4AZJA

Structural basis of l-phosphoserine binding to bacillus alcalophilus phosphoserine aminotransferase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
360
structure length
360
Chain Sequence
VKQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLNTKVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSLMNVTFNLRNEELNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKENA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOSERINE AMINOTRANSFERASE
publication title Structural Basis of L-Phosphoserine Binding to Bacillus Alcalophilus Phosphoserine Aminotransferase
pubmed doi rcsb
source organism Bacillus alcalophilus
molecule tags Transferase
total genus 128
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 2.6.1.52: Phosphoserine transaminase.
pdb deposition date 2012-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4azjA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4azjA02
1AMQA 3JWAA 3E2ZA 1WYVA 3FQ8A 2R5CA 2ZSLA 2AATA 4GE7A 1D7SA 3LV2A 1PMMA 4K2IA 1ARGA 2OKJA 2GMSA 2Q7WA 3K28A 1C7GA 1FC4A 2CANA 4CXQA 2DOUA 2YKUA 3GWPA 3GZDC 1VEFA 4WD2A 4XAUA 5EAAA 4EB5A 1OHYA 2CTZA 1BJOA 1N31A 2ZP7A 3L44A 3FZ8A 2C81A 2VGZA 1M32A 4XK1A 2OATA 4DGTA 2BI9A 2X5DA 5G0AA 1X0MA 4E3RA 1W3UA 4IXOA 3AENA 3P6KA 3ZZKA 2W7EA 1CJ0A 1EJIA 1MDOA 3B1EA 3DXVA 4EB7A 4U2HA 1S06A 4W1XA 2WK7A 3ASAA 1AHFA 3BB8A 3WX9A 1M0PA 3NYUA 3WGBA 4F5IA 3D6KA 1IX6A 1IBJA 2AY1A 2XH1A 2X8UA 2QB2A 3LVLB 4FFCA 4Q6RA 5E3KA 7AATA 1BW0A 1PMOA 2W8VA 3NTJA 2YKVA 3E2FA 1CZCA 4AO9A 4JF1A 4GDYA 3HVYA 2Z1YA 1ASEA 2OGAA 1TASA 3ECDA 3EZSA 3E9KA 1UU2A 2QLRA 3TQXA 4GEBA 4XJOA 4ITGA 3WZFA 1WYTA 3BCAA 9AATA 2Z20A 2E7IA 1WYUA 1GBNA 3I16A 3WLXA 4XQ2A 3CAIA 3JU7A 3VK4A 5I92A 2RFVA 3RQ1A 1AJSB 1V2EA 1AAMA 4A0RA 1UU0A 1MLZA 4MGRA 2W7HA 1O69A 1UKJA 1MDZA 1G4XA 4OCAA 3NU8A 2VMXA 1KMKA 2ZUKA 3A9ZA 3WGCA 2W7MA 4F5GA 1B8GA 2VMVA 3H14A 5C6UA 2ZY3A 2JISA 3FRKA 3DR4A 1LC8A 1GCKA 5DX5A 2O7CA 4J8LA 1V2DA 2W7IA 2BI3A 5F9SA 5HXXA 1ASBA 1ZOBA 2D65A 3PA9A 1O4SA 2VMRA 4PVFA 3G0TA 4IX8A 4WBTA 3RUYA 1UU1A 2Z9UA 2AY5A 1S07A 4ADDA 1TATA 5G4IA 1IAXA 4I8AA 4ATPA 1QJ5A 2G6WA 2VMNA 3DU4A 4K2BA 3TFUA 5J8QA 3RBLA 1IVRA 3MADA 2Z1ZA 1AIAA 4ITXA 2ZY4A 2BI5A 3HT4A 3A9YA 5M4BA 4R8DA 2D63A 2FYFA 3RBFA 1Y4IA 1ECXA 4Y0DA 1B9HA 1SZKA 5M49A 3F9TA 4IXZA 1N8PA 1YIYA 3LVJA 5EFSA 4MQPA 3NUIA 2JGTA 4Q75A 3NDNA 4GSAA 2YRIA 2VGTA 2AEVA 3BWNC 2YCTA 5BJ3A 2HUIA 3DR7A 4LNMA 1QGNA 3KE3A 3FVUA 2W7LA 1GC0A 4ATQA 4A0HA 4KXKA 3DRDA 3ASBA 1D7VA 1I29A 1RVYA 1RV3A 1O61A 2ZC0A 3AEJC 3KGWA 4R2NA 2CFBA 4F5LA 2AEUA 2DKBA 2QBTA 1SZUA 1Z7DA 3FKDA 3UE8A 1AAWA 3VOMA 3OP7A 3DZZA 4HF8A 4H51A 3T32A 1KL1A 2VMYA 3JTXA 1AJSA 1EG5A 3GETA 1ARIA 3N75A 2HUFA 4DQ6A 4PFFA 2OQXA 3MC6C 4GE4A 1GEYA 5IWQA 4P3MA 1I43A 5AX8A 3TFTA 3GR9A 5D95A 3GZDA 5EUDA 5K8BA 4IXSA 3HQTA 1G4VA 3AOWA 4F5FA 3P1TA 3N0LA 1ASLA 4MQQA 3B1CA 1BJ4A 4DBCA 1S09A 1T3IA 4ZWVA 5G09A 1W7LA 3BN1A 1AX4A 3FVSA 3NYSA 4OBVA 4HVKA 1EQBA 4MKJA 1M0QA 3DXWA 1C7NA 3PDBB 4XEWA 3ZZJA 4M2MA 4ZSYA 1W7MA 1U08A 2VMTA 3Q8NA 1S08A 4JEYA 4MSOA 4ZM4A 1V2FA 1BJNA 3FZ7A 1CQ7A 1ARTA 4WYFA 1CQ6A 1X28A 4M2KA 1JF9A 4LNJA 4WXBA 3WY7A 2VGVA 2F8JA 3VAXA 2GQNA 3VK2A 2NMPA 5DJ1A 4CBRA 3R9AA 1AJRA 2AY7A 4JE5D 1AHGA 1JS6A 2BKWA 4R5FA 1FG7A 1QZ9A 2W7KA 1QIRA 2EZ2A 3MKJA 4XJLA 1ELUA 1ASGA 1LS3A 1W23A 1YAAA 1BS0A 2BIEA 1B5OA 1YJZA 3NRAA 5LH9A 1H1CA 1ZC9A 2DKJA 2E7JA 3FDDA 3BCBA 1OATA 2GMUA 3WKSA 4A72A 2O1BA 1DJUA 3VP6A 3CBFA 2QA3A 3FZ6A 4OT8A 4WB0B 3ZRPA 3B46A 4UHNA 1SFFA 4WYAA 4F5HA 1AICA 2WKAA 2Z9WA 1TOEA 4RKDA 3QHXA 4JEVA 3M5UA 2BWPA 4BMKA 1RV4A 3FFHA 2W8TA 3IF2A 2VGWA 3HL2A 3FFRA 3E2YA 1BKGA 4A6UA 1M0NA 1YIZA 2D61A 2HP1A 4ADEA 4RAEA 4RIZA 1PG8A 2DGLA 3LG0A 3NX3A 1IX7A 2VI9A 4A6RA 2BWNA 2BYLA 3B1DA 3BS8A 2D5YA 1ZODA 2C0RA 2VMWA 2YCNA 1AIBA 1MAQA 2VMUA 2VMZA 3EI6A 3EI8A 3PJ0A 4FL0A 4K2MA 3QBOA 1LW4A 3UAKA 1C9CA 2YCPA 3EI7A 5EUEA 1PFFA 4LW4A 1YJSA 5M4DA 2OGEA 3IHJA 5LHAA 3DC1A 1XEYA 3DYDA 1BQAA 4RITA 3PGYA 2R2NA 2CSTA 3TATA 1BT4A 3BC8A 2CY8A 2PB2A 3RI6A 1DGDA 2PB0A 3FDBA 4OBUA 2D7YA 3A8UX 1OHWA 3RCHB 3AELA 2ZSMA 1IUGA 1I48A 4ZDPA 2YRRA 1MDXA 1YJYA 1Z3ZA 1QISA 3II0A 1ASNA 2W7JA 3PDBA 3PD6B 1LKCA 4A6TA 4WYCA 2ORDA 3G8MA 1MLYA 3LY1A 1DGEA 4EU1A 4TV7A 4JEZA 5EUNA 4BQ0A 3NYTA 4RJYA 3MBBA 4LW2A 4KAMA 3EIBA 1J32A 1CZEA 3E2ZB 2R5CB 1M4NA 1MGVA 3BWNA 3AEMA 3HDOA 3NNKA 2X5FA 4F5JA 1VP4A 4AZJA 1M6SA 1TOKA 2E7UA 4MQRA 3MEBA 4ZAHA 1GEXA 1CS1A 1TPLA 2V0YA 3AATA 3AEJA 4N0WA 4W5KA 5EIGB 1OXOA 4A00A 4BA4A 8AATA 2HOZA 2JJHA 3BWOA 3QPGA 1D2FA 4WLJA 1DKAA 2YKXA 4KYOA 5E4ZA 3PDXA 3NU7A 1ASAA 4IY7A 4W8IA 3AOVA 3MAFB 1JG8A 4UQVA 1C4KA 1ASCA 4WB0A 4LNLA 1OXPA 1TOIA 1V72A 2HOXA 4WXGA 5JAYA 4BA5A 2C7TA 3ELPA 4ZLVA 3QM2A 3R4TA 1GC4A 1RVUA 3NUBA 3AV7A 1MAPA 3LWSA 2VIBA 1BQDA 4JEXA 4WYEA 2BWOA 2X3LA 3FTBA 2CJGA 1AMAA 2CJDA 3CQ5A 4AO4A 2VMQA 2YKYA 2CH2A 2BYJA 5BJ4A 2FM1A 2Z61A 1AY5A 4ISYA 1ARHA 2CB1A 1YOOA 4P7YA 4QGRA 2AY6A 3FSLA 1QJ3A 4PIWA 2HUUA 2FNUA 2W8UA 4W1WA 5FT6A 4WXFA 3FVXA 3ACZA 2EH6A 1IX8A 2W7GA 3CQ4A 4IYOB 2D66A 1VJOA 4OMAA 5EQCA 3EIAA 1KKJA 3PAAA 3RCHA 4UOYA 1AHXA 4EFFA 2VLFA 2EGYA 2Z67A 4ZDLA 2CH1A 3A9XA 4AZKA 3FQ7A 2W8JA 3PD6A 2ZYJA 2VMPA 2W7DA 2EO5A 3A2BA 1QITA 4Q76A 1AMRA 1TARA 2AY3A 3L8AA 3QGUA 4TN4A 3QI6A 4ZSWA 4R5ZA 3ISLA 3JWBA 3LVMA 1AMSA 3MAUA 2D64A 2Z9VA 4J5UA 2AY4A 4JE5A 2QB3A 2BIAA 2JJFA 2PO3A 2XBNA 5DJ9A 1E5FA 2WK8A 5G4JA 3ZRQA 1C7OA 3GBXA 1WKGA 5E5IA 1X29A 4EMYA 4MKKA 1GC3A 4RJ0A 4W91A 2R0TA 5EIGA 3B8XA 1D7RA 1B4XA 1FG3A 2VLHA 3CQ6A 4XJPA 3W1IA 1W7NA 2TPLA 5F8VA 2HORA 3MAFA 5G2QA 3VK3A 3GJUA 1CL2A 3DODA 4TMRA 2AY2A 2FNIA 5G2PA 4RKCA 4U1TA 4AOAA 4W1VA 3JW9A 3I4JA 4XJMA 2FQ6A 3F6TA 1J04A 1DJEA 1G7WA 1IAYA 3K40A 4L0OA 4ZASA 2VYCA 2Z9XA 1CL1A 1D7UA 1H0CA 3HBXA 1KKPA 4PFNA 2W8WA 5HHYA 2JJEA 2W7FA 4Q31A 1M7YA 3WKRA 3W1HA 3ZRRA 4F5MA 2BHXA 2BI1A 1TOJA 2GB3A 1TOGA 4GRXA 4E3QA 2BI2A 4O6ZA 2HOYA 3H7FA 3PPLA 4N0BA 3BCXA 1GDEA 3QN6A 1YNUA 3G7QA 1GC2A 2VGUA 3EI9A 4IYOA 3ELEA 4RM1A 5M46A 1IJIA 1WKHA 4CVQA 5D5SA 3FQAA 4CBSA 2ZY5A 1X2AA 2D7ZA 2QMAA 1SPAA 2O0RA 3WCNA 4UHMA 2R5EA 2YOBA 5FT8A 4B9BA 3W1JA 4JEWA 4F5KA 4RLGA 3E6GA 1AHEA 2CINA 2DGKA 4WLHA 2ZY2A 4CXRA 3JZLA 1DJ9A 1KL2A 1LC7A 1GD9A 3EUCA 2HP2A 4OYTA 3HLMA 2ZJGA 2VMOA 1WYVB 5FT5A 4IW7A 1LC5A 4Y0IA 3KGXA 1BJWA 2GSAA 1C0NA 2VIAA 4JF0A 3COGA 4ADCA 1P3WA 1LK9A 4BHDA 3AEPA 1JS3A 1WSTA 1BJOB 1DTYA 1B9IA 1AKAA 2OKKA 4MY5A 1E5EA 2VI8A 3FD0A 1OHVA 1ASFA 3K7YA 3GSBA 4ADBA 1SVVA 3F0HA 3AENB 2VMSA 4E1OA 4ZM3A 2CJHA 3MC6A 2BIGA 2DGMA 1S0AA 2C44A 5TF5A 4OTLA 2AY9A 1AKCA 2VGSA 3FCRA 4AH3A 2EZ1A 3E77A 2DR1A 2JJGA 4UHOA 4ZDOA 1N2TA 4F4EA 3KKIA 4A0FA 1CQ8A 4E77A 1SF2A 2FN6A 4LC3A 4M2JA 4OC9A 3I5TA 3HMUA 3OKSA 1B5PA 4NOGA 1LW5A 1WYTB 3AEMC 1SZSA 1I41A 4GE9A 1WYUB 4WP0A 4WYGA 4A0GA 1XI9A 1ARSA 4WYDA 1GEWA 3USFA 4B98A 1O62A 3EI5A 3GZCA 2E54A 1AHYA 1AY8A 2WK9A 3EZ1A 3N5MA 1M0OA 3BV0A 5DB5A 3WCOA 5FT4A 3ATHA 2EPJA 5HDMA 1ORDA 2AY8A 2JG2A 1ELQA 2V1PA 3TCMA 1ASDA 1KMJA 3AEOA 4Y0HA 3UWCA 4ZWMA 1ASMA 3PIUA 5EAVA 2YHKA 3LVKA 1DFOA 1G7XA 2HZPA 1AY4A 1AKBA
chains in the Genus database with same CATH superfamily
1AMQA 3JWAA 3E2ZA 1WYVA 3FQ8A 2R5CA 2ZSLA 2AATA 4GE7A 1D7SA 3LV2A 1PMMA 4K2IA 1ARGA 2OKJA 2GMSA 2Q7WA 3K28A 1C7GA 1FC4A 2CANA 4CXQA 2DOUA 2YKUA 3GWPA 3GZDC 1VEFA 4WD2A 4XAUA 5EAAA 4EB5A 1OHYA 2CTZA 1BJOA 1N31A 2ZP7A 3N4XA 3L44A 3FZ8A 2C81A 2VGZA 1M32A 4XK1A 2OATA 4DGTA 2BI9A 2X5DA 5G0AA 1X0MA 4E3RA 1W3UA 4IXOA 3AENA 3P6KA 3ZZKA 2W7EA 1CJ0A 1EJIA 1MDOA 3B1EA 3DXVA 4EB7A 4U2HA 1S06A 4W1XA 2WK7A 3ASAA 1AHFA 3BB8A 3WX9A 1M0PA 3NYUA 3WGBA 4F5IA 3D6KA 1IX6A 1IBJA 2AY1A 2XH1A 2X8UA 2QB2A 3LVLB 4FFCA 4Q6RA 5E3KA 7AATA 1BW0A 1PMOA 2W8VA 3NTJA 2YKVA 3E2FA 1CZCA 4AO9A 4JF1A 4GDYA 3HVYA 2Z1YA 1ASEA 2OGAA 1TASA 3ECDA 3EZSA 3E9KA 1UU2A 2QLRA 3TQXA 4GEBA 4XJOA 4ITGA 3WZFA 1WYTA 3BCAA 9AATA 2Z20A 2E7IA 1WYUA 1GBNA 3I16A 3WLXA 4XQ2A 3CAIA 3JU7A 3VK4A 5I92A 2RFVA 3RQ1A 2EYQA 1AJSB 1V2EA 1AAMA 4A0RA 1UU0A 1MLZA 4MGRA 2W7HA 1O69A 1UKJA 1MDZA 1G4XA 4OCAA 3NU8A 2VMXA 1KMKA 2ZUKA 3A9ZA 3WGCA 2W7MA 4F5GA 1B8GA 2VMVA 3H14A 5C6UA 2ZY3A 2JISA 2QSRA 3FRKA 3DR4A 1LC8A 1GCKA 5DX5A 2O7CA 4J8LA 1V2DA 2W7IA 2BI3A 5F9SA 5HXXA 1ASBA 1ZOBA 2D65A 3PA9A 1O4SA 2VMRA 4PVFA 3G0TA 4IX8A 4WBTA 3RUYA 1UU1A 2Z9UA 2AY5A 1S07A 4ADDA 1TATA 5G4IA 1IAXA 4I8AA 4ATPA 1QJ5A 2G6WA 2VMNA 3DU4A 4K2BA 3TFUA 5J8QA 3RBLA 3N7NA 1IVRA 3MADA 2Z1ZA 1AIAA 4ITXA 2ZY4A 2BI5A 3HT4A 3A9YA 5M4BA 4R8DA 2D63A 2FYFA 3RBFA 1Y4IA 1ECXA 4Y0DA 1B9HA 1SZKA 5M49A 3F9TA 4IXZA 1N8PA 1YIYA 3LVJA 5EFSA 4MQPA 3NUIA 2JGTA 3N4RA 4Q75A 3NDNA 4GSAA 2YRIA 2VGTA 2AEVA 3BWNC 2YCTA 5BJ3A 2HUIA 3DR7A 4LNMA 1QGNA 3KE3A 3FVUA 2W7LA 1GC0A 4ATQA 4A0HA 4KXKA 3DRDA 3ASBA 1D7VA 1I29A 1RVYA 1RV3A 1O61A 2ZC0A 3AEJC 3KGWA 4R2NA 2CFBA 4F5LA 2AEUA 2DKBA 2QBTA 1SZUA 1Z7DA 3FKDA 3UE8A 1AAWA 3VOMA 3OP7A 3DZZA 4HF8A 4H51A 3T32A 1KL1A 2VMYA 3JTXA 4H63Q 1AJSA 1EG5A 3GETA 1ARIA 3N75A 2HUFA 4DQ6A 4PFFA 2OQXA 3MC6C 4GE4A 1GEYA 5IWQA 4P3MA 1I43A 5AX8A 3TFTA 3GR9A 5D95A 3GZDA 5EUDA 5K8BA 4IXSA 3HQTA 1G4VA 3AOWA 4F5FA 3P1TA 3N0LA 1ASLA 4MQQA 3B1CA 1BJ4A 4DBCA 1S09A 1T3IA 4ZWVA 5G09A 1W7LA 3BN1A 1AX4A 3FVSA 3NYSA 4OBVA 4HVKA 1EQBA 4MKJA 1M0QA 3DXWA 1C7NA 3PDBB 4XEWA 3ZZJA 4M2MA 4ZSYA 1W7MA 1U08A 2VMTA 3Q8NA 1S08A 4JEYA 4MSOA 4ZM4A 1V2FA 1BJNA 3FZ7A 1CQ7A 1ARTA 4WYFA 1CQ6A 1X28A 4M2KA 1JF9A 4LNJA 4WXBA 3WY7A 2VGVA 2F8JA 3VAXA 2GQNA 3VK2A 2NMPA 5DJ1A 4CBRA 3R9AA 1AJRA 2AY7A 4JE5D 1AHGA 1JS6A 2BKWA 4R5FA 1FG7A 1QZ9A 2W7KA 1QIRA 2EZ2A 3MKJA 4XJLA 1ELUA 1ASGA 1LS3A 1W23A 1YAAA 1BS0A 2BIEA 1B5OA 1YJZA 3NRAA 5LH9A 1H1CA 1ZC9A 2DKJA 2E7JA 3FDDA 3BCBA 1OATA 2GMUA 3WKSA 4A72A 2O1BA 1DJUA 3VP6A 3CBFA 2QA3A 3FZ6A 4OT8A 4WB0B 3ZRPA 3B46A 4UHNA 1SFFA 4WYAA 4F5HA 1AICA 2WKAA 2Z9WA 1TOEA 4RKDA 3QHXA 1KAFA 4JEVA 3M5UA 2BWPA 4BMKA 1RV4A 3FFHA 2W8TA 3IF2A 2VGWA 3HL2A 3FFRA 3E2YA 1BKGA 4A6UA 1M0NA 1YIZA 2D61A 2HP1A 4ADEA 4RAEA 4RIZA 1PG8A 2DGLA 3LG0A 3NX3A 1IX7A 2VI9A 4A6RA 2BWNA 2BYLA 3B1DA 3BS8A 2D5YA 1ZODA 2C0RA 2VMWA 2YCNA 1AIBA 1MAQA 2VMUA 2VMZA 3EI6A 3EI8A 3PJ0A 4FL0A 4K2MA 3QBOA 1LW4A 3UAKA 1C9CA 2YCPA 3EI7A 5EUEA 1PFFA 4LW4A 1YJSA 5M4DA 2OGEA 3IHJA 5LHAA 3DC1A 1XEYA 3DYDA 1BQAA 4RITA 3PGYA 2R2NA 2CSTA 2FKIA 3TATA 1BT4A 3BC8A 2CY8A 2PB2A 3RI6A 1DGDA 2PB0A 3FDBA 4OBUA 2D7YA 3A8UX 1OHWA 3RCHB 3AELA 2ZSMA 1IUGA 1I48A 4ZDPA 2YRRA 1MDXA 1YJYA 1Z3ZA 1QISA 3II0A 1ASNA 2W7JA 3PDBA 3PD6B 1LKCA 4A6TA 4WYCA 2ORDA 3G8MA 1MLYA 3LY1A 1DGEA 4EU1A 4TV7A 4JEZA 5EUNA 4BQ0A 3NYTA 4RJYA 3MBBA 4LW2A 4KAMA 3EIBA 1J32A 1CZEA 3E2ZB 2R5CB 1M4NA 1MGVA 3BWNA 3AEMA 3HDOA 3NNKA 2X5FA 4F5JA 1VP4A 4AZJA 1M6SA 1TOKA 2E7UA 4MQRA 3MEBA 4ZAHA 1GEXA 1CS1A 1TPLA 2V0YA 3AATA 3AEJA 4N0WA 4W5KA 5EIGB 1OXOA 4A00A 4BA4A 8AATA 2HOZA 2JJHA 3BWOA 3QPGA 1D2FA 4WLJA 1DKAA 2YKXA 4KYOA 5E4ZA 3PDXA 3NU7A 1ASAA 4IY7A 4W8IA 3AOVA 3MAFB 1JG8A 4UQVA 1C4KA 1ASCA 4WB0A 4LNLA 1OXPA 1TOIA 1V72A 2HOXA 4WXGA 2KFPA 5JAYA 4BA5A 2C7TA 3ELPA 4ZLVA 3QM2A 3R4TA 1GC4A 1RVUA 3NUBA 3AV7A 1MAPA 3LWSA 2VIBA 1BQDA 4JEXA 4WYEA 2BWOA 2X3LA 3FTBA 2CJGA 1AMAA 2CJDA 3CQ5A 4AO4A 2VMQA 2YKYA 2CH2A 2BYJA 5BJ4A 2FM1A 2Z61A 1AY5A 4ISYA 1ARHA 2CB1A 1YOOA 4P7YA 4QGRA 2AY6A 3FSLA 1QJ3A 4PIWA 2HUUA 2FNUA 2W8UA 4W1WA 5FT6A 4WXFA 3FVXA 3ACZA 2EH6A 1IX8A 2W7GA 3CQ4A 4IYOB 2D66A 1VJOA 4OMAA 5EQCA 3EIAA 1KKJA 3PAAA 3RCHA 3N4SA 4UOYA 1AHXA 4EFFA 2VLFA 2EGYA 2Z67A 4ZDLA 2CH1A 3A9XA 4AZKA 3FQ7A 2W8JA 3PD6A 2ZYJA 2VMPA 2W7DA 2EO5A 3A2BA 1QITA 4Q76A 1AMRA 1TARA 2AY3A 3L8AA 3QGUA 4TN4A 3QI6A 4ZSWA 4R5ZA 3ISLA 3JWBA 3LVMA 1AMSA 3MAUA 2D64A 2Z9VA 4J5UA 2AY4A 4JE5A 2QB3A 2BIAA 2JJFA 2PO3A 2XBNA 5DJ9A 1E5FA 2WK8A 5G4JA 3ZRQA 1C7OA 3GBXA 1WKGA 5E5IA 1X29A 4EMYA 4MKKA 1GC3A 4RJ0A 4W91A 2R0TA 5EIGA 3B8XA 1D7RA 1B4XA 1FG3A 2VLHA 3CQ6A 4XJPA 3W1IA 1W7NA 2TPLA 5F8VA 2HORA 3MAFA 5G2QA 3VK3A 3GJUA 1CL2A 3DODA 4TMRA 2AY2A 2FNIA 5G2PA 4RKCA 4U1TA 4AOAA 4W1VA 3JW9A 3I4JA 4XJMA 2FQ6A 3F6TA 1J04A 1DJEA 1G7WA 1IAYA 3K40A 4L0OA 4ZASA 2VYCA 2Z9XA 1CL1A 1D7UA 1H0CA 3HBXA 1KKPA 4PFNA 2W8WA 5HHYA 2JJEA 2W7FA 4Q31A 1M7YA 3WKRA 3W1HA 3ZRRA 4F5MA 2BHXA 2BI1A 1TOJA 2GB3A 1TOGA 4GRXA 4E3QA 2BI2A 2G7JA 4O6ZA 2HOYA 3H7FA 3PPLA 4N0BA 3BCXA 1GDEA 3QN6A 1YNUA 3G7QA 1GC2A 2VGUA 3EI9A 4IYOA 3ELEA 4RM1A 5M46A 1IJIA 1WKHA 4CVQA 5D5SA 3FQAA 4CBSA 2ZY5A 1X2AA 2D7ZA 2QMAA 1SPAA 2O0RA 3WCNA 4UHMA 2R5EA 2YOBA 5FT8A 4B9BA 3W1JA 4JEWA 4F5KA 4RLGA 3E6GA 1AHEA 2CINA 2DGKA 4WLHA 2ZY2A 4CXRA 3JZLA 1DJ9A 1KL2A 1LC7A 1GD9A 3EUCA 2HP2A 4OYTA 3HLMA 2ZJGA 2WB6A 2VMOA 1WYVB 5FT5A 4IW7A 1LC5A 4Y0IA 3KGXA 1BJWA 2GSAA 1C0NA 2VIAA 4JF0A 3COGA 4ADCA 1P3WA 1LK9A 4BHDA 3AEPA 1JS3A 1WSTA 1BJOB 1DTYA 1B9IA 1AKAA 2OKKA 4MY5A 1E5EA 2VI8A 3FD0A 1OHVA 1ASFA 3K7YA 3H9XA 3GSBA 4ADBA 1SVVA 3F0HA 3AENB 2VMSA 4E1OA 4ZM3A 2CJHA 3MC6A 2BIGA 2DGMA 1S0AA 2C44A 5TF5A 4OTLA 2AY9A 1AKCA 2VGSA 3FCRA 4AH3A 2EZ1A 3E77A 2DR1A 2JJGA 4UHOA 4ZDOA 1N2TA 4F4EA 3KKIA 4A0FA 1CQ8A 4E77A 1SF2A 2FN6A 4LC3A 4M2JA 4OC9A 3I5TA 3HMUA 3OKSA 1B5PA 2A1VA 5KTBA 4NOGA 1LW5A 1WYTB 3AEMC 1SZSA 1I41A 4GE9A 1WYUB 4WP0A 4WYGA 4A0GA 1XI9A 1ARSA 4WYDA 1GEWA 3USFA 4B98A 1O62A 3EI5A 3GZCA 2E54A 1AHYA 1AY8A 2WK9A 3EZ1A 3N5MA 1M0OA 3BV0A 5DB5A 3WCOA 5FT4A 3ATHA 2EPJA 5HDMA 1ORDA 2AY8A 2JG2A 1ELQA 2V1PA 3TCMA 1ASDA 1KMJA 3AEOA 4Y0HA 3UWCA 4ZWMA 1ASMA 3PIUA 5EAVA 4K05A 2YHKA 3LVKA 1DFOA 1G7XA 2HZPA 1AY4A 1AKBA
chains in the Genus database with same CATH topology
1AMQA 3JWAA 3E2ZA 1WYVA 3FQ8A 2R5CA 2ZSLA 2AATA 4GE7A 1D7SA 3LV2A 1PMMA 4K2IA 1ARGA 2OKJA 2GMSA 2Q7WA 3K28A 1C7GA 1FC4A 2CANA 4CXQA 2DOUA 2YKUA 3GWPA 3GZDC 1VEFA 4WD2A 4XAUA 5EAAA 4EB5A 1OHYA 2CTZA 1BJOA 1N31A 2ZP7A 3N4XA 3L44A 3FZ8A 2C81A 2VGZA 1M32A 4XK1A 2OATA 4DGTA 2BI9A 2X5DA 5G0AA 1X0MA 4E3RA 1W3UA 4IXOA 3AENA 3P6KA 3ZZKA 2W7EA 1CJ0A 1EJIA 1MDOA 3B1EA 3DXVA 4EB7A 4U2HA 1S06A 4W1XA 2WK7A 3ASAA 1AHFA 3BB8A 3WX9A 1M0PA 3NYUA 3WGBA 4F5IA 3D6KA 1IX6A 1IBJA 2AY1A 2XH1A 2X8UA 2QB2A 3LVLB 4FFCA 4Q6RA 5E3KA 7AATA 1BW0A 1PMOA 2W8VA 3NTJA 2YKVA 3E2FA 1CZCA 4AO9A 4JF1A 4GDYA 3HVYA 2Z1YA 1ASEA 2OGAA 1TASA 3ECDA 3EZSA 3E9KA 1UU2A 2QLRA 3TQXA 4GEBA 4XJOA 4ITGA 3WZFA 1WYTA 3BCAA 9AATA 2Z20A 2E7IA 1WYUA 1GBNA 3I16A 3WLXA 4XQ2A 3CAIA 3JU7A 3VK4A 5I92A 2RFVA 3RQ1A 2EYQA 1AJSB 1V2EA 1AAMA 4A0RA 1UU0A 1MLZA 4MGRA 2W7HA 1O69A 1UKJA 1MDZA 1G4XA 4OCAA 3NU8A 2VMXA 1KMKA 2ZUKA 3A9ZA 3WGCA 2W7MA 4F5GA 1B8GA 2VMVA 3H14A 5C6UA 2ZY3A 2JISA 2QSRA 3FRKA 3DR4A 1LC8A 1GCKA 5DX5A 2O7CA 4J8LA 1V2DA 2W7IA 2BI3A 5F9SA 5HXXA 1ASBA 1ZOBA 2D65A 3PA9A 1O4SA 2VMRA 4PVFA 3G0TA 4IX8A 4WBTA 3RUYA 1UU1A 2Z9UA 2AY5A 1S07A 4ADDA 1TATA 5G4IA 1IAXA 4I8AA 4ATPA 1QJ5A 2G6WA 2VMNA 3DU4A 4K2BA 3TFUA 5J8QA 3RBLA 3N7NA 1IVRA 3MADA 2Z1ZA 1AIAA 4ITXA 2ZY4A 2BI5A 3HT4A 3A9YA 5M4BA 4R8DA 2D63A 2FYFA 3RBFA 1Y4IA 1ECXA 4Y0DA 1B9HA 1SZKA 5M49A 3F9TA 4IXZA 1N8PA 1YIYA 3LVJA 5EFSA 4MQPA 3NUIA 2JGTA 3N4RA 4Q75A 3NDNA 4GSAA 2YRIA 2VGTA 2AEVA 3BWNC 2YCTA 5BJ3A 2HUIA 3DR7A 4LNMA 1QGNA 3KE3A 3FVUA 2W7LA 1GC0A 4ATQA 4A0HA 4KXKA 3DRDA 3ASBA 1D7VA 1I29A 1RVYA 1RV3A 1O61A 2ZC0A 3AEJC 3KGWA 4R2NA 2CFBA 4F5LA 2AEUA 2DKBA 2QBTA 1SZUA 1Z7DA 3FKDA 3UE8A 1AAWA 3VOMA 3OP7A 3DZZA 4HF8A 4H51A 3T32A 1KL1A 2VMYA 3JTXA 4H63Q 1AJSA 1EG5A 3GETA 1ARIA 3N75A 2HUFA 4DQ6A 4PFFA 2OQXA 3MC6C 4GE4A 1GEYA 5IWQA 4P3MA 1I43A 5AX8A 3TFTA 3GR9A 5D95A 3GZDA 5EUDA 5K8BA 4IXSA 3HQTA 1G4VA 3AOWA 4F5FA 3P1TA 3N0LA 1ASLA 4MQQA 3B1CA 1BJ4A 4DBCA 1S09A 1T3IA 4ZWVA 5G09A 1W7LA 3BN1A 1AX4A 3FVSA 3NYSA 4OBVA 4HVKA 1EQBA 4MKJA 1M0QA 3DXWA 1C7NA 3PDBB 4XEWA 3ZZJA 4M2MA 4ZSYA 1W7MA 1U08A 2VMTA 3Q8NA 1S08A 4JEYA 4MSOA 4ZM4A 1V2FA 1BJNA 3FZ7A 1CQ7A 1ARTA 4WYFA 1CQ6A 1X28A 4M2KA 1JF9A 4LNJA 4WXBA 3WY7A 2VGVA 2F8JA 3VAXA 2GQNA 3VK2A 2NMPA 5DJ1A 4CBRA 3R9AA 1AJRA 2AY7A 4JE5D 1AHGA 1JS6A 2BKWA 4R5FA 1FG7A 1QZ9A 2W7KA 1QIRA 2EZ2A 3MKJA 4XJLA 1ELUA 1ASGA 1LS3A 1W23A 1YAAA 1BS0A 2BIEA 1B5OA 1YJZA 3NRAA 5LH9A 1H1CA 1ZC9A 2DKJA 2E7JA 3FDDA 3BCBA 1OATA 2GMUA 3WKSA 4A72A 2O1BA 1DJUA 3VP6A 3CBFA 2QA3A 3FZ6A 4OT8A 4WB0B 3ZRPA 3B46A 4UHNA 1SFFA 4WYAA 4F5HA 1AICA 2WKAA 2Z9WA 1TOEA 4RKDA 3QHXA 4JEVA 3M5UA 2BWPA 4BMKA 1RV4A 3FFHA 2W8TA 3IF2A 2VGWA 3HL2A 3FFRA 3E2YA 1BKGA 4A6UA 1M0NA 1YIZA 2D61A 2HP1A 4ADEA 4RAEA 4RIZA 1PG8A 2DGLA 3LG0A 3NX3A 1IX7A 2VI9A 4A6RA 2BWNA 2BYLA 3B1DA 3BS8A 2D5YA 1ZODA 2C0RA 2VMWA 2YCNA 1AIBA 1MAQA 2VMUA 2VMZA 3EI6A 3EI8A 3PJ0A 4FL0A 4K2MA 3QBOA 1LW4A 3UAKA 1C9CA 2YCPA 3EI7A 5EUEA 1PFFA 4LW4A 1YJSA 5M4DA 2OGEA 3IHJA 5LHAA 3DC1A 1XEYA 3DYDA 1BQAA 4RITA 3PGYA 2R2NA 2CSTA 2FKIA 3TATA 1BT4A 3BC8A 2CY8A 2PB2A 3RI6A 1DGDA 2PB0A 3FDBA 4OBUA 2D7YA 3A8UX 1OHWA 3RCHB 3AELA 2ZSMA 1IUGA 1I48A 4ZDPA 2YRRA 1MDXA 1YJYA 1Z3ZA 1QISA 3II0A 1ASNA 2W7JA 3PDBA 3PD6B 1LKCA 4A6TA 4WYCA 2ORDA 3G8MA 1MLYA 3LY1A 1DGEA 4EU1A 4TV7A 4JEZA 5EUNA 4BQ0A 3NYTA 4RJYA 3MBBA 4LW2A 4KAMA 3EIBA 1J32A 1CZEA 3E2ZB 2R5CB 1M4NA 1MGVA 3BWNA 3AEMA 3HDOA 3NNKA 2X5FA 4F5JA 1VP4A 4AZJA 1M6SA 1TOKA 2E7UA 4MQRA 3MEBA 4ZAHA 1GEXA 1CS1A 1TPLA 2V0YA 3AATA 3AEJA 4N0WA 4W5KA 5EIGB 1OXOA 4A00A 4BA4A 8AATA 2HOZA 2JJHA 3BWOA 3QPGA 1D2FA 4WLJA 1DKAA 2YKXA 4KYOA 5E4ZA 3PDXA 3NU7A 1ASAA 4IY7A 4W8IA 3AOVA 3MAFB 1JG8A 4UQVA 1C4KA 1ASCA 4WB0A 4LNLA 1OXPA 1TOIA 1V72A 2HOXA 4WXGA 2KFPA 5JAYA 4BA5A 2C7TA 3ELPA 4ZLVA 3QM2A 3R4TA 1GC4A 1RVUA 3NUBA 3AV7A 1MAPA 3LWSA 2VIBA 1BQDA 4JEXA 4WYEA 2BWOA 2X3LA 3FTBA 2CJGA 1AMAA 2CJDA 3CQ5A 4AO4A 2VMQA 2YKYA 2CH2A 2BYJA 5BJ4A 2FM1A 2Z61A 1AY5A 4ISYA 1ARHA 2CB1A 1YOOA 4P7YA 4QGRA 2AY6A 3FSLA 1QJ3A 4PIWA 2HUUA 2FNUA 2W8UA 4W1WA 5FT6A 4WXFA 3FVXA 3ACZA 2EH6A 1IX8A 2W7GA 3CQ4A 4IYOB 2D66A 1VJOA 4OMAA 5EQCA 3EIAA 1KKJA 3PAAA 3RCHA 3N4SA 4UOYA 1AHXA 4EFFA 2VLFA 2EGYA 2Z67A 4ZDLA 2CH1A 3A9XA 4AZKA 3FQ7A 2W8JA 3PD6A 2ZYJA 2VMPA 2W7DA 2EO5A 3A2BA 1QITA 4Q76A 1AMRA 1TARA 2AY3A 3L8AA 3QGUA 4TN4A 3QI6A 4ZSWA 4R5ZA 3ISLA 3JWBA 3LVMA 1AMSA 3MAUA 2D64A 2Z9VA 4J5UA 2AY4A 4JE5A 2QB3A 2BIAA 2JJFA 2PO3A 2XBNA 5DJ9A 1E5FA 2WK8A 5G4JA 3ZRQA 1C7OA 3GBXA 1WKGA 5E5IA 1X29A 4EMYA 4MKKA 1GC3A 4RJ0A 4W91A 2R0TA 5EIGA 3B8XA 1D7RA 1B4XA 1FG3A 2VLHA 3CQ6A 4XJPA 3W1IA 1W7NA 2TPLA 5F8VA 2HORA 3MAFA 5G2QA 3VK3A 3GJUA 1CL2A 3DODA 4TMRA 2AY2A 2FNIA 5G2PA 4RKCA 4U1TA 4AOAA 4W1VA 3JW9A 3I4JA 4XJMA 2FQ6A 3F6TA 1J04A 1DJEA 1G7WA 1IAYA 3K40A 4L0OA 4ZASA 2VYCA 2Z9XA 1CL1A 1D7UA 1H0CA 3HBXA 1KKPA 4PFNA 2W8WA 5HHYA 2JJEA 2W7FA 4Q31A 1M7YA 3WKRA 3W1HA 3ZRRA 4F5MA 2BHXA 2BI1A 1TOJA 2GB3A 1TOGA 4GRXA 4E3QA 2BI2A 2G7JA 4O6ZA 2HOYA 3H7FA 3PPLA 4N0BA 3BCXA 1GDEA 3QN6A 1YNUA 3G7QA 1GC2A 2VGUA 3EI9A 4IYOA 3ELEA 4RM1A 5M46A 1IJIA 1WKHA 4CVQA 5D5SA 3FQAA 4CBSA 2ZY5A 1X2AA 2D7ZA 2QMAA 1SPAA 2O0RA 3WCNA 4UHMA 2R5EA 2YOBA 5FT8A 4B9BA 3W1JA 4JEWA 4F5KA 4RLGA 3E6GA 1AHEA 2CINA 2DGKA 4WLHA 2ZY2A 4CXRA 3JZLA 1DJ9A 1KL2A 1LC7A 1GD9A 3EUCA 2HP2A 4OYTA 3HLMA 2ZJGA 2WB6A 2VMOA 1WYVB 5FT5A 4IW7A 1LC5A 4Y0IA 3KGXA 1BJWA 2GSAA 1C0NA 2VIAA 4JF0A 3COGA 4ADCA 1P3WA 1LK9A 4BHDA 3AEPA 1JS3A 1WSTA 1BJOB 1DTYA 1B9IA 1AKAA 2OKKA 4MY5A 1E5EA 2VI8A 3FD0A 1OHVA 1ASFA 3K7YA 3H9XA 3GSBA 4ADBA 1SVVA 3F0HA 3AENB 2VMSA 4E1OA 4ZM3A 2CJHA 3MC6A 2BIGA 2DGMA 1S0AA 2C44A 5TF5A 4OTLA 2AY9A 1AKCA 2VGSA 3FCRA 4AH3A 2EZ1A 3E77A 2DR1A 2JJGA 4UHOA 4ZDOA 1N2TA 4F4EA 3KKIA 4A0FA 1CQ8A 4E77A 1SF2A 2FN6A 4LC3A 4M2JA 4OC9A 3I5TA 3HMUA 3OKSA 1B5PA 2A1VA 5KTBA 4NOGA 1LW5A 1WYTB 3AEMC 1SZSA 1I41A 4GE9A 1WYUB 4WP0A 4WYGA 4A0GA 1XI9A 1ARSA 4WYDA 1GEWA 3USFA 4B98A 1O62A 3EI5A 3GZCA 2E54A 1AHYA 1AY8A 2WK9A 3EZ1A 3N5MA 1M0OA 3BV0A 5DB5A 3WCOA 5FT4A 3ATHA 2EPJA 5HDMA 1ORDA 2AY8A 2JG2A 1ELQA 2V1PA 3TCMA 1ASDA 1KMJA 3AEOA 4Y0HA 3UWCA 4ZWMA 1ASMA 3PIUA 5EAVA 4K05A 2YHKA 3LVKA 1DFOA 1G7XA 2HZPA 1AY4A 1AKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AMQ A;  3JWA A;  3E2Z A;  1WYV A;  3FQ8 A;  2R5C A;  2ZSL A;  2AAT A;  4GE7 A;  1D7S A;  3LV2 A;  1PMM A;  4K2I A;  1ARG A;  2OKJ A;  2GMS A;  2Q7W A;  3K28 A;  1C7G A;  1FC4 A;  2CAN A;  4CXQ A;  2DOU A;  2YKU A;  3GWP A;  3GZD C;  1VEF A;  4WD2 A;  4XAU A;  5EAA A;  4EB5 A;  1OHY A;  2CTZ A;  1BJO A;  1N31 A;  2ZP7 A;  3L44 A;  3FZ8 A;  2C81 A;  2VGZ A;  1M32 A;  4XK1 A;  2OAT A;  4DGT A;  2BI9 A;  2X5D A;  5G0A A;  1X0M A;  4E3R A;  1W3U A;  4IXO A;  3AEN A;  3P6K A;  3ZZK A;  2W7E A;  1CJ0 A;  1EJI A;  1MDO A;  3B1E A;  3DXV A;  4EB7 A;  4U2H A;  1S06 A;  4W1X A;  2WK7 A;  3ASA A;  1AHF A;  3BB8 A;  3WX9 A;  1M0P A;  3NYU A;  3WGB A;  4F5I A;  3D6K A;  1IX6 A;  1IBJ A;  2AY1 A;  2XH1 A;  2X8U A;  2QB2 A;  3LVL B;  4FFC A;  4Q6R A;  5E3K A;  7AAT A;  1BW0 A;  1PMO A;  2W8V A;  3NTJ A;  2YKV A;  3E2F A;  1CZC A;  4AO9 A;  4JF1 A;  4GDY A;  3HVY A;  2Z1Y A;  1ASE A;  2OGA A;  1TAS A;  3ECD A;  3EZS A;  3E9K A;  1UU2 A;  2QLR A;  3TQX A;  4GEB A;  4XJO A;  4ITG A;  3WZF A;  1WYT A;  3BCA A;  9AAT A;  2Z20 A;  2E7I A;  1WYU A;  1GBN A;  3I16 A;  3WLX A;  4XQ2 A;  3CAI A;  3JU7 A;  3VK4 A;  5I92 A;  2RFV A;  3RQ1 A;  1AJS B;  1V2E A;  1AAM A;  4A0R A;  1UU0 A;  1MLZ A;  4MGR A;  2W7H A;  1O69 A;  1UKJ A;  1MDZ A;  1G4X A;  4OCA A;  3NU8 A;  2VMX A;  1KMK A;  2ZUK A;  3A9Z A;  3WGC A;  2W7M A;  4F5G A;  1B8G A;  2VMV A;  3H14 A;  5C6U A;  2ZY3 A;  2JIS A;  3FRK A;  3DR4 A;  1LC8 A;  1GCK A;  5DX5 A;  2O7C A;  4J8L A;  1V2D A;  2W7I A;  2BI3 A;  5F9S A;  5HXX A;  1ASB A;  1ZOB A;  2D65 A;  3PA9 A;  1O4S A;  2VMR A;  4PVF A;  3G0T A;  4IX8 A;  4WBT A;  3RUY A;  1UU1 A;  2Z9U A;  2AY5 A;  1S07 A;  4ADD A;  1TAT A;  5G4I A;  1IAX A;  4I8A A;  4ATP A;  1QJ5 A;  2G6W A;  2VMN A;  3DU4 A;  4K2B A;  3TFU A;  5J8Q A;  3RBL A;  1IVR A;  3MAD A;  2Z1Z A;  1AIA A;  4ITX A;  2ZY4 A;  2BI5 A;  3HT4 A;  3A9Y A;  5M4B A;  4R8D A;  2D63 A;  2FYF A;  3RBF A;  1Y4I A;  1ECX A;  4Y0D A;  1B9H A;  1SZK A;  5M49 A;  3F9T A;  4IXZ A;  1N8P A;  1YIY A;  3LVJ A;  5EFS A;  4MQP A;  3NUI A;  2JGT A;  4Q75 A;  3NDN A;  4GSA A;  2YRI A;  2VGT A;  2AEV A;  3BWN C;  2YCT A;  5BJ3 A;  2HUI A;  3DR7 A;  4LNM A;  1QGN A;  3KE3 A;  3FVU A;  2W7L A;  1GC0 A;  4ATQ A;  4A0H A;  4KXK A;  3DRD A;  3ASB A;  1D7V A;  1I29 A;  1RVY A;  1RV3 A;  1O61 A;  2ZC0 A;  3AEJ C;  3KGW A;  4R2N A;  2CFB A;  4F5L A;  2AEU A;  2DKB A;  2QBT A;  1SZU A;  1Z7D A;  3FKD A;  3UE8 A;  1AAW A;  3VOM A;  3OP7 A;  3DZZ A;  4HF8 A;  4H51 A;  3T32 A;  1KL1 A;  2VMY A;  3JTX A;  1AJS A;  1EG5 A;  3GET A;  1ARI A;  3N75 A;  2HUF A;  4DQ6 A;  4PFF A;  2OQX A;  3MC6 C;  4GE4 A;  1GEY A;  5IWQ A;  4P3M A;  1I43 A;  5AX8 A;  3TFT A;  3GR9 A;  5D95 A;  3GZD A;  5EUD A;  5K8B A;  4IXS A;  3HQT A;  1G4V A;  3AOW A;  4F5F A;  3P1T A;  3N0L A;  1ASL A;  4MQQ A;  3B1C A;  1BJ4 A;  4DBC A;  1S09 A;  1T3I A;  4ZWV A;  5G09 A;  1W7L A;  3BN1 A;  1AX4 A;  3FVS A;  3NYS A;  4OBV A;  4HVK A;  1EQB A;  4MKJ A;  1M0Q A;  3DXW A;  1C7N A;  3PDB B;  4XEW A;  3ZZJ A;  4M2M A;  4ZSY A;  1W7M A;  1U08 A;  2VMT A;  3Q8N A;  1S08 A;  4JEY A;  4MSO A;  4ZM4 A;  1V2F A;  1BJN A;  3FZ7 A;  1CQ7 A;  1ART A;  4WYF A;  1CQ6 A;  1X28 A;  4M2K A;  1JF9 A;  4LNJ A;  4WXB A;  3WY7 A;  2VGV A;  2F8J A;  3VAX A;  2GQN A;  3VK2 A;  2NMP A;  5DJ1 A;  4CBR A;  3R9A A;  1AJR A;  2AY7 A;  4JE5 D;  1AHG A;  1JS6 A;  2BKW A;  4R5F A;  1FG7 A;  1QZ9 A;  2W7K A;  1QIR A;  2EZ2 A;  3MKJ A;  4XJL A;  1ELU A;  1ASG A;  1LS3 A;  1W23 A;  1YAA A;  1BS0 A;  2BIE A;  1B5O A;  1YJZ A;  3NRA A;  5LH9 A;  1H1C A;  1ZC9 A;  2DKJ A;  2E7J A;  3FDD A;  3BCB A;  1OAT A;  2GMU A;  3WKS A;  4A72 A;  2O1B A;  1DJU A;  3VP6 A;  3CBF A;  2QA3 A;  3FZ6 A;  4OT8 A;  4WB0 B;  3ZRP A;  3B46 A;  4UHN A;  1SFF A;  4WYA A;  4F5H A;  1AIC A;  2WKA A;  2Z9W A;  1TOE A;  4RKD A;  3QHX A;  4JEV A;  3M5U A;  2BWP A;  4BMK A;  1RV4 A;  3FFH A;  2W8T A;  3IF2 A;  2VGW A;  3HL2 A;  3FFR A;  3E2Y A;  1BKG A;  4A6U A;  1M0N A;  1YIZ A;  2D61 A;  2HP1 A;  4ADE A;  4RAE A;  4RIZ A;  1PG8 A;  2DGL A;  3LG0 A;  3NX3 A;  1IX7 A;  2VI9 A;  4A6R A;  2BWN A;  2BYL A;  3B1D A;  3BS8 A;  2D5Y A;  1ZOD A;  2C0R A;  2VMW A;  2YCN A;  1AIB A;  1MAQ A;  2VMU A;  2VMZ A;  3EI6 A;  3EI8 A;  3PJ0 A;  4FL0 A;  4K2M A;  3QBO A;  1LW4 A;  3UAK A;  1C9C A;  2YCP A;  3EI7 A;  5EUE A;  1PFF A;  4LW4 A;  1YJS A;  5M4D A;  2OGE A;  3IHJ A;  5LHA A;  3DC1 A;  1XEY A;  3DYD A;  1BQA A;  4RIT A;  3PGY A;  2R2N A;  2CST A;  3TAT A;  1BT4 A;  3BC8 A;  2CY8 A;  2PB2 A;  3RI6 A;  1DGD A;  2PB0 A;  3FDB A;  4OBU A;  2D7Y A;  3A8U X;  1OHW A;  3RCH B;  3AEL A;  2ZSM A;  1IUG A;  1I48 A;  4ZDP A;  2YRR A;  1MDX A;  1YJY A;  1Z3Z A;  1QIS A;  3II0 A;  1ASN A;  2W7J A;  3PDB A;  3PD6 B;  1LKC A;  4A6T A;  4WYC A;  2ORD A;  3G8M A;  1MLY A;  3LY1 A;  1DGE A;  4EU1 A;  4TV7 A;  4JEZ A;  5EUN A;  4BQ0 A;  3NYT A;  4RJY A;  3MBB A;  4LW2 A;  4KAM A;  3EIB A;  1J32 A;  1CZE A;  3E2Z B;  2R5C B;  1M4N A;  1MGV A;  3BWN A;  3AEM A;  3HDO A;  3NNK A;  2X5F A;  4F5J A;  1VP4 A;  4AZJ A;  1M6S A;  1TOK A;  2E7U A;  4MQR A;  3MEB A;  4ZAH A;  1GEX A;  1CS1 A;  1TPL A;  2V0Y A;  3AAT A;  3AEJ A;  4N0W A;  4W5K A;  5EIG B;  1OXO A;  4A00 A;  4BA4 A;  8AAT A;  2HOZ A;  2JJH A;  3BWO A;  3QPG A;  1D2F A;  4WLJ A;  1DKA A;  2YKX A;  4KYO A;  5E4Z A;  3PDX A;  3NU7 A;  1ASA A;  4IY7 A;  4W8I A;  3AOV A;  3MAF B;  1JG8 A;  4UQV A;  1C4K A;  1ASC A;  4WB0 A;  4LNL A;  1OXP A;  1TOI A;  1V72 A;  2HOX A;  4WXG A;  5JAY A;  4BA5 A;  2C7T A;  3ELP A;  4ZLV A;  3QM2 A;  3R4T A;  1GC4 A;  1RVU A;  3NUB A;  3AV7 A;  1MAP A;  3LWS A;  2VIB A;  1BQD A;  4JEX A;  4WYE A;  2BWO A;  2X3L A;  3FTB A;  2CJG A;  1AMA A;  2CJD A;  3CQ5 A;  4AO4 A;  2VMQ A;  2YKY A;  2CH2 A;  2BYJ A;  5BJ4 A;  2FM1 A;  2Z61 A;  1AY5 A;  4ISY A;  1ARH A;  2CB1 A;  1YOO A;  4P7Y A;  4QGR A;  2AY6 A;  3FSL A;  1QJ3 A;  4PIW A;  2HUU A;  2FNU A;  2W8U A;  4W1W A;  5FT6 A;  4WXF A;  3FVX A;  3ACZ A;  2EH6 A;  1IX8 A;  2W7G A;  3CQ4 A;  4IYO B;  2D66 A;  1VJO A;  4OMA A;  5EQC A;  3EIA A;  1KKJ A;  3PAA A;  3RCH A;  4UOY A;  1AHX A;  4EFF A;  2VLF A;  2EGY A;  2Z67 A;  4ZDL A;  2CH1 A;  3A9X A;  4AZK A;  3FQ7 A;  2W8J A;  3PD6 A;  2ZYJ A;  2VMP A;  2W7D A;  2EO5 A;  3A2B A;  1QIT A;  4Q76 A;  1AMR A;  1TAR A;  2AY3 A;  3L8A A;  3QGU A;  4TN4 A;  3QI6 A;  4ZSW A;  4R5Z A;  3ISL A;  3JWB A;  3LVM A;  1AMS A;  3MAU A;  2D64 A;  2Z9V A;  4J5U A;  2AY4 A;  4JE5 A;  2QB3 A;  2BIA A;  2JJF A;  2PO3 A;  2XBN A;  5DJ9 A;  1E5F A;  2WK8 A;  5G4J A;  3ZRQ A;  1C7O A;  3GBX A;  1WKG A;  5E5I A;  1X29 A;  4EMY A;  4MKK A;  1GC3 A;  4RJ0 A;  4W91 A;  2R0T A;  5EIG A;  3B8X A;  1D7R A;  1B4X A;  1FG3 A;  2VLH A;  3CQ6 A;  4XJP A;  3W1I A;  1W7N A;  2TPL A;  5F8V A;  2HOR A;  3MAF A;  5G2Q A;  3VK3 A;  3GJU A;  1CL2 A;  3DOD A;  4TMR A;  2AY2 A;  2FNI A;  5G2P A;  4RKC A;  4U1T A;  4AOA A;  4W1V A;  3JW9 A;  3I4J A;  4XJM A;  2FQ6 A;  3F6T A;  1J04 A;  1DJE A;  1G7W A;  1IAY A;  3K40 A;  4L0O A;  4ZAS A;  2VYC A;  2Z9X A;  1CL1 A;  1D7U A;  1H0C A;  3HBX A;  1KKP A;  4PFN A;  2W8W A;  5HHY A;  2JJE A;  2W7F A;  4Q31 A;  1M7Y A;  3WKR A;  3W1H A;  3ZRR A;  4F5M A;  2BHX A;  2BI1 A;  1TOJ A;  2GB3 A;  1TOG A;  4GRX A;  4E3Q A;  2BI2 A;  4O6Z A;  2HOY A;  3H7F A;  3PPL A;  4N0B A;  3BCX A;  1GDE A;  3QN6 A;  1YNU A;  3G7Q A;  1GC2 A;  2VGU A;  3EI9 A;  4IYO A;  3ELE A;  4RM1 A;  5M46 A;  1IJI A;  1WKH A;  4CVQ A;  5D5S A;  3FQA A;  4CBS A;  2ZY5 A;  1X2A A;  2D7Z A;  2QMA A;  1SPA A;  2O0R A;  3WCN A;  4UHM A;  2R5E A;  2YOB A;  5FT8 A;  4B9B A;  3W1J A;  4JEW A;  4F5K A;  4RLG A;  3E6G A;  1AHE A;  2CIN A;  2DGK A;  4WLH A;  2ZY2 A;  4CXR A;  3JZL A;  1DJ9 A;  1KL2 A;  1LC7 A;  1GD9 A;  3EUC A;  2HP2 A;  4OYT A;  3HLM A;  2ZJG A;  2VMO A;  1WYV B;  5FT5 A;  4IW7 A;  1LC5 A;  4Y0I A;  3KGX A;  1BJW A;  2GSA A;  1C0N A;  2VIA A;  4JF0 A;  3COG A;  4ADC A;  1P3W A;  1LK9 A;  4BHD A;  3AEP A;  1JS3 A;  1WST A;  1BJO B;  1DTY A;  1B9I A;  1AKA A;  2OKK A;  4MY5 A;  1E5E A;  2VI8 A;  3FD0 A;  1OHV A;  1ASF A;  3K7Y A;  3GSB A;  4ADB A;  1SVV A;  3F0H A;  3AEN B;  2VMS A;  4E1O A;  4ZM3 A;  2CJH A;  3MC6 A;  2BIG A;  2DGM A;  1S0A A;  2C44 A;  5TF5 A;  4OTL A;  2AY9 A;  1AKC A;  2VGS A;  3FCR A;  4AH3 A;  2EZ1 A;  3E77 A;  2DR1 A;  2JJG A;  4UHO A;  4ZDO A;  1N2T A;  4F4E A;  3KKI A;  4A0F A;  1CQ8 A;  4E77 A;  1SF2 A;  2FN6 A;  4LC3 A;  4M2J A;  4OC9 A;  3I5T A;  3HMU A;  3OKS A;  1B5P A;  4NOG A;  1LW5 A;  1WYT B;  3AEM C;  1SZS A;  1I41 A;  4GE9 A;  1WYU B;  4WP0 A;  4WYG A;  4A0G A;  1XI9 A;  1ARS A;  4WYD A;  1GEW A;  3USF A;  4B98 A;  1O62 A;  3EI5 A;  3GZC A;  2E54 A;  1AHY A;  1AY8 A;  2WK9 A;  3EZ1 A;  3N5M A;  1M0O A;  3BV0 A;  5DB5 A;  3WCO A;  5FT4 A;  3ATH A;  2EPJ A;  5HDM A;  1ORD A;  2AY8 A;  2JG2 A;  1ELQ A;  2V1P A;  3TCM A;  1ASD A;  1KMJ A;  3AEO A;  4Y0H A;  3UWC A;  4ZWM A;  1ASM A;  3PIU A;  5EAV A;  2YHK A;  3LVK A;  1DFO A;  1G7X A;  2HZP A;  1AY4 A;  1AKB A; 
#chains in the Genus database with same CATH topology
 1AMQ A;  3JWA A;  3E2Z A;  1WYV A;  3FQ8 A;  2R5C A;  2ZSL A;  2AAT A;  4GE7 A;  1D7S A;  3LV2 A;  1PMM A;  4K2I A;  1ARG A;  2OKJ A;  2GMS A;  2Q7W A;  3K28 A;  1C7G A;  1FC4 A;  2CAN A;  4CXQ A;  2DOU A;  2YKU A;  3GWP A;  3GZD C;  1VEF A;  4WD2 A;  4XAU A;  5EAA A;  4EB5 A;  1OHY A;  2CTZ A;  1BJO A;  1N31 A;  2ZP7 A;  3N4X A;  3L44 A;  3FZ8 A;  2C81 A;  2VGZ A;  1M32 A;  4XK1 A;  2OAT A;  4DGT A;  2BI9 A;  2X5D A;  5G0A A;  1X0M A;  4E3R A;  1W3U A;  4IXO A;  3AEN A;  3P6K A;  3ZZK A;  2W7E A;  1CJ0 A;  1EJI A;  1MDO A;  3B1E A;  3DXV A;  4EB7 A;  4U2H A;  1S06 A;  4W1X A;  2WK7 A;  3ASA A;  1AHF A;  3BB8 A;  3WX9 A;  1M0P A;  3NYU A;  3WGB A;  4F5I A;  3D6K A;  1IX6 A;  1IBJ A;  2AY1 A;  2XH1 A;  2X8U A;  2QB2 A;  3LVL B;  4FFC A;  4Q6R A;  5E3K A;  7AAT A;  1BW0 A;  1PMO A;  2W8V A;  3NTJ A;  2YKV A;  3E2F A;  1CZC A;  4AO9 A;  4JF1 A;  4GDY A;  3HVY A;  2Z1Y A;  1ASE A;  2OGA A;  1TAS A;  3ECD A;  3EZS A;  3E9K A;  1UU2 A;  2QLR A;  3TQX A;  4GEB A;  4XJO A;  4ITG A;  3WZF A;  1WYT A;  3BCA A;  9AAT A;  2Z20 A;  2E7I A;  1WYU A;  1GBN A;  3I16 A;  3WLX A;  4XQ2 A;  3CAI A;  3JU7 A;  3VK4 A;  5I92 A;  2RFV A;  3RQ1 A;  2EYQ A;  1AJS B;  1V2E A;  1AAM A;  4A0R A;  1UU0 A;  1MLZ A;  4MGR A;  2W7H A;  1O69 A;  1UKJ A;  1MDZ A;  1G4X A;  4OCA A;  3NU8 A;  2VMX A;  1KMK A;  2ZUK A;  3A9Z A;  3WGC A;  2W7M A;  4F5G A;  1B8G A;  2VMV A;  3H14 A;  5C6U A;  2ZY3 A;  2JIS A;  2QSR A;  3FRK A;  3DR4 A;  1LC8 A;  1GCK A;  5DX5 A;  2O7C A;  4J8L A;  1V2D A;  2W7I A;  2BI3 A;  5F9S A;  5HXX A;  1ASB A;  1ZOB A;  2D65 A;  3PA9 A;  1O4S A;  2VMR A;  4PVF A;  3G0T A;  4IX8 A;  4WBT A;  3RUY A;  1UU1 A;  2Z9U A;  2AY5 A;  1S07 A;  4ADD A;  1TAT A;  5G4I A;  1IAX A;  4I8A A;  4ATP A;  1QJ5 A;  2G6W A;  2VMN A;  3DU4 A;  4K2B A;  3TFU A;  5J8Q A;  3RBL A;  3N7N A;  1IVR A;  3MAD A;  2Z1Z A;  1AIA A;  4ITX A;  2ZY4 A;  2BI5 A;  3HT4 A;  3A9Y A;  5M4B A;  4R8D A;  2D63 A;  2FYF A;  3RBF A;  1Y4I A;  1ECX A;  4Y0D A;  1B9H A;  1SZK A;  5M49 A;  3F9T A;  4IXZ A;  1N8P A;  1YIY A;  3LVJ A;  5EFS A;  4MQP A;  3NUI A;  2JGT A;  3N4R A;  4Q75 A;  3NDN A;  4GSA A;  2YRI A;  2VGT A;  2AEV A;  3BWN C;  2YCT A;  5BJ3 A;  2HUI A;  3DR7 A;  4LNM A;  1QGN A;  3KE3 A;  3FVU A;  2W7L A;  1GC0 A;  4ATQ A;  4A0H A;  4KXK A;  3DRD A;  3ASB A;  1D7V A;  1I29 A;  1RVY A;  1RV3 A;  1O61 A;  2ZC0 A;  3AEJ C;  3KGW A;  4R2N A;  2CFB A;  4F5L A;  2AEU A;  2DKB A;  2QBT A;  1SZU A;  1Z7D A;  3FKD A;  3UE8 A;  1AAW A;  3VOM A;  3OP7 A;  3DZZ A;  4HF8 A;  4H51 A;  3T32 A;  1KL1 A;  2VMY A;  3JTX A;  4H63 Q;  1AJS A;  1EG5 A;  3GET A;  1ARI A;  3N75 A;  2HUF A;  4DQ6 A;  4PFF A;  2OQX A;  3MC6 C;  4GE4 A;  1GEY A;  5IWQ A;  4P3M A;  1I43 A;  5AX8 A;  3TFT A;  3GR9 A;  5D95 A;  3GZD A;  5EUD A;  5K8B A;  4IXS A;  3HQT A;  1G4V A;  3AOW A;  4F5F A;  3P1T A;  3N0L A;  1ASL A;  4MQQ A;  3B1C A;  1BJ4 A;  4DBC A;  1S09 A;  1T3I A;  4ZWV A;  5G09 A;  1W7L A;  3BN1 A;  1AX4 A;  3FVS A;  3NYS A;  4OBV A;  4HVK A;  1EQB A;  4MKJ A;  1M0Q A;  3DXW A;  1C7N A;  3PDB B;  4XEW A;  3ZZJ A;  4M2M A;  4ZSY A;  1W7M A;  1U08 A;  2VMT A;  3Q8N A;  1S08 A;  4JEY A;  4MSO A;  4ZM4 A;  1V2F A;  1BJN A;  3FZ7 A;  1CQ7 A;  1ART A;  4WYF A;  1CQ6 A;  1X28 A;  4M2K A;  1JF9 A;  4LNJ A;  4WXB A;  3WY7 A;  2VGV A;  2F8J A;  3VAX A;  2GQN A;  3VK2 A;  2NMP A;  5DJ1 A;  4CBR A;  3R9A A;  1AJR A;  2AY7 A;  4JE5 D;  1AHG A;  1JS6 A;  2BKW A;  4R5F A;  1FG7 A;  1QZ9 A;  2W7K A;  1QIR A;  2EZ2 A;  3MKJ A;  4XJL A;  1ELU A;  1ASG A;  1LS3 A;  1W23 A;  1YAA A;  1BS0 A;  2BIE A;  1B5O A;  1YJZ A;  3NRA A;  5LH9 A;  1H1C A;  1ZC9 A;  2DKJ A;  2E7J A;  3FDD A;  3BCB A;  1OAT A;  2GMU A;  3WKS A;  4A72 A;  2O1B A;  1DJU A;  3VP6 A;  3CBF A;  2QA3 A;  3FZ6 A;  4OT8 A;  4WB0 B;  3ZRP A;  3B46 A;  4UHN A;  1SFF A;  4WYA A;  4F5H A;  1AIC A;  2WKA A;  2Z9W A;  1TOE A;  4RKD A;  3QHX A;  1KAF A;  4JEV A;  3M5U A;  2BWP A;  4BMK A;  1RV4 A;  3FFH A;  2W8T A;  3IF2 A;  2VGW A;  3HL2 A;  3FFR A;  3E2Y A;  1BKG A;  4A6U A;  1M0N A;  1YIZ A;  2D61 A;  2HP1 A;  4ADE A;  4RAE A;  4RIZ A;  1PG8 A;  2DGL A;  3LG0 A;  3NX3 A;  1IX7 A;  2VI9 A;  4A6R A;  2BWN A;  2BYL A;  3B1D A;  3BS8 A;  2D5Y A;  1ZOD A;  2C0R A;  2VMW A;  2YCN A;  1AIB A;  1MAQ A;  2VMU A;  2VMZ A;  3EI6 A;  3EI8 A;  3PJ0 A;  4FL0 A;  4K2M A;  3QBO A;  1LW4 A;  3UAK A;  1C9C A;  2YCP A;  3EI7 A;  5EUE A;  1PFF A;  4LW4 A;  1YJS A;  5M4D A;  2OGE A;  3IHJ A;  5LHA A;  3DC1 A;  1XEY A;  3DYD A;  1BQA A;  4RIT A;  3PGY A;  2R2N A;  2CST A;  2FKI A;  3TAT A;  1BT4 A;  3BC8 A;  2CY8 A;  2PB2 A;  3RI6 A;  1DGD A;  2PB0 A;  3FDB A;  4OBU A;  2D7Y A;  3A8U X;  1OHW A;  3RCH B;  3AEL A;  2ZSM A;  1IUG A;  1I48 A;  4ZDP A;  2YRR A;  1MDX A;  1YJY A;  1Z3Z A;  1QIS A;  3II0 A;  1ASN A;  2W7J A;  3PDB A;  3PD6 B;  1LKC A;  4A6T A;  4WYC A;  2ORD A;  3G8M A;  1MLY A;  3LY1 A;  1DGE A;  4EU1 A;  4TV7 A;  4JEZ A;  5EUN A;  4BQ0 A;  3NYT A;  4RJY A;  3MBB A;  4LW2 A;  4KAM A;  3EIB A;  1J32 A;  1CZE A;  3E2Z B;  2R5C B;  1M4N A;  1MGV A;  3BWN A;  3AEM A;  3HDO A;  3NNK A;  2X5F A;  4F5J A;  1VP4 A;  4AZJ A;  1M6S A;  1TOK A;  2E7U A;  4MQR A;  3MEB A;  4ZAH A;  1GEX A;  1CS1 A;  1TPL A;  2V0Y A;  3AAT A;  3AEJ A;  4N0W A;  4W5K A;  5EIG B;  1OXO A;  4A00 A;  4BA4 A;  8AAT A;  2HOZ A;  2JJH A;  3BWO A;  3QPG A;  1D2F A;  4WLJ A;  1DKA A;  2YKX A;  4KYO A;  5E4Z A;  3PDX A;  3NU7 A;  1ASA A;  4IY7 A;  4W8I A;  3AOV A;  3MAF B;  1JG8 A;  4UQV A;  1C4K A;  1ASC A;  4WB0 A;  4LNL A;  1OXP A;  1TOI A;  1V72 A;  2HOX A;  4WXG A;  2KFP A;  5JAY A;  4BA5 A;  2C7T A;  3ELP A;  4ZLV A;  3QM2 A;  3R4T A;  1GC4 A;  1RVU A;  3NUB A;  3AV7 A;  1MAP A;  3LWS A;  2VIB A;  1BQD A;  4JEX A;  4WYE A;  2BWO A;  2X3L A;  3FTB A;  2CJG A;  1AMA A;  2CJD A;  3CQ5 A;  4AO4 A;  2VMQ A;  2YKY A;  2CH2 A;  2BYJ A;  5BJ4 A;  2FM1 A;  2Z61 A;  1AY5 A;  4ISY A;  1ARH A;  2CB1 A;  1YOO A;  4P7Y A;  4QGR A;  2AY6 A;  3FSL A;  1QJ3 A;  4PIW A;  2HUU A;  2FNU A;  2W8U A;  4W1W A;  5FT6 A;  4WXF A;  3FVX A;  3ACZ A;  2EH6 A;  1IX8 A;  2W7G A;  3CQ4 A;  4IYO B;  2D66 A;  1VJO A;  4OMA A;  5EQC A;  3EIA A;  1KKJ A;  3PAA A;  3RCH A;  3N4S A;  4UOY A;  1AHX A;  4EFF A;  2VLF A;  2EGY A;  2Z67 A;  4ZDL A;  2CH1 A;  3A9X A;  4AZK A;  3FQ7 A;  2W8J A;  3PD6 A;  2ZYJ A;  2VMP A;  2W7D A;  2EO5 A;  3A2B A;  1QIT A;  4Q76 A;  1AMR A;  1TAR A;  2AY3 A;  3L8A A;  3QGU A;  4TN4 A;  3QI6 A;  4ZSW A;  4R5Z A;  3ISL A;  3JWB A;  3LVM A;  1AMS A;  3MAU A;  2D64 A;  2Z9V A;  4J5U A;  2AY4 A;  4JE5 A;  2QB3 A;  2BIA A;  2JJF A;  2PO3 A;  2XBN A;  5DJ9 A;  1E5F A;  2WK8 A;  5G4J A;  3ZRQ A;  1C7O A;  3GBX A;  1WKG A;  5E5I A;  1X29 A;  4EMY A;  4MKK A;  1GC3 A;  4RJ0 A;  4W91 A;  2R0T A;  5EIG A;  3B8X A;  1D7R A;  1B4X A;  1FG3 A;  2VLH A;  3CQ6 A;  4XJP A;  3W1I A;  1W7N A;  2TPL A;  5F8V A;  2HOR A;  3MAF A;  5G2Q A;  3VK3 A;  3GJU A;  1CL2 A;  3DOD A;  4TMR A;  2AY2 A;  2FNI A;  5G2P A;  4RKC A;  4U1T A;  4AOA A;  4W1V A;  3JW9 A;  3I4J A;  4XJM A;  2FQ6 A;  3F6T A;  1J04 A;  1DJE A;  1G7W A;  1IAY A;  3K40 A;  4L0O A;  4ZAS A;  2VYC A;  2Z9X A;  1CL1 A;  1D7U A;  1H0C A;  3HBX A;  1KKP A;  4PFN A;  2W8W A;  5HHY A;  2JJE A;  2W7F A;  4Q31 A;  1M7Y A;  3WKR A;  3W1H A;  3ZRR A;  4F5M A;  2BHX A;  2BI1 A;  1TOJ A;  2GB3 A;  1TOG A;  4GRX A;  4E3Q A;  2BI2 A;  2G7J A;  4O6Z A;  2HOY A;  3H7F A;  3PPL A;  4N0B A;  3BCX A;  1GDE A;  3QN6 A;  1YNU A;  3G7Q A;  1GC2 A;  2VGU A;  3EI9 A;  4IYO A;  3ELE A;  4RM1 A;  5M46 A;  1IJI A;  1WKH A;  4CVQ A;  5D5S A;  3FQA A;  4CBS A;  2ZY5 A;  1X2A A;  2D7Z A;  2QMA A;  1SPA A;  2O0R A;  3WCN A;  4UHM A;  2R5E A;  2YOB A;  5FT8 A;  4B9B A;  3W1J A;  4JEW A;  4F5K A;  4RLG A;  3E6G A;  1AHE A;  2CIN A;  2DGK A;  4WLH A;  2ZY2 A;  4CXR A;  3JZL A;  1DJ9 A;  1KL2 A;  1LC7 A;  1GD9 A;  3EUC A;  2HP2 A;  4OYT A;  3HLM A;  2ZJG A;  2WB6 A;  2VMO A;  1WYV B;  5FT5 A;  4IW7 A;  1LC5 A;  4Y0I A;  3KGX A;  1BJW A;  2GSA A;  1C0N A;  2VIA A;  4JF0 A;  3COG A;  4ADC A;  1P3W A;  1LK9 A;  4BHD A;  3AEP A;  1JS3 A;  1WST A;  1BJO B;  1DTY A;  1B9I A;  1AKA A;  2OKK A;  4MY5 A;  1E5E A;  2VI8 A;  3FD0 A;  1OHV A;  1ASF A;  3K7Y A;  3H9X A;  3GSB A;  4ADB A;  1SVV A;  3F0H A;  3AEN B;  2VMS A;  4E1O A;  4ZM3 A;  2CJH A;  3MC6 A;  2BIG A;  2DGM A;  1S0A A;  2C44 A;  5TF5 A;  4OTL A;  2AY9 A;  1AKC A;  2VGS A;  3FCR A;  4AH3 A;  2EZ1 A;  3E77 A;  2DR1 A;  2JJG A;  4UHO A;  4ZDO A;  1N2T A;  4F4E A;  3KKI A;  4A0F A;  1CQ8 A;  4E77 A;  1SF2 A;  2FN6 A;  4LC3 A;  4M2J A;  4OC9 A;  3I5T A;  3HMU A;  3OKS A;  1B5P A;  2A1V A;  5KTB A;  4NOG A;  1LW5 A;  1WYT B;  3AEM C;  1SZS A;  1I41 A;  4GE9 A;  1WYU B;  4WP0 A;  4WYG A;  4A0G A;  1XI9 A;  1ARS A;  4WYD A;  1GEW A;  3USF A;  4B98 A;  1O62 A;  3EI5 A;  3GZC A;  2E54 A;  1AHY A;  1AY8 A;  2WK9 A;  3EZ1 A;  3N5M A;  1M0O A;  3BV0 A;  5DB5 A;  3WCO A;  5FT4 A;  3ATH A;  2EPJ A;  5HDM A;  1ORD A;  2AY8 A;  2JG2 A;  1ELQ A;  2V1P A;  3TCM A;  1ASD A;  1KMJ A;  3AEO A;  4Y0H A;  3UWC A;  4ZWM A;  1ASM A;  3PIU A;  5EAV A;  4K05 A;  2YHK A;  3LVK A;  1DFO A;  1G7X A;  2HZP A;  1AY4 A;  1AKB A; 
#chains in the Genus database with same CATH homology
 1AMQ A;  3JWA A;  3E2Z A;  1WYV A;  3FQ8 A;  2R5C A;  2ZSL A;  2AAT A;  4GE7 A;  1D7S A;  3LV2 A;  1PMM A;  4K2I A;  1ARG A;  2OKJ A;  2GMS A;  2Q7W A;  3K28 A;  1C7G A;  1FC4 A;  2CAN A;  4CXQ A;  2DOU A;  2YKU A;  3GWP A;  3GZD C;  1VEF A;  4WD2 A;  4XAU A;  5EAA A;  4EB5 A;  1OHY A;  2CTZ A;  1BJO A;  1N31 A;  2ZP7 A;  3N4X A;  3L44 A;  3FZ8 A;  2C81 A;  2VGZ A;  1M32 A;  4XK1 A;  2OAT A;  4DGT A;  2BI9 A;  2X5D A;  5G0A A;  1X0M A;  4E3R A;  1W3U A;  4IXO A;  3AEN A;  3P6K A;  3ZZK A;  2W7E A;  1CJ0 A;  1EJI A;  1MDO A;  3B1E A;  3DXV A;  4EB7 A;  4U2H A;  1S06 A;  4W1X A;  2WK7 A;  3ASA A;  1AHF A;  3BB8 A;  3WX9 A;  1M0P A;  3NYU A;  3WGB A;  4F5I A;  3D6K A;  1IX6 A;  1IBJ A;  2AY1 A;  2XH1 A;  2X8U A;  2QB2 A;  3LVL B;  4FFC A;  4Q6R A;  5E3K A;  7AAT A;  1BW0 A;  1PMO A;  2W8V A;  3NTJ A;  2YKV A;  3E2F A;  1CZC A;  4AO9 A;  4JF1 A;  4GDY A;  3HVY A;  2Z1Y A;  1ASE A;  2OGA A;  1TAS A;  3ECD A;  3EZS A;  3E9K A;  1UU2 A;  2QLR A;  3TQX A;  4GEB A;  4XJO A;  4ITG A;  3WZF A;  1WYT A;  3BCA A;  9AAT A;  2Z20 A;  2E7I A;  1WYU A;  1GBN A;  3I16 A;  3WLX A;  4XQ2 A;  3CAI A;  3JU7 A;  3VK4 A;  5I92 A;  2RFV A;  3RQ1 A;  2EYQ A;  1AJS B;  1V2E A;  1AAM A;  4A0R A;  1UU0 A;  1MLZ A;  4MGR A;  2W7H A;  1O69 A;  1UKJ A;  1MDZ A;  1G4X A;  4OCA A;  3NU8 A;  2VMX A;  1KMK A;  2ZUK A;  3A9Z A;  3WGC A;  2W7M A;  4F5G A;  1B8G A;  2VMV A;  3H14 A;  5C6U A;  2ZY3 A;  2JIS A;  2QSR A;  3FRK A;  3DR4 A;  1LC8 A;  1GCK A;  5DX5 A;  2O7C A;  4J8L A;  1V2D A;  2W7I A;  2BI3 A;  5F9S A;  5HXX A;  1ASB A;  1ZOB A;  2D65 A;  3PA9 A;  1O4S A;  2VMR A;  4PVF A;  3G0T A;  4IX8 A;  4WBT A;  3RUY A;  1UU1 A;  2Z9U A;  2AY5 A;  1S07 A;  4ADD A;  1TAT A;  5G4I A;  1IAX A;  4I8A A;  4ATP A;  1QJ5 A;  2G6W A;  2VMN A;  3DU4 A;  4K2B A;  3TFU A;  5J8Q A;  3RBL A;  3N7N A;  1IVR A;  3MAD A;  2Z1Z A;  1AIA A;  4ITX A;  2ZY4 A;  2BI5 A;  3HT4 A;  3A9Y A;  5M4B A;  4R8D A;  2D63 A;  2FYF A;  3RBF A;  1Y4I A;  1ECX A;  4Y0D A;  1B9H A;  1SZK A;  5M49 A;  3F9T A;  4IXZ A;  1N8P A;  1YIY A;  3LVJ A;  5EFS A;  4MQP A;  3NUI A;  2JGT A;  3N4R A;  4Q75 A;  3NDN A;  4GSA A;  2YRI A;  2VGT A;  2AEV A;  3BWN C;  2YCT A;  5BJ3 A;  2HUI A;  3DR7 A;  4LNM A;  1QGN A;  3KE3 A;  3FVU A;  2W7L A;  1GC0 A;  4ATQ A;  4A0H A;  4KXK A;  3DRD A;  3ASB A;  1D7V A;  1I29 A;  1RVY A;  1RV3 A;  1O61 A;  2ZC0 A;  3AEJ C;  3KGW A;  4R2N A;  2CFB A;  4F5L A;  2AEU A;  2DKB A;  2QBT A;  1SZU A;  1Z7D A;  3FKD A;  3UE8 A;  1AAW A;  3VOM A;  3OP7 A;  3DZZ A;  4HF8 A;  4H51 A;  3T32 A;  1KL1 A;  2VMY A;  3JTX A;  4H63 Q;  1AJS A;  1EG5 A;  3GET A;  1ARI A;  3N75 A;  2HUF A;  4DQ6 A;  4PFF A;  2OQX A;  3MC6 C;  4GE4 A;  1GEY A;  5IWQ A;  4P3M A;  1I43 A;  5AX8 A;  3TFT A;  3GR9 A;  5D95 A;  3GZD A;  5EUD A;  5K8B A;  4IXS A;  3HQT A;  1G4V A;  3AOW A;  4F5F A;  3P1T A;  3N0L A;  1ASL A;  4MQQ A;  3B1C A;  1BJ4 A;  4DBC A;  1S09 A;  1T3I A;  4ZWV A;  5G09 A;  1W7L A;  3BN1 A;  1AX4 A;  3FVS A;  3NYS A;  4OBV A;  4HVK A;  1EQB A;  4MKJ A;  1M0Q A;  3DXW A;  1C7N A;  3PDB B;  4XEW A;  3ZZJ A;  4M2M A;  4ZSY A;  1W7M A;  1U08 A;  2VMT A;  3Q8N A;  1S08 A;  4JEY A;  4MSO A;  4ZM4 A;  1V2F A;  1BJN A;  3FZ7 A;  1CQ7 A;  1ART A;  4WYF A;  1CQ6 A;  1X28 A;  4M2K A;  1JF9 A;  4LNJ A;  4WXB A;  3WY7 A;  2VGV A;  2F8J A;  3VAX A;  2GQN A;  3VK2 A;  2NMP A;  5DJ1 A;  4CBR A;  3R9A A;  1AJR A;  2AY7 A;  4JE5 D;  1AHG A;  1JS6 A;  2BKW A;  4R5F A;  1FG7 A;  1QZ9 A;  2W7K A;  1QIR A;  2EZ2 A;  3MKJ A;  4XJL A;  1ELU A;  1ASG A;  1LS3 A;  1W23 A;  1YAA A;  1BS0 A;  2BIE A;  1B5O A;  1YJZ A;  3NRA A;  5LH9 A;  1H1C A;  1ZC9 A;  2DKJ A;  2E7J A;  3FDD A;  3BCB A;  1OAT A;  2GMU A;  3WKS A;  4A72 A;  2O1B A;  1DJU A;  3VP6 A;  3CBF A;  2QA3 A;  3FZ6 A;  4OT8 A;  4WB0 B;  3ZRP A;  3B46 A;  4UHN A;  1SFF A;  4WYA A;  4F5H A;  1AIC A;  2WKA A;  2Z9W A;  1TOE A;  4RKD A;  3QHX A;  4JEV A;  3M5U A;  2BWP A;  4BMK A;  1RV4 A;  3FFH A;  2W8T A;  3IF2 A;  2VGW A;  3HL2 A;  3FFR A;  3E2Y A;  1BKG A;  4A6U A;  1M0N A;  1YIZ A;  2D61 A;  2HP1 A;  4ADE A;  4RAE A;  4RIZ A;  1PG8 A;  2DGL A;  3LG0 A;  3NX3 A;  1IX7 A;  2VI9 A;  4A6R A;  2BWN A;  2BYL A;  3B1D A;  3BS8 A;  2D5Y A;  1ZOD A;  2C0R A;  2VMW A;  2YCN A;  1AIB A;  1MAQ A;  2VMU A;  2VMZ A;  3EI6 A;  3EI8 A;  3PJ0 A;  4FL0 A;  4K2M A;  3QBO A;  1LW4 A;  3UAK A;  1C9C A;  2YCP A;  3EI7 A;  5EUE A;  1PFF A;  4LW4 A;  1YJS A;  5M4D A;  2OGE A;  3IHJ A;  5LHA A;  3DC1 A;  1XEY A;  3DYD A;  1BQA A;  4RIT A;  3PGY A;  2R2N A;  2CST A;  2FKI A;  3TAT A;  1BT4 A;  3BC8 A;  2CY8 A;  2PB2 A;  3RI6 A;  1DGD A;  2PB0 A;  3FDB A;  4OBU A;  2D7Y A;  3A8U X;  1OHW A;  3RCH B;  3AEL A;  2ZSM A;  1IUG A;  1I48 A;  4ZDP A;  2YRR A;  1MDX A;  1YJY A;  1Z3Z A;  1QIS A;  3II0 A;  1ASN A;  2W7J A;  3PDB A;  3PD6 B;  1LKC A;  4A6T A;  4WYC A;  2ORD A;  3G8M A;  1MLY A;  3LY1 A;  1DGE A;  4EU1 A;  4TV7 A;  4JEZ A;  5EUN A;  4BQ0 A;  3NYT A;  4RJY A;  3MBB A;  4LW2 A;  4KAM A;  3EIB A;  1J32 A;  1CZE A;  3E2Z B;  2R5C B;  1M4N A;  1MGV A;  3BWN A;  3AEM A;  3HDO A;  3NNK A;  2X5F A;  4F5J A;  1VP4 A;  4AZJ A;  1M6S A;  1TOK A;  2E7U A;  4MQR A;  3MEB A;  4ZAH A;  1GEX A;  1CS1 A;  1TPL A;  2V0Y A;  3AAT A;  3AEJ A;  4N0W A;  4W5K A;  5EIG B;  1OXO A;  4A00 A;  4BA4 A;  8AAT A;  2HOZ A;  2JJH A;  3BWO A;  3QPG A;  1D2F A;  4WLJ A;  1DKA A;  2YKX A;  4KYO A;  5E4Z A;  3PDX A;  3NU7 A;  1ASA A;  4IY7 A;  4W8I A;  3AOV A;  3MAF B;  1JG8 A;  4UQV A;  1C4K A;  1ASC A;  4WB0 A;  4LNL A;  1OXP A;  1TOI A;  1V72 A;  2HOX A;  4WXG A;  2KFP A;  5JAY A;  4BA5 A;  2C7T A;  3ELP A;  4ZLV A;  3QM2 A;  3R4T A;  1GC4 A;  1RVU A;  3NUB A;  3AV7 A;  1MAP A;  3LWS A;  2VIB A;  1BQD A;  4JEX A;  4WYE A;  2BWO A;  2X3L A;  3FTB A;  2CJG A;  1AMA A;  2CJD A;  3CQ5 A;  4AO4 A;  2VMQ A;  2YKY A;  2CH2 A;  2BYJ A;  5BJ4 A;  2FM1 A;  2Z61 A;  1AY5 A;  4ISY A;  1ARH A;  2CB1 A;  1YOO A;  4P7Y A;  4QGR A;  2AY6 A;  3FSL A;  1QJ3 A;  4PIW A;  2HUU A;  2FNU A;  2W8U A;  4W1W A;  5FT6 A;  4WXF A;  3FVX A;  3ACZ A;  2EH6 A;  1IX8 A;  2W7G A;  3CQ4 A;  4IYO B;  2D66 A;  1VJO A;  4OMA A;  5EQC A;  3EIA A;  1KKJ A;  3PAA A;  3RCH A;  3N4S A;  4UOY A;  1AHX A;  4EFF A;  2VLF A;  2EGY A;  2Z67 A;  4ZDL A;  2CH1 A;  3A9X A;  4AZK A;  3FQ7 A;  2W8J A;  3PD6 A;  2ZYJ A;  2VMP A;  2W7D A;  2EO5 A;  3A2B A;  1QIT A;  4Q76 A;  1AMR A;  1TAR A;  2AY3 A;  3L8A A;  3QGU A;  4TN4 A;  3QI6 A;  4ZSW A;  4R5Z A;  3ISL A;  3JWB A;  3LVM A;  1AMS A;  3MAU A;  2D64 A;  2Z9V A;  4J5U A;  2AY4 A;  4JE5 A;  2QB3 A;  2BIA A;  2JJF A;  2PO3 A;  2XBN A;  5DJ9 A;  1E5F A;  2WK8 A;  5G4J A;  3ZRQ A;  1C7O A;  3GBX A;  1WKG A;  5E5I A;  1X29 A;  4EMY A;  4MKK A;  1GC3 A;  4RJ0 A;  4W91 A;  2R0T A;  5EIG A;  3B8X A;  1D7R A;  1B4X A;  1FG3 A;  2VLH A;  3CQ6 A;  4XJP A;  3W1I A;  1W7N A;  2TPL A;  5F8V A;  2HOR A;  3MAF A;  5G2Q A;  3VK3 A;  3GJU A;  1CL2 A;  3DOD A;  4TMR A;  2AY2 A;  2FNI A;  5G2P A;  4RKC A;  4U1T A;  4AOA A;  4W1V A;  3JW9 A;  3I4J A;  4XJM A;  2FQ6 A;  3F6T A;  1J04 A;  1DJE A;  1G7W A;  1IAY A;  3K40 A;  4L0O A;  4ZAS A;  2VYC A;  2Z9X A;  1CL1 A;  1D7U A;  1H0C A;  3HBX A;  1KKP A;  4PFN A;  2W8W A;  5HHY A;  2JJE A;  2W7F A;  4Q31 A;  1M7Y A;  3WKR A;  3W1H A;  3ZRR A;  4F5M A;  2BHX A;  2BI1 A;  1TOJ A;  2GB3 A;  1TOG A;  4GRX A;  4E3Q A;  2BI2 A;  2G7J A;  4O6Z A;  2HOY A;  3H7F A;  3PPL A;  4N0B A;  3BCX A;  1GDE A;  3QN6 A;  1YNU A;  3G7Q A;  1GC2 A;  2VGU A;  3EI9 A;  4IYO A;  3ELE A;  4RM1 A;  5M46 A;  1IJI A;  1WKH A;  4CVQ A;  5D5S A;  3FQA A;  4CBS A;  2ZY5 A;  1X2A A;  2D7Z A;  2QMA A;  1SPA A;  2O0R A;  3WCN A;  4UHM A;  2R5E A;  2YOB A;  5FT8 A;  4B9B A;  3W1J A;  4JEW A;  4F5K A;  4RLG A;  3E6G A;  1AHE A;  2CIN A;  2DGK A;  4WLH A;  2ZY2 A;  4CXR A;  3JZL A;  1DJ9 A;  1KL2 A;  1LC7 A;  1GD9 A;  3EUC A;  2HP2 A;  4OYT A;  3HLM A;  2ZJG A;  2WB6 A;  2VMO A;  1WYV B;  5FT5 A;  4IW7 A;  1LC5 A;  4Y0I A;  3KGX A;  1BJW A;  2GSA A;  1C0N A;  2VIA A;  4JF0 A;  3COG A;  4ADC A;  1P3W A;  1LK9 A;  4BHD A;  3AEP A;  1JS3 A;  1WST A;  1BJO B;  1DTY A;  1B9I A;  1AKA A;  2OKK A;  4MY5 A;  1E5E A;  2VI8 A;  3FD0 A;  1OHV A;  1ASF A;  3K7Y A;  3H9X A;  3GSB A;  4ADB A;  1SVV A;  3F0H A;  3AEN B;  2VMS A;  4E1O A;  4ZM3 A;  2CJH A;  3MC6 A;  2BIG A;  2DGM A;  1S0A A;  2C44 A;  5TF5 A;  4OTL A;  2AY9 A;  1AKC A;  2VGS A;  3FCR A;  4AH3 A;  2EZ1 A;  3E77 A;  2DR1 A;  2JJG A;  4UHO A;  4ZDO A;  1N2T A;  4F4E A;  3KKI A;  4A0F A;  1CQ8 A;  4E77 A;  1SF2 A;  2FN6 A;  4LC3 A;  4M2J A;  4OC9 A;  3I5T A;  3HMU A;  3OKS A;  1B5P A;  2A1V A;  5KTB A;  4NOG A;  1LW5 A;  1WYT B;  3AEM C;  1SZS A;  1I41 A;  4GE9 A;  1WYU B;  4WP0 A;  4WYG A;  4A0G A;  1XI9 A;  1ARS A;  4WYD A;  1GEW A;  3USF A;  4B98 A;  1O62 A;  3EI5 A;  3GZC A;  2E54 A;  1AHY A;  1AY8 A;  2WK9 A;  3EZ1 A;  3N5M A;  1M0O A;  3BV0 A;  5DB5 A;  3WCO A;  5FT4 A;  3ATH A;  2EPJ A;  5HDM A;  1ORD A;  2AY8 A;  2JG2 A;  1ELQ A;  2V1P A;  3TCM A;  1ASD A;  1KMJ A;  3AEO A;  4Y0H A;  3UWC A;  4ZWM A;  1ASM A;  3PIU A;  5EAV A;  4K05 A;  2YHK A;  3LVK A;  1DFO A;  1G7X A;  2HZP A;  1AY4 A;  1AKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...