4AZZA

Carbohydrate binding module cbm66 from bacillus subtilis
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
165
structure length
165
Chain Sequence
TPFMSNMTGWTTVNGTWADTIEGKQGRSDGDSFILSSASGSDFTYESDITIKDGNGRGAGALMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAEYKTPIDVNKKYHLKTEAEGDRFKIYLDDRLVIDAHDSVFSEGQFGLNVWDATAVFQNVTKESLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEVANASE
publication title How Nature Can Exploit Nonspecific Catalytic and Carbohydrate Binding Modules to Create Enzymatic Specificity.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 43
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 3.2.1.80: Fructan beta-fructosidase.
pdb deposition date 2012-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4azzA00
3OSDA 4FFGA 4B1LA 3U75A 5FMDA 3ZR6A 4CCCA 4FFFA 3H3LA 1ST8A 4JQTA 3LF7A 2ADDA 2OXBA 4B1MA 1UYPA 4UFIA 3ZR5A 3S5QA 4UFKA 5ANNA 3LIGA 4QHZA 2ADEA 2XQRA 3LIHA 3UGFA 4AZZA 3SC7X 3HBKA 3NMBA 3UGHA 1Y9MA 1W2TA 4CCDA 5FMBA 4EQVA 3RWKX 4UFHA 1Y4WA 3IMMA 2QQVA 3KF3A 4UFJA 3U14A 3UGGA 2AC1A 4FFIA 2QQUA 2AEZA 5FKBA 3LFIA 3PIGA 3U1XA 1Y9GA 4UFMA 4CCEA 4FFHA 2QQWA 3LDKA 2AEYA 5FK7A 3KF5A 3LEMA 4UFLA 3PIJA 4HXCA 5FKCA 3LDRA 5FIXA 5FMCA 5FK8A
chains in the Genus database with same CATH superfamily
4XQ4A 1W8UA 3HNYM 2XOMA 2H6CA 4X6RB 2PHRA 1XB9A 4XC9A 3VBUC 4QX7A 4ZKTB 4MV2A 3AVSA 1QDCA 1G86A 1NT0A 2WUHA 4RS5C 1JHNA 4E4ZA 2VNVA 4XYXA 1GZCA 2PFWA 2YY1A 3H8RA 1YJKA 1ND2A 1OMIA 1YQ2A 2DCZA 3LQCA 4LXLA 4FTSA 3ZSKA 2NM1A 5A3TA 2OA2A 2AC1A 2W95A 5C6CA 4MGYE 1YJLA 5FZ6A 2C9KA 2GALA 2QFEA 3RYKA 5FZBA 1AXZA 4CDUA 4EROA 1QJU3 3ZVXA 2XMLA 3N7LA 4YZ1A 5CKNA 1OA2A 1VBC1 2A73B 2RS13 3DYOA 3CLPA 4XURA 5FMCA 2FMYA 3EYPA 1SFYA 2JXAA 3VN4A 4EWAA 1APNA 1GZTA 1GZWB 1G7YA 1ND3A 1RUH3 1GFF2 2XLFA 3G6JB 4QWNA 3KT7A 4RQPC 3SQOA 3LSDA 4QKNA 2X8KA 3M3EA 1MQTB 5EZWA 5A33A 1VMJA 3HPNA 4RFT0 1VJ2A 2EIDA 1W9FA 1O4YA 2ZMNA 3O1RA 1V9U2 2KR2A 1TVGA 4XFAA 3ZFFA 3K2OA 1CX1A 5L73A 1W3XA 5A3WA 4YW3A 3NJVA 3PVBB 5FYSA 4QU1A 2P3KA 5CAZA 2PAMA 3POIA 1FPN2 2WAOA 3DEMA 1OSGA 5L9RA 3DYPA 2LTNA 3TEYA 1OFNA 3BOWA 4JDNA 3H7YA 4AVBA 1QXRA 1NXMA 4P5YA 5FZIA 3KD4A 3Q8FA 1MZ6A 2BYVE 3CBNA 3VKNA 3ME2A 3B9IA 4E4DX 1VBC3 1AHSA 1UD1A 3JXSA 4IE6A 4NMIA 4QKFA 2DCKA 5T50A 3MICA 4FFIA 2QQUA 1B09A 3IM0A 4QD2A 2FDJA 3VBSA 1V6MA 4XMAA 4XBNA 4F8AA 3H8UA 1IPKA 4AXOA 3QH7A 1VPHA 2AENA 3DKWA 5FPBA 3AP9A 2BGCA 3PTRB 4P9YA 1F4HA 3TOJA 2R1BA 2WZEA 3F2ZA 5ACA2 1BEV1 1XYPA 3NV2A 4LLOA 4LO6B 2AYHA 4CP9A 4PQQA 1QXPA 5F5CA 2OYZA 5CNAA 3HBZA 5FLHA 3UK9A 4M01A 1SMVA 1VMHA 2QQMA 3UGFA 1STMA 3USUB 3BI3A 3HWJA 3NNJA 1G9AA 3IDAA 5LW9A 2CGPA 4AI0A 3TRSB 1QKQA 4OHXA 3AM2A 2J1SA 4KWLA 3ECQA 1ZRCA 1O7FA 2YFZA 3W59A 1MS8A 1YFUA 2VOTA 3CJIC 5H9QA 1RUD2 5I0UA 3S30A 2QNKA 2VMIA 3AMMA 2XJRA 1CD3G 1NOVA 1ALYA 3Q8AA 4UW5A 4AF9A 2E32A 4AFBA 2HJIA 5AC91 2H6BA 1RIRA 4RL7A 5BXXA 3PJYA 1EYBA 1Q3EA 4L92A 4XUPA 4MG2A 3LFMA 3NWKA 3PJQA 4M3CA 2RR11 5DUXA 5BNPA 3ZR5A 1OLRA 3IDBB 1UOBA 4HETA 4PQ9A 4Q4V3 1CAXB 1QNYA 2XPJA 3RVHA 4QGNA 5BV6A 5J96B 3OEAA 1S2KA 1VBB2 2HBUA 3GCXA 4HG6B 1BEV3 4GZ9A 3MIHA 1I9RA 1KDMA 1T2XA 3AC0A 1ZBE1 1C5IA 2IXCA 1NY72 2VBDA 4WVMA 4NO4A 3CF6E 1C5HA 2CWMA 2JDPA 5FUPA 3K4DA 2VNOA 2VMCA 3KHCA 1DHKB 5I0RA 2VZTA 1RUE2 2VMHA 4PBOA 4RSUA 4D6SA 2YV8A 2P6HA 3RG0A 1AL0G 1N3OA 3D4KA 4YGCA 3RZKA 1SLLA 4IE7A 1W28A 3ZX7A 2B7YA 4DZGA 1C57A 1V00A 1RVF1 1S0GA 2D3PA 1JU3A 3HAGA 5AC93 4MHRA 5F6KA 4HKWA 1QOOA 1EPZA 3ETPA 4HMZA 1ENSA 1HB4A 2KXLA 3VKOA 5KXCA 1WLWA 4AGVA 2EAAA 4NWWA 4Y20B 4ASKA 3BN6A 1NKGA 5LY2A 1VP6A 2LRPA 4YFZA 4H7LA 2VMGA 1PX3A 2FHRA 1Q5OA 2GN3A 2PHUA 5IVBA 4QKBA 3ZSMA 1TQ5A 3NAPA 5CB7A 5JOZA 1ODMA 4UW3A 3H3ZA 3ZPOA 1HIXA 1ODNA 2JICA 3I7DA 4Q4X2 1K42A 1OHFA 1C8M1 2JB4A 4AFDA 3LDRA 5BNQA 1VBE1 2EXKA 1JZ7A 3TBDA 1UU6A 4MX3A 4XAEA 3N7JA 1JZ5A 1H0BA 2QQOA 5FBJA 1G8WA 2BTVC 2H0BA 3ELNA 1MEC1 3E1F1 4QB1A 1F35A 2EXHA 2R0HA 1QOSA 2EIEA 4LO7A 3M1HA 2ZAHA 5C3PA 3W9AA 4ZZ5A 3IIIA 4XUOA 5CADA 2IFRA 2XJQA 3AP5A 1F9KA 3J7HA 1ENXA 1IGOA 2XLGA 4WM7C 5IK7A 2RS51 1WMEA 2Y60A 1RVF3 4W6XA 4QQ2A 3GM8A 1W9YA 4CCNA 2YC0A 3J7LA 4XCAA 3I4IA 2R6QA 2SBAA 4R52A 2ZX2A 2VOVA 4KWJA 3KMHA 2KD7A 5DAVA 5L7OC 4O9GA 3LE0A 2HEYF 2LW8A 4MOAA 5F3EA 4OYUA 5GLVA 3CZJA 4GQ7A 3E6CC 3I2FA 3Q8EA 4CDWC 5KHGA 1H9WA 1DDLA 1C8M3 2ZKLA 5FRAA 3ZKUA 1QJU2 3NJYA 5LEJA 1VBE3 4MUVA 4A3XA 5FYZA 2E9QA 3D0SA 1Q8SA 2ZMKA 3ST7A 2RS12 4ES9A 5D2AA 2BPA2 4R9BA 3AYAA 1VAVA 3OY8A 1NCRB 4Y1ZA 1MEC3 2CYFA 1RUH2 2Y0OA 2ZTNA 3I3EA 2PHDA 3IAQA 5JIUA 2O0OA 5FO7B 4OVEA 1SFNA 3A21A 1AR71 5FZCA 4LR4A 4UF0A 4Q5OA 3T08A 5FZ8A 3WXPA 2QDNA 3GXUA 2RS53 2V4VA 4P5HA 5D8AC 1E5SA 5ABJA 4QXHA 4YPJA 1O3TA 1UY0A 1LJ7A 2G4IA 5IYYA 4ORFA 4P14A 5JSPA 1SHWB 4MLOA 3S7EA 2YC4A 4XTPA 1LNSA 2B9VA 4Q4Y1 4I01A 4JHZA 4ES8A 1RB8G 1ZNPA 2HBTA 5FMOS 1H2NA 2A6WA 1JOJA 5IFTA 4RGAA 2Q4SA 5FY9A 2ZGMA 3RZHA 1U5XA 1A8MA 5F8PA 3FN9A 2PAEA 3VBHC 3WCSA 4CEWA 1N3PA 1MVEA 4BQYA 4QPGC 4HT1T 4IESA 4P02B 1AX1A 3WUCA 3MGUA 2Y33A 4RYDA 4YW6A 1KEXA 3DN7A 1PK6C 1U5ZA 1VBC2 2JENA 3VZJA 5EV7A 3S0MA 5FXZA 2WA4A 1CVNA 5T54A 2E33A 4GJZA 3LOBA 3CO2A 4A42A 1MR5A 3W21A 1CIYA 1AR73 2JKBA 3CU7A 5IVYA 3WEZA 5CFCB 3VV1A 3LIHA 3R4SA 1KJRA 3WDUA 2D6NA 5FZAA 2A6XA 4FPEA 4QPIB 1O5UA 2QQVA 1KFXL 1Z78A 2PLV1 4NHKA 1U0AA 1XSQA 1NCQB 4H3WA 1JODA 1OD5A 4UFMA 2VUJA 2UY8A 2W1SA 1LTEA 4AFCA 2CTVA 2QQWA 2Q8DA 3ZYPA 1CONA 1GOHA 3HMYA 1AYN1 2MEV1 2CY6A 4QXCA 1QDOA 3D8CA 3I3QA 2Y34A 4BU2A 2GC2A 5EFUA 5FOJB 1QH6A 1CIWA 1GZ9A 1O5LA 4LBJA 3RSJA 4PLNA 1F5FA 2FDFA 1XU2A 3PHMA 4OI0A 2XKOA 4Y4RA 5HV0A 1CWPA 4KBBA 4A7KA 1O3RA 4Z8BA 2G9GA 1VB4A 5HV4A 1A6CA 4U36A 3VD3A 1RGSA 4ASMB 5CG9A 1GR3A 5KHIA 2A6ZA 1DFQA 4HL0A 4ZU7A 1OVPA 3ZYBA 1J59A 2YGLA 4HK8A 1UMZA 4FOWA 2VE1A 1RUC1 3ZSEA 1JZ3A 3RZGA 2PLV3 2PHXA 2WKKA 3VBUB 3ZR6A 4B7EA 4XIOA 2D5HA 3JCIA 2Z5WA 3MIDA 1BEV2 2R043 1DGLA 3MYXA 4Y1UA 4B1LA 1PGW1 1UN1A 1J83A 5A3NA 1J3RA 3K3OA 3K4AA 3OB8A 1GNHA 3UT0A 5LATA 4DUWA 4AQTA 1AYN3 2MEV3 1LESA 2ERFA 2P17A 5A3OA 1I5PA 2CV6A 2ZHMA 2J1UA 4DQAA 3HN3A 1Y7BA 3VBOA 2YPJA 3ZYIB 1CAVB 1MQTC 4QX3A 1R1ZA 2VOWA 5T5OA 2SLIA 1MS0A 1NLRA 4RA0A 3WSOA 1M06G 5EPAA 4NPMA 3WF0A 4P9GA 5IAXA 2PA7A 4GAZA 5AC92 5BYNA 3L2HA 5F3GA 4S2GA 3CKHA 5L36A 3WDYA 2ZA9A 4R9CA 5J48A 2VVEA 2EICA 3PMEA 2V72A 1UXXX 3POSA 3WNOA 5HI0A 2PHFA 4A45A 2RR12 2DCYA 4GIQA 5FY5A 4XF9A 1RUC3 3SXWA 3S5QA 4XDQA 3B9CA 2ES3A 4XJWA 5J37A 2IUWA 1F8VA 2O8OA 1W0OA 4E27A 1VAMA 3VBFA 1VE0A 4XBQA 1LOBA 4AEDA 4CSWA 4FBFA 1ZBE2 4GULA 2J7MA 2XBO1 2JX9A 3I8TA 1NQJA 5JVVA 5GLUA 4QPWA 4BLJA 2VL4A 2XLAA 1OLME 4N53A 4Y4YA 3S57A 4NRPA 4Y1VA 3KLSA 2Y6GA 4PDWB 3NV3A 4UOJA 1VBD1 4RS5A 5A7WA 4DPNA 5JZGC 2F17A 4KQ7A 3BIWE 1X8EA 2VZPA 3HT1A 4AAXA 3ZFGA 1DIWA 3AFKA 2QQNA 1RVF2 4D6QA 3FHAA 5GLZA 1AZDA 1SCRA 1PX4A 5JSRA 2C9AA 4N9HA 4K21A 1AR61 1XYOA 2YDEA 3MW2A 1US2A 2NLRA 3MIGA 3UKVA 4XQWA 1IG0A 4CP1A 1XNDA 1GQHA 1O8PA 1UIKA 1PGSA 4KNCA 3RGBA 1ULPA 1W8NA 4OCTA 4V2VA 5M0TA 1LR5A 3AMHA 5C8CC 1SLTA 2ZX1A 1JYNA 1C8M2 5ERLA 3MPPG 5IK4A 1UYYA 1VBE2 3C7EA 4GMP1 2XBO3 1BKZA 3HIFA 4Y22A 2BVVA 1UX7A 2ZAAA 3KGLA 1URXA 3WQ1A 4MVTA 3H3LA 1MEC2 4CDXC 1K5MB 2ZX0A 4KGQA 5B2GB 2YBKA 3WZ1A 5A32B 3OGRA 3B01A 3KT4A 4FCAA 3MI8A 1G9BA 4KG0A 1T6GC 3GBGA 2E26A 2PQQA 2WYFA 3O0WA 1N1SA 1W2TA 3WNMA 5F3CA 2ARBA 2BERA 3OEBA 3CJIB 3S6PA 2RS52 1UO9A 2DTWA 2WQ4A 1X82A 1D0HA 2JDNA 3MV01 4H55A 1KFUL 1GV9A 2ETEA 3WLUA 2PMWB 4LJHA 2Q5TA 2VCCA 1CZTA 3E5XA 5J1XA 1AR63 2BGPA 4QXKA 4QX2A 5A1FA 5DMYA 4YG0A 1S0IA 2LUWA 4AVVA 2WO1A 4YVSB 4IV3A 5FPAA 3VL8A 3C2UA 1NE4A 4QX5A 5I8SA 4COVA 3LA2A 5F37A 2Y38A 1QJEA 2WNVB 4XEZA 1BXHA 2R32A 2BNMA 5A3MA 1F4AA 4AI8A 3IKWA 2D6LX 3VBRC 1UAIA 3AP6A 3CEWA 1LOCA 1WBLA 3VZMA 5IVJA 3DPRC 4IGPA 1ZYBA 3IZOA 4OLLA 4CA9A 5IVVA 4HSLA 4GMP3 3NMBA 2VVFA 2XR4A 3POWA 4Y24A 5IVEA 5J3UA 5HCFA 2W1UA 4PI2A 1WCSA 1DYKA 2YFUA 3NNMA 4Q0SA 4AQ6A 1WKYA 1Y9GA 1BCXA 4G9SB 2BFUL 1DZQA 1AR72 1WCDJ 4QQOA 3ZYFA 1IS6A 4BXSV 4KI5M 4DO0A 1JYWA 1DU3D 3ACFA 4BQXA 5JAXA 2CWSA 2ARCA 1WD3A 1KS5A 1TEIA 2GP3A 3BIEA 2D3SA 5A6XA 3K4ZA 2MHFA 3NVCA 2QQLA 3UKNA 4CP0A 3MDPA 5I93A 2UWBA 2DFBA 3AMNA 4D69A 2VUDA 4Y26A 4BQ3A 4Z92B 2FD8A 3AKSA 2DBIA 4Q4Y2 5J98B 3O1VA 5CA6A 4I3PA 2B45X 3I2KA 1EPWA 4FVVA 1N47A 2OUHA 4IE4A 1QMJA 4ITCA 2EVXA 4MXVA 3IPVB 3SKVA 4B4PA 2EALA 1RHI1 1VIWB 1H1MA 3E5QA 3POFA 4P9XA 4P08A 3POYA 5DAQA 4AI1A 3JD71 4ZHNA 1UL9A 2DV9A 1JI6A 1V6KA 4YW1A 4KL1A 3KQ4B 4UAPA 5CIRA 4ZU5A 3T2TA 4XMIA 5GALA 2JG8A 1E57A 5GKAC 4CU6A 1VB2A 1I1EA 1H6YA 1QJX1 2E7AA 1UYPA 1GWMA 1MACA 1ULEA 4ZY9A 4A6OA 1OLQA 2XKPA 2JWPA 2DBNA 4A6SA 3VUOA 2GMEA 3PUSA 2JKXA 4JGYC 1N1TA 1WCQA 2W5FA 4BK5A 4WZCA 1LHWA 2PLV2 4C1WA 1OA3A 4UFJA 4XUTA 3UGGA 3VKLA 2BWAA 4NHXA 3I2OA 4YG6A 5FR3A 2QQJA 3MPBA 3L2YA 2BUKA 1VALA 2X5IA 3TN91 2YB7A 5L7OB 4LQRA 1A34A 1BQPA 1MPXA 4BB3A 2DUOA 1NCRC 1AYN2 2E51A 2MEV2 5C33A 1RHI3 3OGGA 4XF3A 5IVFA 1W8OA 5FDBA 2YG0A 4CDWB 3LPFA 2OZJA 2VW1A 3H8OA 3O7OA 3AL5A 1YLLA 1YUDA 3ZDSA 3OYWA 1QY4A 1X9PA 4NHYA 4DY5A 1H8TB 3OGSA 1ACCA 3PVNA 3LEGA 2WNUA 4LHSA 1GBGA 2IC1A 1QJX3 1LGBA 3Q9OA 4XJZA 1SBFA 1DQ0A 4ZONA 3WQ0A 1W6QB 2PQSA 3K46A 2OS2A 2WRAA 1MZFA 1XNKA 2OKXA 5CISA 5D8AB 1RUC2 3TB0A 5IFPA 5JUVA 4E4SA 2VZ3A 3WNLA 1AR81 3OBTA 3ZMNA 4LBMA 2CNAA 2MNGA 1J1TA 4YM3A 4DFSA 3R4DB 1PGW2 3TN93 3ZN5A 2PAKA 4JQTA 3SHRA 4B1MA 2YBPA 1C28A 2FMDA 3VD5A 2PELA 1GKBA 2ZABA 2AREA 3LSEA 5JPMB 3T30A 4FQZA 4BQ4A 3A7QA 4PF5A 3TEWA 4QPGB 1IHMA 5L9VA 2WSUA 1J3QA 1W8ZA 1JYTA 2WO7A 1XSRA 3AYCA 2WN3A 2CL2A 1OUXA 1SPPA 2WWJA 1PK6B 3WG2A 3AZWA 3E6BA 3G7DA 4META 4CZSA 2W46A 1LAJA 1POQA 1DGWA 3N7MA 3ALQA 2LM3A 3CHXA 3M8LA 2AEYA 3H7JA 1UXZA 1OKOA 4CTEA 2E63A 4XE9A 1C1LA 4OHWA 1OFSA 4JGZB 4LT5A 4XIKA 1O6UA 3MBWA 4Y5Z0 5FQ0A 4OZOA 1RXGA 3N9OA 3DYMA 1W6MA 1GP6A 3DL3A 4LBQA 5K7PA 3ZFEA 3O1OA 1ENRA 1CN1A 1AR83 2BRTA 1JZ4A 1ND2B 2P2KA 1PVC1 3AKRA 4TLFA 5F32A 4ZU4A 2JEMA 1ZRFA 4YW2A 4YW7A 3T09A 2MPFA 3KF3A 1F5JA 3WQ7A 2XBO2 3VHRA 4DINB 1RYYA 2JG9B 3KVBA 3OD4A 4QHOA 4AHXA 4JTNA 2VJXA 1HV1A 4UWDA 4Z82A 5IW0A 5FFOC 2O1QA 3CNAA 2OVUA 3DUIA 4XZPA 1KRIA 3ORJA 1VBD2 4GH4A 2UY9A 4K8RB 2OIIA 3FL7A 1NYWA 1Q8OA 3JUUA 2R071 2GU9A 5H9SA 1YIFA 2OPKA 3KV4A 5K8SA 3AX4A 1AUYA 4LMFA 3FE5A 5EYYA 3VBHA 3VDAA 3OUIA 3ZXLA 4NR1A 3CQOA 3WP4A 1N3QA 1DF0A 1AR62 4AG4A 4CDQA 2BU9A 4IEOA 5LA9A 2QDRA 2DVAA 1O4TA 4LBQD 4H14A 3WOGA 1OPMA 3GGLA 4O9EA 4XTMA 4FTBA 1NAEA 5FZ3A 5A7QA 1BLZA 3WG1A 1CAWB 1PVC3 2P1BA 2WAAA 5DAWA 5T5JA 1O3QA 3U0ZA 1NA1A 5DG2A 4FP2A 4IEPA 2VMDA 4Q29A 1FAYA 3UL2A 1MZEA 3ITQA 1HRV1 1POV1 5LRRA 5E16A 2JB8A 4S2DA 3U11A 3K48A 5JOXA 5K9YA 1LENA 1PMIA 2VO5A 3NO8A 3NW4A 3VLBB 5KC6A 1QHDA 1Y9QA 2R073 4L2NA 3Q8BA 1BVVA 1KJLA 1RUJ1 1W9TA 3P6BA 3M3CA 3POJA 3JBG3 1XE8A 4J1XA 1I3HA 1FOD1 5FZ4A 1HQNA 4AK3A 4LIUA 2AZ5A 4HPKA 2GH8A 2W08A 3HQXA 2ZGKA 3J7MA 1OURA 1HXS1 4LKFA 3ZYGA 4J1WA 4AL9A 3V65A 4G4FA 1IPJA 2K2SA 4UBGA 3ZO0B 1A8DA 4XF4A 4X8PA 3MLLA 4BZ4A 3GALA 3FZ3A 1JXNA 4XCBA 5J7MA 1VLNA 4PDWC 3WDVA 5G04L 3IN9A 2J1VA 4YW4A 2C6SA 2PYTA 1W6OB 1O8SA 2YC2A 2XHNA 1HRV3 1POV3 4PI0A 1DZRA 3RWKX 1BJQA 2XG3A 1QIQA 3PNAA 4DB5A 3BU7A 3DXUA 2RJLA 4WM8B 4AEJA 1YI7A 4XOGA 5HCHA 2ZACA 1LU2A 5JZGB 3SH4A 2ZBJA 2YYOA 1SBEA 1RUJ3 4MGSA 1DQ6A 5BNNA 4I09A 3PMSA 1FOD3 5FLIA 3UKTA 4Q4V1 3P5BA 1X33A 2VQTA 2WR9A 4COUA 3RPQA 1DLLA 3I3MA 4JX0A 1HXS3 4LOSA 1WWYA 3BODA 4H2AA 5A3PA 4QX8A 1AJOA 1MQTA 4IQPA 4JDOA 1HRI1 4BJ0A 4YFWA 1DQ5A 1RC6A 5CFDA 4HN1A 1F15A 1K5MC 1RHI2 4ZS2A 1WD4A 5FYBA 3WDWA 5C8CB 1G9FA 3K77A 1ZRIA 2GSYA 2A71A 4FPHA 2AH2A 2G1MA 3JD72 5IHRA 1LOFA 3PVEA 4IEYA 2PN5A 5F2SA 3OPZA 1WW5A 4R4ZA 4CDXB 4AHZA 2DVBA 5HCBA 4B3NA 3AFGA 3N7KA 4Q27A 3ZLIA 3V0BB 1QJX2 5C4WC 3DGTA 4YVSC 4QX1A 4HOOA 2VR4A 3WINE 3C7HA 1VMFA 4CUGA 4EZ4A 2WNVC 2ZGSA 2D6PA 1BK0A 3THCA 5F9TA 3RZLA 3MO4A 4C91A 4CCKA 1CAUB 3PUHA 5FZFA 3ZXKA 5T55A 2NMOA 1DQ1A 2EIGA 3K75B 3CMGA 2GMPA 3TN92 5E8AA 3HQUA 3NAPB 1HRI3 3I2JA 3VKFC 3WF4A 3I59B 2XHKA 3UYJA 1PNFA 4K3UA 4JQRA 5C7GA 2PHTA 3LA3A 3VBRB 4AR2A 3PU3A 4KG8A 1GNYA 2WT1A 4N7IA 2W91A 2UWAA 3DPRB 2ZZJA 2Y0IA 3N36A 4IV1C 1OOPC 1SG3A 3U75A 5FMDA 4JKLA 1JN2P 1NXD1 4LKEA 5FP8A 1C1FA 3O1PA 1TG7A 2B39A 2XJTA 4BQ2A 3ABZA 2IXIA 1JS9A 1OQEA 3SC7X 1ONAA 1RJ7A 3T4VA 1A78A 2GNDA 4A7YA 2JE7A 4FOVA 4NWVA 2VMFA 2LROA 4NIGA 3FHIB 3A4UA 4RHV1 4YGDA 2W3JA 2JDYA 1GP5A 1AR82 1WLTA 3BPSA 1U12A 2HYKA 3V0AB 4P9JA 2WZ8A 4QKDA 4QX0A 5A80A 4FQ4A 1G6NA 3B00A 3AP7A 3WW1A 3LF7A 3VDBA 2RJKA 2X53S 1VR3A 2XJUA 1YQCA 3LPGA 3MEPA 2Y26A 2WS91 2J1RA 2WNOA 4ZZ8A 5EQUA 2DVGA 4E2QA 4URAA 1S4CA 4QDSA 4BM8A 3P3PA 2JDZA 1S0DA 1S0EA 1Q56A 1Z7S1 2IWGB 1KXGA 1LEDA 2VXRA 3BTZA 4NAMA 5JI7A 2DCTA 4CUCA 5DABA 4XFIA 3FUOA 4XABA 2VNRA 4FI9A 4EYUA 3MV11 1GICA 4JDMA 2IXJA 2ENRA 2WJSA 5ABJB 2Y8KA 4LEJA 2Z2SB 4YVWC 1UNBA 1UZVA 1D0GA 2ORXA 2XVLA 3AXEA 5E88A 5C3RA 1ZREA 3MW4A 4JGYB 4RHV3 2BEOA 2WSVA 1QXJA 4UFIA 5IT6A 5IATA 1XNBA 4ARXA 4HFSA 1PVC2 1UF2C 2IXHA 2OPWA 3BYWA 4NJ4A 4ATEA 3UGHA 3AKQA 3EJKA 4M4RA 4ARYA 5A7NA 2ZGOA 4K20A 3RYRA 2P34A 4Y20A 4FPFA 5F3IA 2QQKA 4Q0QA 1M4WA 1YNAA 5C3SA 1H8TC 5JXJA 3TEXA 3N9PA 2WS93 4NUBA 4TWTA 3W5MA 4XDOA 2F6BA 2HH9A 3ZXGA 5LY1A 3KF5A 4QU2A 2R072 1Z7S3 5KBFA 1IZ3A 5BY5A 5FREA 2EIBA 4PIZA 1RMU1 4I02A 5KHJA 1X50A 3SCHA 5FYMA 4CU9A 1MZ5A 2XJVA 4JTOA 5CBLA 4CCOA 1D2QA 2ADEA 2VC9A 4FOQA 4OQ8A 1YO8A 4FSJA 3M4FA 4M3CE 1H2MA 1W9SA 3UESA 1W90A 4Y3OA 1GP4A 5CG8A 1D2SA 4XFCA 4NROA 1EAH1 1H4GA 1ULOA 2OW4A 1CPMA 1W6PB 2XONA 3WW3A 2IXKA 4XAAA 5FYCA 1DZTA 3A0KA 2C26A 1DQ2A 3M2MA 4BA6A 4XJ9A 4D94A 2BFUS 2W39A 3ILRA 1FI2A 5JI9A 1QEXA 3VDDC 1HRV2 3IDEA 5E6HA 3WF1A 4OHYA 3T0AA 1GMMA 1H1AA 1I6XA 4LUKA 1W6NB 4EN9B 1XNTA 4Q2FA 1B35C 1ST8A 2R49A 3HR9A 1FT9A 1ASJ1 2D7FA 2K46A 2OQ7A 4MXWA 3SITA 5JXHA 2WYSA 5K4LA 4GWNA 4JGZC 1LHNA 2DCJA 1FNYA 5FP3A 2ILMA 2JDUA 1RUJ2 1AL21 3KWVA 4HANA 1JBCA 1OLMA 1RMU3 4S2FA 1FOD2 4XJ8A 4AGGA 2ZEXA 1NCRA 1R091 1V6JA 1ND2C 1RITA 2XWJB 3QACA 4GB31 1UIJA 5FP7A 1MS5A 1HXS2 3AZXA 3I2GA 2R041 4J6GA 3U37A 2XVKA 4JCKA 3WW4A 2C5DA 2JG9C 5LEKA 1EAH3 4CRQA 3UV9A 3ZM8A 4CDUC 2R061 3AKPA 5FBZA 3VD7A 5KR7A 1YIPA 1WW4A 1MVQA 1XC6A 1QQP1 3ILNA 4PJYA 4AVSA 5T5LA 5FY4A 3T1LA 4BIFA 1UOJA 3KV9A 5JMCA 1RUI1 3RZJA 1ND3C 3OPWA 2WQZC 5L9BA 2XUMA 1HJFA 2XJPA 4CEYB 2Y6JA 4D7YA 5JOYA 1ZRRA 1WUVA 1ZZ7A 4HKOA 4NN0A 1ASJ3 2VCMA 2VZVA 4C1XA 1XQNA 3TNQA 3AB0A 3RYPA 2A7AA 2P37A 2ID4A 2E6VA 3ZFFC 1AL23 4CUBA 1XNAA 4Q4V2 1GQGA 4HXCA 5F2WA 2FDIA 2JIJA 2WT2A 1R093 1NE6A 4GB33 1SCSA 1JU4A 4LITA 3IB3A 3ZDVA 2ZEWA 1N1YA 2WINB 3HNMA 3VZKA 1Q8PA 4BPZA 1OXCA 2XL7A 4XXPA 5CFCA 1UU4A 1HRI2 5B4NA 2R063 2VXJA 4FXKB 4KGGA 4B7KA 3FWEA 3F95A 4QPIA 4Y1YA 4LOTA 4JKKA 4IL7A 1QQP3 3U07A 3WCRA 1NCQA 3GCWA 1RUI3 4QPYA 1UKGA 1K5JA 5EJZB 5C5UA 1NQDA 3MUZ1 5FP4A 4D6RA 3U78A 1W2OA 4JKMA 3UNPA 3EXUA 5A7WB 4DY3A 1YQ8A 1RXFA 3ZN4A 2XH6A 1KITA 3NNFA 1BMV1 5EJ1B 1LKNA 3B93A 2ZX4A 5K0UA 1PO11 2HEWF 2J1EA 3VD4A 3KV5A 2E53A 3CJXA 4DUVA 2Y6HA 3BU0A 1XOYA 1SZBA 3KT1A 1HB3A 1RUNA 1X9TA 1LU1A 1TME1 5EXOA 3URFA 3WNNA 4QT6A 5I8TA 5LK5A 4QQHA 5C9AB 4HZFA 1UCXA 2B9UA 4BQ1A 3J4UH 3E97A 1IG3A 4WM8C 4WVWA 3N35A 1MS9A 1UKRA 2WFF1 4EN8B 1FMD1 3JQXA 1DLCA 1W99A 1YQ6A 3VBUA 3WDTA 2WT0A 1DYPA 5D1IA 3GHMA 4L0PA 2RDRA 5LWBA 4XFFA 3JB4C 1CZSA 2VAUA 5BNOB 1MS4A 2NMNA 4N43B 3O0XA 1LRHA 4LE3A 1X8MA 4WVZA 3VHOA 5BNPC 1EY2A 2ET1A 4OI1A 1CAVA 1QJZA 1PO13 3QBQA 1XJAA 5GJ6A 3ZN6B 4FAGA 3O1TA 1ZA4A 5F1RA 2P3YA 2RMU1 2V5DA 2ZGRA 5DXDA 3P3NA 1WGPA 4RHV2 1CX4A 2HWF1 2OZ6A 3T3YA 3OG2A 4AQSA 4MH0E 3H8XA 4YM2A 3D3AA 4LBNA 2RM21 2VNGA 3E5UA 3OUHA 1OQDA 2QBXA 1NLQA 1VRBA 1YEWA 2NQYA 4RQPA 1TME3 1F2NA 2ZEZA 4YSFA 1AR91 1ZZ6A 3M3QA 2GN7A 2PTMA 5JR2A 1FXZA 1KGYA 2DTYA 2D3RA 2RHPA 1SEFA 2ZHKA 1K45A 3IAPA 4BXFA 1W0NA 2WS92 1JOPA 5DPNA 2WFF3 4D7TA 2W52A 1FMD3 2YU1A 2WZR1 1ZX5A 4GALA 4O7XA 5FXXA 5A6QA 2X29A 3ZXFA 1RUF1 2W0XA 4NAOA 1Z7S2 1HJGA 1O59A 1KDKA 4M00A 2DVDA 5DQ0A 4QMAA 3SNMA 2P6CA 1NG0A 3ZKYA 1WMFA 3RI9A 2VZUA 1PNGA 1HB1A 4Q1RA 1JZ2A 2W1QA 4FPOB 2I2SA 2VECA 2FQPA 5FP9A 5C4WB 2CDOA 4B29A 3NAPC 3OOXA 4M0HA 4CPBD 5HCAA 2RMU3 4YM1A 5H9PA 3FBMA 4ZS3A 1OKQA 2BGOA 2HWF3 3HOBA 1OVSA 4ONUA 3VB9A 5JOWA 2RV9A 3GDBA 5LZ6A 2Y6FA 1QWRA 2RM23 4NIHA 4BCUA 1N1VA 3C7GA 4RR3B 2A75A 4MHUA 1AR93 3CZUA 4OI4A 5JXIA 2A5ZA 3PTYA 5CU1A 1VRH1 1UY4A 4DXSA 1S1AA 5A3UA 2WZR3 4QGLA 1SFPA 3OUJA 2X05A 4IV1B 3N9MA 1OOPB 1RUF3 2HLEA 2Y64A 2YZ4A 4Q0VA 2AGSA 4W6YA 2L9LA 1GSLA 1UW8A 2ZEYA 4MADA 1GWKA 1RMU2 4IEXA 1HN0A 1IKQA 4LUMA 3OGJA 1K5MA 2WWUA 3WHUA 1SDDB 4Q8LA 3EHKA 5A32A 1W8WA 5E1RA 3NL1A 2ZGQA 4UI9L 4AI3A 1XU1A 4DNYA 1EAH2 3CJIA 3V64A 5I0DA 2ZGLA 5LB6A 3JQWA 2JDMA 3R6SA 4BQ5A 2ZGUA 3V56A 2VZSA 5JMOA 5FJKA 4OFGA 4PIYA 1H1IA 1COV1 2JDHA 1JYXA 1UZ0A 4TN7A 4GKXA 4E8DA 5FWEA 4E8CA 4IERA 4C8DA 4AE2A 4RGKA 2VQUA 4YVSA 2OQ6A 3PIJA 4EN7B 3TNPB 3M3OA 4XFGA 1VRH3 3QLQA 2Z69A 4QDQA 5A1LA 2GAUA 2VCAA 4XVHA 3C7FA 1ASJ2 2J42A 1FPN3 4XHBA 3KHBA 3OYWB 5ABJC 3HJRA 4Y5SA 3RFRA 4C90A 1PHMA 2VGDA 2QJVA 3M7AA 2YGMA 1AL22 3R4UA 2EXJA 5A6ZA 4B8EA 4CCDA 2WNUB 2HWD1 4NPLA 4DMIA 3BTXA 2V5YA 5LA1A 1V6OA 3OPTA 1R092 4GB32 4FPJA 4EN6B 3KGZA 3LFIA 1W8TA 1JH5A 2GNBA 2GC3A 1POV0 2R042 1PMHX 3JZVA 4MZUA 5DZEA 1HB2A 2WZPP 2ZJCA 3NNGA 4ASLA 2BWCA 1HQWA 3MUY1 2LALA 1O4ZA 4YVWB 3ZSLA 5AFBA 2PXJA 2AACA 3ACHA 5FK7A 3GZUC 5AVAA 3ZYRA 1IQAA 2R062 3UJOA 5FZOB 2ZCWA 1YFYA 4YRDA 4ISQA 1COV3 5I0TA 3IT8A 2VQ0A 1QF3A 4AHYA 2ATFA 2ZMLA 1QQP2 3ZIWA 2V73A 4R4XA 3H42B 1EP0A 5KHHA 1RUI2 2RDNA 5H9RA 4P9IA 3KV6A 5KXDA 4HSJA 4HONA 4KU8A 4UW6A 2D44A 1SLBA 2BP6A 3IPVA 1Y4WA 2XDVA 2ZGNA 2JDAA 4OUSA 3PIGA 1D4M1 3RI8A 3TWIA 1HW5A 1REFA 1OD3A 2VD7A 1UMHA 4FFHA 4QQLA 2A6VA 2HWD3 3LKJA 1U5IA 3WP5A 1W9WA 5FO8B 4UXAA 5FPZA 3GYDA 3AZZA 1PM7A 3IMNA 4QQPA 3KS7A 4CCCA 3ZMOA 1GYKA 1UZZA 2QCSB 4E9KA 2A3WA 3ZFEB 4BLIA 5A6YA 3W5NA 2FDHA 2Q8OA 5GZDA 5G05L 4WM7A 2WA3A 2D93A 3BUCA 3LB9A 3HEIA 1V6LA 4ISRA 1J58A 3AYEA 1UY2A 2CGOA 3NKTA 4HN0A 1DYOA 4MSVA 2VTXA 4FPYA 4Q1PA 2AEZA 1AF9A 2UYAA 3ON7A 4L97A 5FZEA 1WA4A 1O91A 1AYM1 2GH2A 5FO9B 3I3DA 5L7OA 3VDDB 3I3BA 1Q8QA 1IS5A 4I0WB 3SH5A 4AFMA 5FZKA 5C5TA 1B35B 1UMIA 2OT7A 3IDCB 3J8F1 3N9NA 1LGNA 4IGQA 4A7ZA 1BMV2 4YW5A 1D4M3 3JU9A 4CDWA 5LRSA 3T2OA 4UBHA 1PO12 1W04A 2JE9A 2Q1MA 4OUEA 3SCGA 3VZLA 2RDSA 3T2PA 5KHKA 1OF4A 3VZNA 2VOXA 4EWDA 3O1SA 2AUYA 3GZTB 1H8TA 1WW7A 2E7TA 2WNEA 4QB6A 4AZZA 4AYUA 4O61A 4EQVA 3KZ4C 4HBNA 5T3NA 1L7QA 1E5IA 1TME2 1MS1A 3FBYA 3SCFA 1W6QA 3RZMA 5FPLA 3VBOC 4CEYC 1OC1A 1V70A 5D8AA 4CDUB 1NA1B 4XUNA 3EQEA 1Q43A 4I3GA 2WFF2 4ET7A 1FMD2 1LOAA 2D5FA 3H0OA 3O5SA 4XPVA 3KQRA 1AYM3 3WG4A 2HKXA 1ND3B 3MF9A 3T2QA 4R9AA 4E2SA 3APBA 3AYDA 2D97A 4IETA 3JBG1 2FBEA 3POGA 4CCLA 5I91A 2BQPA 1V0AA 4FOYA 2UWCA 2CDPA 4JVAA 4QHZA 5FYIA 3J8F3 5FY0A 5LBEA 4DEVA 5A33B 3VD9A 1QJY1 4LKSA 2WO3A 1NX9A 4QPGA 1H6XA 3ENRA 3VHPA 5LA2A 4YGBA 3ZFFB 2WFPA 2RMU2 1NZIA 1PK6A 3O0VA 3VBFC 1J1LA 3WNKA 3ZXJA 1CZVA 2HWF2 4AEDC 4F3JA 2YHJA 1ZBA1 5DZFA 2NZ9A 5FZGA 4LULA 2J1AA 2C1FA 3T1MA 2RM22 4COYA 5IK5A 4NOTA 5F5IA 5CYYA 3UETA 1FATA 5D21A 2O8QA 1AR92 4N53C 4JGZA 4QHBA 2F4LA 5FZ7A 4P9WA 4IUGA 4CE8A 2EXIA 1Y3TA 1LCLA 3T0BA 2A1XA 2BJSA 2D6OX 3BKZA 1HV0A 3D0JA 2WZR2 2VU9A 5EYXA 1C8NA 1WBFA 2Z4FA 1W8HA 2W1WA 1GLHA 3ZFGC 2YXSA 1RUF2 3WP6A 3NV4A 4DXZA 1FV2A 1S2BA 1WCKA 3QD6A 2VUAA 4NHLA 2IVJA 3FLPA 2JG9A 3GNEA 5GZGA 3VBSB 2BDRA 3BVCA 4MGIE 2R0FA 2WC2A 3AZYA 1QJY3 4FPCA 2HWE1 3AKTA 4P9LA 2VMEA 5FZ1A 1BZWA 5FZ9A 1UYZA 5BNNB 1VAKA 3T4HB 2RDQA 3LAGA 5FY7A 5C9AC 3MFCA 3T0DA 3BTAA 3S7IA 1H8VA 1ZBA3 1YHFA 2AR6A 4FT8A 5FPVA 1ENQA 4CP9B 2J22A 2GNMA 2DYCA 1PZ9A 3EBRA 5BUVA 2TNFA 4V2WA 4CXWA 2A70A 5T52A 5HBAA 5CFDB 2UU8A 3BTYA 4LKDA 2Q1ZB 4GXLA 2F4PA 4YGEA 5BNOC 1V6IA 3OJBA 1VRH2 3AXDA 3EMRA 4N43C 2Q0AA 1WMDA 5KC5A 2OX0A 3ES1A 3N9LA 4LTAA 4YYOA 3U10A 1EV11 1CAWA 3GBWA 3GZAA 1MS3A 4NRQA 1WW6A 1XNCA 2QQIA 4C0BA 1AX0A 2VZRA 3O1UA 1PGL1 1QH7A 4TXWA 3LWCA 3MIEA 3O12A 3B5LB 1ZVFA 1R081 2ZHLA 1GZWA 1UZYA 3QH6A 4M3CB 3OGVA 1ULGA 1XBFA 2HWE3 2RJ2A 3A22A 4IV3C 4Q26A 1W05A 5BNPB 1AJKA 1JUHA 4YZ5A 5DAPA 5LA0A 1TNFA 4XXAA 4AI2A 4WV8A 4IXLA 3THTA 3H1MA 4BWOA 1UU5A 3IMMA 5C3OA 1UPSA 1ZRDA 2VUCA 3MIFA 5C3QA 1COV2 5I0SA 3RQ0A 4WVMB 1FX5A 3U1XA 4FAHA 2HYXA 2DURA 1O3SA 3H1WA 3ES4A 4DS0A 3HN1A 2XGXA 1OI6A 4LK7A 4W8JA 3THPA 4QM8A 4LBLA 3J7NA 1EV13 4AAPA 5TSWA 4AHWA 4FFFA 5FZMA 4M3CF 1UY1A 2NPIA 1W6OA 2XQRA 3HT2A 2ET7A 2D6MA 4FTEA 2HWD2 4MGTA 1UYXA 4DIQA 1AX2A 1R083 4IGOA 1HDKA 4WM8A 2D6KA 4GWIA 4RR3C 1DG6A 1W03A 1HLCA 3SLIA 5JZGA 1V6NA 4YG3A 5BPXA 3OBZA 2JJ6A 4MO3M 4WVVA 2GP5A 3MW3A 4AOCA 3QOPA 4UW4A 1XRUA 3ASIA 5EP9A 1DGRA 5J09A 3ZXAC 2EA7A 4AWDA 1ULCA 1IOAA 3ZYHA 3FJSA 4K6BA 4A2UA 1PZ8A 3VHNA 5EIYB 1IPSA 1LEMA 4TTGA 3WX5A 3WDXA 1QJFA 1PMJX 2GNTA 3LOIA 1AXKA 2WIIB 3D82A 1YQ5A 1RTVA 1YC61 2JG8C 3B69A 3KB5A 3GJAA 3LIGA 4W6WA 2P4EA 1WMXA 3SEEA 3USUA 4BMBA 2VPVA 4LHKA 1HX6A 1OPOA 5FMBA 3ILFA 2RS31 2BVBA 5C8CA 4COWA 2VBPA 5KXBA 1D4M2 1AXYA 2D43A 1YYNA 4N9IA 1F31A 1IKPA 2PHLA 1WCUA 1IS3A 1PIV1 5CEHA 3O1MA 3RMXA 1LODA 1ULDA 2VZ1A 3K51A 5EWSA 5GZCA 3ACGA 5DAXA 2DFCA 5JDBA 2X5IC 4L9BA 4CDXA 1ZZ8A 1W0PA 4IEVA 4SLIA 1FNZA 1W06A 1JW6A 4LPLA 1UOGA 3V0BA 5CKQA 2WWSA 2VW2A 4KU7A 3EO6A 2D40A 1SQ4A 2O14A 2ZS6B 4EN0A 4GA9A 1DQ4A 1CAXA 4FPLA 2YUEA 3RWNA 4YZ3A 1I5ZA 4HLTA 4XETA 3TAYA 3H9AA 4QDRA 2RR13 2OUJA 4U2AA 5FLJA 1CAUA 3POBA 4LBKA 3OY8B 1AYM2 4XW3A 2A6YA 1YWKA 1RUOA 1S0JA 2WNUC 5DDJ1 1KS4A 3I59A 2K9ZA 3RMYA 2ZGTA 4UF0B 3LDKA 2RS33 3MF6A 1HN1A 3J8F2 1ZBE3 2QZ2A 4KBZA 3VBRA 1GOGA 1DBNA 2DUQA 3DPRA 1GNZA 3VL9A 2N7GA 2W68A 3FFQA 1R64A 1PIV3 1VBA1 2ZKNA 3ACIA 5CKMA 5FJHA 1K12A 1KD7A 5GM0A 1RJ8A 4M4PA 5C70A 3ZOIA 4ZXKA 1JYVA 5FTTC 1UWWA 2V09A 4OI2A 4BQWA 2HEVF 2R30A 3I49A 1X7NA 1Z0HA 5I8YA 4UYBA 2DF7A 4XHXA 3NJZA 1KQRA 4CEWB 3CDZB 4Q0UA 1SACA 3RZZA 2HWC1 2XWBB 2W87A 3AMQA 5FYTA 4EZHA 2PHWA 4NVPA 3WF2A 2HWB1 4GKYA 3UJQA 5SV5A 4UFLA 3HNBM 1Q8VA 5FYHA 4BISA 1IQDC 2EAKA 4Z1VA 1OT5A 4TYSA 3M3IA 3O14A 4I2OA 3PU8A 2E31A 4D8MA 2BZDA 5DDJ3 3JBG2 3K3NA 2ZXQA 4MXWB 2ADDA 4K1ZA 3HQRA 3WR0A 4NIDA 3AJZA 2BOJA 5FV3A 1UY3A 3ROUA 5ANNA 4BYYA 4Z2AA 1QJY2 3NRUA 4NIIA 2XQXA 3A0NA 3PL0A 3SKJE 3ZFEC 1XE7A 4YARA 1VBA3 4CYDA 1W3VA 2WLPA 2YPDA 4EWEA 5A3LA 1ZBA2 3AJYA 1E5HA 4LORA 3WUDA 4AEMA 4R8HA 1WLDA 5FYYA 1RUG1 1GU3A 2VQAA 2VM9A 5IJRA 2I45A 2HWC3 4N7UA 2BNOA 4HVRA 3C8XA 1NLSA 4GH4C 4JGYA 5EHDA 1TMF1 2ARXA 5HXMA 3N3HA 5IUQA 2HWB3 2GMMA 3QCWA 4BE3A 4JV4A 4A3ZA 5FPXA 1S0FA 5F7UA 4JRAA 5FUNA 4Q4W1 1BHGA 4XILA 4FXGB 3WW2A 2VOKA 3OF1A 1OH3A 4K7JA 4GMP0 4KWKA 1PO21 1ULFA 4CDQC 3A23A 3CIHA 4O65A 1H4HA 2GDFA 4H7MA 4DXTA 5CVRA 2HWE2 3ZPYA 2C24A 3AP4A 4AI9A 3E6DA 3MIBA 3ZXDA 5FKCA 3ZYJB 3C7OA 5AVPA 4B4QA 1NA1C 3FHQA 3LGRA 5F5AA 2BBAA 1AVBA 3JB8A 4IEQA 3U4XA 3ZXEA 3H3UA 3DXTA 1GUIA 3AL6A 4LE4A 1RUG3 4LNVA 2YMZA 4OULA 4OUMA 1J84A 3I2IA 1DGWX 2W2IA 4JC1A 1JMUB 2VTFA 1CGPA 2R1DA 2BBVA 2ZZQA 1P8JA 4X6QB 1JHJA 3VBOB 1TMF3 2Q30A 1W6PA 1LHUA 5FKBA 5IWFA 4HVOA 4Q4Y3 5JIAA 1EV12 4KWUA 1FYUA 3ACLA 1WA6X 4Q4W3 1PM4A 1ZM1A 2TEPA 1FV3A 1R1A1 2IXLA 1PGL2 3OBAA 1E5RA 3C3VA 3LEMA 1ZZBA 2DDUA 1QNWA 3NV1A 1UZWA 3P1IA 1PO23 1R082 4IE0A 4K8FA 4L8QA 5GZEA 4D0QA 1W6NA 4XF0A 4NIAA 4RFRB 5FOBB 4W65A 5K0UB 1L7LA 1W39A 1TE1B 1YRZA 5FXWA 3EB7A 3CL1A 4YLZA 3WD5A 2CAVA 1WZXA 4PLMA 2VW0A 1QU0A 5FZLA 4XZUG 5DUWA 2JD9A 4GJYA 2WABA 3D5OA 4OMDA 2JECA 4I30A 3VBFB 4AEDB 3WQBA 2NP0A 1EUTA 3PURA 2WBKA 3DV8A 2Y6LA 5FWJA 2QVSB 4LK6A 1SLCA 3LCPA 2QTWB 3NQHA 3RDIA 2H0VA 1SDWA 1PVXA 2IVIB 4LA2A 4N53B 4NRMA 3W58A 3FFZA 4K9SA 5FAXA 1SBDA 3IIAA 3VBSC 3BOPA 4GWMA 4HK9A 4RS5B 3H1YA 4Q0PA 2W9XA 5LBFA 4HVQA 5A70A 2VULA 1OQ1A 5A7OA 3ZFGB 3LA7A 3OCPA 5BNNC 2LS6A 1D7PM 3DCQA 1R1A3 1ZZ9A 1JOBA 1J3PA 2KA3A 1S0CA 2NN8A 3J26N 4KMQA 2G9FA 3L9JT 3U4SA 2UURA 5ANQA 5J36A 2VH9A 4CEYA 3LEKA 4N90A 5CZKA 4Q8KA 3FUQA 3B3QE 4MGKE 2D98A 2UYBA 4PT6A 1US3A 3INAA 3TYJA 5CFDC 2NYYA 1UQXA 3BGAA 1DCSA 3ETQA 2CSGA 4XACA 2BNNA 1OBNA 3PDQA 1ZA7A 4BDVB 2G9ZA 4EJRA 4NE9A 1REEA 3D6EA 2YBSA 4RQPB 3WV6A 1W2UA 2GC1A 1YXWA 1DP0A 2GC0A 4TSVA 1UX6A 3J9SA 4Y22B 3VDCA 4CVUA 3MLJA 5JCTA 4FFGA 1LOFC 4K1YA 1BBT1 5A1AA 4EV0A 5FZHA 1YFXA 2VY0A 5KXEA 3FLTA 4OHZA 4RN5A 3RNSA 5IK8A 2XL9A 4G3YC 1Y9MA 2B8MA 2RS32 1CJPA 1CJDA 2VBBA 4BOWA 1H2KA 1YCIA 2XXZA 3KCXA 2QZ3A 4IW3A 1CESA 3R0RA 4FO9A 4KH9A 4W4ZA 1UPIA 5GZFA 5F5QA 1PIV2 4N8MA 4CPBA 4E4HA 3KCCA 1LHOA 4IV3B 2DUPA 4DOUA 3KSCA 3NNLA 4WBBA 3POEA 4BMEA 1G9CA 1GANA 3RJ2X 3SMHA 3GF6A 1GWLA 1W2AX 1PZ7A 3MFAA 4AVCA 2WLQA 1CQ9A 3R05A 3B7MA 5JWPA 2I07B 2VG9A 3GJBA 4COZA 1W8FA 2ZGPA 3WVJA 1H30A 4TLGA 3N9QA 5FYUA 2JDKA 3BB6A 2YROA 2VZOA 3IBMA 1BBT3 2FZ1A 2YU2A 4GD4A 3I54A 3WF3A 2FZ2A 4Y1XA 2Y6KA 2X09A 4MGZE 5DDJ2 1LECA 4DXRA 4JZRA 5C9AA 4XFHA 3GHNA 2Z42A 3IWZA 3KVAA 1OF3A 4E2GA 4J25A 3RS6A 4LIVA 4IDZA 3WNPA 4BIOA 4ZXEA 4PDWA 4PIXA 4ATFA 4CCMA 3SISA 3BCWA 1VBA2 4Z07A 3MHZA 4W50A 2CU5A 5FUIA 3HD8B 5BNOA 1VBD3 2WDBA 4N43A 1JZ6A 3TEZA 5JXGA 1GOFA 4FP3A 4XJAA 3ZSJA 5C71A 2FDGA 2DU0A 4XUQA 2A3XA 2IFWA 3Q8CA 4YNIA 3PUIA 5GLTA 1RINA 2VZQA 5LBBA 3ZN6A 1V9U1 1XYNA 4LHNA 2HWC2 1HKDA 3OD0A 4XDPA 2WQ8A 3VKMA 4CU8A 3PLQA 4CP2A 2HWB2 1FPN1 4JRLA 4M0NA 1LGCA 1S55A 5JLVA 2DVFA 3N4MA 2Q1FA 2DWRA 1S0BA 4MGQA 2W47A 2ZPXA 5ISLA 3OSDA 3USSA 2JG8B 5SV8A 3HVDA 3DF0A 1C4RA 4UT5A 3RRDA 2OXBA 3BALA 2RE9A 3OTFA 3I97A 4YZ4A 4BHPA 1JZ8A 5LASA 4WZFA 1SLAA 4OHVA 1LB2A 5FMOL 5F39A 4DUXA 2E7QA 5A7PA 1BK1A 5DN2A 5JPNB 3B94A 3DECA 1BVP1 4UFHA 4D7SA 1LHVA 3KM5A 2BOIA 1TZOA 5LK7B 4AW7A 4LBOA 5FXVA 4Y5TA 5DZGA 3AZVA 3FMGA 2X5IB 4MYEA 4RD7A 5FCCA 1RUG2 3PUQA 2ZX3A 5JR7B 1OA4A 4A44A 4K40A 3S5AA 2G19A 1GQPA 5C4WA 1V9U3 3THDA 2XVGA 5FY1A 2W94A 4I0BA 5ACA1 1TMF2 2WNVA 3GBFA 3ZIXA 4RR3A 1U5YA 3PVOA 4NPRA 2KM2A 4Q4W2 5E89A 3W20A 4PF1A 3AVRA 1H2LA 2RVAA 3WT3A 2JD4A 2XUEA 4SBVA 5FZDA 4QAWA 1PO22 5DG1A 1RL3A 5T5PA 1JYIA 3DKQA 1REDA 2R16A 3V0AA 1TNRA 1RUD1 4AEKA 5DUUA 4DEQA 4I0AA 4IV1A 1OOPA 4CEWC 4QXBA 4IEZA 1G9DA 1W2NA 1YFWA 5EJ3A 2TBVA 2C4XA 4S2HA 5GLWA 2DU1A 5B4XA 5F6LB 3NJXA 1YI9A 5LCWL 1EUUA 5FYVA 5IVCA 4JAAA 3OBRA 4WM7B 3RJRA 1JUIA 4CCJA 1HQLA 2BV4A 2XJSA 5KWRA 3MZHA 4PCRA 2Q8EA 4IEUA 1H9PA 1C3HA 3B02A 3VZOA 1XPWA 3WNXA 4C0HA 5ACA3 4OZXA 1VBB1 3LZZA 3U14A 1WLCA 4OQ9A 2I74A 4INDA 4QM9A 2VCBA 1SPPB 4FPGA 3LDBA 1NY71 3VGIA 3KCYA 4CCEA 2BW8A 2ZHNA 4LO8A 1S2EA 2ZOEB 4NHMA 2WL1A 1R1A2 3I2HA 3PUAA 4LHLA 1L7RA 3X29B 4AFAA 1RUE1 3AK0A 2JE8A 2R7EB 5DUVA 5C8WA 4AVTA 3JD73 4URTA 2VTXJ 4ZPIA 4P00B 5FQ0B 1RUD3 1LOGA 2QKDA 5LBCA 1W6MB 2Q8CA 4BH9A 4LBQB 3SH3A 4EE2A 4XQDA 2FDKA 1Y43B 1XE0A 4JHTA 3WP3A 3FC0A 2A3YA 5FY8A 2FCUA 4A4AA 5HXVA 4PBPA 4YM0A 3MLKA 4TZDA 4DRRA 2B42B 4L11A 5A7SA 4YVWA 2W92A 2GZWA 1LOEA 1VBB3 2B4KA 1OUSA 1JYCA 1ZZCA 4GH4B 1X36A 4CUAA 4XFBA 4Q4X1 2WO2A 4AVAA 2XB6C 1QGLA 5FIXA 5FZOA 2VVDA 2WN2A 2ARAA 2CHHA 4R9DA 4XF1A 4X8NA 1XXNA 1CR7A 4BK4A 1L3JA 1QOTA 4Y33A 2C0ZA 3VBHB 4DRVA 1T6BX 1RUE3 3AMPA 4XJUA 3FX3A 5IAVA 2CAUA 3LEIA 2P5BA 3WY6A 4CDQB 5L19A 3NSTA 5CFCC 4LLFA 4V1PA 1CPNA 4FPKA 2EF6A 2ORZA 4QGMA 4F7ZA 4QPIC 2JIGA 1LULA 2B5HA 1A3KA 2J1TA 1UOFA 2K0GA 2P3IA 2V4AA 3NKGA 1NCQC 3LD8A 4LO4B 4CU7A 2X10A 4F83A 1D4VB 3FLRA 4L99A 4IEWA 4OMCA 4AQ2A 4Z2WA 5FK8A 5HPOA 1NZCA 1BBT2 4YWAA 1DGRN 2IZWA 3BPZA 1K3IA 4GWJA 4UFKA 2QUOA 4HKLA 2QE3A 4B4RA 4Q4X3 3SEPA 4D3WA 2B46X 1NUKA 3HBKA 4RGGA 5APAA 2Z79A 5K0UC 1BYHA 1QJU1 4YZ2A 3WHTA 2TUNA 2CGNA 4AGRA 1JTZX 4LO5B 5AFEA 4IE5A 1IS4A 2RS11 4PLOA 2QQPA 1OH4A 4PHZA 3H50A 4QB2A 2FCVA 5FZ0A 1RUH1 4HPKB 4CXXA 4CXYA 3VDDA 2FCTA 3WG3A 5JSOA 5FPUA 1SLIA 3GZEA 3I2DA 2P3JA 1B35A 2RG4A 4LA3A 3M70A 4XBLA 4A41A 3ATGA
chains in the Genus database with same CATH topology
3OSDA 4FFGA 4B1LA 3U75A 5FMDA 3ZR6A 4CCCA 4FFFA 3H3LA 1ST8A 4JQTA 3LF7A 2ADDA 2OXBA 4B1MA 1UYPA 4UFIA 3ZR5A 3S5QA 4UFKA 5ANNA 3LIGA 4QHZA 2ADEA 2XQRA 3LIHA 3UGFA 4AZZA 3SC7X 3HBKA 3NMBA 3UGHA 1Y9MA 1W2TA 4CCDA 5FMBA 4EQVA 3RWKX 4UFHA 1Y4WA 3IMMA 2QQVA 3KF3A 4UFJA 3U14A 3UGGA 2AC1A 4FFIA 2QQUA 2AEZA 5FKBA 3LFIA 3PIGA 3U1XA 1Y9GA 4UFMA 4CCEA 4FFHA 2QQWA 3LDKA 2AEYA 5FK7A 3KF5A 3LEMA 4UFLA 3PIJA 4HXCA 5FKCA 3LDRA 5FIXA 5FMCA 5FK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OSD A;  4FFG A;  4B1L A;  3U75 A;  5FMD A;  3ZR6 A;  4CCC A;  4FFF A;  3H3L A;  1ST8 A;  4JQT A;  3LF7 A;  2ADD A;  2OXB A;  4B1M A;  1UYP A;  4UFI A;  3ZR5 A;  3S5Q A;  4UFK A;  5ANN A;  3LIG A;  4QHZ A;  2ADE A;  2XQR A;  3LIH A;  3UGF A;  4AZZ A;  3SC7 X;  3HBK A;  3NMB A;  3UGH A;  1Y9M A;  1W2T A;  4CCD A;  5FMB A;  4EQV A;  3RWK X;  4UFH A;  1Y4W A;  3IMM A;  2QQV A;  3KF3 A;  4UFJ A;  3U14 A;  3UGG A;  2AC1 A;  4FFI A;  2QQU A;  2AEZ A;  5FKB A;  3LFI A;  3PIG A;  3U1X A;  1Y9G A;  4UFM A;  4CCE A;  4FFH A;  2QQW A;  3LDK A;  2AEY A;  5FK7 A;  3KF5 A;  3LEM A;  4UFL A;  3PIJ A;  4HXC A;  5FKC A;  3LDR A;  5FIX A;  5FMC A;  5FK8 A; 
#chains in the Genus database with same CATH topology
 4XQ4 A;  1W8U A;  3HNY M;  2XOM A;  2H6C A;  4X6R B;  2PHR A;  1XB9 A;  4XC9 A;  3VBU C;  4QX7 A;  4ZKT B;  4MV2 A;  3AVS A;  1QDC A;  1G86 A;  1NT0 A;  2WUH A;  4RS5 C;  1JHN A;  4E4Z A;  2VNV A;  4XYX A;  1GZC A;  2PFW A;  2YY1 A;  3H8R A;  1YJK A;  1ND2 A;  1OMI A;  1YQ2 A;  2DCZ A;  3LQC A;  4LXL A;  4FTS A;  3ZSK A;  2NM1 A;  5A3T A;  2OA2 A;  2AC1 A;  2W95 A;  5C6C A;  4MGY E;  1YJL A;  5FZ6 A;  2C9K A;  2GAL A;  2QFE A;  3RYK A;  5FZB A;  1AXZ A;  4CDU A;  4ERO A;  1QJU 3;  3ZVX A;  2XML A;  3N7L A;  4YZ1 A;  5CKN A;  1OA2 A;  1VBC 1;  2A73 B;  2RS1 3;  3DYO A;  3CLP A;  4XUR A;  5FMC A;  2FMY A;  3EYP A;  1SFY A;  2JXA A;  3VN4 A;  4EWA A;  1APN A;  1GZT A;  1GZW B;  1G7Y A;  1ND3 A;  1RUH 3;  1GFF 2;  2XLF A;  3G6J B;  4QWN A;  3KT7 A;  4RQP C;  3SQO A;  3LSD A;  4QKN A;  2X8K A;  3M3E A;  1MQT B;  5EZW A;  5A33 A;  1VMJ A;  3HPN A;  4RFT 0;  1VJ2 A;  2EID A;  1W9F A;  1O4Y A;  2ZMN A;  3O1R A;  1V9U 2;  2KR2 A;  1TVG A;  4XFA A;  3ZFF A;  3K2O A;  1CX1 A;  5L73 A;  1W3X A;  5A3W A;  4YW3 A;  3NJV A;  3PVB B;  5FYS A;  4QU1 A;  2P3K A;  5CAZ A;  2PAM A;  3POI A;  1FPN 2;  2WAO A;  3DEM A;  1OSG A;  5L9R A;  3DYP A;  2LTN A;  3TEY A;  1OFN A;  3BOW A;  4JDN A;  3H7Y A;  4AVB A;  1QXR A;  1NXM A;  4P5Y A;  5FZI A;  3KD4 A;  3Q8F A;  1MZ6 A;  2BYV E;  3CBN A;  3VKN A;  3ME2 A;  3B9I A;  4E4D X;  1VBC 3;  1AHS A;  1UD1 A;  3JXS A;  4IE6 A;  4NMI A;  4QKF A;  2DCK A;  5T50 A;  3MIC A;  4FFI A;  2QQU A;  1B09 A;  3IM0 A;  4QD2 A;  2FDJ A;  3VBS A;  1V6M A;  4XMA A;  4XBN A;  4F8A A;  3H8U A;  1IPK A;  4AXO A;  3QH7 A;  1VPH A;  2AEN A;  3DKW A;  5FPB A;  3AP9 A;  2BGC A;  3PTR B;  4P9Y A;  1F4H A;  3TOJ A;  2R1B A;  2WZE A;  3F2Z A;  5ACA 2;  1BEV 1;  1XYP A;  3NV2 A;  4LLO A;  4LO6 B;  2AYH A;  4CP9 A;  4PQQ A;  1QXP A;  5F5C A;  2OYZ A;  5CNA A;  3HBZ A;  5FLH A;  3UK9 A;  4M01 A;  1SMV A;  1VMH A;  2QQM A;  3UGF A;  1STM A;  3USU B;  3BI3 A;  3HWJ A;  3NNJ A;  1G9A A;  3IDA A;  5LW9 A;  2CGP A;  4AI0 A;  3TRS B;  1QKQ A;  4OHX A;  3AM2 A;  2J1S A;  4KWL A;  3ECQ A;  1ZRC A;  1O7F A;  2YFZ A;  3W59 A;  1MS8 A;  1YFU A;  2VOT A;  3CJI C;  5H9Q A;  1RUD 2;  5I0U A;  3S30 A;  2QNK A;  2VMI A;  3AMM A;  2XJR A;  1CD3 G;  1NOV A;  1ALY A;  3Q8A A;  4UW5 A;  4AF9 A;  2E32 A;  4AFB A;  2HJI A;  5AC9 1;  2H6B A;  1RIR A;  4RL7 A;  5BXX A;  3PJY A;  1EYB A;  1Q3E A;  4L92 A;  4XUP A;  4MG2 A;  3LFM A;  3NWK A;  3PJQ A;  4M3C A;  2RR1 1;  5DUX A;  5BNP A;  3ZR5 A;  1OLR A;  3IDB B;  1UOB A;  4HET A;  4PQ9 A;  4Q4V 3;  1CAX B;  1QNY A;  2XPJ A;  3RVH A;  4QGN A;  5BV6 A;  5J96 B;  3OEA A;  1S2K A;  1VBB 2;  2HBU A;  3GCX A;  4HG6 B;  1BEV 3;  4GZ9 A;  3MIH A;  1I9R A;  1KDM A;  1T2X A;  3AC0 A;  1ZBE 1;  1C5I A;  2IXC A;  1NY7 2;  2VBD A;  4WVM A;  4NO4 A;  3CF6 E;  1C5H A;  2CWM A;  2JDP A;  5FUP A;  3K4D A;  2VNO A;  2VMC A;  3KHC A;  1DHK B;  5I0R A;  2VZT A;  1RUE 2;  2VMH A;  4PBO A;  4RSU A;  4D6S A;  2YV8 A;  2P6H A;  3RG0 A;  1AL0 G;  1N3O A;  3D4K A;  4YGC A;  3RZK A;  1SLL A;  4IE7 A;  1W28 A;  3ZX7 A;  2B7Y A;  4DZG A;  1C57 A;  1V00 A;  1RVF 1;  1S0G A;  2D3P A;  1JU3 A;  3HAG A;  5AC9 3;  4MHR A;  5F6K A;  4HKW A;  1QOO A;  1EPZ A;  3ETP A;  4HMZ A;  1ENS A;  1HB4 A;  2KXL A;  3VKO A;  5KXC A;  1WLW A;  4AGV A;  2EAA A;  4NWW A;  4Y20 B;  4ASK A;  3BN6 A;  1NKG A;  5LY2 A;  1VP6 A;  2LRP A;  4YFZ A;  4H7L A;  2VMG A;  1PX3 A;  2FHR A;  1Q5O A;  2GN3 A;  2PHU A;  5IVB A;  4QKB A;  3ZSM A;  1TQ5 A;  3NAP A;  5CB7 A;  5JOZ A;  1ODM A;  4UW3 A;  3H3Z A;  3ZPO A;  1HIX A;  1ODN A;  2JIC A;  3I7D A;  4Q4X 2;  1K42 A;  1OHF A;  1C8M 1;  2JB4 A;  4AFD A;  3LDR A;  5BNQ A;  1VBE 1;  2EXK A;  1JZ7 A;  3TBD A;  1UU6 A;  4MX3 A;  4XAE A;  3N7J A;  1JZ5 A;  1H0B A;  2QQO A;  5FBJ A;  1G8W A;  2BTV C;  2H0B A;  3ELN A;  1MEC 1;  3E1F 1;  4QB1 A;  1F35 A;  2EXH A;  2R0H A;  1QOS A;  2EIE A;  4LO7 A;  3M1H A;  2ZAH A;  5C3P A;  3W9A A;  4ZZ5 A;  3III A;  4XUO A;  5CAD A;  2IFR A;  2XJQ A;  3AP5 A;  1F9K A;  3J7H A;  1ENX A;  1IGO A;  2XLG A;  4WM7 C;  5IK7 A;  2RS5 1;  1WME A;  2Y60 A;  1RVF 3;  4W6X A;  4QQ2 A;  3GM8 A;  1W9Y A;  4CCN A;  2YC0 A;  3J7L A;  4XCA A;  3I4I A;  2R6Q A;  2SBA A;  4R52 A;  2ZX2 A;  2VOV A;  4KWJ A;  3KMH A;  2KD7 A;  5DAV A;  5L7O C;  4O9G A;  3LE0 A;  2HEY F;  2LW8 A;  4MOA A;  5F3E A;  4OYU A;  5GLV A;  3CZJ A;  4GQ7 A;  3E6C C;  3I2F A;  3Q8E A;  4CDW C;  5KHG A;  1H9W A;  1DDL A;  1C8M 3;  2ZKL A;  5FRA A;  3ZKU A;  1QJU 2;  3NJY A;  5LEJ A;  1VBE 3;  4MUV A;  4A3X A;  5FYZ A;  2E9Q A;  3D0S A;  1Q8S A;  2ZMK A;  3ST7 A;  2RS1 2;  4ES9 A;  5D2A A;  2BPA 2;  4R9B A;  3AYA A;  1VAV A;  3OY8 A;  1NCR B;  4Y1Z A;  1MEC 3;  2CYF A;  1RUH 2;  2Y0O A;  2ZTN A;  3I3E A;  2PHD A;  3IAQ A;  5JIU A;  2O0O A;  5FO7 B;  4OVE A;  1SFN A;  3A21 A;  1AR7 1;  5FZC A;  4LR4 A;  4UF0 A;  4Q5O A;  3T08 A;  5FZ8 A;  3WXP A;  2QDN A;  3GXU A;  2RS5 3;  2V4V A;  4P5H A;  5D8A C;  1E5S A;  5ABJ A;  4QXH A;  4YPJ A;  1O3T A;  1UY0 A;  1LJ7 A;  2G4I A;  5IYY A;  4ORF A;  4P14 A;  5JSP A;  1SHW B;  4MLO A;  3S7E A;  2YC4 A;  4XTP A;  1LNS A;  2B9V A;  4Q4Y 1;  4I01 A;  4JHZ A;  4ES8 A;  1RB8 G;  1ZNP A;  2HBT A;  5FMO S;  1H2N A;  2A6W A;  1JOJ A;  5IFT A;  4RGA A;  2Q4S A;  5FY9 A;  2ZGM A;  3RZH A;  1U5X A;  1A8M A;  5F8P A;  3FN9 A;  2PAE A;  3VBH C;  3WCS A;  4CEW A;  1N3P A;  1MVE A;  4BQY A;  4QPG C;  4HT1 T;  4IES A;  4P02 B;  1AX1 A;  3WUC A;  3MGU A;  2Y33 A;  4RYD A;  4YW6 A;  1KEX A;  3DN7 A;  1PK6 C;  1U5Z A;  1VBC 2;  2JEN A;  3VZJ A;  5EV7 A;  3S0M A;  5FXZ A;  2WA4 A;  1CVN A;  5T54 A;  2E33 A;  4GJZ A;  3LOB A;  3CO2 A;  4A42 A;  1MR5 A;  3W21 A;  1CIY A;  1AR7 3;  2JKB A;  3CU7 A;  5IVY A;  3WEZ A;  5CFC B;  3VV1 A;  3LIH A;  3R4S A;  1KJR A;  3WDU A;  2D6N A;  5FZA A;  2A6X A;  4FPE A;  4QPI B;  1O5U A;  2QQV A;  1KFX L;  1Z78 A;  2PLV 1;  4NHK A;  1U0A A;  1XSQ A;  1NCQ B;  4H3W A;  1JOD A;  1OD5 A;  4UFM A;  2VUJ A;  2UY8 A;  2W1S A;  1LTE A;  4AFC A;  2CTV A;  2QQW A;  2Q8D A;  3ZYP A;  1CON A;  1GOH A;  3HMY A;  1AYN 1;  2MEV 1;  2CY6 A;  4QXC A;  1QDO A;  3D8C A;  3I3Q A;  2Y34 A;  4BU2 A;  2GC2 A;  5EFU A;  5FOJ B;  1QH6 A;  1CIW A;  1GZ9 A;  1O5L A;  4LBJ A;  3RSJ A;  4PLN A;  1F5F A;  2FDF A;  1XU2 A;  3PHM A;  4OI0 A;  2XKO A;  4Y4R A;  5HV0 A;  1CWP A;  4KBB A;  4A7K A;  1O3R A;  4Z8B A;  2G9G A;  1VB4 A;  5HV4 A;  1A6C A;  4U36 A;  3VD3 A;  1RGS A;  4ASM B;  5CG9 A;  1GR3 A;  5KHI A;  2A6Z A;  1DFQ A;  4HL0 A;  4ZU7 A;  1OVP A;  3ZYB A;  1J59 A;  2YGL A;  4HK8 A;  1UMZ A;  4FOW A;  2VE1 A;  1RUC 1;  3ZSE A;  1JZ3 A;  3RZG A;  2PLV 3;  2PHX A;  2WKK A;  3VBU B;  3ZR6 A;  4B7E A;  4XIO A;  2D5H A;  3JCI A;  2Z5W A;  3MID A;  1BEV 2;  2R04 3;  1DGL A;  3MYX A;  4Y1U A;  4B1L A;  1PGW 1;  1UN1 A;  1J83 A;  5A3N A;  1J3R A;  3K3O A;  3K4A A;  3OB8 A;  1GNH A;  3UT0 A;  5LAT A;  4DUW A;  4AQT A;  1AYN 3;  2MEV 3;  1LES A;  2ERF A;  2P17 A;  5A3O A;  1I5P A;  2CV6 A;  2ZHM A;  2J1U A;  4DQA A;  3HN3 A;  1Y7B A;  3VBO A;  2YPJ A;  3ZYI B;  1CAV B;  1MQT C;  4QX3 A;  1R1Z A;  2VOW A;  5T5O A;  2SLI A;  1MS0 A;  1NLR A;  4RA0 A;  3WSO A;  1M06 G;  5EPA A;  4NPM A;  3WF0 A;  4P9G A;  5IAX A;  2PA7 A;  4GAZ A;  5AC9 2;  5BYN A;  3L2H A;  5F3G A;  4S2G A;  3CKH A;  5L36 A;  3WDY A;  2ZA9 A;  4R9C A;  5J48 A;  2VVE A;  2EIC A;  3PME A;  2V72 A;  1UXX X;  3POS A;  3WNO A;  5HI0 A;  2PHF A;  4A45 A;  2RR1 2;  2DCY A;  4GIQ A;  5FY5 A;  4XF9 A;  1RUC 3;  3SXW A;  3S5Q A;  4XDQ A;  3B9C A;  2ES3 A;  4XJW A;  5J37 A;  2IUW A;  1F8V A;  2O8O A;  1W0O A;  4E27 A;  1VAM A;  3VBF A;  1VE0 A;  4XBQ A;  1LOB A;  4AED A;  4CSW A;  4FBF A;  1ZBE 2;  4GUL A;  2J7M A;  2XBO 1;  2JX9 A;  3I8T A;  1NQJ A;  5JVV A;  5GLU A;  4QPW A;  4BLJ A;  2VL4 A;  2XLA A;  1OLM E;  4N53 A;  4Y4Y A;  3S57 A;  4NRP A;  4Y1V A;  3KLS A;  2Y6G A;  4PDW B;  3NV3 A;  4UOJ A;  1VBD 1;  4RS5 A;  5A7W A;  4DPN A;  5JZG C;  2F17 A;  4KQ7 A;  3BIW E;  1X8E A;  2VZP A;  3HT1 A;  4AAX A;  3ZFG A;  1DIW A;  3AFK A;  2QQN A;  1RVF 2;  4D6Q A;  3FHA A;  5GLZ A;  1AZD A;  1SCR A;  1PX4 A;  5JSR A;  2C9A A;  4N9H A;  4K21 A;  1AR6 1;  1XYO A;  2YDE A;  3MW2 A;  1US2 A;  2NLR A;  3MIG A;  3UKV A;  4XQW A;  1IG0 A;  4CP1 A;  1XND A;  1GQH A;  1O8P A;  1UIK A;  1PGS A;  4KNC A;  3RGB A;  1ULP A;  1W8N A;  4OCT A;  4V2V A;  5M0T A;  1LR5 A;  3AMH A;  5C8C C;  1SLT A;  2ZX1 A;  1JYN A;  1C8M 2;  5ERL A;  3MPP G;  5IK4 A;  1UYY A;  1VBE 2;  3C7E A;  4GMP 1;  2XBO 3;  1BKZ A;  3HIF A;  4Y22 A;  2BVV A;  1UX7 A;  2ZAA A;  3KGL A;  1URX A;  3WQ1 A;  4MVT A;  3H3L A;  1MEC 2;  4CDX C;  1K5M B;  2ZX0 A;  4KGQ A;  5B2G B;  2YBK A;  3WZ1 A;  5A32 B;  3OGR A;  3B01 A;  3KT4 A;  4FCA A;  3MI8 A;  1G9B A;  4KG0 A;  1T6G C;  3GBG A;  2E26 A;  2PQQ A;  2WYF A;  3O0W A;  1N1S A;  1W2T A;  3WNM A;  5F3C A;  2ARB A;  2BER A;  3OEB A;  3CJI B;  3S6P A;  2RS5 2;  1UO9 A;  2DTW A;  2WQ4 A;  1X82 A;  1D0H A;  2JDN A;  3MV0 1;  4H55 A;  1KFU L;  1GV9 A;  2ETE A;  3WLU A;  2PMW B;  4LJH A;  2Q5T A;  2VCC A;  1CZT A;  3E5X A;  5J1X A;  1AR6 3;  2BGP A;  4QXK A;  4QX2 A;  5A1F A;  5DMY A;  4YG0 A;  1S0I A;  2LUW A;  4AVV A;  2WO1 A;  4YVS B;  4IV3 A;  5FPA A;  3VL8 A;  3C2U A;  1NE4 A;  4QX5 A;  5I8S A;  4COV A;  3LA2 A;  5F37 A;  2Y38 A;  1QJE A;  2WNV B;  4XEZ A;  1BXH A;  2R32 A;  2BNM A;  5A3M A;  1F4A A;  4AI8 A;  3IKW A;  2D6L X;  3VBR C;  1UAI A;  3AP6 A;  3CEW A;  1LOC A;  1WBL A;  3VZM A;  5IVJ A;  3DPR C;  4IGP A;  1ZYB A;  3IZO A;  4OLL A;  4CA9 A;  5IVV A;  4HSL A;  4GMP 3;  3NMB A;  2VVF A;  2XR4 A;  3POW A;  4Y24 A;  5IVE A;  5J3U A;  5HCF A;  2W1U A;  4PI2 A;  1WCS A;  1DYK A;  2YFU A;  3NNM A;  4Q0S A;  4AQ6 A;  1WKY A;  1Y9G A;  1BCX A;  4G9S B;  2BFU L;  1DZQ A;  1AR7 2;  1WCD J;  4QQO A;  3ZYF A;  1IS6 A;  4BXS V;  4KI5 M;  4DO0 A;  1JYW A;  1DU3 D;  3ACF A;  4BQX A;  5JAX A;  2CWS A;  2ARC A;  1WD3 A;  1KS5 A;  1TEI A;  2GP3 A;  3BIE A;  2D3S A;  5A6X A;  3K4Z A;  2MHF A;  3NVC A;  2QQL A;  3UKN A;  4CP0 A;  3MDP A;  5I93 A;  2UWB A;  2DFB A;  3AMN A;  4D69 A;  2VUD A;  4Y26 A;  4BQ3 A;  4Z92 B;  2FD8 A;  3AKS A;  2DBI A;  4Q4Y 2;  5J98 B;  3O1V A;  5CA6 A;  4I3P A;  2B45 X;  3I2K A;  1EPW A;  4FVV A;  1N47 A;  2OUH A;  4IE4 A;  1QMJ A;  4ITC A;  2EVX A;  4MXV A;  3IPV B;  3SKV A;  4B4P A;  2EAL A;  1RHI 1;  1VIW B;  1H1M A;  3E5Q A;  3POF A;  4P9X A;  4P08 A;  3POY A;  5DAQ A;  4AI1 A;  3JD7 1;  4ZHN A;  1UL9 A;  2DV9 A;  1JI6 A;  1V6K A;  4YW1 A;  4KL1 A;  3KQ4 B;  4UAP A;  5CIR A;  4ZU5 A;  3T2T A;  4XMI A;  5GAL A;  2JG8 A;  1E57 A;  5GKA C;  4CU6 A;  1VB2 A;  1I1E A;  1H6Y A;  1QJX 1;  2E7A A;  1UYP A;  1GWM A;  1MAC A;  1ULE A;  4ZY9 A;  4A6O A;  1OLQ A;  2XKP A;  2JWP A;  2DBN A;  4A6S A;  3VUO A;  2GME A;  3PUS A;  2JKX A;  4JGY C;  1N1T A;  1WCQ A;  2W5F A;  4BK5 A;  4WZC A;  1LHW A;  2PLV 2;  4C1W A;  1OA3 A;  4UFJ A;  4XUT A;  3UGG A;  3VKL A;  2BWA A;  4NHX A;  3I2O A;  4YG6 A;  5FR3 A;  2QQJ A;  3MPB A;  3L2Y A;  2BUK A;  1VAL A;  2X5I A;  3TN9 1;  2YB7 A;  5L7O B;  4LQR A;  1A34 A;  1BQP A;  1MPX A;  4BB3 A;  2DUO A;  1NCR C;  1AYN 2;  2E51 A;  2MEV 2;  5C33 A;  1RHI 3;  3OGG A;  4XF3 A;  5IVF A;  1W8O A;  5FDB A;  2YG0 A;  4CDW B;  3LPF A;  2OZJ A;  2VW1 A;  3H8O A;  3O7O A;  3AL5 A;  1YLL A;  1YUD A;  3ZDS A;  3OYW A;  1QY4 A;  1X9P A;  4NHY A;  4DY5 A;  1H8T B;  3OGS A;  1ACC A;  3PVN A;  3LEG A;  2WNU A;  4LHS A;  1GBG A;  2IC1 A;  1QJX 3;  1LGB A;  3Q9O A;  4XJZ A;  1SBF A;  1DQ0 A;  4ZON A;  3WQ0 A;  1W6Q B;  2PQS A;  3K46 A;  2OS2 A;  2WRA A;  1MZF A;  1XNK A;  2OKX A;  5CIS A;  5D8A B;  1RUC 2;  3TB0 A;  5IFP A;  5JUV A;  4E4S A;  2VZ3 A;  3WNL A;  1AR8 1;  3OBT A;  3ZMN A;  4LBM A;  2CNA A;  2MNG A;  1J1T A;  4YM3 A;  4DFS A;  3R4D B;  1PGW 2;  3TN9 3;  3ZN5 A;  2PAK A;  4JQT A;  3SHR A;  4B1M A;  2YBP A;  1C28 A;  2FMD A;  3VD5 A;  2PEL A;  1GKB A;  2ZAB A;  2ARE A;  3LSE A;  5JPM B;  3T30 A;  4FQZ A;  4BQ4 A;  3A7Q A;  4PF5 A;  3TEW A;  4QPG B;  1IHM A;  5L9V A;  2WSU A;  1J3Q A;  1W8Z A;  1JYT A;  2WO7 A;  1XSR A;  3AYC A;  2WN3 A;  2CL2 A;  1OUX A;  1SPP A;  2WWJ A;  1PK6 B;  3WG2 A;  3AZW A;  3E6B A;  3G7D A;  4MET A;  4CZS A;  2W46 A;  1LAJ A;  1POQ A;  1DGW A;  3N7M A;  3ALQ A;  2LM3 A;  3CHX A;  3M8L A;  2AEY A;  3H7J A;  1UXZ A;  1OKO A;  4CTE A;  2E63 A;  4XE9 A;  1C1L A;  4OHW A;  1OFS A;  4JGZ B;  4LT5 A;  4XIK A;  1O6U A;  3MBW A;  4Y5Z 0;  5FQ0 A;  4OZO A;  1RXG A;  3N9O A;  3DYM A;  1W6M A;  1GP6 A;  3DL3 A;  4LBQ A;  5K7P A;  3ZFE A;  3O1O A;  1ENR A;  1CN1 A;  1AR8 3;  2BRT A;  1JZ4 A;  1ND2 B;  2P2K A;  1PVC 1;  3AKR A;  4TLF A;  5F32 A;  4ZU4 A;  2JEM A;  1ZRF A;  4YW2 A;  4YW7 A;  3T09 A;  2MPF A;  3KF3 A;  1F5J A;  3WQ7 A;  2XBO 2;  3VHR A;  4DIN B;  1RYY A;  2JG9 B;  3KVB A;  3OD4 A;  4QHO A;  4AHX A;  4JTN A;  2VJX A;  1HV1 A;  4UWD A;  4Z82 A;  5IW0 A;  5FFO C;  2O1Q A;  3CNA A;  2OVU A;  3DUI A;  4XZP A;  1KRI A;  3ORJ A;  1VBD 2;  4GH4 A;  2UY9 A;  4K8R B;  2OII A;  3FL7 A;  1NYW A;  1Q8O A;  3JUU A;  2R07 1;  2GU9 A;  5H9S A;  1YIF A;  2OPK A;  3KV4 A;  5K8S A;  3AX4 A;  1AUY A;  4LMF A;  3FE5 A;  5EYY A;  3VBH A;  3VDA A;  3OUI A;  3ZXL A;  4NR1 A;  3CQO A;  3WP4 A;  1N3Q A;  1DF0 A;  1AR6 2;  4AG4 A;  4CDQ A;  2BU9 A;  4IEO A;  5LA9 A;  2QDR A;  2DVA A;  1O4T A;  4LBQ D;  4H14 A;  3WOG A;  1OPM A;  3GGL A;  4O9E A;  4XTM A;  4FTB A;  1NAE A;  5FZ3 A;  5A7Q A;  1BLZ A;  3WG1 A;  1CAW B;  1PVC 3;  2P1B A;  2WAA A;  5DAW A;  5T5J A;  1O3Q A;  3U0Z A;  1NA1 A;  5DG2 A;  4FP2 A;  4IEP A;  2VMD A;  4Q29 A;  1FAY A;  3UL2 A;  1MZE A;  3ITQ A;  1HRV 1;  1POV 1;  5LRR A;  5E16 A;  2JB8 A;  4S2D A;  3U11 A;  3K48 A;  5JOX A;  5K9Y A;  1LEN A;  1PMI A;  2VO5 A;  3NO8 A;  3NW4 A;  3VLB B;  5KC6 A;  1QHD A;  1Y9Q A;  2R07 3;  4L2N A;  3Q8B A;  1BVV A;  1KJL A;  1RUJ 1;  1W9T A;  3P6B A;  3M3C A;  3POJ A;  3JBG 3;  1XE8 A;  4J1X A;  1I3H A;  1FOD 1;  5FZ4 A;  1HQN A;  4AK3 A;  4LIU A;  2AZ5 A;  4HPK A;  2GH8 A;  2W08 A;  3HQX A;  2ZGK A;  3J7M A;  1OUR A;  1HXS 1;  4LKF A;  3ZYG A;  4J1W A;  4AL9 A;  3V65 A;  4G4F A;  1IPJ A;  2K2S A;  4UBG A;  3ZO0 B;  1A8D A;  4XF4 A;  4X8P A;  3MLL A;  4BZ4 A;  3GAL A;  3FZ3 A;  1JXN A;  4XCB A;  5J7M A;  1VLN A;  4PDW C;  3WDV A;  5G04 L;  3IN9 A;  2J1V A;  4YW4 A;  2C6S A;  2PYT A;  1W6O B;  1O8S A;  2YC2 A;  2XHN A;  1HRV 3;  1POV 3;  4PI0 A;  1DZR A;  3RWK X;  1BJQ A;  2XG3 A;  1QIQ A;  3PNA A;  4DB5 A;  3BU7 A;  3DXU A;  2RJL A;  4WM8 B;  4AEJ A;  1YI7 A;  4XOG A;  5HCH A;  2ZAC A;  1LU2 A;  5JZG B;  3SH4 A;  2ZBJ A;  2YYO A;  1SBE A;  1RUJ 3;  4MGS A;  1DQ6 A;  5BNN A;  4I09 A;  3PMS A;  1FOD 3;  5FLI A;  3UKT A;  4Q4V 1;  3P5B A;  1X33 A;  2VQT A;  2WR9 A;  4COU A;  3RPQ A;  1DLL A;  3I3M A;  4JX0 A;  1HXS 3;  4LOS A;  1WWY A;  3BOD A;  4H2A A;  5A3P A;  4QX8 A;  1AJO A;  1MQT A;  4IQP A;  4JDO A;  1HRI 1;  4BJ0 A;  4YFW A;  1DQ5 A;  1RC6 A;  5CFD A;  4HN1 A;  1F15 A;  1K5M C;  1RHI 2;  4ZS2 A;  1WD4 A;  5FYB A;  3WDW A;  5C8C B;  1G9F A;  3K77 A;  1ZRI A;  2GSY A;  2A71 A;  4FPH A;  2AH2 A;  2G1M A;  3JD7 2;  5IHR A;  1LOF A;  3PVE A;  4IEY A;  2PN5 A;  5F2S A;  3OPZ A;  1WW5 A;  4R4Z A;  4CDX B;  4AHZ A;  2DVB A;  5HCB A;  4B3N A;  3AFG A;  3N7K A;  4Q27 A;  3ZLI A;  3V0B B;  1QJX 2;  5C4W C;  3DGT A;  4YVS C;  4QX1 A;  4HOO A;  2VR4 A;  3WIN E;  3C7H A;  1VMF A;  4CUG A;  4EZ4 A;  2WNV C;  2ZGS A;  2D6P A;  1BK0 A;  3THC A;  5F9T A;  3RZL A;  3MO4 A;  4C91 A;  4CCK A;  1CAU B;  3PUH A;  5FZF A;  3ZXK A;  5T55 A;  2NMO A;  1DQ1 A;  2EIG A;  3K75 B;  3CMG A;  2GMP A;  3TN9 2;  5E8A A;  3HQU A;  3NAP B;  1HRI 3;  3I2J A;  3VKF C;  3WF4 A;  3I59 B;  2XHK A;  3UYJ A;  1PNF A;  4K3U A;  4JQR A;  5C7G A;  2PHT A;  3LA3 A;  3VBR B;  4AR2 A;  3PU3 A;  4KG8 A;  1GNY A;  2WT1 A;  4N7I A;  2W91 A;  2UWA A;  3DPR B;  2ZZJ A;  2Y0I A;  3N36 A;  4IV1 C;  1OOP C;  1SG3 A;  3U75 A;  5FMD A;  4JKL A;  1JN2 P;  1NXD 1;  4LKE A;  5FP8 A;  1C1F A;  3O1P A;  1TG7 A;  2B39 A;  2XJT A;  4BQ2 A;  3ABZ A;  2IXI A;  1JS9 A;  1OQE A;  3SC7 X;  1ONA A;  1RJ7 A;  3T4V A;  1A78 A;  2GND A;  4A7Y A;  2JE7 A;  4FOV A;  4NWV A;  2VMF A;  2LRO A;  4NIG A;  3FHI B;  3A4U A;  4RHV 1;  4YGD A;  2W3J A;  2JDY A;  1GP5 A;  1AR8 2;  1WLT A;  3BPS A;  1U12 A;  2HYK A;  3V0A B;  4P9J A;  2WZ8 A;  4QKD A;  4QX0 A;  5A80 A;  4FQ4 A;  1G6N A;  3B00 A;  3AP7 A;  3WW1 A;  3LF7 A;  3VDB A;  2RJK A;  2X53 S;  1VR3 A;  2XJU A;  1YQC A;  3LPG A;  3MEP A;  2Y26 A;  2WS9 1;  2J1R A;  2WNO A;  4ZZ8 A;  5EQU A;  2DVG A;  4E2Q A;  4URA A;  1S4C A;  4QDS A;  4BM8 A;  3P3P A;  2JDZ A;  1S0D A;  1S0E A;  1Q56 A;  1Z7S 1;  2IWG B;  1KXG A;  1LED A;  2VXR A;  3BTZ A;  4NAM A;  5JI7 A;  2DCT A;  4CUC A;  5DAB A;  4XFI A;  3FUO A;  4XAB A;  2VNR A;  4FI9 A;  4EYU A;  3MV1 1;  1GIC A;  4JDM A;  2IXJ A;  2ENR A;  2WJS A;  5ABJ B;  2Y8K A;  4LEJ A;  2Z2S B;  4YVW C;  1UNB A;  1UZV A;  1D0G A;  2ORX A;  2XVL A;  3AXE A;  5E88 A;  5C3R A;  1ZRE A;  3MW4 A;  4JGY B;  4RHV 3;  2BEO A;  2WSV A;  1QXJ A;  4UFI A;  5IT6 A;  5IAT A;  1XNB A;  4ARX A;  4HFS A;  1PVC 2;  1UF2 C;  2IXH A;  2OPW A;  3BYW A;  4NJ4 A;  4ATE A;  3UGH A;  3AKQ A;  3EJK A;  4M4R A;  4ARY A;  5A7N A;  2ZGO A;  4K20 A;  3RYR A;  2P34 A;  4Y20 A;  4FPF A;  5F3I A;  2QQK A;  4Q0Q A;  1M4W A;  1YNA A;  5C3S A;  1H8T C;  5JXJ A;  3TEX A;  3N9P A;  2WS9 3;  4NUB A;  4TWT A;  3W5M A;  4XDO A;  2F6B A;  2HH9 A;  3ZXG A;  5LY1 A;  3KF5 A;  4QU2 A;  2R07 2;  1Z7S 3;  5KBF A;  1IZ3 A;  5BY5 A;  5FRE A;  2EIB A;  4PIZ A;  1RMU 1;  4I02 A;  5KHJ A;  1X50 A;  3SCH A;  5FYM A;  4CU9 A;  1MZ5 A;  2XJV A;  4JTO A;  5CBL A;  4CCO A;  1D2Q A;  2ADE A;  2VC9 A;  4FOQ A;  4OQ8 A;  1YO8 A;  4FSJ A;  3M4F A;  4M3C E;  1H2M A;  1W9S A;  3UES A;  1W90 A;  4Y3O A;  1GP4 A;  5CG8 A;  1D2S A;  4XFC A;  4NRO A;  1EAH 1;  1H4G A;  1ULO A;  2OW4 A;  1CPM A;  1W6P B;  2XON A;  3WW3 A;  2IXK A;  4XAA A;  5FYC A;  1DZT A;  3A0K A;  2C26 A;  1DQ2 A;  3M2M A;  4BA6 A;  4XJ9 A;  4D94 A;  2BFU S;  2W39 A;  3ILR A;  1FI2 A;  5JI9 A;  1QEX A;  3VDD C;  1HRV 2;  3IDE A;  5E6H A;  3WF1 A;  4OHY A;  3T0A A;  1GMM A;  1H1A A;  1I6X A;  4LUK A;  1W6N B;  4EN9 B;  1XNT A;  4Q2F A;  1B35 C;  1ST8 A;  2R49 A;  3HR9 A;  1FT9 A;  1ASJ 1;  2D7F A;  2K46 A;  2OQ7 A;  4MXW A;  3SIT A;  5JXH A;  2WYS A;  5K4L A;  4GWN A;  4JGZ C;  1LHN A;  2DCJ A;  1FNY A;  5FP3 A;  2ILM A;  2JDU A;  1RUJ 2;  1AL2 1;  3KWV A;  4HAN A;  1JBC A;  1OLM A;  1RMU 3;  4S2F A;  1FOD 2;  4XJ8 A;  4AGG A;  2ZEX A;  1NCR A;  1R09 1;  1V6J A;  1ND2 C;  1RIT A;  2XWJ B;  3QAC A;  4GB3 1;  1UIJ A;  5FP7 A;  1MS5 A;  1HXS 2;  3AZX A;  3I2G A;  2R04 1;  4J6G A;  3U37 A;  2XVK A;  4JCK A;  3WW4 A;  2C5D A;  2JG9 C;  5LEK A;  1EAH 3;  4CRQ A;  3UV9 A;  3ZM8 A;  4CDU C;  2R06 1;  3AKP A;  5FBZ A;  3VD7 A;  5KR7 A;  1YIP A;  1WW4 A;  1MVQ A;  1XC6 A;  1QQP 1;  3ILN A;  4PJY A;  4AVS A;  5T5L A;  5FY4 A;  3T1L A;  4BIF A;  1UOJ A;  3KV9 A;  5JMC A;  1RUI 1;  3RZJ A;  1ND3 C;  3OPW A;  2WQZ C;  5L9B A;  2XUM A;  1HJF A;  2XJP A;  4CEY B;  2Y6J A;  4D7Y A;  5JOY A;  1ZRR A;  1WUV A;  1ZZ7 A;  4HKO A;  4NN0 A;  1ASJ 3;  2VCM A;  2VZV A;  4C1X A;  1XQN A;  3TNQ A;  3AB0 A;  3RYP A;  2A7A A;  2P37 A;  2ID4 A;  2E6V A;  3ZFF C;  1AL2 3;  4CUB A;  1XNA A;  4Q4V 2;  1GQG A;  4HXC A;  5F2W A;  2FDI A;  2JIJ A;  2WT2 A;  1R09 3;  1NE6 A;  4GB3 3;  1SCS A;  1JU4 A;  4LIT A;  3IB3 A;  3ZDV A;  2ZEW A;  1N1Y A;  2WIN B;  3HNM A;  3VZK A;  1Q8P A;  4BPZ A;  1OXC A;  2XL7 A;  4XXP A;  5CFC A;  1UU4 A;  1HRI 2;  5B4N A;  2R06 3;  2VXJ A;  4FXK B;  4KGG A;  4B7K A;  3FWE A;  3F95 A;  4QPI A;  4Y1Y A;  4LOT A;  4JKK A;  4IL7 A;  1QQP 3;  3U07 A;  3WCR A;  1NCQ A;  3GCW A;  1RUI 3;  4QPY A;  1UKG A;  1K5J A;  5EJZ B;  5C5U A;  1NQD A;  3MUZ 1;  5FP4 A;  4D6R A;  3U78 A;  1W2O A;  4JKM A;  3UNP A;  3EXU A;  5A7W B;  4DY3 A;  1YQ8 A;  1RXF A;  3ZN4 A;  2XH6 A;  1KIT A;  3NNF A;  1BMV 1;  5EJ1 B;  1LKN A;  3B93 A;  2ZX4 A;  5K0U A;  1PO1 1;  2HEW F;  2J1E A;  3VD4 A;  3KV5 A;  2E53 A;  3CJX A;  4DUV A;  2Y6H A;  3BU0 A;  1XOY A;  1SZB A;  3KT1 A;  1HB3 A;  1RUN A;  1X9T A;  1LU1 A;  1TME 1;  5EXO A;  3URF A;  3WNN A;  4QT6 A;  5I8T A;  5LK5 A;  4QQH A;  5C9A B;  4HZF A;  1UCX A;  2B9U A;  4BQ1 A;  3J4U H;  3E97 A;  1IG3 A;  4WM8 C;  4WVW A;  3N35 A;  1MS9 A;  1UKR A;  2WFF 1;  4EN8 B;  1FMD 1;  3JQX A;  1DLC A;  1W99 A;  1YQ6 A;  3VBU A;  3WDT A;  2WT0 A;  1DYP A;  5D1I A;  3GHM A;  4L0P A;  2RDR A;  5LWB A;  4XFF A;  3JB4 C;  1CZS A;  2VAU A;  5BNO B;  1MS4 A;  2NMN A;  4N43 B;  3O0X A;  1LRH A;  4LE3 A;  1X8M A;  4WVZ A;  3VHO A;  5BNP C;  1EY2 A;  2ET1 A;  4OI1 A;  1CAV A;  1QJZ A;  1PO1 3;  3QBQ A;  1XJA A;  5GJ6 A;  3ZN6 B;  4FAG A;  3O1T A;  1ZA4 A;  5F1R A;  2P3Y A;  2RMU 1;  2V5D A;  2ZGR A;  5DXD A;  3P3N A;  1WGP A;  4RHV 2;  1CX4 A;  2HWF 1;  2OZ6 A;  3T3Y A;  3OG2 A;  4AQS A;  4MH0 E;  3H8X A;  4YM2 A;  3D3A A;  4LBN A;  2RM2 1;  2VNG A;  3E5U A;  3OUH A;  1OQD A;  2QBX A;  1NLQ A;  1VRB A;  1YEW A;  2NQY A;  4RQP A;  1TME 3;  1F2N A;  2ZEZ A;  4YSF A;  1AR9 1;  1ZZ6 A;  3M3Q A;  2GN7 A;  2PTM A;  5JR2 A;  1FXZ A;  1KGY A;  2DTY A;  2D3R A;  2RHP A;  1SEF A;  2ZHK A;  1K45 A;  3IAP A;  4BXF A;  1W0N A;  2WS9 2;  1JOP A;  5DPN A;  2WFF 3;  4D7T A;  2W52 A;  1FMD 3;  2YU1 A;  2WZR 1;  1ZX5 A;  4GAL A;  4O7X A;  5FXX A;  5A6Q A;  2X29 A;  3ZXF A;  1RUF 1;  2W0X A;  4NAO A;  1Z7S 2;  1HJG A;  1O59 A;  1KDK A;  4M00 A;  2DVD A;  5DQ0 A;  4QMA A;  3SNM A;  2P6C A;  1NG0 A;  3ZKY A;  1WMF A;  3RI9 A;  2VZU A;  1PNG A;  1HB1 A;  4Q1R A;  1JZ2 A;  2W1Q A;  4FPO B;  2I2S A;  2VEC A;  2FQP A;  5FP9 A;  5C4W B;  2CDO A;  4B29 A;  3NAP C;  3OOX A;  4M0H A;  4CPB D;  5HCA A;  2RMU 3;  4YM1 A;  5H9P A;  3FBM A;  4ZS3 A;  1OKQ A;  2BGO A;  2HWF 3;  3HOB A;  1OVS A;  4ONU A;  3VB9 A;  5JOW A;  2RV9 A;  3GDB A;  5LZ6 A;  2Y6F A;  1QWR A;  2RM2 3;  4NIH A;  4BCU A;  1N1V A;  3C7G A;  4RR3 B;  2A75 A;  4MHU A;  1AR9 3;  3CZU A;  4OI4 A;  5JXI A;  2A5Z A;  3PTY A;  5CU1 A;  1VRH 1;  1UY4 A;  4DXS A;  1S1A A;  5A3U A;  2WZR 3;  4QGL A;  1SFP A;  3OUJ A;  2X05 A;  4IV1 B;  3N9M A;  1OOP B;  1RUF 3;  2HLE A;  2Y64 A;  2YZ4 A;  4Q0V A;  2AGS A;  4W6Y A;  2L9L A;  1GSL A;  1UW8 A;  2ZEY A;  4MAD A;  1GWK A;  1RMU 2;  4IEX A;  1HN0 A;  1IKQ A;  4LUM A;  3OGJ A;  1K5M A;  2WWU A;  3WHU A;  1SDD B;  4Q8L A;  3EHK A;  5A32 A;  1W8W A;  5E1R A;  3NL1 A;  2ZGQ A;  4UI9 L;  4AI3 A;  1XU1 A;  4DNY A;  1EAH 2;  3CJI A;  3V64 A;  5I0D A;  2ZGL A;  5LB6 A;  3JQW A;  2JDM A;  3R6S A;  4BQ5 A;  2ZGU A;  3V56 A;  2VZS A;  5JMO A;  5FJK A;  4OFG A;  4PIY A;  1H1I A;  1COV 1;  2JDH A;  1JYX A;  1UZ0 A;  4TN7 A;  4GKX A;  4E8D A;  5FWE A;  4E8C A;  4IER A;  4C8D A;  4AE2 A;  4RGK A;  2VQU A;  4YVS A;  2OQ6 A;  3PIJ A;  4EN7 B;  3TNP B;  3M3O A;  4XFG A;  1VRH 3;  3QLQ A;  2Z69 A;  4QDQ A;  5A1L A;  2GAU A;  2VCA A;  4XVH A;  3C7F A;  1ASJ 2;  2J42 A;  1FPN 3;  4XHB A;  3KHB A;  3OYW B;  5ABJ C;  3HJR A;  4Y5S A;  3RFR A;  4C90 A;  1PHM A;  2VGD A;  2QJV A;  3M7A A;  2YGM A;  1AL2 2;  3R4U A;  2EXJ A;  5A6Z A;  4B8E A;  4CCD A;  2WNU B;  2HWD 1;  4NPL A;  4DMI A;  3BTX A;  2V5Y A;  5LA1 A;  1V6O A;  3OPT A;  1R09 2;  4GB3 2;  4FPJ A;  4EN6 B;  3KGZ A;  3LFI A;  1W8T A;  1JH5 A;  2GNB A;  2GC3 A;  1POV 0;  2R04 2;  1PMH X;  3JZV A;  4MZU A;  5DZE A;  1HB2 A;  2WZP P;  2ZJC A;  3NNG A;  4ASL A;  2BWC A;  1HQW A;  3MUY 1;  2LAL A;  1O4Z A;  4YVW B;  3ZSL A;  5AFB A;  2PXJ A;  2AAC A;  3ACH A;  5FK7 A;  3GZU C;  5AVA A;  3ZYR A;  1IQA A;  2R06 2;  3UJO A;  5FZO B;  2ZCW A;  1YFY A;  4YRD A;  4ISQ A;  1COV 3;  5I0T A;  3IT8 A;  2VQ0 A;  1QF3 A;  4AHY A;  2ATF A;  2ZML A;  1QQP 2;  3ZIW A;  2V73 A;  4R4X A;  3H42 B;  1EP0 A;  5KHH A;  1RUI 2;  2RDN A;  5H9R A;  4P9I A;  3KV6 A;  5KXD A;  4HSJ A;  4HON A;  4KU8 A;  4UW6 A;  2D44 A;  1SLB A;  2BP6 A;  3IPV A;  1Y4W A;  2XDV A;  2ZGN A;  2JDA A;  4OUS A;  3PIG A;  1D4M 1;  3RI8 A;  3TWI A;  1HW5 A;  1REF A;  1OD3 A;  2VD7 A;  1UMH A;  4FFH A;  4QQL A;  2A6V A;  2HWD 3;  3LKJ A;  1U5I A;  3WP5 A;  1W9W A;  5FO8 B;  4UXA A;  5FPZ A;  3GYD A;  3AZZ A;  1PM7 A;  3IMN A;  4QQP A;  3KS7 A;  4CCC A;  3ZMO A;  1GYK A;  1UZZ A;  2QCS B;  4E9K A;  2A3W A;  3ZFE B;  4BLI A;  5A6Y A;  3W5N A;  2FDH A;  2Q8O A;  5GZD A;  5G05 L;  4WM7 A;  2WA3 A;  2D93 A;  3BUC A;  3LB9 A;  3HEI A;  1V6L A;  4ISR A;  1J58 A;  3AYE A;  1UY2 A;  2CGO A;  3NKT A;  4HN0 A;  1DYO A;  4MSV A;  2VTX A;  4FPY A;  4Q1P A;  2AEZ A;  1AF9 A;  2UYA A;  3ON7 A;  4L97 A;  5FZE A;  1WA4 A;  1O91 A;  1AYM 1;  2GH2 A;  5FO9 B;  3I3D A;  5L7O A;  3VDD B;  3I3B A;  1Q8Q A;  1IS5 A;  4I0W B;  3SH5 A;  4AFM A;  5FZK A;  5C5T A;  1B35 B;  1UMI A;  2OT7 A;  3IDC B;  3J8F 1;  3N9N A;  1LGN A;  4IGQ A;  4A7Z A;  1BMV 2;  4YW5 A;  1D4M 3;  3JU9 A;  4CDW A;  5LRS A;  3T2O A;  4UBH A;  1PO1 2;  1W04 A;  2JE9 A;  2Q1M A;  4OUE A;  3SCG A;  3VZL A;  2RDS A;  3T2P A;  5KHK A;  1OF4 A;  3VZN A;  2VOX A;  4EWD A;  3O1S A;  2AUY A;  3GZT B;  1H8T A;  1WW7 A;  2E7T A;  2WNE A;  4QB6 A;  4AZZ A;  4AYU A;  4O61 A;  4EQV A;  3KZ4 C;  4HBN A;  5T3N A;  1L7Q A;  1E5I A;  1TME 2;  1MS1 A;  3FBY A;  3SCF A;  1W6Q A;  3RZM A;  5FPL A;  3VBO C;  4CEY C;  1OC1 A;  1V70 A;  5D8A A;  4CDU B;  1NA1 B;  4XUN A;  3EQE A;  1Q43 A;  4I3G A;  2WFF 2;  4ET7 A;  1FMD 2;  1LOA A;  2D5F A;  3H0O A;  3O5S A;  4XPV A;  3KQR A;  1AYM 3;  3WG4 A;  2HKX A;  1ND3 B;  3MF9 A;  3T2Q A;  4R9A A;  4E2S A;  3APB A;  3AYD A;  2D97 A;  4IET A;  3JBG 1;  2FBE A;  3POG A;  4CCL A;  5I91 A;  2BQP A;  1V0A A;  4FOY A;  2UWC A;  2CDP A;  4JVA A;  4QHZ A;  5FYI A;  3J8F 3;  5FY0 A;  5LBE A;  4DEV A;  5A33 B;  3VD9 A;  1QJY 1;  4LKS A;  2WO3 A;  1NX9 A;  4QPG A;  1H6X A;  3ENR A;  3VHP A;  5LA2 A;  4YGB A;  3ZFF B;  2WFP A;  2RMU 2;  1NZI A;  1PK6 A;  3O0V A;  3VBF C;  1J1L A;  3WNK A;  3ZXJ A;  1CZV A;  2HWF 2;  4AED C;  4F3J A;  2YHJ A;  1ZBA 1;  5DZF A;  2NZ9 A;  5FZG A;  4LUL A;  2J1A A;  2C1F A;  3T1M A;  2RM2 2;  4COY A;  5IK5 A;  4NOT A;  5F5I A;  5CYY A;  3UET A;  1FAT A;  5D21 A;  2O8Q A;  1AR9 2;  4N53 C;  4JGZ A;  4QHB A;  2F4L A;  5FZ7 A;  4P9W A;  4IUG A;  4CE8 A;  2EXI A;  1Y3T A;  1LCL A;  3T0B A;  2A1X A;  2BJS A;  2D6O X;  3BKZ A;  1HV0 A;  3D0J A;  2WZR 2;  2VU9 A;  5EYX A;  1C8N A;  1WBF A;  2Z4F A;  1W8H A;  2W1W A;  1GLH A;  3ZFG C;  2YXS A;  1RUF 2;  3WP6 A;  3NV4 A;  4DXZ A;  1FV2 A;  1S2B A;  1WCK A;  3QD6 A;  2VUA A;  4NHL A;  2IVJ A;  3FLP A;  2JG9 A;  3GNE A;  5GZG A;  3VBS B;  2BDR A;  3BVC A;  4MGI E;  2R0F A;  2WC2 A;  3AZY A;  1QJY 3;  4FPC A;  2HWE 1;  3AKT A;  4P9L A;  2VME A;  5FZ1 A;  1BZW A;  5FZ9 A;  1UYZ A;  5BNN B;  1VAK A;  3T4H B;  2RDQ A;  3LAG A;  5FY7 A;  5C9A C;  3MFC A;  3T0D A;  3BTA A;  3S7I A;  1H8V A;  1ZBA 3;  1YHF A;  2AR6 A;  4FT8 A;  5FPV A;  1ENQ A;  4CP9 B;  2J22 A;  2GNM A;  2DYC A;  1PZ9 A;  3EBR A;  5BUV A;  2TNF A;  4V2W A;  4CXW A;  2A70 A;  5T52 A;  5HBA A;  5CFD B;  2UU8 A;  3BTY A;  4LKD A;  2Q1Z B;  4GXL A;  2F4P A;  4YGE A;  5BNO C;  1V6I A;  3OJB A;  1VRH 2;  3AXD A;  3EMR A;  4N43 C;  2Q0A A;  1WMD A;  5KC5 A;  2OX0 A;  3ES1 A;  3N9L A;  4LTA A;  4YYO A;  3U10 A;  1EV1 1;  1CAW A;  3GBW A;  3GZA A;  1MS3 A;  4NRQ A;  1WW6 A;  1XNC A;  2QQI A;  4C0B A;  1AX0 A;  2VZR A;  3O1U A;  1PGL 1;  1QH7 A;  4TXW A;  3LWC A;  3MIE A;  3O12 A;  3B5L B;  1ZVF A;  1R08 1;  2ZHL A;  1GZW A;  1UZY A;  3QH6 A;  4M3C B;  3OGV A;  1ULG A;  1XBF A;  2HWE 3;  2RJ2 A;  3A22 A;  4IV3 C;  4Q26 A;  1W05 A;  5BNP B;  1AJK A;  1JUH A;  4YZ5 A;  5DAP A;  5LA0 A;  1TNF A;  4XXA A;  4AI2 A;  4WV8 A;  4IXL A;  3THT A;  3H1M A;  4BWO A;  1UU5 A;  3IMM A;  5C3O A;  1UPS A;  1ZRD A;  2VUC A;  3MIF A;  5C3Q A;  1COV 2;  5I0S A;  3RQ0 A;  4WVM B;  1FX5 A;  3U1X A;  4FAH A;  2HYX A;  2DUR A;  1O3S A;  3H1W A;  3ES4 A;  4DS0 A;  3HN1 A;  2XGX A;  1OI6 A;  4LK7 A;  4W8J A;  3THP A;  4QM8 A;  4LBL A;  3J7N A;  1EV1 3;  4AAP A;  5TSW A;  4AHW A;  4FFF A;  5FZM A;  4M3C F;  1UY1 A;  2NPI A;  1W6O A;  2XQR A;  3HT2 A;  2ET7 A;  2D6M A;  4FTE A;  2HWD 2;  4MGT A;  1UYX A;  4DIQ A;  1AX2 A;  1R08 3;  4IGO A;  1HDK A;  4WM8 A;  2D6K A;  4GWI A;  4RR3 C;  1DG6 A;  1W03 A;  1HLC A;  3SLI A;  5JZG A;  1V6N A;  4YG3 A;  5BPX A;  3OBZ A;  2JJ6 A;  4MO3 M;  4WVV A;  2GP5 A;  3MW3 A;  4AOC A;  3QOP A;  4UW4 A;  1XRU A;  3ASI A;  5EP9 A;  1DGR A;  5J09 A;  3ZXA C;  2EA7 A;  4AWD A;  1ULC A;  1IOA A;  3ZYH A;  3FJS A;  4K6B A;  4A2U A;  1PZ8 A;  3VHN A;  5EIY B;  1IPS A;  1LEM A;  4TTG A;  3WX5 A;  3WDX A;  1QJF A;  1PMJ X;  2GNT A;  3LOI A;  1AXK A;  2WII B;  3D82 A;  1YQ5 A;  1RTV A;  1YC6 1;  2JG8 C;  3B69 A;  3KB5 A;  3GJA A;  3LIG A;  4W6W A;  2P4E A;  1WMX A;  3SEE A;  3USU A;  4BMB A;  2VPV A;  4LHK A;  1HX6 A;  1OPO A;  5FMB A;  3ILF A;  2RS3 1;  2BVB A;  5C8C A;  4COW A;  2VBP A;  5KXB A;  1D4M 2;  1AXY A;  2D43 A;  1YYN A;  4N9I A;  1F31 A;  1IKP A;  2PHL A;  1WCU A;  1IS3 A;  1PIV 1;  5CEH A;  3O1M A;  3RMX A;  1LOD A;  1ULD A;  2VZ1 A;  3K51 A;  5EWS A;  5GZC A;  3ACG A;  5DAX A;  2DFC A;  5JDB A;  2X5I C;  4L9B A;  4CDX A;  1ZZ8 A;  1W0P A;  4IEV A;  4SLI A;  1FNZ A;  1W06 A;  1JW6 A;  4LPL A;  1UOG A;  3V0B A;  5CKQ A;  2WWS A;  2VW2 A;  4KU7 A;  3EO6 A;  2D40 A;  1SQ4 A;  2O14 A;  2ZS6 B;  4EN0 A;  4GA9 A;  1DQ4 A;  1CAX A;  4FPL A;  2YUE A;  3RWN A;  4YZ3 A;  1I5Z A;  4HLT A;  4XET A;  3TAY A;  3H9A A;  4QDR A;  2RR1 3;  2OUJ A;  4U2A A;  5FLJ A;  1CAU A;  3POB A;  4LBK A;  3OY8 B;  1AYM 2;  4XW3 A;  2A6Y A;  1YWK A;  1RUO A;  1S0J A;  2WNU C;  5DDJ 1;  1KS4 A;  3I59 A;  2K9Z A;  3RMY A;  2ZGT A;  4UF0 B;  3LDK A;  2RS3 3;  3MF6 A;  1HN1 A;  3J8F 2;  1ZBE 3;  2QZ2 A;  4KBZ A;  3VBR A;  1GOG A;  1DBN A;  2DUQ A;  3DPR A;  1GNZ A;  3VL9 A;  2N7G A;  2W68 A;  3FFQ A;  1R64 A;  1PIV 3;  1VBA 1;  2ZKN A;  3ACI A;  5CKM A;  5FJH A;  1K12 A;  1KD7 A;  5GM0 A;  1RJ8 A;  4M4P A;  5C70 A;  3ZOI A;  4ZXK A;  1JYV A;  5FTT C;  1UWW A;  2V09 A;  4OI2 A;  4BQW A;  2HEV F;  2R30 A;  3I49 A;  1X7N A;  1Z0H A;  5I8Y A;  4UYB A;  2DF7 A;  4XHX A;  3NJZ A;  1KQR A;  4CEW B;  3CDZ B;  4Q0U A;  1SAC A;  3RZZ A;  2HWC 1;  2XWB B;  2W87 A;  3AMQ A;  5FYT A;  4EZH A;  2PHW A;  4NVP A;  3WF2 A;  2HWB 1;  4GKY A;  3UJQ A;  5SV5 A;  4UFL A;  3HNB M;  1Q8V A;  5FYH A;  4BIS A;  1IQD C;  2EAK A;  4Z1V A;  1OT5 A;  4TYS A;  3M3I A;  3O14 A;  4I2O A;  3PU8 A;  2E31 A;  4D8M A;  2BZD A;  5DDJ 3;  3JBG 2;  3K3N A;  2ZXQ A;  4MXW B;  2ADD A;  4K1Z A;  3HQR A;  3WR0 A;  4NID A;  3AJZ A;  2BOJ A;  5FV3 A;  1UY3 A;  3ROU A;  5ANN A;  4BYY A;  4Z2A A;  1QJY 2;  3NRU A;  4NII A;  2XQX A;  3A0N A;  3PL0 A;  3SKJ E;  3ZFE C;  1XE7 A;  4YAR A;  1VBA 3;  4CYD A;  1W3V A;  2WLP A;  2YPD A;  4EWE A;  5A3L A;  1ZBA 2;  3AJY A;  1E5H A;  4LOR A;  3WUD A;  4AEM A;  4R8H A;  1WLD A;  5FYY A;  1RUG 1;  1GU3 A;  2VQA A;  2VM9 A;  5IJR A;  2I45 A;  2HWC 3;  4N7U A;  2BNO A;  4HVR A;  3C8X A;  1NLS A;  4GH4 C;  4JGY A;  5EHD A;  1TMF 1;  2ARX A;  5HXM A;  3N3H A;  5IUQ A;  2HWB 3;  2GMM A;  3QCW A;  4BE3 A;  4JV4 A;  4A3Z A;  5FPX A;  1S0F A;  5F7U A;  4JRA A;  5FUN A;  4Q4W 1;  1BHG A;  4XIL A;  4FXG B;  3WW2 A;  2VOK A;  3OF1 A;  1OH3 A;  4K7J A;  4GMP 0;  4KWK A;  1PO2 1;  1ULF A;  4CDQ C;  3A23 A;  3CIH A;  4O65 A;  1H4H A;  2GDF A;  4H7M A;  4DXT A;  5CVR A;  2HWE 2;  3ZPY A;  2C24 A;  3AP4 A;  4AI9 A;  3E6D A;  3MIB A;  3ZXD A;  5FKC A;  3ZYJ B;  3C7O A;  5AVP A;  4B4Q A;  1NA1 C;  3FHQ A;  3LGR A;  5F5A A;  2BBA A;  1AVB A;  3JB8 A;  4IEQ A;  3U4X A;  3ZXE A;  3H3U A;  3DXT A;  1GUI A;  3AL6 A;  4LE4 A;  1RUG 3;  4LNV A;  2YMZ A;  4OUL A;  4OUM A;  1J84 A;  3I2I A;  1DGW X;  2W2I A;  4JC1 A;  1JMU B;  2VTF A;  1CGP A;  2R1D A;  2BBV A;  2ZZQ A;  1P8J A;  4X6Q B;  1JHJ A;  3VBO B;  1TMF 3;  2Q30 A;  1W6P A;  1LHU A;  5FKB A;  5IWF A;  4HVO A;  4Q4Y 3;  5JIA A;  1EV1 2;  4KWU A;  1FYU A;  3ACL A;  1WA6 X;  4Q4W 3;  1PM4 A;  1ZM1 A;  2TEP A;  1FV3 A;  1R1A 1;  2IXL A;  1PGL 2;  3OBA A;  1E5R A;  3C3V A;  3LEM A;  1ZZB A;  2DDU A;  1QNW A;  3NV1 A;  1UZW A;  3P1I A;  1PO2 3;  1R08 2;  4IE0 A;  4K8F A;  4L8Q A;  5GZE A;  4D0Q A;  1W6N A;  4XF0 A;  4NIA A;  4RFR B;  5FOB B;  4W65 A;  5K0U B;  1L7L A;  1W39 A;  1TE1 B;  1YRZ A;  5FXW A;  3EB7 A;  3CL1 A;  4YLZ A;  3WD5 A;  2CAV A;  1WZX A;  4PLM A;  2VW0 A;  1QU0 A;  5FZL A;  4XZU G;  5DUW A;  2JD9 A;  4GJY A;  2WAB A;  3D5O A;  4OMD A;  2JEC A;  4I30 A;  3VBF B;  4AED B;  3WQB A;  2NP0 A;  1EUT A;  3PUR A;  2WBK A;  3DV8 A;  2Y6L A;  5FWJ A;  2QVS B;  4LK6 A;  1SLC A;  3LCP A;  2QTW B;  3NQH A;  3RDI A;  2H0V A;  1SDW A;  1PVX A;  2IVI B;  4LA2 A;  4N53 B;  4NRM A;  3W58 A;  3FFZ A;  4K9S A;  5FAX A;  1SBD A;  3IIA A;  3VBS C;  3BOP A;  4GWM A;  4HK9 A;  4RS5 B;  3H1Y A;  4Q0P A;  2W9X A;  5LBF A;  4HVQ A;  5A70 A;  2VUL A;  1OQ1 A;  5A7O A;  3ZFG B;  3LA7 A;  3OCP A;  5BNN C;  2LS6 A;  1D7P M;  3DCQ A;  1R1A 3;  1ZZ9 A;  1JOB A;  1J3P A;  2KA3 A;  1S0C A;  2NN8 A;  3J26 N;  4KMQ A;  2G9F A;  3L9J T;  3U4S A;  2UUR A;  5ANQ A;  5J36 A;  2VH9 A;  4CEY A;  3LEK A;  4N90 A;  5CZK A;  4Q8K A;  3FUQ A;  3B3Q E;  4MGK E;  2D98 A;  2UYB A;  4PT6 A;  1US3 A;  3INA A;  3TYJ A;  5CFD C;  2NYY A;  1UQX A;  3BGA A;  1DCS A;  3ETQ A;  2CSG A;  4XAC A;  2BNN A;  1OBN A;  3PDQ A;  1ZA7 A;  4BDV B;  2G9Z A;  4EJR A;  4NE9 A;  1REE A;  3D6E A;  2YBS A;  4RQP B;  3WV6 A;  1W2U A;  2GC1 A;  1YXW A;  1DP0 A;  2GC0 A;  4TSV A;  1UX6 A;  3J9S A;  4Y22 B;  3VDC A;  4CVU A;  3MLJ A;  5JCT A;  4FFG A;  1LOF C;  4K1Y A;  1BBT 1;  5A1A A;  4EV0 A;  5FZH A;  1YFX A;  2VY0 A;  5KXE A;  3FLT A;  4OHZ A;  4RN5 A;  3RNS A;  5IK8 A;  2XL9 A;  4G3Y C;  1Y9M A;  2B8M A;  2RS3 2;  1CJP A;  1CJD A;  2VBB A;  4BOW A;  1H2K A;  1YCI A;  2XXZ A;  3KCX A;  2QZ3 A;  4IW3 A;  1CES A;  3R0R A;  4FO9 A;  4KH9 A;  4W4Z A;  1UPI A;  5GZF A;  5F5Q A;  1PIV 2;  4N8M A;  4CPB A;  4E4H A;  3KCC A;  1LHO A;  4IV3 B;  2DUP A;  4DOU A;  3KSC A;  3NNL A;  4WBB A;  3POE A;  4BME A;  1G9C A;  1GAN A;  3RJ2 X;  3SMH A;  3GF6 A;  1GWL A;  1W2A X;  1PZ7 A;  3MFA A;  4AVC A;  2WLQ A;  1CQ9 A;  3R05 A;  3B7M A;  5JWP A;  2I07 B;  2VG9 A;  3GJB A;  4COZ A;  1W8F A;  2ZGP A;  3WVJ A;  1H30 A;  4TLG A;  3N9Q A;  5FYU A;  2JDK A;  3BB6 A;  2YRO A;  2VZO A;  3IBM A;  1BBT 3;  2FZ1 A;  2YU2 A;  4GD4 A;  3I54 A;  3WF3 A;  2FZ2 A;  4Y1X A;  2Y6K A;  2X09 A;  4MGZ E;  5DDJ 2;  1LEC A;  4DXR A;  4JZR A;  5C9A A;  4XFH A;  3GHN A;  2Z42 A;  3IWZ A;  3KVA A;  1OF3 A;  4E2G A;  4J25 A;  3RS6 A;  4LIV A;  4IDZ A;  3WNP A;  4BIO A;  4ZXE A;  4PDW A;  4PIX A;  4ATF A;  4CCM A;  3SIS A;  3BCW A;  1VBA 2;  4Z07 A;  3MHZ A;  4W50 A;  2CU5 A;  5FUI A;  3HD8 B;  5BNO A;  1VBD 3;  2WDB A;  4N43 A;  1JZ6 A;  3TEZ A;  5JXG A;  1GOF A;  4FP3 A;  4XJA A;  3ZSJ A;  5C71 A;  2FDG A;  2DU0 A;  4XUQ A;  2A3X A;  2IFW A;  3Q8C A;  4YNI A;  3PUI A;  5GLT A;  1RIN A;  2VZQ A;  5LBB A;  3ZN6 A;  1V9U 1;  1XYN A;  4LHN A;  2HWC 2;  1HKD A;  3OD0 A;  4XDP A;  2WQ8 A;  3VKM A;  4CU8 A;  3PLQ A;  4CP2 A;  2HWB 2;  1FPN 1;  4JRL A;  4M0N A;  1LGC A;  1S55 A;  5JLV A;  2DVF A;  3N4M A;  2Q1F A;  2DWR A;  1S0B A;  4MGQ A;  2W47 A;  2ZPX A;  5ISL A;  3OSD A;  3USS A;  2JG8 B;  5SV8 A;  3HVD A;  3DF0 A;  1C4R A;  4UT5 A;  3RRD A;  2OXB A;  3BAL A;  2RE9 A;  3OTF A;  3I97 A;  4YZ4 A;  4BHP A;  1JZ8 A;  5LAS A;  4WZF A;  1SLA A;  4OHV A;  1LB2 A;  5FMO L;  5F39 A;  4DUX A;  2E7Q A;  5A7P A;  1BK1 A;  5DN2 A;  5JPN B;  3B94 A;  3DEC A;  1BVP 1;  4UFH A;  4D7S A;  1LHV A;  3KM5 A;  2BOI A;  1TZO A;  5LK7 B;  4AW7 A;  4LBO A;  5FXV A;  4Y5T A;  5DZG A;  3AZV A;  3FMG A;  2X5I B;  4MYE A;  4RD7 A;  5FCC A;  1RUG 2;  3PUQ A;  2ZX3 A;  5JR7 B;  1OA4 A;  4A44 A;  4K40 A;  3S5A A;  2G19 A;  1GQP A;  5C4W A;  1V9U 3;  3THD A;  2XVG A;  5FY1 A;  2W94 A;  4I0B A;  5ACA 1;  1TMF 2;  2WNV A;  3GBF A;  3ZIX A;  4RR3 A;  1U5Y A;  3PVO A;  4NPR A;  2KM2 A;  4Q4W 2;  5E89 A;  3W20 A;  4PF1 A;  3AVR A;  1H2L A;  2RVA A;  3WT3 A;  2JD4 A;  2XUE A;  4SBV A;  5FZD A;  4QAW A;  1PO2 2;  5DG1 A;  1RL3 A;  5T5P A;  1JYI A;  3DKQ A;  1RED A;  2R16 A;  3V0A A;  1TNR A;  1RUD 1;  4AEK A;  5DUU A;  4DEQ A;  4I0A A;  4IV1 A;  1OOP A;  4CEW C;  4QXB A;  4IEZ A;  1G9D A;  1W2N A;  1YFW A;  5EJ3 A;  2TBV A;  2C4X A;  4S2H A;  5GLW A;  2DU1 A;  5B4X A;  5F6L B;  3NJX A;  1YI9 A;  5LCW L;  1EUU A;  5FYV A;  5IVC A;  4JAA A;  3OBR A;  4WM7 B;  3RJR A;  1JUI A;  4CCJ A;  1HQL A;  2BV4 A;  2XJS A;  5KWR A;  3MZH A;  4PCR A;  2Q8E A;  4IEU A;  1H9P A;  1C3H A;  3B02 A;  3VZO A;  1XPW A;  3WNX A;  4C0H A;  5ACA 3;  4OZX A;  1VBB 1;  3LZZ A;  3U14 A;  1WLC A;  4OQ9 A;  2I74 A;  4IND A;  4QM9 A;  2VCB A;  1SPP B;  4FPG A;  3LDB A;  1NY7 1;  3VGI A;  3KCY A;  4CCE A;  2BW8 A;  2ZHN A;  4LO8 A;  1S2E A;  2ZOE B;  4NHM A;  2WL1 A;  1R1A 2;  3I2H A;  3PUA A;  4LHL A;  1L7R A;  3X29 B;  4AFA A;  1RUE 1;  3AK0 A;  2JE8 A;  2R7E B;  5DUV A;  5C8W A;  4AVT A;  3JD7 3;  4URT A;  2VTX J;  4ZPI A;  4P00 B;  5FQ0 B;  1RUD 3;  1LOG A;  2QKD A;  5LBC A;  1W6M B;  2Q8C A;  4BH9 A;  4LBQ B;  3SH3 A;  4EE2 A;  4XQD A;  2FDK A;  1Y43 B;  1XE0 A;  4JHT A;  3WP3 A;  3FC0 A;  2A3Y A;  5FY8 A;  2FCU A;  4A4A A;  5HXV A;  4PBP A;  4YM0 A;  3MLK A;  4TZD A;  4DRR A;  2B42 B;  4L11 A;  5A7S A;  4YVW A;  2W92 A;  2GZW A;  1LOE A;  1VBB 3;  2B4K A;  1OUS A;  1JYC A;  1ZZC A;  4GH4 B;  1X36 A;  4CUA A;  4XFB A;  4Q4X 1;  2WO2 A;  4AVA A;  2XB6 C;  1QGL A;  5FIX A;  5FZO A;  2VVD A;  2WN2 A;  2ARA A;  2CHH A;  4R9D A;  4XF1 A;  4X8N A;  1XXN A;  1CR7 A;  4BK4 A;  1L3J A;  1QOT A;  4Y33 A;  2C0Z A;  3VBH B;  4DRV A;  1T6B X;  1RUE 3;  3AMP A;  4XJU A;  3FX3 A;  5IAV A;  2CAU A;  3LEI A;  2P5B A;  3WY6 A;  4CDQ B;  5L19 A;  3NST A;  5CFC C;  4LLF A;  4V1P A;  1CPN A;  4FPK A;  2EF6 A;  2ORZ A;  4QGM A;  4F7Z A;  4QPI C;  2JIG A;  1LUL A;  2B5H A;  1A3K A;  2J1T A;  1UOF A;  2K0G A;  2P3I A;  2V4A A;  3NKG A;  1NCQ C;  3LD8 A;  4LO4 B;  4CU7 A;  2X10 A;  4F83 A;  1D4V B;  3FLR A;  4L99 A;  4IEW A;  4OMC A;  4AQ2 A;  4Z2W A;  5FK8 A;  5HPO A;  1NZC A;  1BBT 2;  4YWA A;  1DGR N;  2IZW A;  3BPZ A;  1K3I A;  4GWJ A;  4UFK A;  2QUO A;  4HKL A;  2QE3 A;  4B4R A;  4Q4X 3;  3SEP A;  4D3W A;  2B46 X;  1NUK A;  3HBK A;  4RGG A;  5APA A;  2Z79 A;  5K0U C;  1BYH A;  1QJU 1;  4YZ2 A;  3WHT A;  2TUN A;  2CGN A;  4AGR A;  1JTZ X;  4LO5 B;  5AFE A;  4IE5 A;  1IS4 A;  2RS1 1;  4PLO A;  2QQP A;  1OH4 A;  4PHZ A;  3H50 A;  4QB2 A;  2FCV A;  5FZ0 A;  1RUH 1;  4HPK B;  4CXX A;  4CXY A;  3VDD A;  2FCT A;  3WG3 A;  5JSO A;  5FPU A;  1SLI A;  3GZE A;  3I2D A;  2P3J A;  1B35 A;  2RG4 A;  4LA3 A;  3M70 A;  4XBL A;  4A41 A;  3ATG A; 
#chains in the Genus database with same CATH homology
 3OSD A;  4FFG A;  4B1L A;  3U75 A;  5FMD A;  3ZR6 A;  4CCC A;  4FFF A;  3H3L A;  1ST8 A;  4JQT A;  3LF7 A;  2ADD A;  2OXB A;  4B1M A;  1UYP A;  4UFI A;  3ZR5 A;  3S5Q A;  4UFK A;  5ANN A;  3LIG A;  4QHZ A;  2ADE A;  2XQR A;  3LIH A;  3UGF A;  4AZZ A;  3SC7 X;  3HBK A;  3NMB A;  3UGH A;  1Y9M A;  1W2T A;  4CCD A;  5FMB A;  4EQV A;  3RWK X;  4UFH A;  1Y4W A;  3IMM A;  2QQV A;  3KF3 A;  4UFJ A;  3U14 A;  3UGG A;  2AC1 A;  4FFI A;  2QQU A;  2AEZ A;  5FKB A;  3LFI A;  3PIG A;  3U1X A;  1Y9G A;  4UFM A;  4CCE A;  4FFH A;  2QQW A;  3LDK A;  2AEY A;  5FK7 A;  3KF5 A;  3LEM A;  4UFL A;  3PIJ A;  4HXC A;  5FKC A;  3LDR A;  5FIX A;  5FMC A;  5FK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...