92 A;  1D7R A;  1GBN A;  1AY8 A;  3BN1 A;  3JU7 A;  3MAF A;  5HXX A;  4A6R A;  1AIB A;  1LW5 A;  1O69 A;  1M0N A;  1AHX A;  1W7L A;  2VMU A;  4F5F A;  2CTZ A;  2VMO A;  1OAT A;  1OXP A;  4WB0 B;  4E77 A;  4WBT A;  1MGV A;  2C81 A;  3I16 A;  3NYT A;  4Y0D A;  4EFF A;  4F5L A;  1QIS A;  3AAT A;  2ZY5 A;  2CAN A;  2VGU A;  2FNI A;  1FG7 A;  1OXO A;  1RV4 A;  1GD9 A;  3F0H A;  2AY2 A;  5E4Z A;  5E5I A;  3AEJ A;  3UE8 A;  1DJU A;  2VLF A;  4EB5 A;  3LVL B;  1OHY A;  3PIU A;  2DR1 A;  2AY6 A;  4UHN A;  4QGR A;  3EUC A;  2O0R A;  2JG2 A;  3FFH A;  4WP0 A;  3FD0 A;  5EAA A;  1MLZ A;  2Q7W A;  1AJS A;  2X5D A;  1V2D A;  3EI7 A;  1U08 A;  3D6K A;  3EI5 A;  3M5U A;  1CQ7 A;  4ZAS A;  1SF2 A;  2W7L A;  5K8B A;  3ISL A;  1B8G A;  3GZD C;  4RIT A;  3BCB A;  2DGK A;  4A0F A;  4A0H A;  2ZUK A;  4ADB A;  4B98 A;  4CXQ A;  4W1W A;  1ZOD A;  3R9A A;  5FT6 A;  2XH1 A;  3DRD A;  3HT4 A;  5M46 A;  5BJ3 A;  2FM1 A;  4GRX A;  3AOV A;  3FZ6 A;  2W7E A;  4GE9 A;  3VK2 A;  4BMK A;  2C0R A;  2BWO A;  3AEM C;  2VI9 A;  2YKY A;  3PPL A;  3QN6 A;  1T3I A;  3LVM A;  1ARS A;  1M0Q A;  3ELE A;  3E9K A;  2BYL A;  2HP2 A;  4JF1 A;  4BHD A;  2WK7 A;  2BWN A;  5BJ4 A;  1C0N A;  3E2Y A;  1EG5 A;  2VMX A;  3A9Z A;  3ATH A;  1QZ9 A;  1S09 A;  4AO4 A;  3QGU A;  4NOG A;  4Q6R A;  1BJ4 A;  4MSO A;  3WGB A;  2Z67 A;  4ADE A;  5LHA A;  3NX3 A;  3LY1 A;  3PDB B;  4B9B A;  1BJN A;  4WXG A;  2JJE A;  1D7S A;  3E2Z A;  2CFB A;  2DOU A;  4OBU A;  2D7Y A;  4AO9 A;  4ZAH A;  3BV0 A;  3PA9 A;  4XJL A;  1V2F A;  1ASF A;  5G4J A;  3MC6 C;  5EIG B;  3T32 A;  5G2Q A;  4ADD A;  4R2N A;  4EB7 A;  1GC0 A;  3FZ8 A;  2HOR A;  1GEX A;  2W7H A;  3NU8 A;  5FT4 A;  4A00 A;  3GSB A;  4TMR A;  2DGM A;  4JF0 A;  3MAU A;  5LH9 A;  3MBB A;  2HOX A;  4RM1 A;  1MLY A;  2YCN A;  2GMS A;  3WLX A;  1I41 A;  2OAT A;  2BKW A;  3HBX A;  3CAI A;  4OT8 A;  1DKA A;  3BWN A;  4PFF A;  2VYC A;  1LW4 A;  1ELQ A;  1B5P A; 
#chains in the Genus database with same CATH homology
 4Q76 A;  2QB2 A;  3FSL A;  1GC2 A;  2PB0 A;  5M4B A;  2BI9 A;  1ASE A;  1AY5 A;  1SPA A;  2D65 A;  3TCM A;  1CS1 A;  4F5K A;  4RIZ A;  1OHV A;  1YAA A;  1M6S A;  3RUY A;  2Z20 A;  4KYO A;  2Z1Y A;  2Z9X A;  1GEW A;  1ARG A;  3B1D A;  4R5Z A;  4CBR A;  2BIA A;  3JTX A;  4JE5 D;  4UOY A;  3TQX A;  4IXO A;  3ZRQ A;  2FQ6 A;  1SZS A;  1D7V A;  2OQX A;  3ASB A;  2BIE A;  2DGL A;  3AEN B;  2Z9U A;  3NNK A;  4F5I A;  3H7F A;  1N2T A;  3KKI A;  4LNJ A;  4JEX A;  3MKJ A;  2Z9V A;  5HDM A;  1O62 A;  1AKB A;  1DGE A;  3DYD A;  4P7Y A;  1AJR A;  2ZYJ A;  4XJM A;  3PD6 A;  4RJ0 A;  1VJO A;  3QBO A;  1AIA A;  2YKU A;  3FZ7 A;  3QHX A;  4XJP A;  1J32 A;  2R2N A;  2C7T A;  3MEB A;  1FG3 A;  4O6Z A;  1V72 A;  4ZM4 A;  1TAS A;  4WYA A;  4DGT A;  1ZOB A;  2AY3 A;  2ZP7 A;  3QI6 A;  5EAV A;  3RCH A;  1AMA A;  3GET A;  4EU1 A;  2JJG A;  3AEL A;  2D63 A;  1AY4 A;  4A0G A;  2OKJ A;  3NYS A;  4BA5 A;  3R4T A;  2E7I A;  3DC1 A;  3BCA A;  1E5F A;  4WD2 A;  1QGN A;  1BJO A;  2VIB A;  1AAW A;  3FKD A;  3GR9 A;  4JEY A;  4MGR A;  4K05 A;  2W7G A;  3EIA A;  3KE3 A;  3AV7 A;  5M49 A;  2W8V A;  3OKS A;  3RBF A;  4K2B A;  5JAY A;  3WCO A;  1LC5 A;  1TOK A;  2X3L A;  5EFS A;  1C4K A;  3DXV A;  1E5E A;  1CQ6 A;  4RAE A;  5M4D A;  4GEB A;  1YJZ A;  1C7G A;  4JEZ A;  4F5H A;  3F9T A;  1LKC A;  3GZC A;  3N7N A;  4LW4 A;  3NU7 A;  4TN4 A;  3EZS A;  4AOA A;  1ECX A;  2EGY A;  1TOJ A;  2CST A;  2F8J A;  4N0B A;  2DKJ A;  2D7Z A;  3WX9 A;  1BW0 A;  3UAK A;  3N4X A;  2PB2 A;  1AJS B;  3PGY A;  3FDD A;  2AY5 A;  5DJ9 A;  5G4I A;  2VMQ A;  2CJH A;  2W7J A;  2EZ2 A;  1JS3 A;  1S06 A;  3B46 A;  1MDX A;  3P1T A;  1TAR A;  1W7N A;  3GZD A;  1S08 A;  1SFF A;  2E7U A;  1O61 A;  1RV3 A;  2AEU A;  2VGV A;  1N8P A;  1WYV A;  2PO3 A;  4CBS A;  1WKH A;  1ASN A;  3ECD A;  2HP1 A;  2RFV A;  3FVS A;  3N0L A;  2VMP A;  4U2H A;  3HL2 A;  1RVU A;  3A2B A;  3DU4 A;  9AAT A;  1KMK A;  4IX8 A;  5DX5 A;  1SZU A;  2HUI A;  1TOE A;  2X5F A;  3AEM A;  2AY1 A;  4P3M A;  3DR7 A;  1PMO A;  4WYE A;  1Y4I A;  1X2A A;  2CH1 A;  2EO5 A;  1MAQ A;  3OP7 A;  4UHM A;  1Z7D A;  3DOD A;  4ITG A;  4OYT A;  1SVV A;  1X0M A;  4RKD A;  3N4S A;  4Y0H A;  1IJI A;  1JG8 A;  1IUG A;  3DZZ A;  3NRA A;  3QPG A;  4GDY A;  4OCA A;  3GJU A;  5EQC A;  3MC6 A;  2W7F A;  2HUF A;  4KAM A;  1CL1 A;  3PAA A;  2BHX A;  3FFR A;  4MY5 A;  2R5C B;  4RJY A;  2O7C A;  1AMR A;  3BS8 A;  3NUI A;  1WYU B;  4M2K A;  4WXB A;  1XEY A;  2JGT A;  3WKS A;  3ACZ A;  4ZWV A;  2WB6 A;  2CIN A;  1C7O A;  1DJ9 A;  3FQA A;  1CZE A;  2AY8 A;  2QSR A;  1KKP A;  1W7M A;  3PDB A;  3L8A A;  1CJ0 A;  4E3R A;  4WYC A;  3CQ4 A;  1M4N A;  1ORD A;  2W8J A;  1MDO A;  3GWP A;  1H1C A;  3W1H A;  2VI8 A;  2XBN A;  1KKJ A;  2VGW A;  3HQT A;  1IX7 A;  5EIG A;  3LG0 A;  2YCP A;  2X8U A;  3BCX A;  3ZZJ A;  2TPL A;  4BQ0 A;  1LC8 A;  1I29 A;  3I4J A;  2JJH A;  2CJD A;  4K2I A;  3H9X A;  2R0T A;  3ASA A;  3NDN A;  1WYT B;  1GCK A;  4CXR A;  4HVK A;  2QLR A;  1G7X A;  4GE7 A;  3A9Y A;  2BI1 A;  3KGW A;  5D5S A;  1I43 A;  1M0O A;  1S07 A;  2BIG A;  1ART A;  4PIW A;  3BWN C;  3LV2 A;  1JF9 A;  4M2M A;  3B1E A;  1I48 A;  1AAM A;  5DB5 A;  5E3K A;  2YKX A;  2W7I A;  3N75 A;  3UWC A;  4IYO B;  4U1T A;  4UHO A;  1GC3 A;  4N0W A;  2W7K A;  5AX8 A;  7AAT A;  4OC9 A;  3W1I A;  2FYF A;  1ASG A;  2ZY3 A;  4Q31 A;  2D66 A;  3Q8N A;  4XEW A;  3RBL A;  1BQA A;  1G4V A;  2BI3 A;  2VMT A;  3IHJ A;  3QM2 A;  3K7Y A;  5EUE A;  3RQ1 A;  1P3W A;  2YCT A;  1BKG A;  3AEN A;  4R5F A;  3FQ8 A;  2HUU A;  1AX4 A;  1WST A;  1ARI A;  1TOI A;  4W1V A;  1EQB A;  3TFU A;  3ZRR A;  1BT4 A;  2FNU A;  2ZY2 A;  3JZL A;  1LC7 A;  2CH2 A;  4XJO A;  4ITX A;  1AKA A;  4H51 A;  3P6K A;  1B9I A;  3FVU A;  4ATQ A;  3MAF B;  2EYQ A;  2A1V A;  1AHF A;  1AMQ A;  3LWS A;  1IAY A;  2W7M A;  3FDB A;  1H0C A;  1D2F A;  2E7J A;  3H14 A;  1D7U A;  2QB3 A;  2YHK A;  5EUN A;  1C7N A;  1KL2 A;  1YJY A;  2G6W A;  1DFO A;  2VMZ A;  3CBF A;  3F6T A;  4K2M A;  5G09 A;  3TFT A;  2Z1Z A;  2E54 A;  2YKV A;  5IWQ A;  1M7Y A;  3AEP A;  4F5G A;  1KL1 A;  3JWB A;  2GMU A;  5HHY A;  3AOW A;  5DJ1 A;  3CQ6 A;  4IY7 A;  1CL2 A;  4R8D A;  3EI9 A;  3USF A;  1TAT A;  3HVY A;  1BJW A;  1OHW A;  4Y0I A;  4BA4 A;  3L44 A;  3E6G A;  1PG8 A;  4WB0 A;  3WZF A;  3TAT A;  2OKK A;  3II0 A;  2HOY A;  4RLG A;  2YRR A;  2BI5 A;  5FT8 A;  2OGA A;  8AAT A;  4ADC A;  1B4X A;  1M32 A;  1JS6 A;  1MAP A;  4HF8 A;  4I8A A;  4XAU A;  3N4R A;  3A8U X;  3VK4 A;  4IXS A;  2VGS A;  3RI6 A;  4WXF A;  2Z9W A;  2VMW A;  4AH3 A;  3A9X A;  1WYV B;  4E1O A;  4W1X A;  4OTL A;  3BB8 A;  1TPL A;  4KXK A;  2GQN A;  3AEJ C;  2QBT A;  4FL0 A;  1ASD A;  2V0Y A;  1IAX A;  3JW9 A;  1ASB A;  4ZDO A;  5G0A A;  3B1C A;  1CZC A;  2VGT A;  1ASL A;  2VMR A;  3K40 A;  1GEY A;  4OBV A;  3G7Q A;  1ASM A;  3FCR A;  3HDO A;  3VAX A;  3BWO A;  2DKB A;  1V2E A;  5G2P A;  1DGD A;  2ZSM A;  3WGC A;  2ZY4 A;  1SZK A;  4FFC A;  4LNM A;  2VLH A;  4IXZ A;  2Z61 A;  1LK9 A;  4W91 A;  4J5U A;  2CB1 A;  4AZJ A;  4ISY A;  3EZ1 A;  3FQ7 A;  1DJE A;  4A6T A;  4WYD A;  3E2Z B;  4GE4 A;  1QIT A;  1YNU A;  2QA3 A;  2W8U A;  4ZLV A;  4E3Q A;  2NMP A;  4LNL A;  3ELP A;  2OGE A;  3FRK A;  2ZSL A;  3E77 A;  4ZWM A;  4F5J A;  3NYU A;  4UQV A;  4RKC A;  2D64 A;  4JE5 A;  1UU1 A;  4L0O A;  4GSA A;  1GC4 A;  4DBC A;  2EH6 A;  4MQQ A;  4MKJ A;  2W8T A;  1QIR A;  4Q75 A;  1VEF A;  1IBJ A;  4MQR A;  1YIZ A;  1ELU A;  1AIC A;  1TOG A;  4A0R A;  1IX8 A;  1VP4 A;  1W3U A;  4A6U A;  1FC4 A;  1ZC9 A;  1O4S A;  3NTJ A;  4ZDP A;  2R5E A;  5FT5 A;  3PJ0 A;  2GB3 A;  2YOB A;  4CVQ A;  2VMS A;  3CQ5 A;  3GBX A;  1IVR A;  2R5C A;  4WYF A;  1B5O A;  5F8V A;  2G7J A;  3FVX A;  2ZC0 A;  2WK8 A;  2ZJG A;  4PFN A;  4XQ2 A;  3B8X A;  1WYU A;  2VGZ A;  2VIA A;  3DXW A;  4JEV A;  4ZM3 A;  4WLJ A;  4F5M A;  3ZZK A;  3IF2 A;  1YJS A;  4J8L A;  3EIB A;  2JJF A;  1N31 A;  4H63 Q;  2AEV A;  1AHG A;  2VMV A;  2O1B A;  2W7D A;  4ATP A;  1S0A A;  1YOO A;  3EI6 A;  2CY8 A;  3MAD A;  3N5M A;  3COG A;  3PDX A;  4OMA A;  2HOZ A;  4DQ6 A;  2VMN A;  1ARH A;  5F9S A;  2FKI A;  5C6U A;  2EZ1 A;  3BC8 A;  1BS0 A;  3VP6 A;  5TF5 A;  2WK9 A;  1BQD A;  4PVF A;  2AAT A;  2D5Y A;  1ASC A;  4F4E A;  1C9C A;  1WYT A;  1Z3Z A;  1W23 A;  5KTB A;  1IX6 A;  1X29 A;  3LVJ A;  1J04 A;  4M2J A;  2BI2 A;  2AY7 A;  3WCN A;  4W5K A;  4JEW A;  1B9H A;  4ZDL A;  4WLH A;  3PD6 B;  3G0T A;  1PMM A;  3W1J A;  1AHY A;  3VK3 A;  4LC3 A;  3AEO A;  1PFF A;  4W8I A;  1AMS A;  2BWP A;  1UU0 A;  2C44 A;  2ORD A;  3G8M A;  3HMU A;  3K28 A;  4A72 A;  1EJI A;  1LS3 A;  1AHE A;  1AKC A;  1CQ8 A;  2AY4 A;  3HLM A;  1WKG A;  3ZRP A;  1ASA A;  2FN6 A;  3E2F A;  4IYO A;  1YIY A;  1DTY A;  2CJG A;  2YRI A;  2GSA A;  5D95 A;  3RCH B;  1QJ3 A;  1KMJ A;  3DR4 A;  1X28 A;  2BYJ A;  4ZSW A;  3WKR A;  4XK1 A;  5EUD A;  4MKK A;  1UU2 A;  2V1P A;  4IW7 A;  1M0P A;  4MQP A;  4EMY A;  2D61 A;  2VMY A;  2WKA A;  1RVY A;  1BJO B;  3LVK A;  1UKJ A;  1G4X A;  1GDE A;  1XI9 A;  2KFP A;  4TV7 A;  2JIS A;  2EPJ A;  4ZSY A;  5J8Q A;  1G7W A;  3I5T A;  4WYG A;  3WY7 A;  1QJ5 A;  1MDZ A;  2AY9 A;  2HZP A;  3NUB A;  2QMA A;  3VOM A;  3EI8 A;  3JWA A;  4LW2 A;  3KGX A;  3FTB A;  4AZK A;  2W8W A;  5I92 A;  1D7R A;  1GBN A;  1AY8 A;  3BN1 A;  3JU7 A;  3MAF A;  5HXX A;  4A6R A;  1AIB A;  1LW5 A;  1O69 A;  1M0N A;  1AHX A;  1W7L A;  2VMU A;  4F5F A;  2CTZ A;  2VMO A;  1OAT A;  1OXP A;  4WB0 B;  4E77 A;  4WBT A;  1MGV A;  2C81 A;  3I16 A;  3NYT A;  4Y0D A;  4EFF A;  4F5L A;  1QIS A;  3AAT A;  2ZY5 A;  2CAN A;  2VGU A;  2FNI A;  1FG7 A;  1OXO A;  1RV4 A;  1GD9 A;  3F0H A;  2AY2 A;  5E4Z A;  5E5I A;  3AEJ A;  3UE8 A;  1DJU A;  2VLF A;  4EB5 A;  3LVL B;  1OHY A;  3PIU A;  2DR1 A;  2AY6 A;  4UHN A;  4QGR A;  3EUC A;  2O0R A;  2JG2 A;  3FFH A;  4WP0 A;  3FD0 A;  5EAA A;  1MLZ A;  2Q7W A;  1AJS A;  2X5D A;  1V2D A;  3EI7 A;  1U08 A;  3D6K A;  3EI5 A;  3M5U A;  1CQ7 A;  4ZAS A;  1SF2 A;  2W7L A;  5K8B A;  3ISL A;  1B8G A;  3GZD C;  4RIT A;  3BCB A;  2DGK A;  4A0F A;  4A0H A;  2ZUK A;  4ADB A;  4B98 A;  4CXQ A;  4W1W A;  1ZOD A;  3R9A A;  5FT6 A;  2XH1 A;  3DRD A;  3HT4 A;  5M46 A;  5BJ3 A;  2FM1 A;  4GRX A;  3AOV A;  3FZ6 A;  2W7E A;  4GE9 A;  3VK2 A;  4BMK A;  2C0R A;  2BWO A;  3AEM C;  2VI9 A;  2YKY A;  3PPL A;  3QN6 A;  1T3I A;  3LVM A;  1ARS A;  1M0Q A;  3ELE A;  3E9K A;  2BYL A;  2HP2 A;  4JF1 A;  4BHD A;  2WK7 A;  2BWN A;  5BJ4 A;  1C0N A;  3E2Y A;  1EG5 A;  2VMX A;  3A9Z A;  3ATH A;  1QZ9 A;  1S09 A;  4AO4 A;  3QGU A;  4NOG A;  4Q6R A;  1BJ4 A;  4MSO A;  3WGB A;  2Z67 A;  4ADE A;  5LHA A;  3NX3 A;  3LY1 A;  3PDB B;  4B9B A;  1BJN A;  4WXG A;  2JJE A;  1D7S A;  3E2Z A;  2CFB A;  2DOU A;  4OBU A;  2D7Y A;  4AO9 A;  4ZAH A;  3BV0 A;  3PA9 A;  4XJL A;  1V2F A;  1ASF A;  5G4J A;  3MC6 C;  5EIG B;  3T32 A;  5G2Q A;  4ADD A;  4R2N A;  4EB7 A;  1GC0 A;  3FZ8 A;  2HOR A;  1GEX A;  2W7H A;  3NU8 A;  5FT4 A;  4A00 A;  3GSB A;  4TMR A;  2DGM A;  4JF0 A;  3MAU A;  5LH9 A;  3MBB A;  2HOX A;  4RM1 A;  1MLY A;  2YCN A;  2GMS A;  3WLX A;  1I41 A;  2OAT A;  2BKW A;  3HBX A;  3CAI A;  4OT8 A;  1DKA A;  3BWN A;  4PFF A;  2VYC A;  1LW4 A;  1ELQ A;  1B5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...