4AZZA

Carbohydrate binding module cbm66 from bacillus subtilis
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
165
structure length
165
Chain Sequence
TPFMSNMTGWTTVNGTWADTIEGKQGRSDGDSFILSSASGSDFTYESDITIKDGNGRGAGALMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAEYKTPIDVNKKYHLKTEAEGDRFKIYLDDRLVIDAHDSVFSEGQFGLNVWDATAVFQNVTKESLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEVANASE
publication title How Nature Can Exploit Nonspecific Catalytic and Carbohydrate Binding Modules to Create Enzymatic Specificity.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 43
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 3.2.1.80: Fructan beta-fructosidase.
pdb deposition date 2012-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4azzA00
2ADEA 4B1MA 3SC7X 3KF5A 3KF3A 4HXCA 1Y4WA 4CCCA 5FMBA 3U1XA 3H3LA 3ZR6A 5FKCA 3U14A 4CCEA 2AEZA 1ST8A 2QQUA 5FIXA 3U75A 3ZR5A 5FKBA 3PIGA 2QQVA 4UFJA 3LIGA 2XQRA 4UFKA 3HBKA 3LDRA 3NMBA 4AZZA 4UFMA 3LFIA 4B1LA 2QQWA 1W2TA 4QHZA 3UGHA 3LF7A 2OXBA 4UFHA 4JQTA 5FK7A 3RWKX 3S5QA 1Y9MA 1Y9GA 1UYPA 3PIJA 4EQVA 3LIHA 5FK8A 3UGGA 4UFIA 5ANNA 4FFIA 5FMCA 3LDKA 5FMDA 4FFFA 2ADDA 2AC1A 3LEMA 3UGFA 4CCDA 4FFHA 3IMMA 3OSDA 4UFLA 2AEYA 4FFGA
chains in the Genus database with same CATH superfamily
4AEDC 3MLLA 1W8OA 1RUG2 5C3QA 3KQRA 3I2IA 2HJIA 2R043 3MDPA 5A80A 1OI6A 1JYCA 3ILRA 3VBSA 3DGTA 3VBSC 1ZZBA 2CDOA 3BOWA 4LULA 1CAVA 3HD8B 4LXLA 3ELNA 1TE1B 2XHKA 5IK5A 4EYUA 2VVEA 3VGIA 3HEIA 5FUPA 1GWMA 1A6CA 1UNBA 4A2UA 4UBHA 5EYYA 1WCKA 4OUSA 1LOGA 1DLLA 1AR83 3N7LA 5FTTC 2XPJA 5FPAA 1AR91 5JIAA 3MUZ1 4YVWA 5KBFA 2YPDA 3G6JB 4YVWC 4CP9A 2W95A 3H3UA 1JHNA 1KJLA 4DXTA 2JENA 4ZKTB 3HWJA 4J25A 2P3YA 4GWNA 4YG0A 2W2IA 3H3LA 2RVAA 4GB33 1LOCA 2N7GA 2FCVA 1HQWA 1UN1A 2GNTA 2YG0A 4LT5A 1LENA 2B46X 1W8HA 1LODA 1S0GA 1V6KA 4Z8BA 5FFOC 1OT5A 5LASA 5JSOA 4YW7A 1OFSA 3A4UA 2H6CA 1GNHA 3D4KA 3OF1A 1BLZA 4HOOA 2RE9A 1HRI1 2J1RA 1YHFA 3VUOA 1ZRFA 2CGOA 2OW4A 1MS9A 2YC2A 2ZGLA 1YQ6A 1DQ6A 3A22A 2J1VA 1LHUA 3CIHA 3KZ4C 4WZCA 3VBRB 3VV1A 3N9PA 3S5QA 2D97A 2RJ2A 5D8AA 1J3RA 4QX8A 4AHZA 2GMEA 1IG3A 2DURA 4FPFA 5A3OA 3ZXGA 4I02A 3FZ3A 2YMZA 1Y43B 2W1UA 2PHRA 3WG2A 1MVEA 2J22A 3VBOA 3AZVA 2AH2A 3VBOC 5JAXA 1X50A 1QJY3 3JB4C 3KV4A 4IEZA 1XU1A 4AGVA 4EN8B 4ONUA 4XJAA 3WY6A 4E9KA 1WMXA 2VOTA 1CAXA 2DFCA 2WJSA 5IVEA 5C4WB 2ADDA 2JDAA 1IG0A 4JGYA 4QT6A 4CSWA 2PELA 3ZXKA 1Y7BA 2R1DA 1O8PA 5FZCA 2XVGA 4GKYA 4QPGA 4QPGC 4I0WB 3T0DA 4ASLA 4ZY9A 1KFUL 1W3XA 3RRDA 4Q4X2 1W6PB 5BNPC 3T3YA 5T54A 4LR4A 3HIFA 1S55A 1FPN1 4L97A 5F32A 1G7YA 3FHIB 2VMIA 4QQLA 5IT6A 2PA7A 4EROA 1GZWA 1GICA 2ORZA 2WO3A 3FBMA 4JTNA 5FBZA 4QHZA 2XONA 3VDBA 3WZ1A 4AXOA 2VNRA 2WAOA 2E6VA 1RUF3 3ZN6A 5F3CA 1ALYA 2GNBA 3IAQA 1GBGA 2F4PA 2RHPA 4HN1A 2BW8A 4IE7A 1N1YA 3AP9A 4XACA 2ADEA 2D6OX 4ISRA 1QXRA 1NLRA 4XFHA 1F5JA 4AFCA 5JXGA 2YFUA 2HWE1 3O0WA 5K7PA 1O3SA 1CGPA 2CHHA 3NV1A 2WNOA 3FFQA 2PYTA 5L9RA 3EBRA 2BUKA 2DTYA 3RZHA 1QJX3 5DG1A 4ARYA 3PHMA 4BM8A 1Y9QA 3SNMA 2W52A 3M3QA 5IHRA 2DBNA 2HBUA 1IGOA 3AKSA 2DFBA 3LA2A 5BV6A 4GMP3 2VNOA 3OBTA 4GWJA 3V65A 1AL0G 1LESA 4Q29A 4Z82A 4BXFA 5BNNA 4FQ4A 4IXLA 3F95A 2E7AA 3FX3A 4CUAA 2C4XA 1AX1A 5CB7A 1IS3A 2IWGB 3E1F1 3P3PA 2VPVA 3GDBA 5H9SA 3A21A 3K4ZA 4BDVB 5A33B 3ETQA 3OBAA 1MPXA 5E6HA 5CFCA 1FI2A 4Y20A 1X7NA 2B45X 2B4KA 4BU2A 4LA3A 1W6NB 2FMYA 2C24A 4KL1A 1OC1A 2K0GA 3P1IA 4X8NA 5EJZB 3MUY1 5FY9A 1KS4A 5IJRA 5A7SA 1HN0A 4B8EA 1BEV2 4BQXA 2E7TA 1S1AA 4CEWB 3RVHA 4CTEA 3O1RA 3I3EA 2OPWA 3AXEA 4M4PA 5GM0A 3CLPA 5AVPA 1XSQA 4IESA 4RR3B 3A0NA 5FY1A 5CG8A 3OCPA 5LA2A 4TSVA 1VBE3 4IE4A 1X82A 4L0PA 3POBA 1DP0A 3UJQA 1DGWX 1COV2 4I30A 2RS12 2A75A 3GCXA 3PU3A 4UBGA 2Q8OA 1NG0A 1SPPA 4ZPIA 4YARA 1JZ3A 2RS33 1RHI1 2RMU2 1RJ7A 4QGNA 1JW6A 3USUA 2XUEA 2RDQA 4TLGA 4QQOA 3C7OA 5GALA 2WT2A 3HR9A 4TWTA 2HEVF 4OZOA 5F39A 4D6RA 1O3TA 5F3EA 3ZSLA 3SCGA 4NHYA 3GGLA 4QDRA 1R1A2 4CP1A 1SFPA 1DU3D 1KD7A 3RYPA 5E1RA 4K1YA 4COVA 1NOVA 5J48A 4TYSA 5FP3A 3KM5A 3ZXAC 3N35A 2C26A 4CCMA 4FAHA 1W06A 4YZ3A 4B1LA 5KHHA 4NHLA 5JZGB 3RSJA 2P4EA 4C0HA 4GALA 3AFGA 4K8RB 2FCUA 1NY71 1ULGA 1X33A 2P17A 4BXSV 2E26A 3J7HA 3UGFA 3BPSA 4Q8LA 5FZHA 3WF4A 1KXGA 3BIEA 3U4SA 2RJLA 1WLDA 2F17A 5KHKA 1OUXA 5FP4A 4RS5A 1SCRA 2NYYA 4NIAA 2Q8DA 3H1YA 1SBFA 4RS5C 5HBAA 1PX3A 4AFAA 4Q4X3 4MADA 1F4AA 1PIV2 3DKQA 4NO4A 4QHBA 1DZRA 1U5ZA 1VBB1 2VUDA 1GQGA 1CWPA 1VBC2 2A3YA 2JDPA 4LKSA 1D2SA 3TOJA 2PHWA 2ZAHA 4LUMA 1G8WA 2JE8A 4HVRA 2WSUA 3CEWA 4JRAA 5EXOA 1HV1A 3UKNA 4BA6A 1J3QA 5D21A 4I01A 3JUUA 2B9UA 5FZOB 5SV5A 1O5UA 5JMOA 3K3OA 1C8NA 4FPCA 4QB6A 5DG2A 1K5JA 4QX2A 4QX0A 3IDEA 3PVEA 2P6CA 1KDMA 2CGNA 1JTZX 2VXJA 2Y6FA 1YEWA 4HXCA 1EV12 4PDWA 3H50A 4PDWC 1UZYA 3PMEA 4PF1A 4QPIB 4PT6A 2JDZA 3C7GA 4P9GA 3I2FA 1POV1 1RUOA 4K7JA 3WW3A 1UU6A 2JDNA 4AE2A 3CMGA 4KWLA 4XYXA 3AX4A 2E51A 4RQPA 4I09A 3N4MA 4RQPC 1NT0A 4ATEA 4HVOA 5C71A 1MZEA 3LB9A 3TBDA 4JKKA 2W9XA 2XKPA 1NCQB 3T08A 4R9DA 4YM1A 4YWAA 4YW5A 5JI9A 4E4SA 5EYXA 3SH4A 1W90A 3M1HA 5FZ6A 2OT7A 1H0BA 1PZ9A 1AR92 1BEV3 4M3CF 4D6SA 4D7TA 2EALA 2OZ6A 1F2NA 2CWMA 2WFF3 4O9EA 1AYN1 1QOTA 2BWAA 4YLZA 4LE3A 4BH9A 4CEYA 3O0VA 1JOBA 1LEMA 1JODA 2K46A 4CEYC 3LAGA 4XFAA 1OBNA 3N7MA 4OI2A 1NYWA 2P37A 1PM7A 3O12A 2FBEA 3C7HA 3E6BA 5FJKA 5I0SA 1SG3A 3KCCA 1QH7A 3DN7A 3V64A 4BCUA 1YI7A 2HKXA 1EUUA 4QGMA 4UAPA 4BE3A 4CDXA 3OGSA 4Y24A 1CD3G 1UOBA 1COV3 5HCBA 1LB2A 4P00B 1RUC1 2RS13 3B7MA 3I49A 1B35B 1PMHX 5FCCA 1HKDA 1RL3A 5K9YA 4NWWA 4Q0QA 5IW0A 4BQYA 2WABA 3WHUA 5A6QA 2O0OA 5B4XA 3I3QA 1HRI2 4Q26A 5FZKA 1GP4A 1NQJA 5FPVA 3BTYA 3U14A 1A34A 1R1A3 2D6NA 2PQQA 2ZGQA 4I3PA 4HK8A 3GNEA 4AAPA 2QQUA 3NRUA 2SBAA 2LS6A 2RM23 5IK7A 4AHXA 1YFUA 3AKPA 3NMBA 3TAYA 1ZREA 2MHFA 4HKOA 1PNGA 2AREA 2WNVB 3RYRA 5JPNB 3SH5A 5BUVA 1ZVFA 4HN0A 3KHBA 3GZUC 4MGZE 1OLRA 4LO5B 5FZEA 1JYNA 3LSEA 1SLCA 1TMF3 4Q0PA 3A0KA 1POQA 4EWDA 5IVVA 1DHKB 4DY5A 2YFZA 3OSDA 2ZZQA 2HWB1 4FFGA 4AEMA 4FPGA 1R092 2KD7A 4FI9A 4V2WA 2DWRA 2A71A 2FHRA 4UT5A 5C3SA 3CDZB 1D0HA 3AYCA 2Y0OA 1XNTA 2QQJA 2BVBA 3ACLA 1SMVA 1ULOA 2G1MA 1SBDA 2J1EA 5D1IA 1T6BX 1OXCA 3SEPA 4AI3A 2E7QA 2B5HA 2QKDA 2VCBA 1RUE3 2Y6GA 2HWF1 3ZLIA 4BWOA 4Y5Z0 4K8FA 3I97A 4XF3A 1J83A 2JE9A 1DYKA 2LW8A 1UMHA 3SCFA 5EFUA 2I2SA 3ABZA 5FZMA 1UZ0A 2EXJA 2ILMA 3O1UA 1CVNA 1FPN2 2K9ZA 2OKXA 2QE3A 2XJTA 4GQ7A 2BBVA 2WWUA 4E2GA 3GJBA 1EV13 3MEPA 4YW3A 1NCRA 2WNUB 5FZLA 3OGRA 1UPIA 2DTWA 2FDJA 5DDJ1 3NKGA 2UWCA 2ZX2A 3ZN4A 3PVOA 1C8M1 4LBMA 2NP0A 3JD73 1IS5A 2GMPA 1JXNA 1K5MB 3WNPA 1W3VA 1XNCA 2HWE2 1CAWA 2D6MA 2Z42A 2HLEA 4QQ2A 1REEA 4DOUA 3P3NA 3ZKYA 4X8PA 5FK7A 1N1VA 4CPBD 2D43A 2EIBA 2VY0A 4Z2WA 4AYUA 2WO2A 4MH0E 1K12A 4HONA 4ZU4A 4F7ZA 2XVKA 3SEEA 1BVP1 2YZ4A 3ZYGA 3ASIA 4YM2A 3RQ0A 5JZGA 4Q4V1 5JZGC 4XUOA 3VBHC 4NIHA 1V70A 4XBNA 5FYZA 1UOJA 3MIDA 3OY8B 4XCBA 2XQXA 1CQ9A 2XUMA 1JN2P 3D0SA 1L7QA 5FREA 1O3QA 1W39A 4P9JA 3HAGA 5AFEA 1XNAA 2FDFA 4CDWA 4I0AA 4CDWC 5GLZA 4FPLA 5ABJC 5LCWL 2WYSA 2QFEA 4AEDB 1Q43A 1YJKA 5IVFA 1WW7A 3U11A 4COYA 3I2DA 1OA4A 1VIWB 1PZ7A 4RL7A 1H2MA 3SITA 1PMJX 2YGMA 3THDA 4P9WA 2DYCA 4DXZA 2DVDA 4ZONA 2J42A 2VMHA 2W1WA 1PVC1 5FMBA 4I3GA 5L19A 4LA2A 1Q8VA 3EYPA 5FZ0A 4DNYA 2WRAA 2Z2SB 4LO7A 2JJ6A 2RDNA 2HBTA 2V5YA 4WM8A 2JECA 1EY2A 1WCDJ 4WM8C 1PZ8A 3UL2A 2XHNA 1XU2A 5LB6A 1NA1A 2OQ6A 1H8TA 2UWAA 2XJSA 1NA1C 4W65A 1H8TC 4YVWB 1JH5A 2LRPA 5F3GA 4LBQD 1GWLA 4P02B 5JSRA 1YFYA 4RHV3 1HW5A 2GAUA 3AKRA 2ZHMA 3ZFGA 1L7RA 3ZFGC 1R093 4XF9A 1T2XA 3UV9A 1HRV1 2WA4A 2YROA 1LHNA 2V5DA 2O8QA 2RS51 3N7JA 5FV3A 4A3ZA 1Z7S1 1WGPA 1NY72 4NJ4A 1CZVA 4QGLA 4M3CA 3IZOA 4Z07A 3MGUA 2XR4A 5ACA1 3I2KA 2X09A 3LPFA 4HT1T 1STMA 2AZ5A 3MZHA 3CNAA 3LWCA 2X29A 5CYYA 5DZEA 1TNFA 1ZBA3 4I0BA 4CDQB 1LNSA 2FD8A 1QMJA 1AUYA 1TZOA 4YFZA 4QAWA 3N36A 5I8TA 1GP5A 1FV3A 1HDKA 2OS2A 1VBB2 4KGQA 5JUVA 2VVDA 4BQ4A 3WUDA 5FY5A 2D6PA 2PLV1 5C8CA 3THCA 1FATA 5C8CC 1YCIA 3NV4A 3VBOB 4E4HA 1US3A 4B4PA 2DVFA 4LHKA 2V09A 1ST8A 4JKLA 1YQ8A 3IDCB 2H6BA 5DXDA 5F5CA 1TVGA 2V73A 3VBFA 4CP0A 3VZMA 1SLTA 3ZYIB 3BOPA 2O8OA 2YGLA 1KITA 3VBFC 1UXZA 5G05L 2ZGPA 4AVBA 5FXZA 1PO22 2Q4SA 5IVYA 2DDUA 2GN7A 1U12A 1VBD1 4OHWA 3CZUA 4WVVA 5CAZA 5BNOA 1D0GA 1V0AA 1I1EA 3RS6A 3MPBA 1W9SA 1V9U1 3NNJA 1LR5A 1HXS3 1UY3A 5BNPB 5LRRA 3WNXA 2VW2A 2CAUA 3T2TA 3E5UA 4FPJA 3RFRA 2DBIA 2E31A 1SLIA 2DCJA 2NQYA 4N90A 4QXBA 2FZ2A 2P1BA 5FPLA 2VMDA 4BISA 4CCEA 4GKXA 3AP4A 5LA9A 2EA7A 3ZN6B 3S5AA 3HT2A 1QQP3 5DABA 3BIWE 2VJXA 5A1FA 3MO4A 3BPZA 3R4SA 4Q4W1 1EUTA 4P08A 3ZMNA 4BPZA 3O1VA 3DXUA 3LEKA 2LUWA 5C5TA 3OGGA 4Y1ZA 1AYN2 2IFWA 4DS0A 2VBDA 3CJIB 4EQVA 4XFBA 4K40A 3UKVA 4M4RA 4AVVA 1VP6A 4PLNA 5AFBA 2CWSA 3DV8A 4PQ9A 1JZ7A 2EIEA 2W0XA 2XXZA 3QLQA 4LBJA 2UYBA 2XL9A 4QM8A 4XHXA 5L9BA 4KWUA 1X9PA 5F2WA 2Y34A 4YZ2A 2AYHA 2YU2A 2WDBA 1O3RA 1W2OA 1RUC2 3VHRA 5GJ6A 2QUOA 1ZRIA 4YPJA 1SLAA 2LTNA 2Y8KA 2D3PA 3THTA 5A7WA 3T09A 3VD7A 3ORJA 3WVJA 3UNPA 2GN3A 3AP5A 5EZWA 5GZDA 5IATA 5A32A 3UK9A 2JDUA 2WT0A 2IXIA 2VCCA 1JUHA 3CJXA 4JVAA 4CU7A 3H8RA 3ZPYA 5T52A 4LBQB 4COUA 2K2SA 1W28A 1UYXA 2WN2A 1UIJA 4FAGA 2QQIA 2MPFA 2ZACA 5A7NA 3ZFFA 1QJFA 1ULDA 4KNCA 2JDMA 4W50A 3ZFFC 1WLCA 1UU5A 4C91A 3O1PA 4XZPA 1TME1 3LIGA 1OVSA 3PVBB 5A6ZA 5LY1A 5LK7B 3WUCA 1PO11 3ZXDA 5J09A 1BVVA 2C1FA 2QZ3A 1LHWA 3APBA 2JXAA 4Y22B 1UKRA 4NUBA 1PK6A 4CUBA 4YVSC 1PK6C 3L2YA 1XE7A 3KCYA 1L7LA 3BU7A 5BXXA 1ZRDA 4XFCA 4AI9A 2X10A 3PUHA 1WBLA 4IL7A 2QVSB 4DO0A 4DUXA 1BK1A 1H6XA 1SPPB 4EZHA 1Q8PA 3HBZA 4WVMB 3WG1A 5FQ0A 4OI4A 3MIGA 1VBB3 3ZYJB 4EN6B 2E53A 2VGDA 2HWF2 2RDSA 3M8LA 3VKMA 2CU5A 2GP3A 5T3NA 1GOFA 3FFZA 5I91A 1WW5A 1S2EA 2A1XA 2VZOA 4FQZA 2W91A 1D2QA 1YLLA 3M3CA 4XMAA 5AC91 2GDFA 3NO8A 1W6QA 2BVVA 4L99A 5FZDA 4PIYA 4S2HA 3WV6A 5A70A 2WS91 1W8UA 2CSGA 5JR7B 2CNAA 4NROA 4D3WA 1OH3A 1RXGA 2I07B 3FLTA 1PO23 1J58A 3MF9A 1WCSA 2E33A 2L9LA 4P9LA 3D6EA 4XQWA 5DDJ2 4A4AA 2D3SA 3SHRA 1UXXX 1AL23 3AZYA 4NHXA 1C8M2 4RS5B 5FLHA 1AXKA 2CDPA 2R061 4CDUC 4FOWA 3LE0A 3ZYFA 4ASKA 4UF0B 1ENXA 4K1ZA 4CA9A 2VZ1A 5C3OA 1EAH3 1U5YA 1YXWA 1Y4WA 4MYEA 4W6XA 2XLGA 3BCWA 2BP6A 1QJU1 4LORA 4AHYA 1HV0A 1LEDA 3WOGA 1RTVA 3V0BA 1BXHA 4AI2A 1Z0HA 2D5FA 2Y6HA 3TEYA 1F9KA 5LBBA 3THPA 3G7DA 4BB3A 4Q4V2 3ZDSA 2UU8A 3FJSA 4UFMA 5F37A 4H2AA 4XAEA 2ZCWA 1M06G 4JCKA 3H7YA 3PLQA 1J1TA 2DU0A 2BERA 3VDDA 3VDDC 2WN3A 3KVBA 3LA7A 4LBNA 3UGGA 1O4YA 4NPLA 4PDWB 5FMDA 3ZXLA 4COWA 3ZYBA 3I3MA 1OH4A 4GULA 4EJRA 2V72A 1KDKA 4FPKA 3WF2A 4HETA 4KBZA 5CKMA 3W59A 5FYVA 2D98A 3BTAA 2DVGA 1TQ5A 5FY4A 1RUC3 1CZTA 2ZGKA 3T4VA 1RUJ1 3EO6A 4IGOA 1BHGA 4INDA 4ES9A 3GCWA 5I0UA 1VPHA 2VZ3A 1KQRA 2WBKA 4K9SA 4Y3OA 2JG8B 1UD1A 4RQPB 2PAKA 1NLQA 1UZWA 1MS8A 3IB3A 4F3JA 5FOBB 4JGZA 4J1XA 4MXVA 3RWNA 4JGZC 5J36A 1UY1A 1PVC2 2W92A 3B5LB 2CGPA 2ZAAA 1PX4A 3P6BA 2XH6A 3AXDA 1QJEA 1D4VB 4PIXA 2EVXA 3NNLA 1MACA 4FFIA 2IXKA 3LDKA 3VB9A 3WP3A 3KV9A 1OKQA 1RXFA 3OUIA 4LJHA 2VOWA 2QZ2A 2E32A 2HYKA 3J7NA 1W6OA 2XMLA 4KU8A 1ASJ1 5D8AC 1ZZ9A 5FP7A 3VBUB 4E4ZA 4LTAA 4D94A 1F31A 4AW7A 1JS9A 2J1AA 1G9FA 1AYM1 1YIFA 5LW9A 4XQDA 1OA2A 3I3BA 2ZMNA 1RGSA 1RUH1 3PU8A 5FUIA 4CXXA 1ONAA 4JKMA 4AZZA 1IPKA 4XDPA 1A3KA 1Z7S2 4H7LA 1C1FA 2VBBA 3S57A 2MEV3 4QPWA 5ACA2 2HWF3 3EMRA 1UMIA 5FZGA 5I93A 1SLLA 1FAYA 3OJBA 4CCOA 4RA0A 2P3JA 4JGYC 2YV8A 2IXCA 3POWA 4IV1A 2BNOA 4IV1C 4G9SB 1UO9A 4JTOA 2XBO1 1GZ9A 2ZKNA 3AFKA 5FYTA 1J59A 4YW4A 3CHXA 1B09A 2E9QA 3VN4A 2PLV2 3WXPA 1Q3EA 4DUWA 3H8OA 4KWJA 4AI1A 3W21A 3IPVB 3VZLA 3D82A 1BMV1 1C8M3 4XMIA 3WX5A 1PVXA 2JWPA 4L92A 2WC2A 2VM9A 3Q9OA 1LTEA 2XB6C 2F4LA 2VD7A 3IMMA 4HANA 4F83A 2A6XA 1XYPA 4QWNA 1BBT1 1X8MA 1RUG3 5I8YA 4XOGA 1N3QA 1W6MB 5DAPA 1ND2A 5FWEA 5C6CA 1VBD2 2OQ7A 1ND2C 3K3NA 3ZX7A 4DRVA 4OLLA 1FYUA 2IVIB 4MGSA 3RZKA 3CBNA 2JDYA 1LGBA 4Q4V3 4IERA 3KD4A 3A7QA 3KCXA 5A7QA 3I59B 4DB5A 2DCKA 3POEA 5FZFA 3M7AA 4WV8A 2VMGA 2ORXA 5BNNC 2X5IA 2BU9A 2X5IC 3RI8A 1UU4A 4BQWA 4Q4W2 4XUTA 5F3IA 4DEQA 1IHMA 1WD4A 3W20A 4ZU5A 5DMYA 3SC7X 5FLIA 5CFCC 1JOJA 3VDAA 1OUSA 4BQ2A 4A44A 5F1RA 4UW5A 5JOXA 2UURA 4DXSA 1CAWB 1XE8A 2W87A 4LLFA 1XNDA 3VD4A 4S2DA 4QM9A 3B00A 5EPAA 1E5IA 4E8DA 4HPKA 4YZ5A 5JOZA 1BZWA 1AX0A 4QMAA 5T50A 1W2TA 3LF7A 3KGZA 3IWZA 3QD6A 1H6YA 3JBG1 4BHPA 3BUCA 1UX6A 4MGQA 3LSDA 3FHAA 3POGA 1J84A 3VBHB 3ILNA 3DL3A 4YM0A 1FMD2 2W46A 4QB2A 2XG3A 5JXJA 3WW1A 1OMIA 1A78A 1OOPA 1NE6A 1OOPC 1LECA 2P2KA 3M2MA 1Y9GA 5GLWA 4O7XA 3EJKA 2EICA 5FMOS 1HIXA 2D7FA 5CG9A 3LGRA 3BU0A 3EHKA 4CDWB 3AKTA 4N43A 5ABJB 4NRPA 1W99A 1DF0A 4N43C 5FYHA 3TWIA 3DPRB 2WZR1 4LKEA 2GC3A 2D40A 5FPZA 1TME2 1N1SA 4BJ0A 3NJZA 2KXLA 3ALQA 4NOTA 2ZJCA 2EIGA 5EQUA 2LROA 1PO12 3VD3A 4QKDA 3V0AB 2VULA 2XJPA 5ACA3 2R7EB 2VZQA 2DU1A 4IV3B 4FO9A 1UCXA 1VRH1 1QY4A 2VUJA 4XBQA 4AQ2A 2X05A 1OLMA 3B3QE 1EYBA 1LKNA 5GZFA 4WM8B 1DGWA 2VOKA 2Z79A 5DAQA 3UT0A 4LHSA 1I5PA 5A6YA 3S7IA 5FYSA 4FTEA 3ZSKA 1A8MA 1MS3A 1NA1B 4META 4AAXA 3ZR6A 4P9YA 3NJYA 1DGRN 5FYYA 4H14A 3RZMA 1VBA1 1OQDA 3IBMA 2PHFA 2BOJA 1HB1A 2VQAA 5DUUA 4IE5A 1KEXA 3EB7A 1MEC1 3LFIA 5IWFA 5AC92 2R071 1UWWA 1FT9A 1HLCA 1CR7A 1RUD1 3K77A 3PUIA 4JRLA 3USSA 5CA6A 1DFQA 3CU7A 3PTRB 4OHZA 4GZ9A 4MVTA 3LEGA 3ZYHA 2WUHA 3I2JA 4Y33A 2UY9A 3GM8A 1OQ1A 4M3CB 4Q8KA 1F15A 3HVDA 2Q1MA 2NZ9A 4TLFA 1VBD3 5EIYB 4DQAA 3FN9A 2XGXA 3GYDA 3OGJA 4OI1A 1NE4A 2VUAA 3DEMA 3NWKA 4AEKA 5JSPA 2R062 1JZ4A 1NQDA 2WZ8A 5FZ9A 2AACA 1AF9A 1REDA 1W2NA 2V4VA 5CADA 4Q0SA 4FOYA 4QD2A 5LEKA 5LA1A 1RUNA 2C9KA 1XYNA 4MX3A 4LEJA 4UWDA 1QJU2 2ZX0A 5J98B 4C1XA 2PAMA 3MBWA 4LHLA 2ENRA 4Q4W3 3OGVA 4LOTA 2FQPA 3VDCA 1WA6X 1GWKA 1ENQA 2VECA 4ZS2A 3I8TA 3I54A 2ZGNA 1YFWA 1W8ZA 5KC5A 2IXLA 1JZ5A 4AQTA 1O6UA 4LO6B 4Y1XA 3TNQA 3VBFB 4NPMA 1JYVA 3VLBB 1LCLA 1LOFA 2HEYF 3MIEA 1T6GC 1LOFC 2DV9A 3B9IA 5FKBA 3J8F1 3BI3A 1JBCA 1RUJ2 3LDRA 4CDXC 3OBZA 5I8SA 3BYWA 1C5HA 1I5ZA 3AZXA 2VUCA 4UFHA 1OD5A 3AP6A 4XTPA 2EIDA 2R041 4A6SA 1FMD3 3AP7A 4AOCA 4BMEA 5C9AA 1XXNA 1UOFA 4PHZA 5F6KA 1FNYA 5DQ0A 3TNPB 5C9AC 1NZIA 1YI9A 2PTMA 3PVNA 4OHVA 2AEYA 3AMQA 3UJOA 2RMU3 2TBVA 4U2AA 3K48A 5HI0A 1HB3A 3IMNA 1D7PM 4XUNA 3T1MA 2VU9A 1J3PA 1WBFA 1AR81 1A8DA 3AZZA 3T0BA 5EWSA 5F5QA 4Q5OA 3KV5A 1PO13 3DKWA 4AR2A 2DUQA 2PHTA 2VTFA 1QDOA 3TEXA 4YGCA 5L9VA 1WD3A 1QOSA 1S0IA 1AYM2 2O14A 2CAVA 4QKNA 5FK8A 5A7OA 1RUH2 5FMCA 4GB31 4NHKA 3OPWA 5CU1A 3NV3A 4ZXEA 2DF7A 2D6LX 3OUHA 5I0DA 4RFT0 3VKNA 1IKQA 2DCZA 2RG4A 5GZEA 4AQSA 3KF5A 2VTXJ 2Y6JA 5A32B 2BWCA 1O5LA 4OMCA 5CZKA 3U37A 5J96B 2ZPXA 5BYNA 5IVJA 5L36A 3BODA 2EXKA 5HCAA 1PIV3 3K4AA 1X8EA 3ON7A 1RITA 2HWC1 1TEIA 5EJ3A 4AGGA 1JYIA 3NAPB 3ZSEA 1GYKA 1ZZCA 3O7OA 1HQNA 2A5ZA 1VBC3 1TNRA 3SKVA 1BQPA 5AC93 5ISLA 4XHBA 2YYOA 3FC0A 1XJAA 3UETA 4OFGA 4B29A 1W6PA 2XBO2 4XFGA 4MXWA 3N9QA 4K20A 4LBLA 4OULA 4A6OA 4YGBA 4URTA 4XJZA 1QXJA 1SDDB 4UW3A 1XE0A 5JVVA 3LPGA 4LK7A 3AMPA 2I45A 1H1IA 4F8AA 5GZCA 1MR5A 4YVSB 3SXWA 1LRHA 2JIJA 3HN1A 1OSGA 2ETEA 3KSCA 4XC9A 5BPXA 4KU7A 4BMBA 4C8DA 5HV4A 1S0BA 2JKXA 4GWIA 3O1OA 1BMV2 4LQRA 2R063 1QJY1 3U1XA 1NCRC 3MYXA 1NAEA 5J3UA 4CUGA 3WF3A 1NLSA 3MIHA 1CPMA 2BDRA 3KS7A 5FQ0B 3CO2A 3NVCA 1O4ZA 3SH3A 5LK5A 1BBT2 5E88A 2RJKA 3MW4A 3OYWA 3E97A 4AL9A 1S4CA 3ZMOA 2YBKA 2TEPA 2ZS6B 1F5FA 2AENA 1Y3TA 4GJZA 2C5DA 2ET7A 1GQPA 2WWSA 4FPEA 4P14A 3T0AA 4CCLA 1MZ6A 2VR4A 4R9AA 4DZGA 5FOJB 1UIKA 3FUQA 2A6ZA 4PF5A 4ZHNA 2ZA9A 2WR9A 3N9MA 3NQHA 4KMQA 3U10A 1CIWA 1OD3A 3QBQA 3PTYA 2OX0A 1V6MA 3BKZA 4WM7A 2G9FA 3H8UA 4WM7C 2ZEZA 1AR93 3ZFEB 1KJRA 5A33A 1JI6A 1FNZA 3NNGA 4YYOA 3WSOA 1RUF1 5CIRA 4BIOA 2ZEXA 1VLNA 1W6NA 2QCSB 2ZXQA 3BVCA 4QQHA 1WA4A 4NIIA 4A42A 5KR7A 2JG9B 1ZNPA 4FSJA 1QEXA 4CDUB 3VZKA 1YRZA 2R1BA 2XOMA 5EHDA 5DUVA 3U4XA 3TN91 3OEBA 3WD5A 5KHIA 2VQ0A 3GALA 4RGAA 4XIKA 1ND3A 1ND3C 3VD9A 4CCDA 2GC2A 3CF6E 4RR3A 1PHMA 2ID4A 1QJX1 3NNMA 4LHNA 3VBSB 3WNKA 2GNDA 4IETA 4L11A 4CUCA 4YSFA 5FPXA 3V0BB 1CAVB 1H1MA 1DGLA 2LALA 3AKQA 4NN0A 3DYPA 4MGKE 4R4ZA 1PGSA 4E8CA 4ET7A 4XJUA 1S0FA 4A41A 2VW1A 1HRI3 3JBG2 4AWDA 2ZEWA 1C4RA 2VNGA 1DIWA 3GZTB 3PL0A 3LOBA 4HMZA 4MGIE 2R49A 3N3HA 1GKBA 4Y5TA 5JR2A 4XF4A 4YG3A 3R4DB 1ACCA 4UFJA 1RHI2 1VAKA 2B7YA 4KG8A 4OUMA 4EV0A 4CP9B 3LQCA 3Q8FA 5FRAA 2WZR2 4A7KA 4XPVA 3PIJA 3E5XA 3U0ZA 4OHYA 5EP9A 1IZ3A 3AMNA 2BOIA 5CKNA 1KGYA 5IAXA 4W6YA 1H2NA 1E5HA 2WAAA 2EXIA 4OVEA 4M0HA 2DVAA 2BGPA 2O1QA 2QQOA 4UFLA 4EE2A 1UOGA 4NRQA 1ZM1A 4R8HA 4JGZB 4K3UA 2P3IA 1SFNA 1W04A 1YFXA 1REFA 2BGCA 3R0RA 1VBE1 4Q1RA 3PUQA 5I0TA 4DY3A 4UFKA 3DXTA 2VMFA 2XBO3 2YBPA 3FLRA 2VH9A 5DAVA 1FXZA 3H1WA 1LGNA 1XPWA 2A3XA 2RS31 1LOAA 3ZKUA 5D8AB 4YRDA 1YQ2A 3HQRA 2ZMLA 5FYCA 1FPN3 3WDWA 3B69A 4CRQA 2HEWF 3Q8BA 4IEYA 1MZFA 4AK3A 1MEC2 1SEFA 2ARAA 3Q8EA 4XXPA 2R072 5FZOA 1Q8OA 1DQ4A 1RUD2 2Z5WA 2GALA 2ZGUA 3T30A 3WINE 2VZUA 3MIBA 4GXLA 3DF0A 4M0NA 3EQEA 5FUNA 3ZIWA 1OFNA 2WWJA 2WZEA 3KHCA 1WW4A 1AR61 2HWE3 1CAXB 4OZXA 4YG6A 4B7KA 4JGYB 3SLIA 3T2QA 3AYEA 3WHTA 2WA3A 1VMJA 2G19A 4IV1B 2W47A 4RSUA 2PHXA 4FTSA 3GF6A 4ATFA 2ZGMA 3W5MA 2W94A 4AEDA 1C5IA 4QPGB 1XB9A 5BNOC 1R081 4HL0A 3O1TA 4LLOA 2DCYA 4B1MA 4C90A 2QDRA 2WL1A 5A1AA 2VBPA 1N47A 1ZZ8A 2VQTA 1CJPA 1DBNA 3BB6A 5IAVA 1NCQA 1JYWA 1GZWB 1NCQC 2ERFA 2DVBA 3JCIA 1UY2A 5FXXA 2PQSA 3IDAA 3K75B 3VKOA 3MI8A 1F8VA 2TNFA 2Y33A 2PHDA 4AI8A 2QQWA 2BGOA 2PN5A 4Y26A 4Y1YA 5LY2A 1W03A 2IC1A 2NMNA 4JQTA 3D5OA 4D6QA 3AYDA 4BQ5A 4CU6A 5HXMA 5L7OA 1YUDA 1IPJA 4EWAA 3J8F2 4IEXA 4KI5M 5L7OC 2C9AA 3LD8A 1V00A 3PJYA 1CX4A 4N7IA 1U5IA 2W3JA 4IEWA 4MZUA 2R042 3OB8A 3HNYM 4QHOA 5LRSA 5FYMA 1W0PA 1QIQA 1VAVA 3N9OA 1H4HA 5BNNB 1O7FA 1RHI3 1VB2A 3ZOIA 1W05A 5TSWA 3HPNA 1DGRA 1MS0A 1OQEA 1G9CA 1O91A 2J1SA 1PNFA 2WNEA 4KH9A 2WZR3 4Q2FA 4QDSA 5DN2A 3UGHA 5CISA 2VZTA 3E6DA 5GLVA 1G86A 5CFCB 1AR82 5K8SA 3INAA 4Y20B 1W0OA 1DYPA 2ZEYA 3NJXA 5M0TA 4ZXKA 2WNVA 2WFF1 3S30A 1XNKA 2WNVC 2PMWB 3B9CA 1NX9A 2VMEA 3AL5A 1GP6A 2R0HA 1LU2A 3PUSA 4AEJA 4FBFA 3I2HA 1M4WA 1DYOA 3RDIA 1AR71 3HQXA 4HPKB 1BK0A 1QDCA 1YWKA 4GH4A 3VHNA 2JB8A 3WCRA 4GH4C 1NKGA 4N9HA 1WKYA 2VVFA 5DUWA 3HMYA 2R0FA 3DECA 4MHUA 4Y5SA 1CZSA 2HWB2 3GHMA 4HFSA 3IIAA 3HQUA 4Z1VA 4EWEA 4YNIA 3IDBB 1V6IA 3TYJA 2HWC2 2NMOA 3W58A 4LOSA 3NNFA 2TUNA 3J4UH 3USUB 4MSVA 5K4LA 1APNA 4N43B 5A3WA 1XQNA 2UWBA 1LHOA 2PHLA 1I3HA 3B02A 1UMZA 2RM21 3ACGA 3QACA 1MS4A 3IT8A 4OI0A 2UYAA 2ZGSA 4JDMA 4AFMA 4NMIA 1MVQA 2AEZA 3C7FA 1GNZA 2YB7A 5JDBA 1QWRA 1TMF1 5A1LA 4N53A 4ORFA 3LA3A 4N53C 3MFCA 1UPSA 4XF1A 2D3RA 1QJY2 1DLCA 1N1TA 1V6JA 1ZBE1 2ZMKA 2UY8A 4LO8A 4QX1A 2Q8CA 1QF3A 4LNVA 4XFFA 1K5MA 2R6QA 4L9BA 4YGEA 5IVCA 3POFA 1POV3 4XTMA 5FZ1A 1V6OA 1GZCA 2RV9A 5A6XA 4CCKA 4RFRB 2WZPP 5C3PA 4PCRA 1HB2A 5H9RA 5FO8B 4XZUG 4XVHA 5FXWA 1ULCA 2VG9A 1RB8G 5LA0A 3WP4A 1RUE1 2GP5A 5C5UA 1DZQA 1PGL1 1H8VA 2HYXA 3M3EA 2WT1A 4ASMB 4C1WA 5E8AA 2J7MA 3BGAA 4UW6A 2FMDA 3IAPA 4AVTA 3RGBA 1LOBA 4DRRA 5IUQA 2AGSA 5LEJA 2YY1A 1YQ5A 2VW0A 3IM0A 3S0MA 1VR3A 1RVF1 1OF4A 2WO7A 3AJYA 3LDBA 1Q5OA 3ACHA 3OY8A 5FR3A 3MV11 4MO3M 1PM4A 3VKFC 1V6NA 3WDUA 1AYN3 1G6NA 4NVPA 1RUF2 3JU9A 1NZCA 3R05A 4M01A 3WNMA 1JZ8A 1GU3A 1DQ2A 4IEOA 1ULFA 4XDOA 3LCPA 1IS6A 5FY0A 4Q0VA 3BTZA 3JD71 3TN92 3D8CA 2WFPA 4U36A 5CVRA 2B9VA 2B8MA 2VCMA 4W6WA 1XSRA 2OZJA 5JOYA 5T5PA 2CY6A 1C3HA 4XFIA 4BK4A 4E2SA 5J1XA 1QJX2 3ROUA 4MG2A 5C70A 2P6HA 4KWKA 5FDBA 2HH9A 4A7YA 4CXWA 2Y26A 4LE4A 5ANQA 3UYJA 3FLPA 4NHMA 2JD9A 4XJWA 1N3OA 1IS4A 2VOXA 1CX1A 4DUVA 4DEVA 1YO8A 3LOIA 2Q1ZB 2OPKA 4CVUA 4MGTA 3SKJE 1UQXA 2AC1A 2JD4A 1MS1A 3RYKA 2G9GA 1EP0A 2CTVA 1ZZ7A 2A73B 3FUOA 4WVZA 3AYAA 4M3CE 4WBBA 1SQ4A 3R6SA 3WDYA 5A3LA 2R16A 4CEYB 1DDLA 4XBLA 5FBJA 2Z4FA 4GMP0 1H9PA 2F6BA 4H3WA 4A7ZA 4D0QA 4MGYE 1JUIA 5JWPA 3WNOA 1WLWA 3MLJA 3ILFA 3W5NA 2G4IA 1W8WA 4CDXB 1SLBA 1YNAA 1UAIA 2HWB3 5F2SA 3RZZA 2WLPA 5C9AB 1U5XA 1ODMA 1V6LA 1HRV2 2Y60A 3Q8AA 4LKFA 3MV01 1E5SA 5F9TA 3T2PA 3GHNA 1LU1A 2HWC3 2AR6A 2RS52 5KXEA 1RIRA 1VBE2 1I9RA 1CESA 4AI0A 1CJDA 3MIFA 3FL7A 4CDQA 3LEIA 1GMMA 3SISA 4CDQC 4YZ4A 4YW6A 2JE7A 3LEMA 1AXYA 5JIUA 2YUEA 3AM2A 2NLRA 2RS32 2PAEA 5FY8A 3WF1A 1LULA 4IUGA 2W5FA 5KXCA 3H1MA 3M3IA 3VZNA 1IKPA 2A70A 2VQUA 4OUEA 3OTFA 5G04L 5K0UA 4MUVA 3VZJA 4D7SA 5K0UC 4RHV1 5FZ4A 3OUJA 1NUKA 1P8JA 1W9WA 5FO9B 2YXSA 1MQTA 2EAKA 4SLIA 1MQTC 2A7AA 2XJQA 1R091 4O61A 2XVLA 5DDJ3 4RGGA 2OXBA 5FZ3A 3URFA 1H9WA 4B3NA 2ZX3A 1EPWA 5DAWA 1UYPA 1YC61 2IZWA 4UXAA 4XILA 4FPOB 2ZGRA 5T5JA 3VL8A 1AR62 1C1LA 3ACFA 4NPRA 3ZSMA 3MLKA 2ZHKA 1O4TA 2ZKLA 4CPBA 4Y1VA 5LBEA 1IPSA 5A3NA 1ZBA1 4JC1A 2QQKA 2BFUL 2ZOEB 4LO4B 5BNPA 3E6CC 2VO5A 2ARCA 4MXWB 1R082 3E5QA 1V9U2 2KA3A 2ZX1A 4QKFA 4URAA 3U75A 1W8FA 4LK6A 1NXMA 1IQAA 1QXPA 5T5LA 3ZDVA 4DFSA 5I0RA 5IFTA 1FV2A 1QHDA 4DXRA 1OVPA 1YJLA 4XUPA 4W4ZA 1S2KA 1HX6A 2BFUS 2VL4A 3I7DA 1ODNA 4ZZ5A 3H0OA 4CZSA 3BTXA 4ARXA 2AUYA 3FWEA 2YBSA 2R32A 4HKWA 1NCRB 4JHTA 1LGCA 5ERLA 3NJVA 1D4M1 2FDHA 3TN93 4P5YA 2WYFA 4YFWA 3CJIA 4LIVA 1VB4A 5DAXA 2W1SA 3CJIC 4RD7A 3W9AA 4B4RA 3CKHA 4PJYA 5E89A 4CYDA 3OYWB 4IW3A 2Q8EA 4C0BA 3T1LA 1CAUA 3ZXFA 4UYBA 4FTBA 1GOGA 5EJ1B 3NKTA 2V4AA 4XETA 2KR2A 3OEAA 4E27A 1PVC3 3WF0A 1GNYA 2QQPA 1H30A 1HXS1 1GZTA 5GLUA 5CBLA 3NW4A 1OPOA 3WQ7A 1VMFA 2G9ZA 5FMOL 2GU9A 2GC0A 3KGLA 4WM7B 5JLVA 5KHJA 2DUOA 3HJRA 4JZRA 1OPMA 1KRIA 4LBQA 2JDHA 4FFHA 2IUWA 3OD4A 1W9FA 5HPOA 1QQP1 2FDKA 1JHJA 2VMCA 2OA2A 2C0ZA 2JB4A 3KT7A 1NXD1 4K6BA 4NE9A 1XYOA 4N8MA 2QJVA 2NM1A 2HWD1 1VMHA 3WEZA 4CCJA 1UX7A 2P3KA 3RG0A 2WFF2 1UZZA 3PJQA 1HRV3 3D0JA 3KMHA 1ND3B 2VOVA 4R52A 4Y22A 2LM3A 5FPBA 1AR72 1GLHA 2RS53 2PXJA 1Z7S3 3ZO0B 3B93A 2KM2A 1FOD1 4XJ8A 4Z2AA 3AK0A 5FZ8A 4CU8A 2D5HA 3O14A 4DINB 4EZ4A 3RNSA 4WVMA 3U78A 4JX0A 5IK4A 5L73A 2XL7A 2IVJA 1K3IA 3J7MA 3GBGA 5KHGA 1H8TB 3WDXA 2W1QA 3PURA 5LATA 1VE0A 2PLV3 3FE5A 2XJRA 4Q4Y1 4KQ7A 2VE1A 1RUI1 1AJOA 4IQPA 4P5HA 4HSJA 4QXHA 4CCNA 3ZXEA 2OYZA 1G9BA 2RM22 5CNAA 3BALA 4CU9A 3ZFGB 2GC1A 4H55A 4XUQA 1GQHA 1GSLA 5CFDA 4V1PA 1R1ZA 3LFMA 4QDQA 5E16A 3RWKX 3VD5A 5CFDC 5FYBA 2JEMA 1AR63 4NAMA 3GJAA 1TMF2 2BNNA 4XE9A 1YIPA 5HXVA 2WS92 2EF6A 5D2AA 2ZGTA 5KC6A 1ZBE2 2GMMA 3GXUA 1WUVA 1W9TA 3J9SA 3KLSA 3HNBM 1WMDA 4HKLA 2BQPA 4NRMA 1R083 3B01A 4UF0A 2CYFA 1V9U3 1BKZA 2ARBA 4FP2A 3C3VA 4LPLA 1JU4A 1AZDA 1RMU1 4YW2A 5C7GA 3PIGA 2JKBA 1RUE2 1QU0A 2RR11 1PGL2 3HT1A 1H2LA 1MS5A 1KS5A 4PLMA 4XAAA 2QTWB 5DZFA 5A3UA 5C8CB 2ZZJA 3LIHA 3RJRA 2EAAA 3POYA 5GLTA 2Q1FA 1WMEA 2WKKA 1RVF2 3AVRA 1UY0A 5T5OA 3VKLA 5B2GB 4PI0A 3H9AA 1ENSA 2H0BA 4IGPA 1XNBA 3JB8A 5LBFA 1PO21 4R4XA 3FBYA 2GH2A 4QQPA 2Y0IA 1Q56A 3LZZA 3JXSA 1W9YA 1QH6A 4CE8A 3ZN5A 4EN9B 3WQBA 1IQDC 1JYTA 1AL21 3WP6A 2Y6KA 2FDIA 3JD72 4FCAA 3AVSA 5BNOB 1TG7A 2JG8A 2JG8C 2VNVA 1EAH1 1HJGA 1RJ8A 3X29B 2YDEA 2SLIA 4E2QA 3TEWA 3OPZA 2X8KA 4IDZA 4JDNA 1J1LA 2BYVE 1OHFA 3HN3A 1JU3A 5DUXA 3DYOA 2DUPA 2QNKA 3OBRA 3HOBA 4EN0A 2WLQA 3VBRA 3VBRC 2B39A 4GAZA 1TME3 1S0EA 1W8TA 1HJFA 1AR73 3ES4A 3QH6A 2DCTA 2VC9A 3VBUA 3VBUC 2XQRA 4WZFA 2WO1A 5L7OB 4FPHA 3SQOA 1SDWA 1ASJ2 1SBEA 4GJYA 3FMGA 4M00A 5AVAA 4ITCA 4J1WA 4AQ6A 3K4DA 1LHVA 2J1TA 3WNNA 4XCAA 1C28A 3MFAA 1Q8QA 3O0XA 3DCQA 4AHWA 2H0VA 1YYNA 3MPPG 2BJSA 3WQ1A 4MOAA 3FHQA 5F5AA 5FZBA 2ZBJA 5A7WB 4HLTA 4XJ9A 1QNWA 3PDQA 1ZRCA 4BYYA 3WNLA 1H4GA 1CN1A 1ZX5A 5A7PA 5C4WA 2D6KA 5A3MA 5C4WC 5JPMB 5IK8A 3ME2A 1PMIA 3QCWA 3T4HB 1G9AA 2XDVA 2IXJA 1XC6A 1LAJA 2BPA2 1QGLA 3ITQA 4MHRA 5GKAC 4H7MA 3J26N 3ZFFB 3T2OA 4FVVA 4HVQA 2FCTA 1N3PA 1OLQA 3POIA 4ZZ8A 4RHV2 4KGGA 5FXVA 5HCFA 4D69A 1AHSA 4FT8A 1OURA 4YGDA 2WS93 4HG6B 4GH4B 4OCTA 3IPVA 3I2OA 1ZBE3 4XW3A 3ES1A 1PK6B 1XRUA 3AB0A 1W2UA 2P5BA 3AJZA 4IE6A 4BZ4A 3WW2A 1WZXA 1S0CA 3M70A 3MICA 2C6SA 2VZRA 1C57A 2A6VA 2WQ4A 1PGW1 4GWMA 5A3PA 1O59A 2MEV1 1W6MA 2Y38A 4K21A 3ZR5A 3KT4A 4AF9A 2E63A 1ZBA2 4ZU7A 5FPUA 5F7UA 1QJU3 4LITA 2QQNA 4JAAA 4YW1A 3CQOA 3NV2A 4BQ1A 5FY7A 1RVF3 2VZVA 4BOWA 1HQLA 1SACA 3I59A 3N9LA 1DCSA 3WR0A 5T55A 4TN7A 1GUIA 1W6QB 2Q0AA 3ST7A 1JYXA 4G4FA 4G3YC 2ZX4A 3MF6A 4N53B 1DQ0A 1WW6A 3EXUA 3ENRA 5KXBA 4QKBA 4IEPA 1D4M2 2JIGA 3H3ZA 4J6GA 1WLTA 3TRSB 4Q1PA 4QX5A 4S2GA 4PBPA 1RUJ3 1WWYA 1XBFA 1XOYA 2ZHLA 3I4IA 4FOQA 2YPJA 4JQRA 4LBOA 4AFBA 1BCXA 1RUG1 2BTVC 2ZGOA 3Q8CA 4SBVA 3ZM8A 4HBNA 4CEWA 5KWRA 4CEWC 2IXHA 5F6LB 5FZAA 5ANNA 3RMXA 5APAA 1DQ1A 2VZPA 1H1AA 1HXS2 2I74A 2WINB 3GBWA 2Q30A 3KQ4B 4RR3C 3VHPA 4B4QA 1JZ6A 1SCSA 3JQXA 3VBHA 2W68A 4Z92B 3KV6A 2VAUA 1OA3A 4Q27A 4AFDA 1URXA 3D3AA 4GMP1 5HV0A 2JICA 5IYYA 1O8SA 1ULPA 2BEOA 2QQLA 3AL6A 2A6YA 5A3TA 2ARXA 5LZ6A 2VXRA 4XEZA 3ZVXA 1QQP2 3VDDB 1ZA4A 2OUJA 5ABJA 1ASJ3 1OLME 3DPRA 4MLOA 3DPRC 2HWD2 1ZZ6A 3ATGA 3AMHA 1AYM3 4DMIA 3O1MA 3MW3A 2JX9A 1RUH3 1WCUA 2XLAA 2YU1A 1UYZA 3RZGA 4QU2A 4N7UA 4FFFA 3V0AA 5J37A 1CIYA 5LWBA 1LOEA 1UZVA 3ETPA 4JHZA 4IV3A 4IV3C 5CEHA 4NIDA 3NL1A 1FOD2 3NSTA 5FO7B 3JQWA 3QOPA 3VZOA 2YC4A 1VRH2 1W8NA 4JV4A 4XDQA 5DZGA 3VHOA 2XLFA 4LBKA 3KVAA 2OIIA 2XKOA 4X6QB 2GSYA 1R64A 3C7EA 4RYDA 2Y64A 4FP3A 5FZIA 3K51A 3QH7A 4LIUA 4Q4Y2 2A6WA 4UFIA 1I6XA 2J1UA 1RUI2 1W6OB 1DZTA 1S2BA 1VBA2 2YHJA 3JZVA 4XURA 4A45A 3GBFA 3MW2A 3C8XA 4ES8A 2GH8A 4UOJA 5FAXA 4KG0A 3J7LA 3CL1A 1UYYA 4QX3A 1JOPA 3I3DA 4PLOA 2WQZC 5JXIA 1AXZA 4XQ4A 2X53S 5BY5A 2ES3A 3OG2A 1YQCA 2NN8A 3M3OA 1BBT3 3P5BA 2ATFA 4LKDA 4O65A 3RPQA 3WW4A 4BK5A 4BLIA 3HBKA 1K42A 4Y4RA 4TZDA 3IIIA 4QPIA 4YM3A 1DG6A 1RYYA 4QPIC 3UESA 2D93A 1HN1A 1S0DA 1L3JA 1U0AA 4ISQA 1SHWB 4MV2A 4RGKA 5SV8A 5JOWA 1JMUB 1RMU2 4OMDA 4CXYA 3GZEA 4DIQA 2BV4A 2OUHA 1RC6A 2RR12 4Q4X1 5C8WA 4KBBA 5IFPA 5K0UB 4COZA 4Y1UA 1AJKA 1DQ5A 3KF3A 1MQTB 4DPNA 1W2AX 3TB0A 1K45A 1QJZA 3O5SA 2GNMA 3IN9A 1D4M3 3KB5A 3WDVA 2OVUA 3ZYRA 4IE0A 2XJUA 3SCHA 2QBXA 2FDGA 5FWJA 2QQVA 4XABA 1VAMA 3AMMA 1GV9A 3OPTA 4HK9A 3VL9A 1X9TA 1AX2A 3UKTA 3AZWA 1US2A 5F5IA 5JCTA 4AVSA 4QU1A 2FZ1A 3DYMA 2WIIB 3GZAA 1AL22 3S6PA 1H2KA 5H9QA 1QNYA 1ND2B 4N9IA 5FYIA 3O1SA 2A3WA 1S0JA 1ULEA 2EXHA 3ZSJA 2Y6LA 4W8JA 1X36A 1EAH2 2IFRA 3R4UA 3JBG3 1B35A 2ZABA 3AC0A 3OD0A 4GD4A 1B35C 4IGQA 1UL9A 1VRBA 2RDRA 4GIQA 1POV0 5CKQA 3ZXJA 4UI9L 5FJHA 4I2OA 4HZFA 1HB4A 4FPYA 4IEVA 4QB1A 5FIXA 4OQ8A 3ACIA 4AVAA 2PFWA 4ZS3A 3N7KA 3WDTA 2HWD3 2X5IB 1GANA 1BJQA 1SZBA 3DUIA 3LKJA 4IEUA 4AGRA 1G9DA 3H8XA 4NIGA 3MHZA 3WG4A 1E5RA 2VZSA 4FXGB 1FX5A 4PBOA 1QOOA 4NAOA 5JI7A 4OQ9A 3K2OA 5J7MA 2XWJB 3H42B 2Z69A 3F2ZA 3WLUA 1BEV1 1VJ2A 2BBAA 2MNGA 3L9JT 1ENRA 4XF0A 2JDKA 1CAUB 3WQ0A 3H7JA 1FOD3 1SFYA 5JMCA 2CL2A 1IOAA 1AVBA 1GFF2 3L2HA 5FP9A 1VRH3 4QPYA 4OHXA 1WCQA 2W39A 1ZYBA 2GZWA 4GB32 2VTXA 4FOVA 2WSVA 1FMD1 1COV1 4Q0UA 3WP5A 4YZ1A 1RINA 3KWVA 2RS11 5IVBA 2QDNA 3I2GA 3S7EA 1KFXL 3TEZA 4QX7A 2BRTA 2RMU1 3NAPA 1OOPB 2ET1A 2WQ8A 1GR3A 3KT1A 3CZJA 3NAPC 4L2NA 4Q4Y3 3ZIXA 4XXAA 5FYUA 1RUI3 1W0NA 3PMSA 1VBA3 4V2VA 4P9IA 1CPNA 3ECQA 1VALA 3K46A 4X6RB 1MEC3 1R1A1 4GA9A 4PQQA 2R073 5B4NA 4WVWA 1RUD3 2P34A 3RMYA 5JXHA 4JDOA 4L8QA 1F35A 2Q5TA 3BN6A 1GOHA 1ZRRA 2NPIA 2PHUA 3V56A 3ZPOA 4YVSA 3RI9A 4RN5A 5FKCA 3N9NA 1JZ2A 4BIFA 2WNUA 2W08A 4TXWA 2WNUC 1E57A 3WCSA 1Z78A 3POJA 4TTGA 2ZTNA 4AVCA 2R30A 4EN7B 1LJ7A 1UKGA 3HNMA 3PNAA 1PGW2 4PI2A 4NR1A 4CP2A 1RMU3 2MEV2 4Y4YA 4NWVA 5C3RA 1K5MC 2RR13 4AG4A 4QXKA 1OF3A 1PIV1 1ZA7A 4FXKB 4R9BA 3OOXA 1Q8SA 4D8MA 5KXDA 1CONA 2D44A 2ZHNA 3A23A 4OYUA 5F8PA 2XWBB 1VBC1 4D7YA 2CV6A 4R9CA 4CCCA 3IKWA 5FLJA 4P9XA 1UF2C 2XJVA 4BQ3A 5H9PA 4E4DX 5DPNA 5BNQA 1OKOA 4A3XA 3WG3A 3ZYPA 4O9GA 2B42B 2YC0A 4BLJA 5EV7A 1QKQA 4LMFA 5CFDB 3RZJA 2QQMA 3C2UA 1F4HA 3POSA 3U07A 3B94A 5FZ7A 4B7EA 5HCHA 3ZFEA 4IEQA 2VCAA 4PIZA 1UW8A 3ZFEC 4UW4A 1BYHA 4HSLA 5C33A 1UY4A 1WMFA 3PUAA 3M4FA 4S2FA 3SMHA 1EV11 2JG9A 1Y9MA 5GZGA 4LUKA 4CDUA 2JG9C 2BZDA 1EPZA 3J8F3 2BNMA 4QXCA 3WT3A 5LBCA 3RJ2X 5FP8A 3RZLA 4XIOA 1MZ5A
chains in the Genus database with same CATH topology
2ADEA 4B1MA 3SC7X 3KF5A 3KF3A 4HXCA 1Y4WA 4CCCA 5FMBA 3U1XA 3H3LA 3ZR6A 5FKCA 3U14A 4CCEA 2AEZA 1ST8A 2QQUA 5FIXA 3U75A 3ZR5A 5FKBA 3PIGA 2QQVA 4UFJA 3LIGA 2XQRA 4UFKA 3HBKA 3LDRA 3NMBA 4AZZA 4UFMA 3LFIA 4B1LA 2QQWA 1W2TA 4QHZA 3UGHA 3LF7A 2OXBA 4UFHA 4JQTA 5FK7A 3RWKX 3S5QA 1Y9MA 1Y9GA 1UYPA 3PIJA 4EQVA 3LIHA 5FK8A 3UGGA 4UFIA 5ANNA 4FFIA 5FMCA 3LDKA 5FMDA 4FFFA 2ADDA 2AC1A 3LEMA 3UGFA 4CCDA 4FFHA 3IMMA 3OSDA 4UFLA 2AEYA 4FFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADE A;  4B1M A;  3SC7 X;  3KF5 A;  3KF3 A;  4HXC A;  1Y4W A;  4CCC A;  5FMB A;  3U1X A;  3H3L A;  3ZR6 A;  5FKC A;  3U14 A;  4CCE A;  2AEZ A;  1ST8 A;  2QQU A;  5FIX A;  3U75 A;  3ZR5 A;  5FKB A;  3PIG A;  2QQV A;  4UFJ A;  3LIG A;  2XQR A;  4UFK A;  3HBK A;  3LDR A;  3NMB A;  4AZZ A;  4UFM A;  3LFI A;  4B1L A;  2QQW A;  1W2T A;  4QHZ A;  3UGH A;  3LF7 A;  2OXB A;  4UFH A;  4JQT A;  5FK7 A;  3RWK X;  3S5Q A;  1Y9M A;  1Y9G A;  1UYP A;  3PIJ A;  4EQV A;  3LIH A;  5FK8 A;  3UGG A;  4UFI A;  5ANN A;  4FFI A;  5FMC A;  3LDK A;  5FMD A;  4FFF A;  2ADD A;  2AC1 A;  3LEM A;  3UGF A;  4CCD A;  4FFH A;  3IMM A;  3OSD A;  4UFL A;  2AEY A;  4FFG A; 
#chains in the Genus database with same CATH topology
 4AED C;  3MLL A;  1W8O A;  1RUG 2;  5C3Q A;  3KQR A;  3I2I A;  2HJI A;  2R04 3;  3MDP A;  5A80 A;  1OI6 A;  1JYC A;  3ILR A;  3VBS A;  3DGT A;  3VBS C;  1ZZB A;  2CDO A;  3BOW A;  4LUL A;  1CAV A;  3HD8 B;  4LXL A;  3ELN A;  1TE1 B;  2XHK A;  5IK5 A;  4EYU A;  2VVE A;  3VGI A;  3HEI A;  5FUP A;  1GWM A;  1A6C A;  1UNB A;  4A2U A;  4UBH A;  5EYY A;  1WCK A;  4OUS A;  1LOG A;  1DLL A;  1AR8 3;  3N7L A;  5FTT C;  2XPJ A;  5FPA A;  1AR9 1;  5JIA A;  3MUZ 1;  4YVW A;  5KBF A;  2YPD A;  3G6J B;  4YVW C;  4CP9 A;  2W95 A;  3H3U A;  1JHN A;  1KJL A;  4DXT A;  2JEN A;  4ZKT B;  3HWJ A;  4J25 A;  2P3Y A;  4GWN A;  4YG0 A;  2W2I A;  3H3L A;  2RVA A;  4GB3 3;  1LOC A;  2N7G A;  2FCV A;  1HQW A;  1UN1 A;  2GNT A;  2YG0 A;  4LT5 A;  1LEN A;  2B46 X;  1W8H A;  1LOD A;  1S0G A;  1V6K A;  4Z8B A;  5FFO C;  1OT5 A;  5LAS A;  5JSO A;  4YW7 A;  1OFS A;  3A4U A;  2H6C A;  1GNH A;  3D4K A;  3OF1 A;  1BLZ A;  4HOO A;  2RE9 A;  1HRI 1;  2J1R A;  1YHF A;  3VUO A;  1ZRF A;  2CGO A;  2OW4 A;  1MS9 A;  2YC2 A;  2ZGL A;  1YQ6 A;  1DQ6 A;  3A22 A;  2J1V A;  1LHU A;  3CIH A;  3KZ4 C;  4WZC A;  3VBR B;  3VV1 A;  3N9P A;  3S5Q A;  2D97 A;  2RJ2 A;  5D8A A;  1J3R A;  4QX8 A;  4AHZ A;  2GME A;  1IG3 A;  2DUR A;  4FPF A;  5A3O A;  3ZXG A;  4I02 A;  3FZ3 A;  2YMZ A;  1Y43 B;  2W1U A;  2PHR A;  3WG2 A;  1MVE A;  2J22 A;  3VBO A;  3AZV A;  2AH2 A;  3VBO C;  5JAX A;  1X50 A;  1QJY 3;  3JB4 C;  3KV4 A;  4IEZ A;  1XU1 A;  4AGV A;  4EN8 B;  4ONU A;  4XJA A;  3WY6 A;  4E9K A;  1WMX A;  2VOT A;  1CAX A;  2DFC A;  2WJS A;  5IVE A;  5C4W B;  2ADD A;  2JDA A;  1IG0 A;  4JGY A;  4QT6 A;  4CSW A;  2PEL A;  3ZXK A;  1Y7B A;  2R1D A;  1O8P A;  5FZC A;  2XVG A;  4GKY A;  4QPG A;  4QPG C;  4I0W B;  3T0D A;  4ASL A;  4ZY9 A;  1KFU L;  1W3X A;  3RRD A;  4Q4X 2;  1W6P B;  5BNP C;  3T3Y A;  5T54 A;  4LR4 A;  3HIF A;  1S55 A;  1FPN 1;  4L97 A;  5F32 A;  1G7Y A;  3FHI B;  2VMI A;  4QQL A;  5IT6 A;  2PA7 A;  4ERO A;  1GZW A;  1GIC A;  2ORZ A;  2WO3 A;  3FBM A;  4JTN A;  5FBZ A;  4QHZ A;  2XON A;  3VDB A;  3WZ1 A;  4AXO A;  2VNR A;  2WAO A;  2E6V A;  1RUF 3;  3ZN6 A;  5F3C A;  1ALY A;  2GNB A;  3IAQ A;  1GBG A;  2F4P A;  2RHP A;  4HN1 A;  2BW8 A;  4IE7 A;  1N1Y A;  3AP9 A;  4XAC A;  2ADE A;  2D6O X;  4ISR A;  1QXR A;  1NLR A;  4XFH A;  1F5J A;  4AFC A;  5JXG A;  2YFU A;  2HWE 1;  3O0W A;  5K7P A;  1O3S A;  1CGP A;  2CHH A;  3NV1 A;  2WNO A;  3FFQ A;  2PYT A;  5L9R A;  3EBR A;  2BUK A;  2DTY A;  3RZH A;  1QJX 3;  5DG1 A;  4ARY A;  3PHM A;  4BM8 A;  1Y9Q A;  3SNM A;  2W52 A;  3M3Q A;  5IHR A;  2DBN A;  2HBU A;  1IGO A;  3AKS A;  2DFB A;  3LA2 A;  5BV6 A;  4GMP 3;  2VNO A;  3OBT A;  4GWJ A;  3V65 A;  1AL0 G;  1LES A;  4Q29 A;  4Z82 A;  4BXF A;  5BNN A;  4FQ4 A;  4IXL A;  3F95 A;  2E7A A;  3FX3 A;  4CUA A;  2C4X A;  1AX1 A;  5CB7 A;  1IS3 A;  2IWG B;  3E1F 1;  3P3P A;  2VPV A;  3GDB A;  5H9S A;  3A21 A;  3K4Z A;  4BDV B;  5A33 B;  3ETQ A;  3OBA A;  1MPX A;  5E6H A;  5CFC A;  1FI2 A;  4Y20 A;  1X7N A;  2B45 X;  2B4K A;  4BU2 A;  4LA3 A;  1W6N B;  2FMY A;  2C24 A;  4KL1 A;  1OC1 A;  2K0G A;  3P1I A;  4X8N A;  5EJZ B;  3MUY 1;  5FY9 A;  1KS4 A;  5IJR A;  5A7S A;  1HN0 A;  4B8E A;  1BEV 2;  4BQX A;  2E7T A;  1S1A A;  4CEW B;  3RVH A;  4CTE A;  3O1R A;  3I3E A;  2OPW A;  3AXE A;  4M4P A;  5GM0 A;  3CLP A;  5AVP A;  1XSQ A;  4IES A;  4RR3 B;  3A0N A;  5FY1 A;  5CG8 A;  3OCP A;  5LA2 A;  4TSV A;  1VBE 3;  4IE4 A;  1X82 A;  4L0P A;  3POB A;  1DP0 A;  3UJQ A;  1DGW X;  1COV 2;  4I30 A;  2RS1 2;  2A75 A;  3GCX A;  3PU3 A;  4UBG A;  2Q8O A;  1NG0 A;  1SPP A;  4ZPI A;  4YAR A;  1JZ3 A;  2RS3 3;  1RHI 1;  2RMU 2;  1RJ7 A;  4QGN A;  1JW6 A;  3USU A;  2XUE A;  2RDQ A;  4TLG A;  4QQO A;  3C7O A;  5GAL A;  2WT2 A;  3HR9 A;  4TWT A;  2HEV F;  4OZO A;  5F39 A;  4D6R A;  1O3T A;  5F3E A;  3ZSL A;  3SCG A;  4NHY A;  3GGL A;  4QDR A;  1R1A 2;  4CP1 A;  1SFP A;  1DU3 D;  1KD7 A;  3RYP A;  5E1R A;  4K1Y A;  4COV A;  1NOV A;  5J48 A;  4TYS A;  5FP3 A;  3KM5 A;  3ZXA C;  3N35 A;  2C26 A;  4CCM A;  4FAH A;  1W06 A;  4YZ3 A;  4B1L A;  5KHH A;  4NHL A;  5JZG B;  3RSJ A;  2P4E A;  4C0H A;  4GAL A;  3AFG A;  4K8R B;  2FCU A;  1NY7 1;  1ULG A;  1X33 A;  2P17 A;  4BXS V;  2E26 A;  3J7H A;  3UGF A;  3BPS A;  4Q8L A;  5FZH A;  3WF4 A;  1KXG A;  3BIE A;  3U4S A;  2RJL A;  1WLD A;  2F17 A;  5KHK A;  1OUX A;  5FP4 A;  4RS5 A;  1SCR A;  2NYY A;  4NIA A;  2Q8D A;  3H1Y A;  1SBF A;  4RS5 C;  5HBA A;  1PX3 A;  4AFA A;  4Q4X 3;  4MAD A;  1F4A A;  1PIV 2;  3DKQ A;  4NO4 A;  4QHB A;  1DZR A;  1U5Z A;  1VBB 1;  2VUD A;  1GQG A;  1CWP A;  1VBC 2;  2A3Y A;  2JDP A;  4LKS A;  1D2S A;  3TOJ A;  2PHW A;  2ZAH A;  4LUM A;  1G8W A;  2JE8 A;  4HVR A;  2WSU A;  3CEW A;  4JRA A;  5EXO A;  1HV1 A;  3UKN A;  4BA6 A;  1J3Q A;  5D21 A;  4I01 A;  3JUU A;  2B9U A;  5FZO B;  5SV5 A;  1O5U A;  5JMO A;  3K3O A;  1C8N A;  4FPC A;  4QB6 A;  5DG2 A;  1K5J A;  4QX2 A;  4QX0 A;  3IDE A;  3PVE A;  2P6C A;  1KDM A;  2CGN A;  1JTZ X;  2VXJ A;  2Y6F A;  1YEW A;  4HXC A;  1EV1 2;  4PDW A;  3H50 A;  4PDW C;  1UZY A;  3PME A;  4PF1 A;  4QPI B;  4PT6 A;  2JDZ A;  3C7G A;  4P9G A;  3I2F A;  1POV 1;  1RUO A;  4K7J A;  3WW3 A;  1UU6 A;  2JDN A;  4AE2 A;  3CMG A;  4KWL A;  4XYX A;  3AX4 A;  2E51 A;  4RQP A;  4I09 A;  3N4M A;  4RQP C;  1NT0 A;  4ATE A;  4HVO A;  5C71 A;  1MZE A;  3LB9 A;  3TBD A;  4JKK A;  2W9X A;  2XKP A;  1NCQ B;  3T08 A;  4R9D A;  4YM1 A;  4YWA A;  4YW5 A;  5JI9 A;  4E4S A;  5EYX A;  3SH4 A;  1W90 A;  3M1H A;  5FZ6 A;  2OT7 A;  1H0B A;  1PZ9 A;  1AR9 2;  1BEV 3;  4M3C F;  4D6S A;  4D7T A;  2EAL A;  2OZ6 A;  1F2N A;  2CWM A;  2WFF 3;  4O9E A;  1AYN 1;  1QOT A;  2BWA A;  4YLZ A;  4LE3 A;  4BH9 A;  4CEY A;  3O0V A;  1JOB A;  1LEM A;  1JOD A;  2K46 A;  4CEY C;  3LAG A;  4XFA A;  1OBN A;  3N7M A;  4OI2 A;  1NYW A;  2P37 A;  1PM7 A;  3O12 A;  2FBE A;  3C7H A;  3E6B A;  5FJK A;  5I0S A;  1SG3 A;  3KCC A;  1QH7 A;  3DN7 A;  3V64 A;  4BCU A;  1YI7 A;  2HKX A;  1EUU A;  4QGM A;  4UAP A;  4BE3 A;  4CDX A;  3OGS A;  4Y24 A;  1CD3 G;  1UOB A;  1COV 3;  5HCB A;  1LB2 A;  4P00 B;  1RUC 1;  2RS1 3;  3B7M A;  3I49 A;  1B35 B;  1PMH X;  5FCC A;  1HKD A;  1RL3 A;  5K9Y A;  4NWW A;  4Q0Q A;  5IW0 A;  4BQY A;  2WAB A;  3WHU A;  5A6Q A;  2O0O A;  5B4X A;  3I3Q A;  1HRI 2;  4Q26 A;  5FZK A;  1GP4 A;  1NQJ A;  5FPV A;  3BTY A;  3U14 A;  1A34 A;  1R1A 3;  2D6N A;  2PQQ A;  2ZGQ A;  4I3P A;  4HK8 A;  3GNE A;  4AAP A;  2QQU A;  3NRU A;  2SBA A;  2LS6 A;  2RM2 3;  5IK7 A;  4AHX A;  1YFU A;  3AKP A;  3NMB A;  3TAY A;  1ZRE A;  2MHF A;  4HKO A;  1PNG A;  2ARE A;  2WNV B;  3RYR A;  5JPN B;  3SH5 A;  5BUV A;  1ZVF A;  4HN0 A;  3KHB A;  3GZU C;  4MGZ E;  1OLR A;  4LO5 B;  5FZE A;  1JYN A;  3LSE A;  1SLC A;  1TMF 3;  4Q0P A;  3A0K A;  1POQ A;  4EWD A;  5IVV A;  1DHK B;  4DY5 A;  2YFZ A;  3OSD A;  2ZZQ A;  2HWB 1;  4FFG A;  4AEM A;  4FPG A;  1R09 2;  2KD7 A;  4FI9 A;  4V2W A;  2DWR A;  2A71 A;  2FHR A;  4UT5 A;  5C3S A;  3CDZ B;  1D0H A;  3AYC A;  2Y0O A;  1XNT A;  2QQJ A;  2BVB A;  3ACL A;  1SMV A;  1ULO A;  2G1M A;  1SBD A;  2J1E A;  5D1I A;  1T6B X;  1OXC A;  3SEP A;  4AI3 A;  2E7Q A;  2B5H A;  2QKD A;  2VCB A;  1RUE 3;  2Y6G A;  2HWF 1;  3ZLI A;  4BWO A;  4Y5Z 0;  4K8F A;  3I97 A;  4XF3 A;  1J83 A;  2JE9 A;  1DYK A;  2LW8 A;  1UMH A;  3SCF A;  5EFU A;  2I2S A;  3ABZ A;  5FZM A;  1UZ0 A;  2EXJ A;  2ILM A;  3O1U A;  1CVN A;  1FPN 2;  2K9Z A;  2OKX A;  2QE3 A;  2XJT A;  4GQ7 A;  2BBV A;  2WWU A;  4E2G A;  3GJB A;  1EV1 3;  3MEP A;  4YW3 A;  1NCR A;  2WNU B;  5FZL A;  3OGR A;  1UPI A;  2DTW A;  2FDJ A;  5DDJ 1;  3NKG A;  2UWC A;  2ZX2 A;  3ZN4 A;  3PVO A;  1C8M 1;  4LBM A;  2NP0 A;  3JD7 3;  1IS5 A;  2GMP A;  1JXN A;  1K5M B;  3WNP A;  1W3V A;  1XNC A;  2HWE 2;  1CAW A;  2D6M A;  2Z42 A;  2HLE A;  4QQ2 A;  1REE A;  4DOU A;  3P3N A;  3ZKY A;  4X8P A;  5FK7 A;  1N1V A;  4CPB D;  2D43 A;  2EIB A;  2VY0 A;  4Z2W A;  4AYU A;  2WO2 A;  4MH0 E;  1K12 A;  4HON A;  4ZU4 A;  4F7Z A;  2XVK A;  3SEE A;  1BVP 1;  2YZ4 A;  3ZYG A;  3ASI A;  4YM2 A;  3RQ0 A;  5JZG A;  4Q4V 1;  5JZG C;  4XUO A;  3VBH C;  4NIH A;  1V70 A;  4XBN A;  5FYZ A;  1UOJ A;  3MID A;  3OY8 B;  4XCB A;  2XQX A;  1CQ9 A;  2XUM A;  1JN2 P;  3D0S A;  1L7Q A;  5FRE A;  1O3Q A;  1W39 A;  4P9J A;  3HAG A;  5AFE A;  1XNA A;  2FDF A;  4CDW A;  4I0A A;  4CDW C;  5GLZ A;  4FPL A;  5ABJ C;  5LCW L;  2WYS A;  2QFE A;  4AED B;  1Q43 A;  1YJK A;  5IVF A;  1WW7 A;  3U11 A;  4COY A;  3I2D A;  1OA4 A;  1VIW B;  1PZ7 A;  4RL7 A;  1H2M A;  3SIT A;  1PMJ X;  2YGM A;  3THD A;  4P9W A;  2DYC A;  4DXZ A;  2DVD A;  4ZON A;  2J42 A;  2VMH A;  2W1W A;  1PVC 1;  5FMB A;  4I3G A;  5L19 A;  4LA2 A;  1Q8V A;  3EYP A;  5FZ0 A;  4DNY A;  2WRA A;  2Z2S B;  4LO7 A;  2JJ6 A;  2RDN A;  2HBT A;  2V5Y A;  4WM8 A;  2JEC A;  1EY2 A;  1WCD J;  4WM8 C;  1PZ8 A;  3UL2 A;  2XHN A;  1XU2 A;  5LB6 A;  1NA1 A;  2OQ6 A;  1H8T A;  2UWA A;  2XJS A;  1NA1 C;  4W65 A;  1H8T C;  4YVW B;  1JH5 A;  2LRP A;  5F3G A;  4LBQ D;  1GWL A;  4P02 B;  5JSR A;  1YFY A;  4RHV 3;  1HW5 A;  2GAU A;  3AKR A;  2ZHM A;  3ZFG A;  1L7R A;  3ZFG C;  1R09 3;  4XF9 A;  1T2X A;  3UV9 A;  1HRV 1;  2WA4 A;  2YRO A;  1LHN A;  2V5D A;  2O8Q A;  2RS5 1;  3N7J A;  5FV3 A;  4A3Z A;  1Z7S 1;  1WGP A;  1NY7 2;  4NJ4 A;  1CZV A;  4QGL A;  4M3C A;  3IZO A;  4Z07 A;  3MGU A;  2XR4 A;  5ACA 1;  3I2K A;  2X09 A;  3LPF A;  4HT1 T;  1STM A;  2AZ5 A;  3MZH A;  3CNA A;  3LWC A;  2X29 A;  5CYY A;  5DZE A;  1TNF A;  1ZBA 3;  4I0B A;  4CDQ B;  1LNS A;  2FD8 A;  1QMJ A;  1AUY A;  1TZO A;  4YFZ A;  4QAW A;  3N36 A;  5I8T A;  1GP5 A;  1FV3 A;  1HDK A;  2OS2 A;  1VBB 2;  4KGQ A;  5JUV A;  2VVD A;  4BQ4 A;  3WUD A;  5FY5 A;  2D6P A;  2PLV 1;  5C8C A;  3THC A;  1FAT A;  5C8C C;  1YCI A;  3NV4 A;  3VBO B;  4E4H A;  1US3 A;  4B4P A;  2DVF A;  4LHK A;  2V09 A;  1ST8 A;  4JKL A;  1YQ8 A;  3IDC B;  2H6B A;  5DXD A;  5F5C A;  1TVG A;  2V73 A;  3VBF A;  4CP0 A;  3VZM A;  1SLT A;  3ZYI B;  3BOP A;  2O8O A;  2YGL A;  1KIT A;  3VBF C;  1UXZ A;  5G05 L;  2ZGP A;  4AVB A;  5FXZ A;  1PO2 2;  2Q4S A;  5IVY A;  2DDU A;  2GN7 A;  1U12 A;  1VBD 1;  4OHW A;  3CZU A;  4WVV A;  5CAZ A;  5BNO A;  1D0G A;  1V0A A;  1I1E A;  3RS6 A;  3MPB A;  1W9S A;  1V9U 1;  3NNJ A;  1LR5 A;  1HXS 3;  1UY3 A;  5BNP B;  5LRR A;  3WNX A;  2VW2 A;  2CAU A;  3T2T A;  3E5U A;  4FPJ A;  3RFR A;  2DBI A;  2E31 A;  1SLI A;  2DCJ A;  2NQY A;  4N90 A;  4QXB A;  2FZ2 A;  2P1B A;  5FPL A;  2VMD A;  4BIS A;  4CCE A;  4GKX A;  3AP4 A;  5LA9 A;  2EA7 A;  3ZN6 B;  3S5A A;  3HT2 A;  1QQP 3;  5DAB A;  3BIW E;  2VJX A;  5A1F A;  3MO4 A;  3BPZ A;  3R4S A;  4Q4W 1;  1EUT A;  4P08 A;  3ZMN A;  4BPZ A;  3O1V A;  3DXU A;  3LEK A;  2LUW A;  5C5T A;  3OGG A;  4Y1Z A;  1AYN 2;  2IFW A;  4DS0 A;  2VBD A;  3CJI B;  4EQV A;  4XFB A;  4K40 A;  3UKV A;  4M4R A;  4AVV A;  1VP6 A;  4PLN A;  5AFB A;  2CWS A;  3DV8 A;  4PQ9 A;  1JZ7 A;  2EIE A;  2W0X A;  2XXZ A;  3QLQ A;  4LBJ A;  2UYB A;  2XL9 A;  4QM8 A;  4XHX A;  5L9B A;  4KWU A;  1X9P A;  5F2W A;  2Y34 A;  4YZ2 A;  2AYH A;  2YU2 A;  2WDB A;  1O3R A;  1W2O A;  1RUC 2;  3VHR A;  5GJ6 A;  2QUO A;  1ZRI A;  4YPJ A;  1SLA A;  2LTN A;  2Y8K A;  2D3P A;  3THT A;  5A7W A;  3T09 A;  3VD7 A;  3ORJ A;  3WVJ A;  3UNP A;  2GN3 A;  3AP5 A;  5EZW A;  5GZD A;  5IAT A;  5A32 A;  3UK9 A;  2JDU A;  2WT0 A;  2IXI A;  2VCC A;  1JUH A;  3CJX A;  4JVA A;  4CU7 A;  3H8R A;  3ZPY A;  5T52 A;  4LBQ B;  4COU A;  2K2S A;  1W28 A;  1UYX A;  2WN2 A;  1UIJ A;  4FAG A;  2QQI A;  2MPF A;  2ZAC A;  5A7N A;  3ZFF A;  1QJF A;  1ULD A;  4KNC A;  2JDM A;  4W50 A;  3ZFF C;  1WLC A;  1UU5 A;  4C91 A;  3O1P A;  4XZP A;  1TME 1;  3LIG A;  1OVS A;  3PVB B;  5A6Z A;  5LY1 A;  5LK7 B;  3WUC A;  1PO1 1;  3ZXD A;  5J09 A;  1BVV A;  2C1F A;  2QZ3 A;  1LHW A;  3APB A;  2JXA A;  4Y22 B;  1UKR A;  4NUB A;  1PK6 A;  4CUB A;  4YVS C;  1PK6 C;  3L2Y A;  1XE7 A;  3KCY A;  1L7L A;  3BU7 A;  5BXX A;  1ZRD A;  4XFC A;  4AI9 A;  2X10 A;  3PUH A;  1WBL A;  4IL7 A;  2QVS B;  4DO0 A;  4DUX A;  1BK1 A;  1H6X A;  1SPP B;  4EZH A;  1Q8P A;  3HBZ A;  4WVM B;  3WG1 A;  5FQ0 A;  4OI4 A;  3MIG A;  1VBB 3;  3ZYJ B;  4EN6 B;  2E53 A;  2VGD A;  2HWF 2;  2RDS A;  3M8L A;  3VKM A;  2CU5 A;  2GP3 A;  5T3N A;  1GOF A;  3FFZ A;  5I91 A;  1WW5 A;  1S2E A;  2A1X A;  2VZO A;  4FQZ A;  2W91 A;  1D2Q A;  1YLL A;  3M3C A;  4XMA A;  5AC9 1;  2GDF A;  3NO8 A;  1W6Q A;  2BVV A;  4L99 A;  5FZD A;  4PIY A;  4S2H A;  3WV6 A;  5A70 A;  2WS9 1;  1W8U A;  2CSG A;  5JR7 B;  2CNA A;  4NRO A;  4D3W A;  1OH3 A;  1RXG A;  2I07 B;  3FLT A;  1PO2 3;  1J58 A;  3MF9 A;  1WCS A;  2E33 A;  2L9L A;  4P9L A;  3D6E A;  4XQW A;  5DDJ 2;  4A4A A;  2D3S A;  3SHR A;  1UXX X;  1AL2 3;  3AZY A;  4NHX A;  1C8M 2;  4RS5 B;  5FLH A;  1AXK A;  2CDP A;  2R06 1;  4CDU C;  4FOW A;  3LE0 A;  3ZYF A;  4ASK A;  4UF0 B;  1ENX A;  4K1Z A;  4CA9 A;  2VZ1 A;  5C3O A;  1EAH 3;  1U5Y A;  1YXW A;  1Y4W A;  4MYE A;  4W6X A;  2XLG A;  3BCW A;  2BP6 A;  1QJU 1;  4LOR A;  4AHY A;  1HV0 A;  1LED A;  3WOG A;  1RTV A;  3V0B A;  1BXH A;  4AI2 A;  1Z0H A;  2D5F A;  2Y6H A;  3TEY A;  1F9K A;  5LBB A;  3THP A;  3G7D A;  4BB3 A;  4Q4V 2;  3ZDS A;  2UU8 A;  3FJS A;  4UFM A;  5F37 A;  4H2A A;  4XAE A;  2ZCW A;  1M06 G;  4JCK A;  3H7Y A;  3PLQ A;  1J1T A;  2DU0 A;  2BER A;  3VDD A;  3VDD C;  2WN3 A;  3KVB A;  3LA7 A;  4LBN A;  3UGG A;  1O4Y A;  4NPL A;  4PDW B;  5FMD A;  3ZXL A;  4COW A;  3ZYB A;  3I3M A;  1OH4 A;  4GUL A;  4EJR A;  2V72 A;  1KDK A;  4FPK A;  3WF2 A;  4HET A;  4KBZ A;  5CKM A;  3W59 A;  5FYV A;  2D98 A;  3BTA A;  2DVG A;  1TQ5 A;  5FY4 A;  1RUC 3;  1CZT A;  2ZGK A;  3T4V A;  1RUJ 1;  3EO6 A;  4IGO A;  1BHG A;  4IND A;  4ES9 A;  3GCW A;  5I0U A;  1VPH A;  2VZ3 A;  1KQR A;  2WBK A;  4K9S A;  4Y3O A;  2JG8 B;  1UD1 A;  4RQP B;  2PAK A;  1NLQ A;  1UZW A;  1MS8 A;  3IB3 A;  4F3J A;  5FOB B;  4JGZ A;  4J1X A;  4MXV A;  3RWN A;  4JGZ C;  5J36 A;  1UY1 A;  1PVC 2;  2W92 A;  3B5L B;  2CGP A;  2ZAA A;  1PX4 A;  3P6B A;  2XH6 A;  3AXD A;  1QJE A;  1D4V B;  4PIX A;  2EVX A;  3NNL A;  1MAC A;  4FFI A;  2IXK A;  3LDK A;  3VB9 A;  3WP3 A;  3KV9 A;  1OKQ A;  1RXF A;  3OUI A;  4LJH A;  2VOW A;  2QZ2 A;  2E32 A;  2HYK A;  3J7N A;  1W6O A;  2XML A;  4KU8 A;  1ASJ 1;  5D8A C;  1ZZ9 A;  5FP7 A;  3VBU B;  4E4Z A;  4LTA A;  4D94 A;  1F31 A;  4AW7 A;  1JS9 A;  2J1A A;  1G9F A;  1AYM 1;  1YIF A;  5LW9 A;  4XQD A;  1OA2 A;  3I3B A;  2ZMN A;  1RGS A;  1RUH 1;  3PU8 A;  5FUI A;  4CXX A;  1ONA A;  4JKM A;  4AZZ A;  1IPK A;  4XDP A;  1A3K A;  1Z7S 2;  4H7L A;  1C1F A;  2VBB A;  3S57 A;  2MEV 3;  4QPW A;  5ACA 2;  2HWF 3;  3EMR A;  1UMI A;  5FZG A;  5I93 A;  1SLL A;  1FAY A;  3OJB A;  4CCO A;  4RA0 A;  2P3J A;  4JGY C;  2YV8 A;  2IXC A;  3POW A;  4IV1 A;  2BNO A;  4IV1 C;  4G9S B;  1UO9 A;  4JTO A;  2XBO 1;  1GZ9 A;  2ZKN A;  3AFK A;  5FYT A;  1J59 A;  4YW4 A;  3CHX A;  1B09 A;  2E9Q A;  3VN4 A;  2PLV 2;  3WXP A;  1Q3E A;  4DUW A;  3H8O A;  4KWJ A;  4AI1 A;  3W21 A;  3IPV B;  3VZL A;  3D82 A;  1BMV 1;  1C8M 3;  4XMI A;  3WX5 A;  1PVX A;  2JWP A;  4L92 A;  2WC2 A;  2VM9 A;  3Q9O A;  1LTE A;  2XB6 C;  2F4L A;  2VD7 A;  3IMM A;  4HAN A;  4F83 A;  2A6X A;  1XYP A;  4QWN A;  1BBT 1;  1X8M A;  1RUG 3;  5I8Y A;  4XOG A;  1N3Q A;  1W6M B;  5DAP A;  1ND2 A;  5FWE A;  5C6C A;  1VBD 2;  2OQ7 A;  1ND2 C;  3K3N A;  3ZX7 A;  4DRV A;  4OLL A;  1FYU A;  2IVI B;  4MGS A;  3RZK A;  3CBN A;  2JDY A;  1LGB A;  4Q4V 3;  4IER A;  3KD4 A;  3A7Q A;  3KCX A;  5A7Q A;  3I59 B;  4DB5 A;  2DCK A;  3POE A;  5FZF A;  3M7A A;  4WV8 A;  2VMG A;  2ORX A;  5BNN C;  2X5I A;  2BU9 A;  2X5I C;  3RI8 A;  1UU4 A;  4BQW A;  4Q4W 2;  4XUT A;  5F3I A;  4DEQ A;  1IHM A;  1WD4 A;  3W20 A;  4ZU5 A;  5DMY A;  3SC7 X;  5FLI A;  5CFC C;  1JOJ A;  3VDA A;  1OUS A;  4BQ2 A;  4A44 A;  5F1R A;  4UW5 A;  5JOX A;  2UUR A;  4DXS A;  1CAW B;  1XE8 A;  2W87 A;  4LLF A;  1XND A;  3VD4 A;  4S2D A;  4QM9 A;  3B00 A;  5EPA A;  1E5I A;  4E8D A;  4HPK A;  4YZ5 A;  5JOZ A;  1BZW A;  1AX0 A;  4QMA A;  5T50 A;  1W2T A;  3LF7 A;  3KGZ A;  3IWZ A;  3QD6 A;  1H6Y A;  3JBG 1;  4BHP A;  3BUC A;  1UX6 A;  4MGQ A;  3LSD A;  3FHA A;  3POG A;  1J84 A;  3VBH B;  3ILN A;  3DL3 A;  4YM0 A;  1FMD 2;  2W46 A;  4QB2 A;  2XG3 A;  5JXJ A;  3WW1 A;  1OMI A;  1A78 A;  1OOP A;  1NE6 A;  1OOP C;  1LEC A;  2P2K A;  3M2M A;  1Y9G A;  5GLW A;  4O7X A;  3EJK A;  2EIC A;  5FMO S;  1HIX A;  2D7F A;  5CG9 A;  3LGR A;  3BU0 A;  3EHK A;  4CDW B;  3AKT A;  4N43 A;  5ABJ B;  4NRP A;  1W99 A;  1DF0 A;  4N43 C;  5FYH A;  3TWI A;  3DPR B;  2WZR 1;  4LKE A;  2GC3 A;  2D40 A;  5FPZ A;  1TME 2;  1N1S A;  4BJ0 A;  3NJZ A;  2KXL A;  3ALQ A;  4NOT A;  2ZJC A;  2EIG A;  5EQU A;  2LRO A;  1PO1 2;  3VD3 A;  4QKD A;  3V0A B;  2VUL A;  2XJP A;  5ACA 3;  2R7E B;  2VZQ A;  2DU1 A;  4IV3 B;  4FO9 A;  1UCX A;  1VRH 1;  1QY4 A;  2VUJ A;  4XBQ A;  4AQ2 A;  2X05 A;  1OLM A;  3B3Q E;  1EYB A;  1LKN A;  5GZF A;  4WM8 B;  1DGW A;  2VOK A;  2Z79 A;  5DAQ A;  3UT0 A;  4LHS A;  1I5P A;  5A6Y A;  3S7I A;  5FYS A;  4FTE A;  3ZSK A;  1A8M A;  1MS3 A;  1NA1 B;  4MET A;  4AAX A;  3ZR6 A;  4P9Y A;  3NJY A;  1DGR N;  5FYY A;  4H14 A;  3RZM A;  1VBA 1;  1OQD A;  3IBM A;  2PHF A;  2BOJ A;  1HB1 A;  2VQA A;  5DUU A;  4IE5 A;  1KEX A;  3EB7 A;  1MEC 1;  3LFI A;  5IWF A;  5AC9 2;  2R07 1;  1UWW A;  1FT9 A;  1HLC A;  1CR7 A;  1RUD 1;  3K77 A;  3PUI A;  4JRL A;  3USS A;  5CA6 A;  1DFQ A;  3CU7 A;  3PTR B;  4OHZ A;  4GZ9 A;  4MVT A;  3LEG A;  3ZYH A;  2WUH A;  3I2J A;  4Y33 A;  2UY9 A;  3GM8 A;  1OQ1 A;  4M3C B;  4Q8K A;  1F15 A;  3HVD A;  2Q1M A;  2NZ9 A;  4TLF A;  1VBD 3;  5EIY B;  4DQA A;  3FN9 A;  2XGX A;  3GYD A;  3OGJ A;  4OI1 A;  1NE4 A;  2VUA A;  3DEM A;  3NWK A;  4AEK A;  5JSP A;  2R06 2;  1JZ4 A;  1NQD A;  2WZ8 A;  5FZ9 A;  2AAC A;  1AF9 A;  1RED A;  1W2N A;  2V4V A;  5CAD A;  4Q0S A;  4FOY A;  4QD2 A;  5LEK A;  5LA1 A;  1RUN A;  2C9K A;  1XYN A;  4MX3 A;  4LEJ A;  4UWD A;  1QJU 2;  2ZX0 A;  5J98 B;  4C1X A;  2PAM A;  3MBW A;  4LHL A;  2ENR A;  4Q4W 3;  3OGV A;  4LOT A;  2FQP A;  3VDC A;  1WA6 X;  1GWK A;  1ENQ A;  2VEC A;  4ZS2 A;  3I8T A;  3I54 A;  2ZGN A;  1YFW A;  1W8Z A;  5KC5 A;  2IXL A;  1JZ5 A;  4AQT A;  1O6U A;  4LO6 B;  4Y1X A;  3TNQ A;  3VBF B;  4NPM A;  1JYV A;  3VLB B;  1LCL A;  1LOF A;  2HEY F;  3MIE A;  1T6G C;  1LOF C;  2DV9 A;  3B9I A;  5FKB A;  3J8F 1;  3BI3 A;  1JBC A;  1RUJ 2;  3LDR A;  4CDX C;  3OBZ A;  5I8S A;  3BYW A;  1C5H A;  1I5Z A;  3AZX A;  2VUC A;  4UFH A;  1OD5 A;  3AP6 A;  4XTP A;  2EID A;  2R04 1;  4A6S A;  1FMD 3;  3AP7 A;  4AOC A;  4BME A;  5C9A A;  1XXN A;  1UOF A;  4PHZ A;  5F6K A;  1FNY A;  5DQ0 A;  3TNP B;  5C9A C;  1NZI A;  1YI9 A;  2PTM A;  3PVN A;  4OHV A;  2AEY A;  3AMQ A;  3UJO A;  2RMU 3;  2TBV A;  4U2A A;  3K48 A;  5HI0 A;  1HB3 A;  3IMN A;  1D7P M;  4XUN A;  3T1M A;  2VU9 A;  1J3P A;  1WBF A;  1AR8 1;  1A8D A;  3AZZ A;  3T0B A;  5EWS A;  5F5Q A;  4Q5O A;  3KV5 A;  1PO1 3;  3DKW A;  4AR2 A;  2DUQ A;  2PHT A;  2VTF A;  1QDO A;  3TEX A;  4YGC A;  5L9V A;  1WD3 A;  1QOS A;  1S0I A;  1AYM 2;  2O14 A;  2CAV A;  4QKN A;  5FK8 A;  5A7O A;  1RUH 2;  5FMC A;  4GB3 1;  4NHK A;  3OPW A;  5CU1 A;  3NV3 A;  4ZXE A;  2DF7 A;  2D6L X;  3OUH A;  5I0D A;  4RFT 0;  3VKN A;  1IKQ A;  2DCZ A;  2RG4 A;  5GZE A;  4AQS A;  3KF5 A;  2VTX J;  2Y6J A;  5A32 B;  2BWC A;  1O5L A;  4OMC A;  5CZK A;  3U37 A;  5J96 B;  2ZPX A;  5BYN A;  5IVJ A;  5L36 A;  3BOD A;  2EXK A;  5HCA A;  1PIV 3;  3K4A A;  1X8E A;  3ON7 A;  1RIT A;  2HWC 1;  1TEI A;  5EJ3 A;  4AGG A;  1JYI A;  3NAP B;  3ZSE A;  1GYK A;  1ZZC A;  3O7O A;  1HQN A;  2A5Z A;  1VBC 3;  1TNR A;  3SKV A;  1BQP A;  5AC9 3;  5ISL A;  4XHB A;  2YYO A;  3FC0 A;  1XJA A;  3UET A;  4OFG A;  4B29 A;  1W6P A;  2XBO 2;  4XFG A;  4MXW A;  3N9Q A;  4K20 A;  4LBL A;  4OUL A;  4A6O A;  4YGB A;  4URT A;  4XJZ A;  1QXJ A;  1SDD B;  4UW3 A;  1XE0 A;  5JVV A;  3LPG A;  4LK7 A;  3AMP A;  2I45 A;  1H1I A;  4F8A A;  5GZC A;  1MR5 A;  4YVS B;  3SXW A;  1LRH A;  2JIJ A;  3HN1 A;  1OSG A;  2ETE A;  3KSC A;  4XC9 A;  5BPX A;  4KU7 A;  4BMB A;  4C8D A;  5HV4 A;  1S0B A;  2JKX A;  4GWI A;  3O1O A;  1BMV 2;  4LQR A;  2R06 3;  1QJY 1;  3U1X A;  1NCR C;  3MYX A;  1NAE A;  5J3U A;  4CUG A;  3WF3 A;  1NLS A;  3MIH A;  1CPM A;  2BDR A;  3KS7 A;  5FQ0 B;  3CO2 A;  3NVC A;  1O4Z A;  3SH3 A;  5LK5 A;  1BBT 2;  5E88 A;  2RJK A;  3MW4 A;  3OYW A;  3E97 A;  4AL9 A;  1S4C A;  3ZMO A;  2YBK A;  2TEP A;  2ZS6 B;  1F5F A;  2AEN A;  1Y3T A;  4GJZ A;  2C5D A;  2ET7 A;  1GQP A;  2WWS A;  4FPE A;  4P14 A;  3T0A A;  4CCL A;  1MZ6 A;  2VR4 A;  4R9A A;  4DZG A;  5FOJ B;  1UIK A;  3FUQ A;  2A6Z A;  4PF5 A;  4ZHN A;  2ZA9 A;  2WR9 A;  3N9M A;  3NQH A;  4KMQ A;  3U10 A;  1CIW A;  1OD3 A;  3QBQ A;  3PTY A;  2OX0 A;  1V6M A;  3BKZ A;  4WM7 A;  2G9F A;  3H8U A;  4WM7 C;  2ZEZ A;  1AR9 3;  3ZFE B;  1KJR A;  5A33 A;  1JI6 A;  1FNZ A;  3NNG A;  4YYO A;  3WSO A;  1RUF 1;  5CIR A;  4BIO A;  2ZEX A;  1VLN A;  1W6N A;  2QCS B;  2ZXQ A;  3BVC A;  4QQH A;  1WA4 A;  4NII A;  4A42 A;  5KR7 A;  2JG9 B;  1ZNP A;  4FSJ A;  1QEX A;  4CDU B;  3VZK A;  1YRZ A;  2R1B A;  2XOM A;  5EHD A;  5DUV A;  3U4X A;  3TN9 1;  3OEB A;  3WD5 A;  5KHI A;  2VQ0 A;  3GAL A;  4RGA A;  4XIK A;  1ND3 A;  1ND3 C;  3VD9 A;  4CCD A;  2GC2 A;  3CF6 E;  4RR3 A;  1PHM A;  2ID4 A;  1QJX 1;  3NNM A;  4LHN A;  3VBS B;  3WNK A;  2GND A;  4IET A;  4L11 A;  4CUC A;  4YSF A;  5FPX A;  3V0B B;  1CAV B;  1H1M A;  1DGL A;  2LAL A;  3AKQ A;  4NN0 A;  3DYP A;  4MGK E;  4R4Z A;  1PGS A;  4E8C A;  4ET7 A;  4XJU A;  1S0F A;  4A41 A;  2VW1 A;  1HRI 3;  3JBG 2;  4AWD A;  2ZEW A;  1C4R A;  2VNG A;  1DIW A;  3GZT B;  3PL0 A;  3LOB A;  4HMZ A;  4MGI E;  2R49 A;  3N3H A;  1GKB A;  4Y5T A;  5JR2 A;  4XF4 A;  4YG3 A;  3R4D B;  1ACC A;  4UFJ A;  1RHI 2;  1VAK A;  2B7Y A;  4KG8 A;  4OUM A;  4EV0 A;  4CP9 B;  3LQC A;  3Q8F A;  5FRA A;  2WZR 2;  4A7K A;  4XPV A;  3PIJ A;  3E5X A;  3U0Z A;  4OHY A;  5EP9 A;  1IZ3 A;  3AMN A;  2BOI A;  5CKN A;  1KGY A;  5IAX A;  4W6Y A;  1H2N A;  1E5H A;  2WAA A;  2EXI A;  4OVE A;  4M0H A;  2DVA A;  2BGP A;  2O1Q A;  2QQO A;  4UFL A;  4EE2 A;  1UOG A;  4NRQ A;  1ZM1 A;  4R8H A;  4JGZ B;  4K3U A;  2P3I A;  1SFN A;  1W04 A;  1YFX A;  1REF A;  2BGC A;  3R0R A;  1VBE 1;  4Q1R A;  3PUQ A;  5I0T A;  4DY3 A;  4UFK A;  3DXT A;  2VMF A;  2XBO 3;  2YBP A;  3FLR A;  2VH9 A;  5DAV A;  1FXZ A;  3H1W A;  1LGN A;  1XPW A;  2A3X A;  2RS3 1;  1LOA A;  3ZKU A;  5D8A B;  4YRD A;  1YQ2 A;  3HQR A;  2ZML A;  5FYC A;  1FPN 3;  3WDW A;  3B69 A;  4CRQ A;  2HEW F;  3Q8B A;  4IEY A;  1MZF A;  4AK3 A;  1MEC 2;  1SEF A;  2ARA A;  3Q8E A;  4XXP A;  2R07 2;  5FZO A;  1Q8O A;  1DQ4 A;  1RUD 2;  2Z5W A;  2GAL A;  2ZGU A;  3T30 A;  3WIN E;  2VZU A;  3MIB A;  4GXL A;  3DF0 A;  4M0N A;  3EQE A;  5FUN A;  3ZIW A;  1OFN A;  2WWJ A;  2WZE A;  3KHC A;  1WW4 A;  1AR6 1;  2HWE 3;  1CAX B;  4OZX A;  4YG6 A;  4B7K A;  4JGY B;  3SLI A;  3T2Q A;  3AYE A;  3WHT A;  2WA3 A;  1VMJ A;  2G19 A;  4IV1 B;  2W47 A;  4RSU A;  2PHX A;  4FTS A;  3GF6 A;  4ATF A;  2ZGM A;  3W5M A;  2W94 A;  4AED A;  1C5I A;  4QPG B;  1XB9 A;  5BNO C;  1R08 1;  4HL0 A;  3O1T A;  4LLO A;  2DCY A;  4B1M A;  4C90 A;  2QDR A;  2WL1 A;  5A1A A;  2VBP A;  1N47 A;  1ZZ8 A;  2VQT A;  1CJP A;  1DBN A;  3BB6 A;  5IAV A;  1NCQ A;  1JYW A;  1GZW B;  1NCQ C;  2ERF A;  2DVB A;  3JCI A;  1UY2 A;  5FXX A;  2PQS A;  3IDA A;  3K75 B;  3VKO A;  3MI8 A;  1F8V A;  2TNF A;  2Y33 A;  2PHD A;  4AI8 A;  2QQW A;  2BGO A;  2PN5 A;  4Y26 A;  4Y1Y A;  5LY2 A;  1W03 A;  2IC1 A;  2NMN A;  4JQT A;  3D5O A;  4D6Q A;  3AYD A;  4BQ5 A;  4CU6 A;  5HXM A;  5L7O A;  1YUD A;  1IPJ A;  4EWA A;  3J8F 2;  4IEX A;  4KI5 M;  5L7O C;  2C9A A;  3LD8 A;  1V00 A;  3PJY A;  1CX4 A;  4N7I A;  1U5I A;  2W3J A;  4IEW A;  4MZU A;  2R04 2;  3OB8 A;  3HNY M;  4QHO A;  5LRS A;  5FYM A;  1W0P A;  1QIQ A;  1VAV A;  3N9O A;  1H4H A;  5BNN B;  1O7F A;  1RHI 3;  1VB2 A;  3ZOI A;  1W05 A;  5TSW A;  3HPN A;  1DGR A;  1MS0 A;  1OQE A;  1G9C A;  1O91 A;  2J1S A;  1PNF A;  2WNE A;  4KH9 A;  2WZR 3;  4Q2F A;  4QDS A;  5DN2 A;  3UGH A;  5CIS A;  2VZT A;  3E6D A;  5GLV A;  1G86 A;  5CFC B;  1AR8 2;  5K8S A;  3INA A;  4Y20 B;  1W0O A;  1DYP A;  2ZEY A;  3NJX A;  5M0T A;  4ZXK A;  2WNV A;  2WFF 1;  3S30 A;  1XNK A;  2WNV C;  2PMW B;  3B9C A;  1NX9 A;  2VME A;  3AL5 A;  1GP6 A;  2R0H A;  1LU2 A;  3PUS A;  4AEJ A;  4FBF A;  3I2H A;  1M4W A;  1DYO A;  3RDI A;  1AR7 1;  3HQX A;  4HPK B;  1BK0 A;  1QDC A;  1YWK A;  4GH4 A;  3VHN A;  2JB8 A;  3WCR A;  4GH4 C;  1NKG A;  4N9H A;  1WKY A;  2VVF A;  5DUW A;  3HMY A;  2R0F A;  3DEC A;  4MHU A;  4Y5S A;  1CZS A;  2HWB 2;  3GHM A;  4HFS A;  3IIA A;  3HQU A;  4Z1V A;  4EWE A;  4YNI A;  3IDB B;  1V6I A;  3TYJ A;  2HWC 2;  2NMO A;  3W58 A;  4LOS A;  3NNF A;  2TUN A;  3J4U H;  3USU B;  4MSV A;  5K4L A;  1APN A;  4N43 B;  5A3W A;  1XQN A;  2UWB A;  1LHO A;  2PHL A;  1I3H A;  3B02 A;  1UMZ A;  2RM2 1;  3ACG A;  3QAC A;  1MS4 A;  3IT8 A;  4OI0 A;  2UYA A;  2ZGS A;  4JDM A;  4AFM A;  4NMI A;  1MVQ A;  2AEZ A;  3C7F A;  1GNZ A;  2YB7 A;  5JDB A;  1QWR A;  1TMF 1;  5A1L A;  4N53 A;  4ORF A;  3LA3 A;  4N53 C;  3MFC A;  1UPS A;  4XF1 A;  2D3R A;  1QJY 2;  1DLC A;  1N1T A;  1V6J A;  1ZBE 1;  2ZMK A;  2UY8 A;  4LO8 A;  4QX1 A;  2Q8C A;  1QF3 A;  4LNV A;  4XFF A;  1K5M A;  2R6Q A;  4L9B A;  4YGE A;  5IVC A;  3POF A;  1POV 3;  4XTM A;  5FZ1 A;  1V6O A;  1GZC A;  2RV9 A;  5A6X A;  4CCK A;  4RFR B;  2WZP P;  5C3P A;  4PCR A;  1HB2 A;  5H9R A;  5FO8 B;  4XZU G;  4XVH A;  5FXW A;  1ULC A;  2VG9 A;  1RB8 G;  5LA0 A;  3WP4 A;  1RUE 1;  2GP5 A;  5C5U A;  1DZQ A;  1PGL 1;  1H8V A;  2HYX A;  3M3E A;  2WT1 A;  4ASM B;  4C1W A;  5E8A A;  2J7M A;  3BGA A;  4UW6 A;  2FMD A;  3IAP A;  4AVT A;  3RGB A;  1LOB A;  4DRR A;  5IUQ A;  2AGS A;  5LEJ A;  2YY1 A;  1YQ5 A;  2VW0 A;  3IM0 A;  3S0M A;  1VR3 A;  1RVF 1;  1OF4 A;  2WO7 A;  3AJY A;  3LDB A;  1Q5O A;  3ACH A;  3OY8 A;  5FR3 A;  3MV1 1;  4MO3 M;  1PM4 A;  3VKF C;  1V6N A;  3WDU A;  1AYN 3;  1G6N A;  4NVP A;  1RUF 2;  3JU9 A;  1NZC A;  3R05 A;  4M01 A;  3WNM A;  1JZ8 A;  1GU3 A;  1DQ2 A;  4IEO A;  1ULF A;  4XDO A;  3LCP A;  1IS6 A;  5FY0 A;  4Q0V A;  3BTZ A;  3JD7 1;  3TN9 2;  3D8C A;  2WFP A;  4U36 A;  5CVR A;  2B9V A;  2B8M A;  2VCM A;  4W6W A;  1XSR A;  2OZJ A;  5JOY A;  5T5P A;  2CY6 A;  1C3H A;  4XFI A;  4BK4 A;  4E2S A;  5J1X A;  1QJX 2;  3ROU A;  4MG2 A;  5C70 A;  2P6H A;  4KWK A;  5FDB A;  2HH9 A;  4A7Y A;  4CXW A;  2Y26 A;  4LE4 A;  5ANQ A;  3UYJ A;  3FLP A;  4NHM A;  2JD9 A;  4XJW A;  1N3O A;  1IS4 A;  2VOX A;  1CX1 A;  4DUV A;  4DEV A;  1YO8 A;  3LOI A;  2Q1Z B;  2OPK A;  4CVU A;  4MGT A;  3SKJ E;  1UQX A;  2AC1 A;  2JD4 A;  1MS1 A;  3RYK A;  2G9G A;  1EP0 A;  2CTV A;  1ZZ7 A;  2A73 B;  3FUO A;  4WVZ A;  3AYA A;  4M3C E;  4WBB A;  1SQ4 A;  3R6S A;  3WDY A;  5A3L A;  2R16 A;  4CEY B;  1DDL A;  4XBL A;  5FBJ A;  2Z4F A;  4GMP 0;  1H9P A;  2F6B A;  4H3W A;  4A7Z A;  4D0Q A;  4MGY E;  1JUI A;  5JWP A;  3WNO A;  1WLW A;  3MLJ A;  3ILF A;  3W5N A;  2G4I A;  1W8W A;  4CDX B;  1SLB A;  1YNA A;  1UAI A;  2HWB 3;  5F2S A;  3RZZ A;  2WLP A;  5C9A B;  1U5X A;  1ODM A;  1V6L A;  1HRV 2;  2Y60 A;  3Q8A A;  4LKF A;  3MV0 1;  1E5S A;  5F9T A;  3T2P A;  3GHN A;  1LU1 A;  2HWC 3;  2AR6 A;  2RS5 2;  5KXE A;  1RIR A;  1VBE 2;  1I9R A;  1CES A;  4AI0 A;  1CJD A;  3MIF A;  3FL7 A;  4CDQ A;  3LEI A;  1GMM A;  3SIS A;  4CDQ C;  4YZ4 A;  4YW6 A;  2JE7 A;  3LEM A;  1AXY A;  5JIU A;  2YUE A;  3AM2 A;  2NLR A;  2RS3 2;  2PAE A;  5FY8 A;  3WF1 A;  1LUL A;  4IUG A;  2W5F A;  5KXC A;  3H1M A;  3M3I A;  3VZN A;  1IKP A;  2A70 A;  2VQU A;  4OUE A;  3OTF A;  5G04 L;  5K0U A;  4MUV A;  3VZJ A;  4D7S A;  5K0U C;  4RHV 1;  5FZ4 A;  3OUJ A;  1NUK A;  1P8J A;  1W9W A;  5FO9 B;  2YXS A;  1MQT A;  2EAK A;  4SLI A;  1MQT C;  2A7A A;  2XJQ A;  1R09 1;  4O61 A;  2XVL A;  5DDJ 3;  4RGG A;  2OXB A;  5FZ3 A;  3URF A;  1H9W A;  4B3N A;  2ZX3 A;  1EPW A;  5DAW A;  1UYP A;  1YC6 1;  2IZW A;  4UXA A;  4XIL A;  4FPO B;  2ZGR A;  5T5J A;  3VL8 A;  1AR6 2;  1C1L A;  3ACF A;  4NPR A;  3ZSM A;  3MLK A;  2ZHK A;  1O4T A;  2ZKL A;  4CPB A;  4Y1V A;  5LBE A;  1IPS A;  5A3N A;  1ZBA 1;  4JC1 A;  2QQK A;  2BFU L;  2ZOE B;  4LO4 B;  5BNP A;  3E6C C;  2VO5 A;  2ARC A;  4MXW B;  1R08 2;  3E5Q A;  1V9U 2;  2KA3 A;  2ZX1 A;  4QKF A;  4URA A;  3U75 A;  1W8F A;  4LK6 A;  1NXM A;  1IQA A;  1QXP A;  5T5L A;  3ZDV A;  4DFS A;  5I0R A;  5IFT A;  1FV2 A;  1QHD A;  4DXR A;  1OVP A;  1YJL A;  4XUP A;  4W4Z A;  1S2K A;  1HX6 A;  2BFU S;  2VL4 A;  3I7D A;  1ODN A;  4ZZ5 A;  3H0O A;  4CZS A;  3BTX A;  4ARX A;  2AUY A;  3FWE A;  2YBS A;  2R32 A;  4HKW A;  1NCR B;  4JHT A;  1LGC A;  5ERL A;  3NJV A;  1D4M 1;  2FDH A;  3TN9 3;  4P5Y A;  2WYF A;  4YFW A;  3CJI A;  4LIV A;  1VB4 A;  5DAX A;  2W1S A;  3CJI C;  4RD7 A;  3W9A A;  4B4R A;  3CKH A;  4PJY A;  5E89 A;  4CYD A;  3OYW B;  4IW3 A;  2Q8E A;  4C0B A;  3T1L A;  1CAU A;  3ZXF A;  4UYB A;  4FTB A;  1GOG A;  5EJ1 B;  3NKT A;  2V4A A;  4XET A;  2KR2 A;  3OEA A;  4E27 A;  1PVC 3;  3WF0 A;  1GNY A;  2QQP A;  1H30 A;  1HXS 1;  1GZT A;  5GLU A;  5CBL A;  3NW4 A;  1OPO A;  3WQ7 A;  1VMF A;  2G9Z A;  5FMO L;  2GU9 A;  2GC0 A;  3KGL A;  4WM7 B;  5JLV A;  5KHJ A;  2DUO A;  3HJR A;  4JZR A;  1OPM A;  1KRI A;  4LBQ A;  2JDH A;  4FFH A;  2IUW A;  3OD4 A;  1W9F A;  5HPO A;  1QQP 1;  2FDK A;  1JHJ A;  2VMC A;  2OA2 A;  2C0Z A;  2JB4 A;  3KT7 A;  1NXD 1;  4K6B A;  4NE9 A;  1XYO A;  4N8M A;  2QJV A;  2NM1 A;  2HWD 1;  1VMH A;  3WEZ A;  4CCJ A;  1UX7 A;  2P3K A;  3RG0 A;  2WFF 2;  1UZZ A;  3PJQ A;  1HRV 3;  3D0J A;  3KMH A;  1ND3 B;  2VOV A;  4R52 A;  4Y22 A;  2LM3 A;  5FPB A;  1AR7 2;  1GLH A;  2RS5 3;  2PXJ A;  1Z7S 3;  3ZO0 B;  3B93 A;  2KM2 A;  1FOD 1;  4XJ8 A;  4Z2A A;  3AK0 A;  5FZ8 A;  4CU8 A;  2D5H A;  3O14 A;  4DIN B;  4EZ4 A;  3RNS A;  4WVM A;  3U78 A;  4JX0 A;  5IK4 A;  5L73 A;  2XL7 A;  2IVJ A;  1K3I A;  3J7M A;  3GBG A;  5KHG A;  1H8T B;  3WDX A;  2W1Q A;  3PUR A;  5LAT A;  1VE0 A;  2PLV 3;  3FE5 A;  2XJR A;  4Q4Y 1;  4KQ7 A;  2VE1 A;  1RUI 1;  1AJO A;  4IQP A;  4P5H A;  4HSJ A;  4QXH A;  4CCN A;  3ZXE A;  2OYZ A;  1G9B A;  2RM2 2;  5CNA A;  3BAL A;  4CU9 A;  3ZFG B;  2GC1 A;  4H55 A;  4XUQ A;  1GQH A;  1GSL A;  5CFD A;  4V1P A;  1R1Z A;  3LFM A;  4QDQ A;  5E16 A;  3RWK X;  3VD5 A;  5CFD C;  5FYB A;  2JEM A;  1AR6 3;  4NAM A;  3GJA A;  1TMF 2;  2BNN A;  4XE9 A;  1YIP A;  5HXV A;  2WS9 2;  2EF6 A;  5D2A A;  2ZGT A;  5KC6 A;  1ZBE 2;  2GMM A;  3GXU A;  1WUV A;  1W9T A;  3J9S A;  3KLS A;  3HNB M;  1WMD A;  4HKL A;  2BQP A;  4NRM A;  1R08 3;  3B01 A;  4UF0 A;  2CYF A;  1V9U 3;  1BKZ A;  2ARB A;  4FP2 A;  3C3V A;  4LPL A;  1JU4 A;  1AZD A;  1RMU 1;  4YW2 A;  5C7G A;  3PIG A;  2JKB A;  1RUE 2;  1QU0 A;  2RR1 1;  1PGL 2;  3HT1 A;  1H2L A;  1MS5 A;  1KS5 A;  4PLM A;  4XAA A;  2QTW B;  5DZF A;  5A3U A;  5C8C B;  2ZZJ A;  3LIH A;  3RJR A;  2EAA A;  3POY A;  5GLT A;  2Q1F A;  1WME A;  2WKK A;  1RVF 2;  3AVR A;  1UY0 A;  5T5O A;  3VKL A;  5B2G B;  4PI0 A;  3H9A A;  1ENS A;  2H0B A;  4IGP A;  1XNB A;  3JB8 A;  5LBF A;  1PO2 1;  4R4X A;  3FBY A;  2GH2 A;  4QQP A;  2Y0I A;  1Q56 A;  3LZZ A;  3JXS A;  1W9Y A;  1QH6 A;  4CE8 A;  3ZN5 A;  4EN9 B;  3WQB A;  1IQD C;  1JYT A;  1AL2 1;  3WP6 A;  2Y6K A;  2FDI A;  3JD7 2;  4FCA A;  3AVS A;  5BNO B;  1TG7 A;  2JG8 A;  2JG8 C;  2VNV A;  1EAH 1;  1HJG A;  1RJ8 A;  3X29 B;  2YDE A;  2SLI A;  4E2Q A;  3TEW A;  3OPZ A;  2X8K A;  4IDZ A;  4JDN A;  1J1L A;  2BYV E;  1OHF A;  3HN3 A;  1JU3 A;  5DUX A;  3DYO A;  2DUP A;  2QNK A;  3OBR A;  3HOB A;  4EN0 A;  2WLQ A;  3VBR A;  3VBR C;  2B39 A;  4GAZ A;  1TME 3;  1S0E A;  1W8T A;  1HJF A;  1AR7 3;  3ES4 A;  3QH6 A;  2DCT A;  2VC9 A;  3VBU A;  3VBU C;  2XQR A;  4WZF A;  2WO1 A;  5L7O B;  4FPH A;  3SQO A;  1SDW A;  1ASJ 2;  1SBE A;  4GJY A;  3FMG A;  4M00 A;  5AVA A;  4ITC A;  4J1W A;  4AQ6 A;  3K4D A;  1LHV A;  2J1T A;  3WNN A;  4XCA A;  1C28 A;  3MFA A;  1Q8Q A;  3O0X A;  3DCQ A;  4AHW A;  2H0V A;  1YYN A;  3MPP G;  2BJS A;  3WQ1 A;  4MOA A;  3FHQ A;  5F5A A;  5FZB A;  2ZBJ A;  5A7W B;  4HLT A;  4XJ9 A;  1QNW A;  3PDQ A;  1ZRC A;  4BYY A;  3WNL A;  1H4G A;  1CN1 A;  1ZX5 A;  5A7P A;  5C4W A;  2D6K A;  5A3M A;  5C4W C;  5JPM B;  5IK8 A;  3ME2 A;  1PMI A;  3QCW A;  3T4H B;  1G9A A;  2XDV A;  2IXJ A;  1XC6 A;  1LAJ A;  2BPA 2;  1QGL A;  3ITQ A;  4MHR A;  5GKA C;  4H7M A;  3J26 N;  3ZFF B;  3T2O A;  4FVV A;  4HVQ A;  2FCT A;  1N3P A;  1OLQ A;  3POI A;  4ZZ8 A;  4RHV 2;  4KGG A;  5FXV A;  5HCF A;  4D69 A;  1AHS A;  4FT8 A;  1OUR A;  4YGD A;  2WS9 3;  4HG6 B;  4GH4 B;  4OCT A;  3IPV A;  3I2O A;  1ZBE 3;  4XW3 A;  3ES1 A;  1PK6 B;  1XRU A;  3AB0 A;  1W2U A;  2P5B A;  3AJZ A;  4IE6 A;  4BZ4 A;  3WW2 A;  1WZX A;  1S0C A;  3M70 A;  3MIC A;  2C6S A;  2VZR A;  1C57 A;  2A6V A;  2WQ4 A;  1PGW 1;  4GWM A;  5A3P A;  1O59 A;  2MEV 1;  1W6M A;  2Y38 A;  4K21 A;  3ZR5 A;  3KT4 A;  4AF9 A;  2E63 A;  1ZBA 2;  4ZU7 A;  5FPU A;  5F7U A;  1QJU 3;  4LIT A;  2QQN A;  4JAA A;  4YW1 A;  3CQO A;  3NV2 A;  4BQ1 A;  5FY7 A;  1RVF 3;  2VZV A;  4BOW A;  1HQL A;  1SAC A;  3I59 A;  3N9L A;  1DCS A;  3WR0 A;  5T55 A;  4TN7 A;  1GUI A;  1W6Q B;  2Q0A A;  3ST7 A;  1JYX A;  4G4F A;  4G3Y C;  2ZX4 A;  3MF6 A;  4N53 B;  1DQ0 A;  1WW6 A;  3EXU A;  3ENR A;  5KXB A;  4QKB A;  4IEP A;  1D4M 2;  2JIG A;  3H3Z A;  4J6G A;  1WLT A;  3TRS B;  4Q1P A;  4QX5 A;  4S2G A;  4PBP A;  1RUJ 3;  1WWY A;  1XBF A;  1XOY A;  2ZHL A;  3I4I A;  4FOQ A;  2YPJ A;  4JQR A;  4LBO A;  4AFB A;  1BCX A;  1RUG 1;  2BTV C;  2ZGO A;  3Q8C A;  4SBV A;  3ZM8 A;  4HBN A;  4CEW A;  5KWR A;  4CEW C;  2IXH A;  5F6L B;  5FZA A;  5ANN A;  3RMX A;  5APA A;  1DQ1 A;  2VZP A;  1H1A A;  1HXS 2;  2I74 A;  2WIN B;  3GBW A;  2Q30 A;  3KQ4 B;  4RR3 C;  3VHP A;  4B4Q A;  1JZ6 A;  1SCS A;  3JQX A;  3VBH A;  2W68 A;  4Z92 B;  3KV6 A;  2VAU A;  1OA3 A;  4Q27 A;  4AFD A;  1URX A;  3D3A A;  4GMP 1;  5HV0 A;  2JIC A;  5IYY A;  1O8S A;  1ULP A;  2BEO A;  2QQL A;  3AL6 A;  2A6Y A;  5A3T A;  2ARX A;  5LZ6 A;  2VXR A;  4XEZ A;  3ZVX A;  1QQP 2;  3VDD B;  1ZA4 A;  2OUJ A;  5ABJ A;  1ASJ 3;  1OLM E;  3DPR A;  4MLO A;  3DPR C;  2HWD 2;  1ZZ6 A;  3ATG A;  3AMH A;  1AYM 3;  4DMI A;  3O1M A;  3MW3 A;  2JX9 A;  1RUH 3;  1WCU A;  2XLA A;  2YU1 A;  1UYZ A;  3RZG A;  4QU2 A;  4N7U A;  4FFF A;  3V0A A;  5J37 A;  1CIY A;  5LWB A;  1LOE A;  1UZV A;  3ETP A;  4JHZ A;  4IV3 A;  4IV3 C;  5CEH A;  4NID A;  3NL1 A;  1FOD 2;  3NST A;  5FO7 B;  3JQW A;  3QOP A;  3VZO A;  2YC4 A;  1VRH 2;  1W8N A;  4JV4 A;  4XDQ A;  5DZG A;  3VHO A;  2XLF A;  4LBK A;  3KVA A;  2OII A;  2XKO A;  4X6Q B;  2GSY A;  1R64 A;  3C7E A;  4RYD A;  2Y64 A;  4FP3 A;  5FZI A;  3K51 A;  3QH7 A;  4LIU A;  4Q4Y 2;  2A6W A;  4UFI A;  1I6X A;  2J1U A;  1RUI 2;  1W6O B;  1DZT A;  1S2B A;  1VBA 2;  2YHJ A;  3JZV A;  4XUR A;  4A45 A;  3GBF A;  3MW2 A;  3C8X A;  4ES8 A;  2GH8 A;  4UOJ A;  5FAX A;  4KG0 A;  3J7L A;  3CL1 A;  1UYY A;  4QX3 A;  1JOP A;  3I3D A;  4PLO A;  2WQZ C;  5JXI A;  1AXZ A;  4XQ4 A;  2X53 S;  5BY5 A;  2ES3 A;  3OG2 A;  1YQC A;  2NN8 A;  3M3O A;  1BBT 3;  3P5B A;  2ATF A;  4LKD A;  4O65 A;  3RPQ A;  3WW4 A;  4BK5 A;  4BLI A;  3HBK A;  1K42 A;  4Y4R A;  4TZD A;  3III A;  4QPI A;  4YM3 A;  1DG6 A;  1RYY A;  4QPI C;  3UES A;  2D93 A;  1HN1 A;  1S0D A;  1L3J A;  1U0A A;  4ISQ A;  1SHW B;  4MV2 A;  4RGK A;  5SV8 A;  5JOW A;  1JMU B;  1RMU 2;  4OMD A;  4CXY A;  3GZE A;  4DIQ A;  2BV4 A;  2OUH A;  1RC6 A;  2RR1 2;  4Q4X 1;  5C8W A;  4KBB A;  5IFP A;  5K0U B;  4COZ A;  4Y1U A;  1AJK A;  1DQ5 A;  3KF3 A;  1MQT B;  4DPN A;  1W2A X;  3TB0 A;  1K45 A;  1QJZ A;  3O5S A;  2GNM A;  3IN9 A;  1D4M 3;  3KB5 A;  3WDV A;  2OVU A;  3ZYR A;  4IE0 A;  2XJU A;  3SCH A;  2QBX A;  2FDG A;  5FWJ A;  2QQV A;  4XAB A;  1VAM A;  3AMM A;  1GV9 A;  3OPT A;  4HK9 A;  3VL9 A;  1X9T A;  1AX2 A;  3UKT A;  3AZW A;  1US2 A;  5F5I A;  5JCT A;  4AVS A;  4QU1 A;  2FZ1 A;  3DYM A;  2WII B;  3GZA A;  1AL2 2;  3S6P A;  1H2K A;  5H9Q A;  1QNY A;  1ND2 B;  4N9I A;  5FYI A;  3O1S A;  2A3W A;  1S0J A;  1ULE A;  2EXH A;  3ZSJ A;  2Y6L A;  4W8J A;  1X36 A;  1EAH 2;  2IFR A;  3R4U A;  3JBG 3;  1B35 A;  2ZAB A;  3AC0 A;  3OD0 A;  4GD4 A;  1B35 C;  4IGQ A;  1UL9 A;  1VRB A;  2RDR A;  4GIQ A;  1POV 0;  5CKQ A;  3ZXJ A;  4UI9 L;  5FJH A;  4I2O A;  4HZF A;  1HB4 A;  4FPY A;  4IEV A;  4QB1 A;  5FIX A;  4OQ8 A;  3ACI A;  4AVA A;  2PFW A;  4ZS3 A;  3N7K A;  3WDT A;  2HWD 3;  2X5I B;  1GAN A;  1BJQ A;  1SZB A;  3DUI A;  3LKJ A;  4IEU A;  4AGR A;  1G9D A;  3H8X A;  4NIG A;  3MHZ A;  3WG4 A;  1E5R A;  2VZS A;  4FXG B;  1FX5 A;  4PBO A;  1QOO A;  4NAO A;  5JI7 A;  4OQ9 A;  3K2O A;  5J7M A;  2XWJ B;  3H42 B;  2Z69 A;  3F2Z A;  3WLU A;  1BEV 1;  1VJ2 A;  2BBA A;  2MNG A;  3L9J T;  1ENR A;  4XF0 A;  2JDK A;  1CAU B;  3WQ0 A;  3H7J A;  1FOD 3;  1SFY A;  5JMC A;  2CL2 A;  1IOA A;  1AVB A;  1GFF 2;  3L2H A;  5FP9 A;  1VRH 3;  4QPY A;  4OHX A;  1WCQ A;  2W39 A;  1ZYB A;  2GZW A;  4GB3 2;  2VTX A;  4FOV A;  2WSV A;  1FMD 1;  1COV 1;  4Q0U A;  3WP5 A;  4YZ1 A;  1RIN A;  3KWV A;  2RS1 1;  5IVB A;  2QDN A;  3I2G A;  3S7E A;  1KFX L;  3TEZ A;  4QX7 A;  2BRT A;  2RMU 1;  3NAP A;  1OOP B;  2ET1 A;  2WQ8 A;  1GR3 A;  3KT1 A;  3CZJ A;  3NAP C;  4L2N A;  4Q4Y 3;  3ZIX A;  4XXA A;  5FYU A;  1RUI 3;  1W0N A;  3PMS A;  1VBA 3;  4V2V A;  4P9I A;  1CPN A;  3ECQ A;  1VAL A;  3K46 A;  4X6R B;  1MEC 3;  1R1A 1;  4GA9 A;  4PQQ A;  2R07 3;  5B4N A;  4WVW A;  1RUD 3;  2P34 A;  3RMY A;  5JXH A;  4JDO A;  4L8Q A;  1F35 A;  2Q5T A;  3BN6 A;  1GOH A;  1ZRR A;  2NPI A;  2PHU A;  3V56 A;  3ZPO A;  4YVS A;  3RI9 A;  4RN5 A;  5FKC A;  3N9N A;  1JZ2 A;  4BIF A;  2WNU A;  2W08 A;  4TXW A;  2WNU C;  1E57 A;  3WCS A;  1Z78 A;  3POJ A;  4TTG A;  2ZTN A;  4AVC A;  2R30 A;  4EN7 B;  1LJ7 A;  1UKG A;  3HNM A;  3PNA A;  1PGW 2;  4PI2 A;  4NR1 A;  4CP2 A;  1RMU 3;  2MEV 2;  4Y4Y A;  4NWV A;  5C3R A;  1K5M C;  2RR1 3;  4AG4 A;  4QXK A;  1OF3 A;  1PIV 1;  1ZA7 A;  4FXK B;  4R9B A;  3OOX A;  1Q8S A;  4D8M A;  5KXD A;  1CON A;  2D44 A;  2ZHN A;  3A23 A;  4OYU A;  5F8P A;  2XWB B;  1VBC 1;  4D7Y A;  2CV6 A;  4R9C A;  4CCC A;  3IKW A;  5FLJ A;  4P9X A;  1UF2 C;  2XJV A;  4BQ3 A;  5H9P A;  4E4D X;  5DPN A;  5BNQ A;  1OKO A;  4A3X A;  3WG3 A;  3ZYP A;  4O9G A;  2B42 B;  2YC0 A;  4BLJ A;  5EV7 A;  1QKQ A;  4LMF A;  5CFD B;  3RZJ A;  2QQM A;  3C2U A;  1F4H A;  3POS A;  3U07 A;  3B94 A;  5FZ7 A;  4B7E A;  5HCH A;  3ZFE A;  4IEQ A;  2VCA A;  4PIZ A;  1UW8 A;  3ZFE C;  4UW4 A;  1BYH A;  4HSL A;  5C33 A;  1UY4 A;  1WMF A;  3PUA A;  3M4F A;  4S2F A;  3SMH A;  1EV1 1;  2JG9 A;  1Y9M A;  5GZG A;  4LUK A;  4CDU A;  2JG9 C;  2BZD A;  1EPZ A;  3J8F 3;  2BNM A;  4QXC A;  3WT3 A;  5LBC A;  3RJ2 X;  5FP8 A;  3RZL A;  4XIO A;  1MZ5 A; 
#chains in the Genus database with same CATH homology
 2ADE A;  4B1M A;  3SC7 X;  3KF5 A;  3KF3 A;  4HXC A;  1Y4W A;  4CCC A;  5FMB A;  3U1X A;  3H3L A;  3ZR6 A;  5FKC A;  3U14 A;  4CCE A;  2AEZ A;  1ST8 A;  2QQU A;  5FIX A;  3U75 A;  3ZR5 A;  5FKB A;  3PIG A;  2QQV A;  4UFJ A;  3LIG A;  2XQR A;  4UFK A;  3HBK A;  3LDR A;  3NMB A;  4AZZ A;  4UFM A;  3LFI A;  4B1L A;  2QQW A;  1W2T A;  4QHZ A;  3UGH A;  3LF7 A;  2OXB A;  4UFH A;  4JQT A;  5FK7 A;  3RWK X;  3S5Q A;  1Y9M A;  1Y9G A;  1UYP A;  3PIJ A;  4EQV A;  3LIH A;  5FK8 A;  3UGG A;  4UFI A;  5ANN A;  4FFI A;  5FMC A;  3LDK A;  5FMD A;  4FFF A;  2ADD A;  2AC1 A;  3LEM A;  3UGF A;  4CCD A;  4FFH A;  3IMM A;  3OSD A;  4UFL A;  2AEY A;  4FFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...