4AZZA

Carbohydrate binding module cbm66 from bacillus subtilis
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
165
structure length
165
Chain Sequence
TPFMSNMTGWTTVNGTWADTIEGKQGRSDGDSFILSSASGSDFTYESDITIKDGNGRGAGALMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAEYKTPIDVNKKYHLKTEAEGDRFKIYLDDRLVIDAHDSVFSEGQFGLNVWDATAVFQNVTKESLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How Nature Can Exploit Nonspecific Catalytic and Carbohydrate Binding Modules to Create Enzymatic Specificity.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords LEVANASE
total genus 43
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 3.2.1.80: Fructan beta-fructosidase.
pdb deposition date 2012-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4azzA00
5FMDA 4FFGA 3KF5A 4UFLA 2ADEA 3SC7X 2QQVA 2AEYA 3U75A 4CCCA 1W2TA 4UFIA 3U1XA 4UFJA 5FK7A 4JQTA 3LDKA 3NMBA 2AEZA 4HXCA 1UYPA 4QHZA 3LDRA 3PIJA 3IMMA 3LFIA 1Y9GA 1Y9MA 3UGGA 4CCEA 5FKCA 3ZR5A 2QQUA 2ADDA 3H3LA 5FK8A 3OSDA 5FIXA 2OXBA 1Y4WA 3LIHA 2AC1A 3U14A 2XQRA 3KF3A 3LEMA 3LIGA 3PIGA 4FFHA 5FMBA 4B1MA 4UFKA 1ST8A 3HBKA 4AZZA 3UGFA 4FFIA 5ANNA 3RWKX 3S5QA 3ZR6A 2QQWA 4UFHA 4B1LA 4EQVA 5FKBA 4CCDA 3LF7A 4UFMA 5FMCA 4FFFA 3UGHA
chains in the Genus database with same CATH superfamily
4INDA 1RINA 1U0AA 4WM7A 2RJ2A 1DQ0A 1S2BA 3AVSA 3FHQA 2Y6JA 4RGKA 3WCSA 2PHLA 2QE3A 4BA6A 2WJSA 2WT0A 3NAPC 3N9NA 5M0TA 5B2GB 5KXEA 2GMEA 3KQ4B 2YUEA 5A7NA 3UKNA 4C0HA 1YI9A 4QPGB 2ADDA 2IXCA 4D3WA 4YVSC 1KDKA 5C3OA 3MIGA 1S0JA 2VOTA 3KZ4C 1PMJX 2VUAA 5C6CA 1OHFA 2GALA 3K4AA 4N9HA 4HMZA 1B35C 2V5DA 5DABA 5IVJA 4EQVA 1UOBA 4IE6A 1G9CA 1HQWA 1NCRB 5FZ7A 3PUIA 1W9TA 5HCHA 3RZKA 2VUDA 2A75A 4LKEA 1HN0A 4XF0A 3BUCA 2CYFA 2IVIB 3POJA 1L7QA 4URAA 3D4KA 2K9ZA 2WO3A 5IFTA 1MQTA 2WWUA 3L2HA 1EAH3 1VBB3 3J4UH 1DHKB 1RTVA 1UQXA 3F95A 4ORFA 3JBG2 4A6SA 4WM8B 1H1MA 4YZ1A 1R1A3 1UYXA 3I59A 4QM9A 3BTXA 4HSJA 4FQ4A 5LY1A 1W0NA 3AVRA 5CKNA 4E8CA 1WCQA 3VZMA 2WA4A 1XU2A 4LBLA 3RZHA 1VBC3 1E5RA 1W9WA 4YFWA 1GQPA 4NRMA 3WDTA 3BGAA 4ISRA 5LA9A 5LB6A 5EXOA 1Q8QA 3H3ZA 1HB2A 3UYJA 2ENRA 1Q8SA 1RUC2 3R4DB 4NWWA 3NQHA 2A71A 3TOJA 3IKWA 5FPLA 1JOBA 4ZZ8A 1LOCA 5A7PA 4IGQA 4FI9A 2CV6A 1GOGA 3T0AA 3J8F1 1C4RA 4N7UA 3TEYA 5FY8A 2NPIA 4FO9A 1LEMA 2P6HA 5FWEA 2WRAA 4QD2A 1UD1A 2A7AA 3ZXGA 1WGPA 2JDPA 1OUSA 3OG2A 5H9SA 1ZBE3 3R0RA 4AHYA 4Z2AA 2ZKNA 3K51A 4QU1A 1CIYA 4JGYB 4YVWB 5DZGA 4EROA 5ACA2 1PO13 1ULDA 2WUHA 3K4ZA 3NJXA 1JZ2A 3PUAA 2VPVA 5D8AA 4CP9B 4L97A 3CL1A 1CJPA 5D21A 4UBGA 2RDQA 1WCKA 3J9SA 4FPLA 1E5IA 5FZEA 2OZJA 4QB1A 3WNXA 1UOFA 3NVCA 3GXUA 3MPPG 4YWAA 2O14A 1QJEA 4E4HA 2BYVE 5JOXA 3H8OA 1PO21 3BB6A 4KGGA 2D5HA 5EPAA 4DNYA 1GNHA 1LNSA 2C4XA 5FZIA 3ZYPA 2JG8A 3NNFA 1UYPA 4HFSA 1GP6A 4Z8BA 3WF0A 2JWPA 3VGIA 1GLHA 2PAEA 1WW5A 3X29B 1DLCA 3V0AB 4JAAA 3AKPA 2JDUA 1BLZA 1SBEA 2WKKA 2YBKA 3LDBA 5C4WA 4F8AA 5LRSA 5L7OC 4XBQA 1RJ7A 3P5BA 2E33A 4FPEA 4KBZA 5C3RA 1AR82 5JXGA 2YROA 2VMCA 2B46X 2LROA 3IDCB 4E4ZA 3HD8B 4HN0A 4QKFA 2HEYF 5IK7A 1YUDA 4S2HA 1H8VA 4FCAA 4GH4A 1C8M1 4Y20A 5B4NA 1VAKA 4ZS3A 1FNYA 3R4SA 1VBE2 2GC0A 4S2FA 1PGL1 1G9DA 1DQ1A 4GZ9A 4FP2A 1RUI1 2VZVA 2VW0A 1UY3A 1FMD3 1VB4A 1V0AA 2BFUL 3EXUA 2WO1A 5DG2A 1R64A 1IOAA 5FJHA 3WNOA 2EICA 2CDPA 1CIWA 1GANA 4FP3A 4XFGA 2JEMA 2EAAA 3V0BA 4LKSA 1X36A 1QHDA 1EPZA 4XFHA 3WDWA 3V0BB 1Z7S1 2WNVC 4M4RA 4P9GA 5APAA 1FMD2 3UV9A 2W1WA 4A3XA 2QFEA 4RFT0 1UY0A 1RUH3 2NZ9A 3C7GA 4GKXA 1QGLA 4RR3A 3W58A 2AGSA 4NPLA 5LY2A 3MF6A 2WC2A 5FY0A 4GB31 1SQ4A 5DG1A 1R083 5EQUA 5I8YA 4GJYA 2ARCA 1WD4A 1WLTA 1Z7S2 1QQP3 1UIKA 5FR3A 2EXKA 2GH2A 3AMQA 3RNSA 4HT1T 2A3WA 1DYKA 2JIGA 3AK0A 2ZPXA 3P3NA 4OLLA 4P00B 2X10A 5FZOB 2HYKA 1ACCA 1PMHX 4B7EA 1RUE3 5J37A 1IPJA 1L7LA 3J7HA 4RS5C 1NE6A 4QPIB 1URXA 3EQEA 3HWJA 3GHMA 4WVVA 5FYUA 3VL8A 3KM5A 4IV1A 3ZFFA 3RSJA 4ASKA 5KXCA 1JU4A 2C1FA 1CZSA 1AYN2 3C8XA 3CHXA 1YHFA 4MHRA 4XZPA 4LHSA 4OYUA 3SITA 2WO2A 3VBRC 4BJ0A 2JECA 3BPSA 2VCCA 2FDIA 4K21A 4CCOA 1RUF3 2ZGMA 5E16A 4CPBD 1FPN2 1YEWA 4CDWB 2VBPA 3IBMA 4OI2A 1JYVA 2PHDA 3W5NA 2Y6HA 4QHZA 2EF6A 3T3YA 5FZOA 4L0PA 4I0WB 4PF1A 3WQ7A 3I8TA 1A8MA 1FAYA 1UZZA 3RS6A 4XF9A 4XYXA 2XUMA 3UGFA 3WEZA 1SEFA 5J7MA 3KHBA 4QDQA 3DUIA 3O12A 1DYPA 2R32A 3OYWB 3WP3A 1BBT2 1PGW1 5KHHA 1AUYA 2BW8A 3MPBA 1JN2P 1X9PA 4IE7A 1AYM3 4UFIA 1VAVA 1REFA 1QJU2 1ZVFA 4AF9A 2YC4A 2P3IA 3POWA 2VOKA 2WZ8A 4QMAA 3RYKA 3QD6A 2WNVA 1VAMA 1HXS2 2JJ6A 4AEMA 3DPRC 1VRH3 4E2QA 1RUD2 3MGUA 1VR3A 4CDXB 4FPKA 3N9PA 5FIXA 1HB1A 2OW4A 1VMJA 4W6XA 2ZEZA 2JE7A 1UPSA 4QXCA 2VECA 1R091 1XQNA 1K12A 2RDRA 3P3PA 4RQPC 1J1TA 1LOAA 3GZEA 1VMFA 3POYA 4Y20B 3AP4A 3S30A 2V5YA 1IS5A 1G6NA 5A7WB 3ZFGC 1WLCA 2BBAA 2ZGNA 1BVP1 5A3UA 2PLV2 3U75A 4BHPA 1OOPA 1WWYA 1DG6A 2VNVA 2ZX0A 2H6CA 3KV5A 4Q4V1 1IPKA 1DQ4A 1H2KA 4MVTA 3UT0A 3ZXKA 3MLKA 4XJAA 1U12A 4XJ9A 1RYYA 1PVXA 1Z78A 3I2KA 2DU1A 1UXZA 2P4EA 3O0VA 3RG0A 4CXXA 1D2SA 5T5LA 4EZ4A 5F9TA 1UOGA 5FFOC 5A32A 2JDAA 4NIIA 1WW6A 1WCUA 1STMA 3FN9A 2JDYA 2EIEA 2JIJA 1QQP1 4UXAA 2QQIA 4Y26A 4QHOA 1HV1A 4LITA 3WHTA 1XNTA 3VD5A 5C3QA 2QQOA 3IDAA 4AGGA 4LO4B 3UETA 2X09A 5JUVA 3CLPA 4P9IA 2PAKA 3GBFA 1GOHA 2JB4A 3C7HA 2P37A 3DCQA 5FOJB 4CCJA 1O3SA 1QH7A 4GALA 1CAVA 1Y3TA 1RUC1 3ZN6B 4PQQA 5BNPA 1RUOA 1PVC2 3JXSA 1SPPB 1VBA1 1ZZ8A 4XFAA 5IK5A 2R0FA 2Z4FA 5JOWA 3WX5A 1AJKA 2C9KA 4AZZA 2N7GA 5I0TA 2NMOA 4DXZA 1GWLA 1QJX1 3ATGA 4UFMA 2HWC3 5A6ZA 2QNKA 1MS5A 2WNUC 3I7DA 2D43A 4Q0VA 4MGSA 5JSRA 1K5MB 5EWSA 4HBNA 4AVSA 4COVA 5A7SA 3RVHA 3A0NA 3H7YA 3OUIA 5LASA 4IEZA 4M4PA 3ROUA 3VHRA 1BK1A 3RDIA 3OD4A 1FNZA 1QXRA 1MS3A 2XBO1 5FZBA 3D82A 2F4LA 1DU3D 1YJLA 3EBRA 3EYPA 3KGLA 4O7XA 4QT6A 1US3A 4CP2A 4I02A 1VMHA 4BXSV 4QQ2A 1JYIA 4JC1A 1F15A 1DIWA 4EN0A 1ALYA 1XNDA 3LFMA 2B9VA 1D7PM 1QH6A 3AYCA 3LEIA 4HVRA 1VE0A 1S0CA 5T52A 4AHZA 5FXXA 3WDXA 1W9FA 1YWKA 4LLOA 4W8JA 1JUIA 4CEYA 4AI8A 4L8QA 3GZAA 1RUE1 3AFGA 2QZ2A 3AP6A 4NROA 3I2HA 4PBOA 2BGCA 4Q4W2 3NV2A 2QQLA 3WF4A 4HETA 2QJVA 1UY4A 2R061 1F9KA 3VBRB 2VUCA 3WP5A 4IE5A 3MO4A 3RYRA 4LUKA 3WNLA 4OCTA 2WLPA 1FOD2 2YZ4A 5FLJA 1CVNA 3FZ3A 4NIHA 1D4M1 2E6VA 2WS93 2GU9A 3O0WA 3OBAA 3HNYM 3JB8A 4OI0A 4IE0A 3WOGA 3PVEA 4Q4X3 5BXXA 3OJBA 5GZFA 4AQ2A 1W03A 1W9SA 3ZSEA 4YW1A 4CE8A 1OXCA 2PQSA 4NUBA 2RM21 1NAEA 2VMGA 3DKQA 1RUH1 1W90A 5FZ4A 4A7KA 3BTZA 1SCRA 4QWNA 4LOSA 3MLLA 4LBQA 2JKBA 2DCKA 5BNPB 3MUZ1 1TNFA 2BEOA 1G8WA 4NJ4A 5FYTA 3MHZA 4Y33A 2CGPA 1PGSA 2NMNA 1AJOA 1MQTC 2A3YA 4I09A 2ZGUA 3UNPA 4IEQA 3WY6A 1RUG1 2Y64A 3OY8B 4GA9A 4P9XA 1DZTA 1QQP2 1MZFA 1C1FA 1YXWA 1DDLA 2VNOA 2W46A 2VZQA 3D0JA 1OA3A 5CADA 2O1QA 4A42A 4L2NA 4AI9A 3V65A 4U36A 3A23A 4NAMA 1GKBA 3N9MA 2UWBA 3ZXFA 4EN7B 4MG2A 3MW3A 3ACIA 5L9RA 4GH4B 4XDOA 5BNOC 5EYXA 3ASIA 3VBFA 4W65A 4QKNA 3SEEA 3VBOA 4BQ4A 2A6VA 4OQ9A 1JTZX 3THCA 2E53A 3ZLIA 1W8WA 3MDPA 4BM8A 5F7UA 2XLGA 1YQ5A 4XF4A 1QEXA 2WQ4A 2VH9A 3LOBA 3JD71 4JRLA 1R092 3C7OA 1QJX3 5IVCA 3GJBA 1TE1B 3GNEA 4AI2A 3ZSKA 4U2AA 5CKMA 4AFCA 3ZR5A 4NHXA 1RUD1 3AX4A 5FYBA 2Y6KA 3AL5A 4IE4A 1K45A 4NRQA 3WQ1A 3UKTA 3CKHA 1WCSA 5I0RA 5KHJA 2PYTA 1WW7A 4FPYA 4Q4W3 4XIKA 5FJKA 4CCLA 3PUHA 3WVJA 1JZ8A 3NKGA 4LLFA 4QX8A 5ABJC 1LAJA 3VZOA 2UYAA 1NLSA 2OPWA 2A6WA 4WM8A 3L2YA 4WV8A 5F3GA 2D93A 2P34A 4RN5A 4UW4A 4TLFA 1GWMA 4JVAA 4CU7A 2HWE1 5BNQA 1U5YA 1BHGA 2EAKA 3U1XA 1JHNA 2XXZA 4NWVA 3OYWA 5DPNA 4MOAA 2GSYA 3IIIA 3VBFB 1SPPA 4BU2A 3B9CA 3N36A 5CZKA 5DAPA 3O14A 4FOQA 2JKXA 1H2LA 3U11A 4DIQA 5I93A 1LODA 1YFUA 5E88A 3U78A 3KF3A 4IGPA 3T09A 4DZGA 5FO8B 4J1WA 4Y1VA 5AC91 2YC0A 1JZ6A 4IUGA 1LCLA 2XKOA 2XMLA 1HXS3 1O4ZA 1Q3EA 3FBYA 3NJVA 1RUNA 1NZIA 5FP4A 3GZUC 4NAOA 5CBLA 2O8OA 4FTSA 2YMZA 3RQ0A 5IVBA 2BGPA 2FDFA 2DV9A 1JOJA 1HB3A 2PELA 2CGNA 4I0BA 4ZPIA 5C9AB 3UGGA 4OHVA 3SH4A 1NX9A 4C91A 5KXDA 2VE1A 5G05L 2E32A 3CMGA 2AC1A 3N3HA 3R4UA 1LULA 2I07B 1TMF2 2PMWB 2WNEA 1HRV2 2XKPA 3NRUA 3PJYA 4META 4Q27A 3UL2A 1NLRA 2ZEYA 3GHNA 4RSUA 3RMXA 3POGA 4CSWA 1OF4A 2ZJCA 4H7MA 2VUJA 2VMDA 5TSWA 4AVBA 1PZ9A 3PVBB 3KF5A 1QY4A 2HWD3 4CDXC 5FY1A 2ATFA 1H6XA 1KGYA 3AM2A 1EPWA 1SFYA 1T6GC 5GLWA 4GWNA 2CY6A 4DXRA 1PIV3 5FTTC 4XMAA 1O6UA 1P8JA 2BVVA 2JG8C 2D6LX 4YM2A 3KT4A 1LB2A 4I2OA 1OH3A 1F8VA 4ET7A 4LHLA 2KA3A 2WWJA 1W8ZA 1L3JA 4FT8A 3DXTA 3SNMA 5JI9A 3T0BA 4QQPA 4UFKA 3ETQA 3HQUA 4E27A 3NW4A 4K6BA 2OPKA 3DYMA 2LTNA 4LIVA 4HN1A 2BZDA 3H1MA 1Q5OA 5CIRA 3E1F1 5C9AA 5JLVA 1PGL2 4IQPA 3SLIA 3ZPOA 1POQA 1R082 1SHWB 3FUOA 3IB3A 5FO7B 3FJSA 4Y5Z0 1AR91 4GH4C 4R52A 2IWGB 3HMYA 4DUXA 3HQRA 2BTVC 3WV6A 3ZXEA 5DDJ1 4LHKA 5GJ6A 2D44A 4LHNA 3A4UA 5I0UA 3SHRA 3S5AA 4OMDA 3NO8A 1REEA 1KS5A 3OEBA 5C8CA 5EP9A 3O1MA 5JVVA 2L9LA 2A5ZA 2QCSB 3DV8A 2IC1A 3H1WA 1LGCA 2YY1A 3K77A 1VBA2 4RA0A 5GZGA 1XOYA 3MV01 1A78A 5T54A 1JZ3A 4CCEA 1V6MA 4AEDA 1AX0A 1COV2 1PO22 4HK8A 1HDKA 1NG0A 4OMCA 3FUQA 3BI3A 5DUVA 4FAHA 4PI2A 3USUA 4D94A 5FLIA 4CEWA 3ACLA 3WHUA 4FBFA 3DL3A 3ZFFB 1N1SA 1HRV3 1NY72 4IEOA 2AREA 2VGDA 4PIZA 5KR7A 4W6YA 1DZQA 1PHMA 2ET1A 1NCRC 4ZXEA 2P3JA 2XHNA 3UKVA 3HQXA 4YM3A 1O3TA 2X5IC 5FZ6A 5EFUA 2FZ2A 3IMNA 4D6RA 1RHI3 2B7YA 2G19A 3AYAA 1H0BA 5J1XA 2FMYA 2XJVA 2ZBJA 2PHTA 4IDZA 3RYPA 4CVUA 3H1YA 4KWJA 4KQ7A 1JYCA 2FDHA 4LNVA 1LENA 3MZHA 3NV3A 1LHNA 1CX4A 3J7MA 3J8F2 4OQ8A 4AW7A 1ENQA 3AXDA 3B01A 4A41A 3ACFA 3OGVA 3VZNA 1IS3A 2OUHA 3N9OA 3W59A 4QPWA 2BOIA 3IDBB 4XPVA 1UZYA 4ZONA 3OGRA 1DGWX 4D7YA 2I2SA 2Q1FA 5FZGA 4OI1A 2G9ZA 2WR9A 2VCMA 3MW4A 3ON7A 1L7RA 1PO12 3CIHA 3GYDA 4HKWA 2HWB3 1UW8A 2VMIA 2CTVA 4MGYE 3JBG1 5J09A 2VCBA 4Z1VA 1GZWB 1HXS1 4AQ6A 4H14A 2XLFA 4NE9A 1VRH2 1AX1A 5HCFA 2XQXA 1R1ZA 5C33A 5CFCC 2CWSA 1LTEA 5IJRA 5A33A 2ARBA 1SLBA 2KD7A 1HRI3 3RZJA 3O7OA 1NOVA 1Z0HA 1ASJ3 4CP9A 2BBVA 1AL23 3ZPYA 2B9UA 3VBOB 1EUUA 3VBUB 4ZKTB 2GN7A 2GC2A 1N3PA 5GLZA 3KMHA 2UU8A 3B7MA 4LA3A 1F35A 2GZWA 1J84A 4CTEA 5CA6A 1G9FA 3I3BA 3WNKA 2BNNA 2DURA 1IQAA 2X29A 4Q2FA 1H8TB 1MZ6A 1ULOA 3AL6A 4A7ZA 5H9QA 4X6QB 2HKXA 4FAGA 5HBAA 4BLIA 1VLNA 1YQ8A 1C1LA 3KLSA 3LOIA 1LOFA 1MS4A 2GH8A 3JCIA 1YI7A 2OUJA 2R16A 1MVEA 1C5IA 4WM8C 2XLAA 1JXNA 1QXJA 1JYNA 1DFQA 2D6NA 1SLAA 2WT2A 1BKZA 4IEXA 3AZWA 2QKDA 4E2SA 4RHV1 3ZYBA 1I6XA 1NXMA 1TMF1 4D6SA 1QMJA 2ZMLA 3DF0A 1RUJ1 4TTGA 4LBKA 4AFMA 2WZPP 2PHFA 1A6CA 3IPVA 5FYIA 2BV4A 3WDUA 3AXEA 3LIGA 4XXPA 3URFA 1PIV2 2HLEA 4IV3C 4LO7A 3WT3A 3I97A 1ZA7A 4Q4V3 4DQAA 4CCKA 2XJTA 2WZR2 1AVBA 3CZJA 4JTOA 4XABA 5FYCA 2X8KA 5JPNB 4BB3A 4CCCA 4KNCA 3U10A 1C8NA 1BEV3 1TME1 1FXZA 4M3CE 4M3CF 3VKNA 2W1UA 4C8DA 4CUAA 2Y8KA 5CFDB 3FLTA 1UY1A 4QAWA 4QGNA 4YG0A 2RE9A 5CNAA 5FY7A 3T30A 5AC92 4MGZE 4COZA 1CESA 1NCQA 2TUNA 2D6KA 1DGWA 2ZTNA 1OPOA 5FK8A 2ZOEB 5C3SA 2VJXA 1TVGA 3M4FA 2DVFA 4YW5A 1BEV2 4P5HA 3VDDC 3VBHA 2J1TA 5T5PA 4IV1C 4EWDA 3GZTB 1RMU1 1HQNA 2J1SA 3LA3A 2WYSA 2RMU2 3T2QA 2HWE2 3UGHA 4XJWA 2WNUB 3WQ0A 1RITA 3EMRA 1GOFA 1VBA3 2DCTA 3LKJA 4ONUA 4XQWA 2K46A 5L73A 2E7AA 3C7FA 4HPKA 3HIFA 5C7GA 2XJPA 1ULFA 3O1OA 1MZ5A 1COV3 5HV0A 3TNPB 3PIJA 4XJZA 5DUWA 1CAWA 4QB6A 1JMUB 1VP6A 2YV8A 2VZSA 2F17A 2OT7A 5D8AB 4Q4X2 4CCMA 1IZ3A 1KEXA 4PDWB 1CAUB 5CFDA 3THDA 2BVBA 2YU2A 2OYZA 3THPA 3E5XA 4QX0A 3USUB 3MIHA 3OTFA 1MS8A 1W99A 4N53A 4OI4A 3PTYA 1DQ2A 4JZRA 3Q8BA 3Q8CA 4GWMA 2X5IA 3I2FA 1W8FA 3VHOA 2WFF2 5C9AC 4D7SA 3ILFA 1Q56A 3MYXA 1PMIA 3LD8A 2WWSA 2WN2A 2Z69A 1OOPB 2FDJA 4LEJA 5E6HA 5LBFA 2JG9C 4RL7A 1BK0A 1NLQA 3ZN5A 4CDUB 2CDOA 1Y9GA 4BQXA 4O9EA 4IV3A 5D2AA 5GLUA 3ZYRA 1AR62 2DFCA 3KGZA 5EIYB 5F32A 5KXBA 2VY0A 3M2MA 2D6MA 1YFWA 2JE9A 3FLPA 4MH0E 2RS33 4Y24A 5A6QA 3M3CA 1OA2A 4LOTA 1FYUA 2NQYA 2XB6C 1ZZBA 1PK6C 3BYWA 3GCXA 4FOYA 4NR1A 4YZ5A 3VDBA 3JD73 3RZMA 3VD3A 2A70A 4PIXA 4LBJA 2DF7A 2EIBA 4MGQA 4AGVA 3IWZA 1C5HA 5JMCA 1R1A1 2VVEA 4YG6A 2WL1A 4QX1A 3VB9A 4XDQA 1R093 3EJKA 4JKKA 4XUQA 5ABJA 1GQHA 2WBKA 1X33A 4ISQA 5T5JA 4AVAA 1NUKA 1F31A 1RMU2 3LPGA 1W2NA 1UKRA 2CWMA 3LDRA 4SLIA 1NA1B 1ENXA 4DB5A 5H9PA 4H7LA 2RMU3 2FD8A 5B4XA 1BJQA 5FZ0A 1A34A 1OVSA 2XJRA 2Y6LA 2Q8OA 3H42B 4FFHA 5C70A 3VD4A 1TNRA 4I3PA 1WBFA 4EWEA 2RS31 3QH6A 5FZ3A 2TNFA 5E89A 4YNIA 2RS51 3WW1A 2VQTA 4CUGA 5IUQA 2ZX1A 2HJIA 2VQ0A 1AR72 1NZCA 4PLOA 2A3XA 2E7QA 2DVAA 2XR4A 4K20A 3NJZA 3PU3A 4AQTA 1WD3A 2G9FA 2J42A 2DVDA 3TYJA 5FQ0A 3AMHA 1OA4A 2HWB1 1H1AA 2JD4A 4FOWA 4LBQB 3S7IA 3DECA 3U37A 4JGZC 2K0GA 4XHBA 3HT1A 4YW7A 5FZCA 2VZOA 2WFF3 3J7LA 4UBHA 3LEMA 1UZ0A 1YIPA 3A21A 5HV4A 5EYYA 3T4VA 2ZABA 5F5AA 1I9RA 4AYUA 5IAVA 5LRRA 1W8HA 2BRTA 4NHYA 2J7MA 3I3QA 1IHMA 3VD7A 5A3PA 4B4PA 3TBDA 4CDWA 3E5QA 2ZHKA 4I30A 1NT0A 1ASJ2 1LRHA 3D6EA 2JD9A 5H9RA 4AWDA 5BNNA 4OHXA 3HPNA 5FZKA 4TZDA 3SCHA 5JZGC 3PTRB 4AVCA 1V9U1 1ZBE2 1LOEA 4CDXA 2FDKA 4R9DA 3CQOA 1PVC1 1YIFA 2YFUA 4B8EA 5F2WA 4AI0A 1Q8VA 4BE3A 5AFEA 1UYZA 2ZHLA 3JUUA 4FPCA 4CUBA 3M7AA 3OUJA 3WQBA 4JX0A 3QCWA 1HLCA 2G9GA 3AC0A 2VOWA 3OPTA 4BQ2A 1UX7A 4MXVA 3AFKA 4Y4YA 1Y7BA 4QPIC 1BMV1 2C24A 4DUWA 4Z82A 3DPRA 4QGMA 5L9VA 2GMPA 3AZXA 4KWKA 2Z5WA 3IN9A 1CZVA 5A7QA 1N47A 2B8MA 4OFGA 3HEIA 2SLIA 2HH9A 2JICA 4UF0B 1J3PA 5C4WC 2D7FA 4R9AA 1QNYA 3D3AA 4Q4V2 1XJAA 1W6PB 4GKYA 3CBNA 4N7IA 4LT5A 5T5OA 2XJUA 1UN1A 2GMMA 3K2OA 3VBUC 4OUMA 3JZVA 5JI7A 3LB9A 4DEVA 1JOPA 4PQ9A 3USSA 1X82A 2BOJA 2ZGQA 4L9BA 2VW2A 5L7OB 2D3SA 4CDQB 3AKQA 2RM23 5JIAA 4FXGB 3RZGA 3WR0A 1D4VB 4LO6B 4BCUA 2V73A 3I2IA 4LTAA 2XHKA 2QQUA 3AZVA 4MGIE 4NIDA 1O5UA 4LMFA 4Q26A 1QXPA 4ZY9A 2XQRA 5FPVA 3MF9A 2Z79A 3E6BA 4Q4Y1 1ST8A 3J7NA 2PA7A 5BNOA 2D6PA 4XFIA 1REDA 1XE0A 3DYOA 3OBZA 2VMFA 2KM2A 5FQ0B 2GP5A 1RHI1 4OZXA 1EV12 4XAEA 4PCRA 4V1PA 4LKFA 5GZCA 1CD3G 4X6RB 2ADEA 4MZUA 4PHZA 2VTFA 3UESA 2WQZC 1W2TA 1MS9A 2NN8A 3PDQA 5DUXA 1OFNA 3M70A 1MS0A 1POV0 3RPQA 3RRDA 1W3XA 3VDAA 1UMZA 2DFBA 5DXDA 3S6PA 1PX3A 1QWRA 2Y34A 4NMIA 3S57A 3MIDA 1WKYA 3B93A 1AR83 5FKCA 3RZZA 4YFZA 1E5HA 1NA1C 3HVDA 5FZDA 4CA9A 4YG3A 4CCNA 2WABA 1RXGA 3PLQA 1RUF2 2HEWF 2OQ6A 5HXMA 4CRQA 4YVWA 2W3JA 3CNAA 3EHKA 1F5JA 4LULA 2EXJA 2W95A 4XUNA 4YW6A 3WDYA 3I59B 5SV5A 3ZXLA 1RC6A 1GZTA 2RR13 4CPBA 1J83A 4E4DX 1AR92 5A6YA 1VBC2 4MO3M 1YCIA 1OVPA 3POIA 2ARAA 3T2OA 2C9AA 3ZFGB 3NV4A 3SEPA 5F6KA 2BJSA 2XOMA 4Q0QA 1OQEA 1W6QA 3MIBA 5BY5A 4XFBA 3WF3A 5JDBA 2ZEXA 4L99A 1O8PA 2CL2A 3H50A 4NVPA 2IFWA 4MXWA 3RGBA 2HWB2 2QQPA 1OLME 4B3NA 2OXBA 4P9YA 3VBUA 4JGZB 5CVRA 4KU8A 1AXYA 1EYBA 4OVEA 4SBVA 4GQ7A 4OHYA 2I74A 1LR5A 3W9AA 4QM8A 1SDDB 2XWBB 3W20A 1LOGA 3KS7A 3ZKYA 2W1QA 2RJLA 5IWFA 4DXSA 4X8PA 2CNAA 4NHMA 2RS32 4JV4A 4S2GA 1FMD1 3PURA 3NNLA 1RMU3 1JS9A 2YB7A 4N43C 1U5ZA 4HONA 4RS5A 4JHTA 2WIIB 3WINE 4XUOA 1G86A 2WSVA 2YG0A 1GR3A 1OKOA 2ZEWA 1AYN3 4WVZA 4A4AA 3Q8FA 2BWCA 2ZMNA 5SV8A 5C8CC 5A3OA 1TMF3 3RI9A 1ULCA 1QJZA 1CAXB 3FLRA 5FZ8A 1SFPA 5EJ3A 4B1LA 1DF0A 5I0SA 3TN91 4RGAA 3AKRA 4DEQA 3H3UA 4GMP3 2ZAAA 3ZM8A 4JKMA 4CDQA 2VZTA 5E1RA 5L7OA 1LECA 1OPMA 2VQUA 1VBC1 4MYEA 4ASLA 1D4M3 4D69A 4Y1XA 5A1LA 3J26N 1CPNA 2UY9A 4HXCA 2R041 3OUHA 3KT1A 2WT1A 4AGRA 2ORZA 3T2PA 5CKQA 3TWIA 1W6OB 2RDNA 1PM7A 2DCZA 1MVQA 3G7DA 1J58A 1ND3C 4YM0A 5C71A 1X50A 5AVPA 2P6CA 3QOPA 5GZDA 3KCCA 4MX3A 1EAH2 4QDRA 4YRDA 1AL21 1J3QA 4LBMA 1RVF3 2GC3A 4CCDA 1N3OA 3RWKX 4BQWA 5FAXA 4FPHA 1HN1A 2DBIA 4KG0A 2WAOA 5I8SA 5FUNA 3VBOC 4QU2A 4XIOA 4MADA 4UYBA 4LE3A 4NRPA 1EV11 5FPZA 3O1VA 5AC93 4RR3C 2P17A 4NPRA 5IFPA 4C1WA 3ACGA 5BNNC 1HJFA 2B4KA 4Q1RA 4BIFA 1BZWA 4URTA 2VAUA 1FX5A 4PDWC 2BU9A 1S55A 1K5JA 2DUPA 2PFWA 5FP3A 1WCDJ 5A3WA 3ZXJA 2PLV3 3WF1A 5I8TA 5JZGB 3MLJA 1BXHA 4DOUA 3KB5A 3T2TA 3LA7A 1D2QA 1YYNA 4LBOA 1A3KA 2A73B 4AEDB 4IEVA 2YXSA 4QGLA 4CXYA 2LUWA 1W6PA 3ZX7A 5DAWA 1TG7A 1S0IA 2BDRA 3ECQA 3U4XA 2P5BA 3BOPA 3FC0A 3LAGA 3MUY1 4XXAA 1X7NA 3AP9A 1ULGA 1PM4A 3TN93 4L11A 1PX4A 4BOWA 4AFBA 1XSQA 5IT6A 4IERA 4D8MA 2JDHA 5IAXA 2FCVA 1ZRCA 2RHPA 3HT2A 2R072 2EIDA 4JQRA 4B1MA 1Y9QA 4QX2A 4CDQC 4LQRA 4COWA 1FOD3 1OH4A 1LHUA 1TME2 5A32B 5CAZA 2BWAA 1K5MA 2RR11 4IGOA 4ZU5A 3T0DA 1S2EA 2IZWA 5FCCA 2K2SA 2Q8EA 4COUA 1EY2A 3SCGA 4JCKA 4HVQA 1BMV2 3WW2A 2ZAHA 1JYWA 4BQ3A 1ZA4A 2D3RA 4AK3A 2JDNA 5C3PA 1JUHA 2BQPA 3C3VA 2BUKA 2AEZA 2IXKA 5JR2A 1KFXL 2MHFA 3CDZB 1RUH2 4K3UA 4QX5A 1RVF2 1V00A 3DN7A 1RUJ2 5FP7A 5JXJA 3CJXA 2UY8A 3I49A 4NN0A 4MGTA 4XTPA 2ZHNA 4P9LA 2BPA2 1VBE3 1WBLA 2ZX4A 1S1AA 5LBBA 1RGSA 1RUI3 1KD7A 4LJHA 1GSLA 5A1AA 1ZBE1 5CU1A 3TEZA 5CFDC 2H0VA 2ZGSA 1FOD1 1W9YA 4UW3A 2WNVB 1RUD3 2WZR3 3MEPA 4R4XA 4UW6A 5BPXA 4CDUA 5L36A 1XC6A 3M1HA 3AP5A 4FVVA 2DVGA 1RIRA 4Q4W1 2VTXJ 2F6BA 1VRH1 2GNDA 3QLQA 1CONA 4PJYA 3AKSA 1RUE2 4LUMA 4CEWC 5C4WB 1UMIA 2RS53 3OGSA 4DS0A 3B5LB 1ZRRA 4DRRA 2E9QA 3BPZA 3ZIXA 3NNGA 1YFXA 4B7KA 2WN3A 3D0SA 5IYYA 1ZZCA 3N35A 4IEYA 2EXIA 3ETPA 3C2UA 4H3WA 1MEC2 3OGGA 3PL0A 1MEC1 3I2JA 4G4FA 1F5FA 3VV1A 3UJQA 4Y5SA 1LOFC 4IEUA 3WW4A 3ZIWA 4BK5A 2ES3A 4F3JA 1VIWB 1UZWA 2W5FA 3BCWA 4HANA 2XVGA 3O0XA 5FBJA 3FFZA 4M0NA 5DUUA 5HI0A 2J1VA 5T50A 1S4CA 5FMOS 4CEWB 5A3MA 2QQVA 1GZWA 4J1XA 4XBLA 4Z07A 3ZYGA 4EYUA 4MLOA 1MACA 4XEZA 3N4MA 3VHNA 1AXKA 1S0GA 2R071 4M3CB 1QJX2 2V4VA 1PO11 1JYTA 4CDWC 2R49A 3KT7A 3GDBA 4PT6A 1XPWA 5K4LA 2XH6A 2VC9A 2B5HA 5GM0A 5BNOB 1UU4A 2XBO3 1ZREA 4XTMA 1SG3A 1W3VA 1E5SA 3N9QA 3DEMA 1RVF1 2P2KA 2Z42A 5F3IA 1G9AA 2VO5A 4EE2A 1PVC3 5FO9B 1ND2C 1OLMA 4H55A 5F5IA 1AZDA 1N3QA 2DCJA 3K48A 1LGNA 1QDCA 4JDNA 4I3GA 4N53C 2JDMA 4N90A 4AEJA 1V9U3 4IEPA 5JXIA 2E7TA 4XFFA 2VXJA 1RUJ3 3ZDSA 1K5MC 1V6JA 1JH5A 4XACA 2E63A 5A80A 1XE7A 1RUC3 4FPJA 2ZX3A 5LA2A 2NP0A 2VG9A 3NNMA 4RR3B 5JXHA 1HV0A 1MS1A 2W39A 3BOWA 5J48A 5LATA 1POV3 2GC1A 4I01A 4IV3B 4TSVA 3H8XA 3VDDA 5F39A 2VULA 1NY71 3FHIB 1AYM2 3ZSMA 3VKFC 3HR9A 3R05A 1V6IA 1YO8A 1W6OA 4RGGA 3B02A 4ATEA 3E6DA 1NCQB 3INAA 4NIGA 2FBEA 3KCYA 2WYFA 4NIAA 3VUOA 2Y60A 1LHWA 4GMP1 3FL7A 4QKDA 1TEIA 2PLV1 3U4SA 2IVJA 1GP5A 2VM9A 5DZFA 4AHXA 1AL22 1X9TA 3LA2A 5FZHA 4GJZA 4CEYC 1UPIA 3BALA 4JDMA 2R1BA 2XG3A 5AVAA 4TN7A 4XURA 1CAWB 2NLRA 5IHRA 2VMHA 4PLMA 2VMEA 1HIXA 3PVNA 2HWD2 5F1RA 5DDJ2 1VPHA 4N8MA 1BVVA 2EXHA 3KVAA 4H2AA 5F8PA 2TBVA 1HKDA 4MHUA 3ES4A 1DQ6A 4IW3A 3VBRA 1FPN3 1XNCA 5F5QA 1DGRN 1R081 4GIQA 1PK6B 1I5PA 1GU3A 2EA7A 5DDJ3 1AR73 3WUDA 3FHAA 2VQAA 1BBT1 1PGW2 4O61A 3SQOA 3VBHB 2P3YA 4Y4RA 4OUEA 3AJYA 4QPIA 5FXZA 5FOBB 4CU9A 1X8EA 2YGLA 1UY2A 3NKTA 4Y22A 2DCYA 3AYDA 4KU7A 1X8MA 3HJRA 3RFRA 2XL7A 5ACA1 1LOBA 2DU0A 4XETA 2ILMA 3PU8A 1EAH1 3I2GA 4YVSB 1HB4A 1ZM1A 3H3LA 4BIOA 4O9GA 4YW3A 2YDEA 4YZ3A 2QZ3A 1AHSA 5ERLA 2DYCA 1OD5A 3VHPA 1XYPA 4E9KA 3PIGA 2HYXA 3OOXA 1LJ7A 4GWJA 1RUG3 3MIEA 2FHRA 2R042 1LESA 4AXOA 1FPN1 1CZTA 2QBXA 2XL9A 1VJ2A 1G9BA 3DGTA 3GALA 1ZRIA 4LKDA 1FV3A 2D3PA 3SC7X 4C1XA 5ABJB 1UMHA 5D1IA 3P1IA 2IXHA 3TAYA 2WZR1 2WQ8A 1DGLA 3ZN4A 2ZXQA 4Q0PA 3B69A 5FY9A 3IPVB 1ZBA1 3KCXA 3TN92 2GNTA 1F4HA 4KWLA 4B29A 4RFRB 2QVSB 2O0OA 2WO7A 4UI9L 5K0UB 2J1EA 2JG8B 2IFRA 1S2KA 1ZBA2 4BXFA 1SZBA 4GULA 3I3MA 5FKBA 5A3TA 5FMCA 2VD7A 5GKAC 1HJGA 1MEC3 2R7EB 1H9PA 2H6BA 4C90A 4GB32 4S2DA 5FUPA 1XB9A 2QUOA 2YPDA 5FDBA 1S0EA 4RQPA 1FI2A 1U5IA 1V6NA 2DTWA 4XHXA 1GWKA 1DZRA 4Q1PA 3KQRA 4N43B 3ZYHA 3ZXDA 1GICA 4LR4A 1Q8OA 3ZYIB 1QJY3 4NPMA 4XFCA 1DLLA 2EVXA 2IUWA 3POFA 4BQ1A 1TZOA 1XSRA 2V4AA 1W2OA 2DVBA 4GB33 4RS5B 3TNQA 5KC5A 4PF5A 4Q0SA 5FUIA 1VBD1 2OVUA 5HCBA 4Q0UA 4Z92B 4YGCA 5J98B 2YFZA 4XQ4A 4HKOA 3RZLA 3LWCA 5ANNA 1O7FA 4OZOA 2RVAA 4C0BA 3WG1A 2XJSA 1G7YA 2V09A 2JE8A 1LU1A 2YHJA 1OBNA 4HPKB 2TEPA 1OQDA 4PI0A 4XBNA 4ZXKA 1KJLA 2JDZA 2W9XA 4R9CA 3SKJE 3VBSB 3O1UA 1W04A 3PUSA 3SCFA 1SBDA 4XMIA 3DKWA 4EV0A 2P1BA 2JB8A 5C5TA 1AR63 3JB4C 3GF6A 4HVOA 4I0AA 3H8UA 2X05A 3FFQA 2FCUA 2BERA 4M00A 1B09A 3RJ2X 1RUF1 4IESA 4MSVA 3QBQA 1JI6A 5LZ6A 1WMFA 5GLTA 5CB7A 4JRAA 4ZHNA 3HBKA 3JD72 3AKTA 3R6SA 1POV1 5CISA 4K40A 3PVOA 4Z2WA 4O65A 2PXJA 2Q30A 3MFCA 3D5OA 2VZRA 1IS4A 1J59A 4WVMA 2XDVA 1GP4A 4P9JA 1HX6A 2ZX2A 3M3OA 3V56A 4V2WA 2RV9A 1D0HA 2WNUA 3JBG3 3LEKA 3SH3A 4DY3A 1WLDA 1OQ1A 1RHI2 5FZFA 3WSOA 5FPBA 2Q0AA 2D5FA 1W06A 3WG4A 1PZ8A 4Q4Y2 3K4DA 3OSDA 4Y5TA 1XE8A 2CU5A 4XUPA 3ZXAC 1ZRFA 1W39A 5FV3A 5K7PA 1OMIA 3K75B 1NKGA 5KWRA 3NNJA 4EWAA 2VVDA 2OA2A 3I3DA 2XONA 4YPJA 4B4QA 5C8WA 3T4HB 3S5QA 2HBUA 1Q43A 3AB0A 4LE4A 4ZU4A 3APBA 3OPZA 4QQOA 4JKLA 1PK6A 1QU0A 1VRBA 3VBSC 4DXTA 1I5ZA 2VZ1A 4FFGA 1QJY2 1BBT3 1W6NB 3KSCA 3OD0A 4IEWA 5FYZA 2A1XA 5FZLA 2VNRA 5FYMA 4FTEA 3LSDA 3VDCA 2OZ6A 2VVFA 4BMEA 4J6GA 2Q8DA 2RM22 3HNBM 2ZGPA 1OSGA 2ZGTA 2J22A 3OPWA 1FV2A 5F37A 5F2SA 5JMOA 5LEKA 4QDSA 2DUQA 1CAXA 2R0HA 1J3RA 3O1TA 1V9U2 3I2OA 1CPMA 2PAMA 4LIUA 1CGPA 3B94A 3I3EA 1HRI2 2HWF1 2RDSA 2XUEA 4FPGA 2V72A 2VZPA 3P6BA 2VZ3A 4FXKB 1XXNA 4D6QA 3IM0A 4ZS2A 4J25A 5J96B 2P3KA 4HOOA 5JOYA 1CQ9A 3NSTA 4AI1A 1XBFA 3V64A 4IETA 3ZFEC 4GMP0 4V2VA 3VZKA 3GJAA 4XJ8A 1H30A 3AZZA 4QPYA 4X8NA 1XRUA 3OEAA 3S0MA 2WZEA 4IL7A 1JU3A 2VZUA 4CP1A 3B9IA 5I0DA 1OOPC 1LHOA 1WMDA 4P14A 1NCQC 5JSPA 1UU5A 3L9JT 2LALA 3KVBA 1RXFA 1C3HA 3A7QA 2JXAA 3ZYFA 5HPOA 1ND2B 1KXGA 1W8NA 5I91A 2W47A 4BQYA 1Q8PA 1KDMA 5FREA 3U14A 5K0UC 4HK9A 4JGZA 3ZYJB 1GZ9A 3POBA 2VTXA 1W6MB 3BTAA 3SISA 5K9YA 1I3HA 1J1LA 2Y6FA 2W87A 1AR71 5DZEA 4XAAA 3WW3A 2A6XA 4XVHA 3FWEA 5C5UA 5EJZB 2MNGA 1ASJ1 2NYYA 3AZYA 3WNPA 1N1VA 1SMVA 5AFBA 1W6QB 4W6WA 4Q8LA 5L19A 2VBBA 2PQQA 5LK5A 4F83A 1ZYBA 1YFYA 3ACHA 4XCAA 3LFIA 1HRV1 4AFDA 5LK7B 3RWNA 2DWRA 1GNYA 1C8M3 1CAVB 2QQKA 3BN6A 3M3EA 5FRAA 2E31A 2GNMA 4MUVA 1LEDA 2ET7A 4K1YA 5FMBA 2W08A 1ODMA 2Y6GA 2UYBA 4XILA 4AAXA 4Y1UA 3FE5A 4KH9A 4OUSA 1UIJA 3THTA 1KITA 1NYWA 2GP3A 1QOOA 2R1DA 4UFLA 1IS6A 4UAPA 2AYHA 3PJQA 4KG8A 3BTYA 5F6LB 3NAPA 2RS12 5BV6A 2DDUA 4XF3A 5JIUA 1JHJA 2KXLA 4AE2A 2ZGKA 3M8LA 5FZMA 5JPMB 3V0AA 4KGQA 5IVYA 2RS52 4YGBA 1UNBA 5FZAA 2HBTA 2HWC2 1OF3A 2RJKA 1WMXA 2UWCA 4OHWA 4P02B 1ODNA 3CJIC 4CU6A 3PHMA 4A6OA 1T2XA 1XYOA 2W92A 4ARXA 3MW2A 1ND2A 5ISLA 1SBFA 4FFIA 2MEV1 3AJZA 4FQZA 4QXBA 4XUTA 5FYHA 2PHWA 3LF7A 5FP8A 5FP9A 3ZMOA 4EN8B 4FFFA 1S0FA 4HSLA 2WFF1 5FMDA 3N7MA 2Q8CA 3HN3A 4BWOA 3CU7A 1JZ4A 4CDUC 1ZNPA 2A6YA 3Q9OA 2XVKA 2LRPA 4AEKA 4W50A 1GMMA 3G6JB 3A0KA 1N1TA 1VBB2 4E8DA 4TWTA 1CJDA 1LGBA 1O3RA 3I54A 3W5MA 1H8TC 1VBD3 3CJIB 5KBFA 3J8F3 4M0HA 2GNBA 3LIHA 5FPUA 3QACA 4WZFA 5A3LA 1MQTB 4LORA 1QJU1 3K3OA 4FOVA 5JSOA 5JOZA 1UXXX 3KD4A 4W4ZA 3ZR6A 3ILRA 1DGRA 3ZFGA 4ZZ5A 4K1ZA 1SLLA 2IXLA 2UWAA 4ARYA 5KHGA 3WCRA 3NL1A 2RMU1 3MIFA 1AR93 2IXIA 1UYYA 2D40A 3ENRA 3NJYA 4L92A 5DAVA 3WZ1A 3WNNA 4PLNA 4E2GA 1W6MA 3AP7A 3ITQA 1WLWA 2MEV2 2B42B 2FCTA 4XF1A 4XE9A 4N9IA 3JQWA 4K8RB 3POEA 4PIYA 5HCAA 4BDVB 2ZGRA 4AAPA 3PNAA 3OGJA 4AVVA 5CEHA 2XVLA 1CX1A 1H4GA 5FXWA 3WUCA 1AYM1 4TLGA 4BPZA 3WF2A 1H6YA 2Q1ZB 2QQNA 4Q4X1 5IVEA 3U0ZA 2W2IA 2D98A 2ORXA 5FYYA 3SKVA 2WS91 2Q5TA 1KFUL 2WNOA 3VDDB 4FPFA 2ETEA 2W1SA 4QXKA 1H9WA 1JW6A 2XWJB 2CHHA 4WM7B 5KHKA 1UCXA 2C0ZA 2E26A 4P08A 2FDGA 1WA6X 3T08A 1M4WA 5IVVA 5BNNB 4GD4A 4N53B 3VBHC 1CN1A 3MV11 1OD3A 2W94A 4NO4A 4COYA 5JZGA 1PIV1 2W0XA 4ES8A 5KHIA 1RB8G 1LHVA 5IATA 3ES1A 3EB7A 3PMEA 3D8CA 1U5XA 2AR6A 2X53S 2Y0IA 3IAPA 4K9SA 5FYVA 4YGEA 4EZHA 4QPGA 1Y9MA 3QH7A 1AL0G 1ND3A 2VU9A 2LW8A 5LEJA 4WVWA 2B45X 4NHLA 1SLIA 5CYYA 5CFCB 4YYOA 4AEDC 3DYPA 1QIQA 3T1MA 4KBBA 4BZ4A 2EIGA 4RHV2 1VALA 5ACA3 3VZJA 3ZSLA 2YBSA 5BNPC 2WLQA 2DTYA 1W8TA 3RJRA 3CJIA 1YQCA 3POSA 3UJOA 2YC2A 1YRZA 2Y26A 2R062 2JG9A 2VR4A 3VBSA 4Q4Y3 3ZFFC 3VZLA 2J1AA 4JHZA 1LKNA 1SLTA 5CG8A 3NWKA 4AI3A 4B4RA 3LEGA 1NXD1 3B00A 5FK7A 3C7EA 3HBZA 4XJUA 4UF0A 4G9SB 4JDOA 5K8SA 4DFSA 3UK9A 4OHZA 1GZCA 2PHXA 3VKLA 1O3QA 1GUIA 3E5UA 1D0GA 1EP0A 3N7JA 4HG6B 1APNA 3M3QA 3WD5A 1OKQA 3O5SA 5DAQA 4Y3OA 1GBGA 4UOJA 3GBGA 4YLZA 1FT9A 1RUI2 2Z2SB 4MGKE 1O59A 4AG4A 1PNGA 3DPRB 1UWWA 4AVTA 4Q5OA 4MXWB 4AQSA 2HWF3 2PN5A 4YARA 3H8RA 1QNWA 1UZVA 1C8M2 4LA2A 3ZO0B 3RI8A 1DQ5A 1KRIA 3H7JA 2C6SA 1AX2A 5JWPA 2PHRA 3VN4A 3S7EA 2AEYA 4AL9A 1KS4A 3NAPB 2GN3A 4MV2A 2WFPA 1JODA 1QJU3 5F3CA 1IQDC 1YLLA 3IIAA 3T1LA 3W21A 3BU7A 3LDKA 1HRI1 2BP6A 1NQDA 2HWF2 2IXJA 2YBPA 2J1UA 5FWJA 3IMMA 4NHKA 2HWE3 4GXLA 2ZCWA 1KQRA 3CO2A 5EJ1B 5FZ9A 1OC1A 5IVFA 1ZZ7A 2YYOA 1I1EA 2R30A 4GAZA 3KHCA 2AH2A 5K0UA 2G1MA 5BUVA 1F2NA 4QQLA 4Y22B 1UL9A 1ZZ6A 5DAXA 3LPFA 1QJY1 4PBPA 4BH9A 1AXZA 4QPGC 2VNGA 2ZS6B 4YSFA 1WUVA 2QQJA 1PZ7A 2BGOA 1KJRA 5EV7A 1UAIA 1UF2C 2C5DA 2WSUA 3ALQA 3I4IA 4E4SA 4DPNA 4F7ZA 2FMDA 4CUCA 4IV1B 5FY5A 1V6LA 4JGYA 1C28A 2RR12 3E97A 5BYNA 3OBRA 4YW2A 3ME2A 4LO8A 4BISA 4LBNA 5F3EA 2XJQA 3E6CC 2R063 1CAUA 4YVWC 1DYOA 4UT5A 3ILNA 4OULA 4PDWA 4ZU7A 3KV4A 1TQ5A 2UURA 4XDPA 2ZGLA 3KV9A 1IKQA 4QHBA 3TEXA 5FZ1A 1SACA 4UFHA 5LBCA 5J3UA 3ORJA 5A7WA 2GDFA 1MZEA 1O4YA 3JU9A 1ONAA 1ZRDA 1CR7A 5JAXA 4AFAA 1ZZ9A 1JZ7A 1K42A 2H0BA 2RS13 3LCPA 4FPOB 1JBCA 4CXWA 1Y43B 1HW5A 1ULPA 3F2ZA 3NMBA 4QX7A 2Q1MA 1YQ6A 2G4IA 4LXLA 3SH5A 3WNMA 4CEYB 3VLBB 2CAUA 3RMYA 3ZFEB 1JYXA 2HEVF 2VCAA 4CZSA 1H2MA 2YPJA 5DQ0A 2NM1A 3VKMA 1QF3A 2OQ7A 1Y4WA 4LBQD 2MEV3 3O1SA 4KMQA 1BYHA 1V70A 4P5YA 1SDWA 4EN6B 5JR7B 1SCSA 4YZ4A 1UO9A 3CZUA 3LSEA 2JG9B 2CGOA 2WA3A 4HKLA 1ENSA 2X5IB 3M3IA 3Q8AA 3GM8A 5FPXA 5EHDA 1OI6A 1V6KA 3H0OA 4BYYA 1IG0A 5FXVA 5GALA 4WVMB 4R9BA 1XYNA 2DBNA 3BIWE 3IT8A 4UFJA 1COV1 1W6NA 3MBWA 5CFCA 4A2UA 4UW5A 1Z7S3 2LS6A 1VBD2 4YVSA 1ND3B 3OB8A 4KL1A 5JCTA 4XC9A 5DMYA 4FTBA 3TRSB 2AENA 4QKBA 1A8DA 1MPXA 3OY8A 1OUXA 3PMSA 1GV9A 1SFNA 2C26A 2W52A 3BKZA 2OIIA 3N7LA 2FZ1A 2QQWA 2AZ5A 4R8HA 5DN2A 3ZFEA 4AR2A 2ID4A 3B3QE 4KI5M 1EUTA 2JX9A 1UU6A 1SLCA 3JQXA 3N9LA 1FATA 4ES9A 1QOTA 3CF6E 5A1FA 1BCXA 1AYN1 1YNAA 3LZZA 4TXWA 2CSGA 4QB2A 4XOGA 5A70A 1YJKA 2BFUS 4JQTA 5C8CB 1PNFA 5ANQA 4A44A 2MPFA 2VOXA 1YQ2A 2JENA 4LK7A 3SMHA 3ZKUA 4IXLA 1WW4A 1V6OA 2LM3A 1E57A 2XPJA 3K3NA 3VKOA 1DBNA 4JGYC 1W0OA 2VXRA 4ATFA 5KC6A 3ZN6A 4HZFA 2R043 4WZCA 5EZWA 5T55A 1S0DA 3LQCA 1OLRA 4WBBA 1LU2A 1IGOA 5FBZA 4EJRA 4A45A 3LGRA 2EALA 4XCBA 4Y1YA 2AUYA 2VBDA 4BK4A 3AYEA 1GQGA 3KWVA 3ZOIA 5LA0A 4M01A 1IG3A 1XNKA 4DO0A 2ZZQA 4HL0A 5GLVA 3WG3A 3MI8A 4KWUA 4A7YA 1O5LA 2ZHMA 3ZDVA 4LK6A 1OT5A 4Y1ZA 1QJFA 2XGXA 2YU1A 1W2UA 3GGLA 4RHV3 3WLUA 1ZBA3 4DMIA 2GAUA 2Y0OA 1O4TA 1XNAA 2QDNA 2ZZJA 3TB0A 3Q8EA 3IDEA 1NA1A 4DY5A 1GFF2 3ZSJA 1VBE1 2R6QA 1R1A2 3FX3A 2A6ZA 3FBMA 3O1RA 3HN1A 4Q29A 4YGDA 2W91A 4TYSA 1WZXA 2OS2A 4RQPB 5J36A 2R073 4G3YC 4FSJA 3VL9A 3MICA 2WINB 2E51A 4RD7A 1AR81 3WDVA 1WA4A 4HLTA 2OX0A 2WS92 5A3NA 1QKQA 2ZKLA 1QDOA 1IPSA 3TEWA 1US2A 2HWD1 3AMPA 5FPAA 1OURA 4AOCA 4DINB 4CU8A 1O91A 2VOVA 4XQDA 4DRVA 3EO6A 4NOTA 2RG4A 4M3CA 5IW0A 5IK4A 1WMEA 5GZEA 1W2AX 3U07A 2ERFA 2WAAA 2YGMA 3I2DA 4CYDA 2CAVA 1UX6A 5A33B 4XZUG 3LE0A 2ZMKA 4QX3A 3BIEA 1QOSA 2FQPA 5G04L 5IK8A 3SXWA 5CG9A 5A6XA 3ZMNA 2D6OX 2O8QA 2OKXA 4ITCA 3VD9A 1H8TA 3ZVXA 5LA1A 4WM7C 1W8UA 4BLJA 1NQJA 5D8AC 1NCRA 2ARXA 3CEWA 1B35A 5FLHA 3OBTA 4DUVA 1UKGA 4JTNA 5LW9A 1W05A 4QXHA 1HQLA 2PHUA 4N43A 1ZX5A 5HXVA 1RUG2 1ENRA 3HNMA 1S0BA 1JZ5A 1XU1A 3WXPA 1VBB1 1N1YA 3AMNA 4RYDA 1PO23 1DCSA 1UOJA 3BODA 3GBWA 3ST7A 2QDRA 1AR61 2ZACA 3PUQA 4YZ2A 2J1RA 3IAQA 1W0PA 1NE4A 3A22A 4CP0A 5A7OA 1W28A 3O1PA 2PTMA 1RL3A 4UWDA 1H4HA 2W68A 3FMGA 1BEV1 1TME3 1M06G 1EV13 1C57A 1RJ8A 4BQ5A 3NV1A 4QQHA 4BMBA 3BVCA 3ELNA 3BU0A 2AACA 4P9WA 1CWPA 1W8OA 2B39A 1D4M2 3ABZA 4GWIA 1O8SA 5FY4A 4D7TA 4K7JA 4XW3A 3WP4A 2HWC1 2JDKA 1T6BX 2ZGOA 1OFSA 3K46A 2DUOA 3MFAA 5F5CA 5FYSA 5T3NA 1VB2A 2VW1A 1F4AA 2KR2A 2RS11 3WP6A 2Y33A 5E8AA 2BNMA 5LCWL 3HOBA 1AF9A 5L9BA 3OF1A 1XNBA 5LBEA 2BNOA 2VL4A 3IZOA 3AMMA 2Q4SA 4YW4A 4EN9B 2QTWB 4D0QA 1GNZA 1YC61 4Q8KA 3KV6A 1K3IA 3OCPA 3WG2A 2I45A 4AHWA 2SBAA 2Y38A 5LWBA 2XBO2 1OLQA 1GYKA 3DXUA 4K8FA 2ZA9A 4LO5B 4A3ZA 1MR5A 3HAGA 1H2NA 3GCWA 1DP0A 2WDBA 1BQPA 3H9AA 1IKPA 4LPLA 4R4ZA 4YM1A 3VBFC 2QQMA 3N7KA 2F4PA 1B35B 1H1IA 1ULEA 5FMOL 4ASMB 2D97A
chains in the Genus database with same CATH topology
5FMDA 4FFGA 3KF5A 4UFLA 2ADEA 3SC7X 2QQVA 2AEYA 3U75A 4CCCA 1W2TA 4UFIA 3U1XA 4UFJA 5FK7A 4JQTA 3LDKA 3NMBA 2AEZA 4HXCA 1UYPA 4QHZA 3LDRA 3PIJA 3IMMA 3LFIA 1Y9GA 1Y9MA 3UGGA 4CCEA 5FKCA 3ZR5A 2QQUA 2ADDA 3H3LA 5FK8A 3OSDA 5FIXA 2OXBA 1Y4WA 3LIHA 2AC1A 3U14A 2XQRA 3KF3A 3LEMA 3LIGA 3PIGA 4FFHA 5FMBA 4B1MA 4UFKA 1ST8A 3HBKA 4AZZA 3UGFA 4FFIA 5ANNA 3RWKX 3S5QA 3ZR6A 2QQWA 4UFHA 4B1LA 4EQVA 5FKBA 4CCDA 3LF7A 4UFMA 5FMCA 4FFFA 3UGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FMD A;  4FFG A;  3KF5 A;  4UFL A;  2ADE A;  3SC7 X;  2QQV A;  2AEY A;  3U75 A;  4CCC A;  1W2T A;  4UFI A;  3U1X A;  4UFJ A;  5FK7 A;  4JQT A;  3LDK A;  3NMB A;  2AEZ A;  4HXC A;  1UYP A;  4QHZ A;  3LDR A;  3PIJ A;  3IMM A;  3LFI A;  1Y9G A;  1Y9M A;  3UGG A;  4CCE A;  5FKC A;  3ZR5 A;  2QQU A;  2ADD A;  3H3L A;  5FK8 A;  3OSD A;  5FIX A;  2OXB A;  1Y4W A;  3LIH A;  2AC1 A;  3U14 A;  2XQR A;  3KF3 A;  3LEM A;  3LIG A;  3PIG A;  4FFH A;  5FMB A;  4B1M A;  4UFK A;  1ST8 A;  3HBK A;  4AZZ A;  3UGF A;  4FFI A;  5ANN A;  3RWK X;  3S5Q A;  3ZR6 A;  2QQW A;  4UFH A;  4B1L A;  4EQV A;  5FKB A;  4CCD A;  3LF7 A;  4UFM A;  5FMC A;  4FFF A;  3UGH A; 
#chains in the Genus database with same CATH topology
 4IND A;  1RIN A;  1U0A A;  4WM7 A;  2RJ2 A;  1DQ0 A;  1S2B A;  3AVS A;  3FHQ A;  2Y6J A;  4RGK A;  3WCS A;  2PHL A;  2QE3 A;  4BA6 A;  2WJS A;  2WT0 A;  3NAP C;  3N9N A;  5M0T A;  5B2G B;  5KXE A;  2GME A;  3KQ4 B;  2YUE A;  5A7N A;  3UKN A;  4C0H A;  1YI9 A;  4QPG B;  2ADD A;  2IXC A;  4D3W A;  4YVS C;  1KDK A;  5C3O A;  3MIG A;  1S0J A;  2VOT A;  3KZ4 C;  1PMJ X;  2VUA A;  5C6C A;  1OHF A;  2GAL A;  3K4A A;  4N9H A;  4HMZ A;  1B35 C;  2V5D A;  5DAB A;  5IVJ A;  4EQV A;  1UOB A;  4IE6 A;  1G9C A;  1HQW A;  1NCR B;  5FZ7 A;  3PUI A;  1W9T A;  5HCH A;  3RZK A;  2VUD A;  2A75 A;  4LKE A;  1HN0 A;  4XF0 A;  3BUC A;  2CYF A;  2IVI B;  3POJ A;  1L7Q A;  4URA A;  3D4K A;  2K9Z A;  2WO3 A;  5IFT A;  1MQT A;  2WWU A;  3L2H A;  1EAH 3;  1VBB 3;  3J4U H;  1DHK B;  1RTV A;  1UQX A;  3F95 A;  4ORF A;  3JBG 2;  4A6S A;  4WM8 B;  1H1M A;  4YZ1 A;  1R1A 3;  1UYX A;  3I59 A;  4QM9 A;  3BTX A;  4HSJ A;  4FQ4 A;  5LY1 A;  1W0N A;  3AVR A;  5CKN A;  4E8C A;  1WCQ A;  3VZM A;  2WA4 A;  1XU2 A;  4LBL A;  3RZH A;  1VBC 3;  1E5R A;  1W9W A;  4YFW A;  1GQP A;  4NRM A;  3WDT A;  3BGA A;  4ISR A;  5LA9 A;  5LB6 A;  5EXO A;  1Q8Q A;  3H3Z A;  1HB2 A;  3UYJ A;  2ENR A;  1Q8S A;  1RUC 2;  3R4D B;  4NWW A;  3NQH A;  2A71 A;  3TOJ A;  3IKW A;  5FPL A;  1JOB A;  4ZZ8 A;  1LOC A;  5A7P A;  4IGQ A;  4FI9 A;  2CV6 A;  1GOG A;  3T0A A;  3J8F 1;  1C4R A;  4N7U A;  3TEY A;  5FY8 A;  2NPI A;  4FO9 A;  1LEM A;  2P6H A;  5FWE A;  2WRA A;  4QD2 A;  1UD1 A;  2A7A A;  3ZXG A;  1WGP A;  2JDP A;  1OUS A;  3OG2 A;  5H9S A;  1ZBE 3;  3R0R A;  4AHY A;  4Z2A A;  2ZKN A;  3K51 A;  4QU1 A;  1CIY A;  4JGY B;  4YVW B;  5DZG A;  4ERO A;  5ACA 2;  1PO1 3;  1ULD A;  2WUH A;  3K4Z A;  3NJX A;  1JZ2 A;  3PUA A;  2VPV A;  5D8A A;  4CP9 B;  4L97 A;  3CL1 A;  1CJP A;  5D21 A;  4UBG A;  2RDQ A;  1WCK A;  3J9S A;  4FPL A;  1E5I A;  5FZE A;  2OZJ A;  4QB1 A;  3WNX A;  1UOF A;  3NVC A;  3GXU A;  3MPP G;  4YWA A;  2O14 A;  1QJE A;  4E4H A;  2BYV E;  5JOX A;  3H8O A;  1PO2 1;  3BB6 A;  4KGG A;  2D5H A;  5EPA A;  4DNY A;  1GNH A;  1LNS A;  2C4X A;  5FZI A;  3ZYP A;  2JG8 A;  3NNF A;  1UYP A;  4HFS A;  1GP6 A;  4Z8B A;  3WF0 A;  2JWP A;  3VGI A;  1GLH A;  2PAE A;  1WW5 A;  3X29 B;  1DLC A;  3V0A B;  4JAA A;  3AKP A;  2JDU A;  1BLZ A;  1SBE A;  2WKK A;  2YBK A;  3LDB A;  5C4W A;  4F8A A;  5LRS A;  5L7O C;  4XBQ A;  1RJ7 A;  3P5B A;  2E33 A;  4FPE A;  4KBZ A;  5C3R A;  1AR8 2;  5JXG A;  2YRO A;  2VMC A;  2B46 X;  2LRO A;  3IDC B;  4E4Z A;  3HD8 B;  4HN0 A;  4QKF A;  2HEY F;  5IK7 A;  1YUD A;  4S2H A;  1H8V A;  4FCA A;  4GH4 A;  1C8M 1;  4Y20 A;  5B4N A;  1VAK A;  4ZS3 A;  1FNY A;  3R4S A;  1VBE 2;  2GC0 A;  4S2F A;  1PGL 1;  1G9D A;  1DQ1 A;  4GZ9 A;  4FP2 A;  1RUI 1;  2VZV A;  2VW0 A;  1UY3 A;  1FMD 3;  1VB4 A;  1V0A A;  2BFU L;  3EXU A;  2WO1 A;  5DG2 A;  1R64 A;  1IOA A;  5FJH A;  3WNO A;  2EIC A;  2CDP A;  1CIW A;  1GAN A;  4FP3 A;  4XFG A;  2JEM A;  2EAA A;  3V0B A;  4LKS A;  1X36 A;  1QHD A;  1EPZ A;  4XFH A;  3WDW A;  3V0B B;  1Z7S 1;  2WNV C;  4M4R A;  4P9G A;  5APA A;  1FMD 2;  3UV9 A;  2W1W A;  4A3X A;  2QFE A;  4RFT 0;  1UY0 A;  1RUH 3;  2NZ9 A;  3C7G A;  4GKX A;  1QGL A;  4RR3 A;  3W58 A;  2AGS A;  4NPL A;  5LY2 A;  3MF6 A;  2WC2 A;  5FY0 A;  4GB3 1;  1SQ4 A;  5DG1 A;  1R08 3;  5EQU A;  5I8Y A;  4GJY A;  2ARC A;  1WD4 A;  1WLT A;  1Z7S 2;  1QQP 3;  1UIK A;  5FR3 A;  2EXK A;  2GH2 A;  3AMQ A;  3RNS A;  4HT1 T;  2A3W A;  1DYK A;  2JIG A;  3AK0 A;  2ZPX A;  3P3N A;  4OLL A;  4P00 B;  2X10 A;  5FZO B;  2HYK A;  1ACC A;  1PMH X;  4B7E A;  1RUE 3;  5J37 A;  1IPJ A;  1L7L A;  3J7H A;  4RS5 C;  1NE6 A;  4QPI B;  1URX A;  3EQE A;  3HWJ A;  3GHM A;  4WVV A;  5FYU A;  3VL8 A;  3KM5 A;  4IV1 A;  3ZFF A;  3RSJ A;  4ASK A;  5KXC A;  1JU4 A;  2C1F A;  1CZS A;  1AYN 2;  3C8X A;  3CHX A;  1YHF A;  4MHR A;  4XZP A;  4LHS A;  4OYU A;  3SIT A;  2WO2 A;  3VBR C;  4BJ0 A;  2JEC A;  3BPS A;  2VCC A;  2FDI A;  4K21 A;  4CCO A;  1RUF 3;  2ZGM A;  5E16 A;  4CPB D;  1FPN 2;  1YEW A;  4CDW B;  2VBP A;  3IBM A;  4OI2 A;  1JYV A;  2PHD A;  3W5N A;  2Y6H A;  4QHZ A;  2EF6 A;  3T3Y A;  5FZO A;  4L0P A;  4I0W B;  4PF1 A;  3WQ7 A;  3I8T A;  1A8M A;  1FAY A;  1UZZ A;  3RS6 A;  4XF9 A;  4XYX A;  2XUM A;  3UGF A;  3WEZ A;  1SEF A;  5J7M A;  3KHB A;  4QDQ A;  3DUI A;  3O12 A;  1DYP A;  2R32 A;  3OYW B;  3WP3 A;  1BBT 2;  1PGW 1;  5KHH A;  1AUY A;  2BW8 A;  3MPB A;  1JN2 P;  1X9P A;  4IE7 A;  1AYM 3;  4UFI A;  1VAV A;  1REF A;  1QJU 2;  1ZVF A;  4AF9 A;  2YC4 A;  2P3I A;  3POW A;  2VOK A;  2WZ8 A;  4QMA A;  3RYK A;  3QD6 A;  2WNV A;  1VAM A;  1HXS 2;  2JJ6 A;  4AEM A;  3DPR C;  1VRH 3;  4E2Q A;  1RUD 2;  3MGU A;  1VR3 A;  4CDX B;  4FPK A;  3N9P A;  5FIX A;  1HB1 A;  2OW4 A;  1VMJ A;  4W6X A;  2ZEZ A;  2JE7 A;  1UPS A;  4QXC A;  2VEC A;  1R09 1;  1XQN A;  1K12 A;  2RDR A;  3P3P A;  4RQP C;  1J1T A;  1LOA A;  3GZE A;  1VMF A;  3POY A;  4Y20 B;  3AP4 A;  3S30 A;  2V5Y A;  1IS5 A;  1G6N A;  5A7W B;  3ZFG C;  1WLC A;  2BBA A;  2ZGN A;  1BVP 1;  5A3U A;  2PLV 2;  3U75 A;  4BHP A;  1OOP A;  1WWY A;  1DG6 A;  2VNV A;  2ZX0 A;  2H6C A;  3KV5 A;  4Q4V 1;  1IPK A;  1DQ4 A;  1H2K A;  4MVT A;  3UT0 A;  3ZXK A;  3MLK A;  4XJA A;  1U12 A;  4XJ9 A;  1RYY A;  1PVX A;  1Z78 A;  3I2K A;  2DU1 A;  1UXZ A;  2P4E A;  3O0V A;  3RG0 A;  4CXX A;  1D2S A;  5T5L A;  4EZ4 A;  5F9T A;  1UOG A;  5FFO C;  5A32 A;  2JDA A;  4NII A;  1WW6 A;  1WCU A;  1STM A;  3FN9 A;  2JDY A;  2EIE A;  2JIJ A;  1QQP 1;  4UXA A;  2QQI A;  4Y26 A;  4QHO A;  1HV1 A;  4LIT A;  3WHT A;  1XNT A;  3VD5 A;  5C3Q A;  2QQO A;  3IDA A;  4AGG A;  4LO4 B;  3UET A;  2X09 A;  5JUV A;  3CLP A;  4P9I A;  2PAK A;  3GBF A;  1GOH A;  2JB4 A;  3C7H A;  2P37 A;  3DCQ A;  5FOJ B;  4CCJ A;  1O3S A;  1QH7 A;  4GAL A;  1CAV A;  1Y3T A;  1RUC 1;  3ZN6 B;  4PQQ A;  5BNP A;  1RUO A;  1PVC 2;  3JXS A;  1SPP B;  1VBA 1;  1ZZ8 A;  4XFA A;  5IK5 A;  2R0F A;  2Z4F A;  5JOW A;  3WX5 A;  1AJK A;  2C9K A;  4AZZ A;  2N7G A;  5I0T A;  2NMO A;  4DXZ A;  1GWL A;  1QJX 1;  3ATG A;  4UFM A;  2HWC 3;  5A6Z A;  2QNK A;  1MS5 A;  2WNU C;  3I7D A;  2D43 A;  4Q0V A;  4MGS A;  5JSR A;  1K5M B;  5EWS A;  4HBN A;  4AVS A;  4COV A;  5A7S A;  3RVH A;  3A0N A;  3H7Y A;  3OUI A;  5LAS A;  4IEZ A;  4M4P A;  3ROU A;  3VHR A;  1BK1 A;  3RDI A;  3OD4 A;  1FNZ A;  1QXR A;  1MS3 A;  2XBO 1;  5FZB A;  3D82 A;  2F4L A;  1DU3 D;  1YJL A;  3EBR A;  3EYP A;  3KGL A;  4O7X A;  4QT6 A;  1US3 A;  4CP2 A;  4I02 A;  1VMH A;  4BXS V;  4QQ2 A;  1JYI A;  4JC1 A;  1F15 A;  1DIW A;  4EN0 A;  1ALY A;  1XND A;  3LFM A;  2B9V A;  1D7P M;  1QH6 A;  3AYC A;  3LEI A;  4HVR A;  1VE0 A;  1S0C A;  5T52 A;  4AHZ A;  5FXX A;  3WDX A;  1W9F A;  1YWK A;  4LLO A;  4W8J A;  1JUI A;  4CEY A;  4AI8 A;  4L8Q A;  3GZA A;  1RUE 1;  3AFG A;  2QZ2 A;  3AP6 A;  4NRO A;  3I2H A;  4PBO A;  2BGC A;  4Q4W 2;  3NV2 A;  2QQL A;  3WF4 A;  4HET A;  2QJV A;  1UY4 A;  2R06 1;  1F9K A;  3VBR B;  2VUC A;  3WP5 A;  4IE5 A;  3MO4 A;  3RYR A;  4LUK A;  3WNL A;  4OCT A;  2WLP A;  1FOD 2;  2YZ4 A;  5FLJ A;  1CVN A;  3FZ3 A;  4NIH A;  1D4M 1;  2E6V A;  2WS9 3;  2GU9 A;  3O0W A;  3OBA A;  3HNY M;  3JB8 A;  4OI0 A;  4IE0 A;  3WOG A;  3PVE A;  4Q4X 3;  5BXX A;  3OJB A;  5GZF A;  4AQ2 A;  1W03 A;  1W9S A;  3ZSE A;  4YW1 A;  4CE8 A;  1OXC A;  2PQS A;  4NUB A;  2RM2 1;  1NAE A;  2VMG A;  3DKQ A;  1RUH 1;  1W90 A;  5FZ4 A;  4A7K A;  3BTZ A;  1SCR A;  4QWN A;  4LOS A;  3MLL A;  4LBQ A;  2JKB A;  2DCK A;  5BNP B;  3MUZ 1;  1TNF A;  2BEO A;  1G8W A;  4NJ4 A;  5FYT A;  3MHZ A;  4Y33 A;  2CGP A;  1PGS A;  2NMN A;  1AJO A;  1MQT C;  2A3Y A;  4I09 A;  2ZGU A;  3UNP A;  4IEQ A;  3WY6 A;  1RUG 1;  2Y64 A;  3OY8 B;  4GA9 A;  4P9X A;  1DZT A;  1QQP 2;  1MZF A;  1C1F A;  1YXW A;  1DDL A;  2VNO A;  2W46 A;  2VZQ A;  3D0J A;  1OA3 A;  5CAD A;  2O1Q A;  4A42 A;  4L2N A;  4AI9 A;  3V65 A;  4U36 A;  3A23 A;  4NAM A;  1GKB A;  3N9M A;  2UWB A;  3ZXF A;  4EN7 B;  4MG2 A;  3MW3 A;  3ACI A;  5L9R A;  4GH4 B;  4XDO A;  5BNO C;  5EYX A;  3ASI A;  3VBF A;  4W65 A;  4QKN A;  3SEE A;  3VBO A;  4BQ4 A;  2A6V A;  4OQ9 A;  1JTZ X;  3THC A;  2E53 A;  3ZLI A;  1W8W A;  3MDP A;  4BM8 A;  5F7U A;  2XLG A;  1YQ5 A;  4XF4 A;  1QEX A;  2WQ4 A;  2VH9 A;  3LOB A;  3JD7 1;  4JRL A;  1R09 2;  3C7O A;  1QJX 3;  5IVC A;  3GJB A;  1TE1 B;  3GNE A;  4AI2 A;  3ZSK A;  4U2A A;  5CKM A;  4AFC A;  3ZR5 A;  4NHX A;  1RUD 1;  3AX4 A;  5FYB A;  2Y6K A;  3AL5 A;  4IE4 A;  1K45 A;  4NRQ A;  3WQ1 A;  3UKT A;  3CKH A;  1WCS A;  5I0R A;  5KHJ A;  2PYT A;  1WW7 A;  4FPY A;  4Q4W 3;  4XIK A;  5FJK A;  4CCL A;  3PUH A;  3WVJ A;  1JZ8 A;  3NKG A;  4LLF A;  4QX8 A;  5ABJ C;  1LAJ A;  3VZO A;  2UYA A;  1NLS A;  2OPW A;  2A6W A;  4WM8 A;  3L2Y A;  4WV8 A;  5F3G A;  2D93 A;  2P34 A;  4RN5 A;  4UW4 A;  4TLF A;  1GWM A;  4JVA A;  4CU7 A;  2HWE 1;  5BNQ A;  1U5Y A;  1BHG A;  2EAK A;  3U1X A;  1JHN A;  2XXZ A;  4NWV A;  3OYW A;  5DPN A;  4MOA A;  2GSY A;  3III A;  3VBF B;  1SPP A;  4BU2 A;  3B9C A;  3N36 A;  5CZK A;  5DAP A;  3O14 A;  4FOQ A;  2JKX A;  1H2L A;  3U11 A;  4DIQ A;  5I93 A;  1LOD A;  1YFU A;  5E88 A;  3U78 A;  3KF3 A;  4IGP A;  3T09 A;  4DZG A;  5FO8 B;  4J1W A;  4Y1V A;  5AC9 1;  2YC0 A;  1JZ6 A;  4IUG A;  1LCL A;  2XKO A;  2XML A;  1HXS 3;  1O4Z A;  1Q3E A;  3FBY A;  3NJV A;  1RUN A;  1NZI A;  5FP4 A;  3GZU C;  4NAO A;  5CBL A;  2O8O A;  4FTS A;  2YMZ A;  3RQ0 A;  5IVB A;  2BGP A;  2FDF A;  2DV9 A;  1JOJ A;  1HB3 A;  2PEL A;  2CGN A;  4I0B A;  4ZPI A;  5C9A B;  3UGG A;  4OHV A;  3SH4 A;  1NX9 A;  4C91 A;  5KXD A;  2VE1 A;  5G05 L;  2E32 A;  3CMG A;  2AC1 A;  3N3H A;  3R4U A;  1LUL A;  2I07 B;  1TMF 2;  2PMW B;  2WNE A;  1HRV 2;  2XKP A;  3NRU A;  3PJY A;  4MET A;  4Q27 A;  3UL2 A;  1NLR A;  2ZEY A;  3GHN A;  4RSU A;  3RMX A;  3POG A;  4CSW A;  1OF4 A;  2ZJC A;  4H7M A;  2VUJ A;  2VMD A;  5TSW A;  4AVB A;  1PZ9 A;  3PVB B;  3KF5 A;  1QY4 A;  2HWD 3;  4CDX C;  5FY1 A;  2ATF A;  1H6X A;  1KGY A;  3AM2 A;  1EPW A;  1SFY A;  1T6G C;  5GLW A;  4GWN A;  2CY6 A;  4DXR A;  1PIV 3;  5FTT C;  4XMA A;  1O6U A;  1P8J A;  2BVV A;  2JG8 C;  2D6L X;  4YM2 A;  3KT4 A;  1LB2 A;  4I2O A;  1OH3 A;  1F8V A;  4ET7 A;  4LHL A;  2KA3 A;  2WWJ A;  1W8Z A;  1L3J A;  4FT8 A;  3DXT A;  3SNM A;  5JI9 A;  3T0B A;  4QQP A;  4UFK A;  3ETQ A;  3HQU A;  4E27 A;  3NW4 A;  4K6B A;  2OPK A;  3DYM A;  2LTN A;  4LIV A;  4HN1 A;  2BZD A;  3H1M A;  1Q5O A;  5CIR A;  3E1F 1;  5C9A A;  5JLV A;  1PGL 2;  4IQP A;  3SLI A;  3ZPO A;  1POQ A;  1R08 2;  1SHW B;  3FUO A;  3IB3 A;  5FO7 B;  3FJS A;  4Y5Z 0;  1AR9 1;  4GH4 C;  4R52 A;  2IWG B;  3HMY A;  4DUX A;  3HQR A;  2BTV C;  3WV6 A;  3ZXE A;  5DDJ 1;  4LHK A;  5GJ6 A;  2D44 A;  4LHN A;  3A4U A;  5I0U A;  3SHR A;  3S5A A;  4OMD A;  3NO8 A;  1REE A;  1KS5 A;  3OEB A;  5C8C A;  5EP9 A;  3O1M A;  5JVV A;  2L9L A;  2A5Z A;  2QCS B;  3DV8 A;  2IC1 A;  3H1W A;  1LGC A;  2YY1 A;  3K77 A;  1VBA 2;  4RA0 A;  5GZG A;  1XOY A;  3MV0 1;  1A78 A;  5T54 A;  1JZ3 A;  4CCE A;  1V6M A;  4AED A;  1AX0 A;  1COV 2;  1PO2 2;  4HK8 A;  1HDK A;  1NG0 A;  4OMC A;  3FUQ A;  3BI3 A;  5DUV A;  4FAH A;  4PI2 A;  3USU A;  4D94 A;  5FLI A;  4CEW A;  3ACL A;  3WHU A;  4FBF A;  3DL3 A;  3ZFF B;  1N1S A;  1HRV 3;  1NY7 2;  4IEO A;  2ARE A;  2VGD A;  4PIZ A;  5KR7 A;  4W6Y A;  1DZQ A;  1PHM A;  2ET1 A;  1NCR C;  4ZXE A;  2P3J A;  2XHN A;  3UKV A;  3HQX A;  4YM3 A;  1O3T A;  2X5I C;  5FZ6 A;  5EFU A;  2FZ2 A;  3IMN A;  4D6R A;  1RHI 3;  2B7Y A;  2G19 A;  3AYA A;  1H0B A;  5J1X A;  2FMY A;  2XJV A;  2ZBJ A;  2PHT A;  4IDZ A;  3RYP A;  4CVU A;  3H1Y A;  4KWJ A;  4KQ7 A;  1JYC A;  2FDH A;  4LNV A;  1LEN A;  3MZH A;  3NV3 A;  1LHN A;  1CX4 A;  3J7M A;  3J8F 2;  4OQ8 A;  4AW7 A;  1ENQ A;  3AXD A;  3B01 A;  4A41 A;  3ACF A;  3OGV A;  3VZN A;  1IS3 A;  2OUH A;  3N9O A;  3W59 A;  4QPW A;  2BOI A;  3IDB B;  4XPV A;  1UZY A;  4ZON A;  3OGR A;  1DGW X;  4D7Y A;  2I2S A;  2Q1F A;  5FZG A;  4OI1 A;  2G9Z A;  2WR9 A;  2VCM A;  3MW4 A;  3ON7 A;  1L7R A;  1PO1 2;  3CIH A;  3GYD A;  4HKW A;  2HWB 3;  1UW8 A;  2VMI A;  2CTV A;  4MGY E;  3JBG 1;  5J09 A;  2VCB A;  4Z1V A;  1GZW B;  1HXS 1;  4AQ6 A;  4H14 A;  2XLF A;  4NE9 A;  1VRH 2;  1AX1 A;  5HCF A;  2XQX A;  1R1Z A;  5C33 A;  5CFC C;  2CWS A;  1LTE A;  5IJR A;  5A33 A;  2ARB A;  1SLB A;  2KD7 A;  1HRI 3;  3RZJ A;  3O7O A;  1NOV A;  1Z0H A;  1ASJ 3;  4CP9 A;  2BBV A;  1AL2 3;  3ZPY A;  2B9U A;  3VBO B;  1EUU A;  3VBU B;  4ZKT B;  2GN7 A;  2GC2 A;  1N3P A;  5GLZ A;  3KMH A;  2UU8 A;  3B7M A;  4LA3 A;  1F35 A;  2GZW A;  1J84 A;  4CTE A;  5CA6 A;  1G9F A;  3I3B A;  3WNK A;  2BNN A;  2DUR A;  1IQA A;  2X29 A;  4Q2F A;  1H8T B;  1MZ6 A;  1ULO A;  3AL6 A;  4A7Z A;  5H9Q A;  4X6Q B;  2HKX A;  4FAG A;  5HBA A;  4BLI A;  1VLN A;  1YQ8 A;  1C1L A;  3KLS A;  3LOI A;  1LOF A;  1MS4 A;  2GH8 A;  3JCI A;  1YI7 A;  2OUJ A;  2R16 A;  1MVE A;  1C5I A;  4WM8 C;  2XLA A;  1JXN A;  1QXJ A;  1JYN A;  1DFQ A;  2D6N A;  1SLA A;  2WT2 A;  1BKZ A;  4IEX A;  3AZW A;  2QKD A;  4E2S A;  4RHV 1;  3ZYB A;  1I6X A;  1NXM A;  1TMF 1;  4D6S A;  1QMJ A;  2ZML A;  3DF0 A;  1RUJ 1;  4TTG A;  4LBK A;  4AFM A;  2WZP P;  2PHF A;  1A6C A;  3IPV A;  5FYI A;  2BV4 A;  3WDU A;  3AXE A;  3LIG A;  4XXP A;  3URF A;  1PIV 2;  2HLE A;  4IV3 C;  4LO7 A;  3WT3 A;  3I97 A;  1ZA7 A;  4Q4V 3;  4DQA A;  4CCK A;  2XJT A;  2WZR 2;  1AVB A;  3CZJ A;  4JTO A;  4XAB A;  5FYC A;  2X8K A;  5JPN B;  4BB3 A;  4CCC A;  4KNC A;  3U10 A;  1C8N A;  1BEV 3;  1TME 1;  1FXZ A;  4M3C E;  4M3C F;  3VKN A;  2W1U A;  4C8D A;  4CUA A;  2Y8K A;  5CFD B;  3FLT A;  1UY1 A;  4QAW A;  4QGN A;  4YG0 A;  2RE9 A;  5CNA A;  5FY7 A;  3T30 A;  5AC9 2;  4MGZ E;  4COZ A;  1CES A;  1NCQ A;  2TUN A;  2D6K A;  1DGW A;  2ZTN A;  1OPO A;  5FK8 A;  2ZOE B;  5C3S A;  2VJX A;  1TVG A;  3M4F A;  2DVF A;  4YW5 A;  1BEV 2;  4P5H A;  3VDD C;  3VBH A;  2J1T A;  5T5P A;  4IV1 C;  4EWD A;  3GZT B;  1RMU 1;  1HQN A;  2J1S A;  3LA3 A;  2WYS A;  2RMU 2;  3T2Q A;  2HWE 2;  3UGH A;  4XJW A;  2WNU B;  3WQ0 A;  1RIT A;  3EMR A;  1GOF A;  1VBA 3;  2DCT A;  3LKJ A;  4ONU A;  4XQW A;  2K46 A;  5L73 A;  2E7A A;  3C7F A;  4HPK A;  3HIF A;  5C7G A;  2XJP A;  1ULF A;  3O1O A;  1MZ5 A;  1COV 3;  5HV0 A;  3TNP B;  3PIJ A;  4XJZ A;  5DUW A;  1CAW A;  4QB6 A;  1JMU B;  1VP6 A;  2YV8 A;  2VZS A;  2F17 A;  2OT7 A;  5D8A B;  4Q4X 2;  4CCM A;  1IZ3 A;  1KEX A;  4PDW B;  1CAU B;  5CFD A;  3THD A;  2BVB A;  2YU2 A;  2OYZ A;  3THP A;  3E5X A;  4QX0 A;  3USU B;  3MIH A;  3OTF A;  1MS8 A;  1W99 A;  4N53 A;  4OI4 A;  3PTY A;  1DQ2 A;  4JZR A;  3Q8B A;  3Q8C A;  4GWM A;  2X5I A;  3I2F A;  1W8F A;  3VHO A;  2WFF 2;  5C9A C;  4D7S A;  3ILF A;  1Q56 A;  3MYX A;  1PMI A;  3LD8 A;  2WWS A;  2WN2 A;  2Z69 A;  1OOP B;  2FDJ A;  4LEJ A;  5E6H A;  5LBF A;  2JG9 C;  4RL7 A;  1BK0 A;  1NLQ A;  3ZN5 A;  4CDU B;  2CDO A;  1Y9G A;  4BQX A;  4O9E A;  4IV3 A;  5D2A A;  5GLU A;  3ZYR A;  1AR6 2;  2DFC A;  3KGZ A;  5EIY B;  5F32 A;  5KXB A;  2VY0 A;  3M2M A;  2D6M A;  1YFW A;  2JE9 A;  3FLP A;  4MH0 E;  2RS3 3;  4Y24 A;  5A6Q A;  3M3C A;  1OA2 A;  4LOT A;  1FYU A;  2NQY A;  2XB6 C;  1ZZB A;  1PK6 C;  3BYW A;  3GCX A;  4FOY A;  4NR1 A;  4YZ5 A;  3VDB A;  3JD7 3;  3RZM A;  3VD3 A;  2A70 A;  4PIX A;  4LBJ A;  2DF7 A;  2EIB A;  4MGQ A;  4AGV A;  3IWZ A;  1C5H A;  5JMC A;  1R1A 1;  2VVE A;  4YG6 A;  2WL1 A;  4QX1 A;  3VB9 A;  4XDQ A;  1R09 3;  3EJK A;  4JKK A;  4XUQ A;  5ABJ A;  1GQH A;  2WBK A;  1X33 A;  4ISQ A;  5T5J A;  4AVA A;  1NUK A;  1F31 A;  1RMU 2;  3LPG A;  1W2N A;  1UKR A;  2CWM A;  3LDR A;  4SLI A;  1NA1 B;  1ENX A;  4DB5 A;  5H9P A;  4H7L A;  2RMU 3;  2FD8 A;  5B4X A;  1BJQ A;  5FZ0 A;  1A34 A;  1OVS A;  2XJR A;  2Y6L A;  2Q8O A;  3H42 B;  4FFH A;  5C70 A;  3VD4 A;  1TNR A;  4I3P A;  1WBF A;  4EWE A;  2RS3 1;  3QH6 A;  5FZ3 A;  2TNF A;  5E89 A;  4YNI A;  2RS5 1;  3WW1 A;  2VQT A;  4CUG A;  5IUQ A;  2ZX1 A;  2HJI A;  2VQ0 A;  1AR7 2;  1NZC A;  4PLO A;  2A3X A;  2E7Q A;  2DVA A;  2XR4 A;  4K20 A;  3NJZ A;  3PU3 A;  4AQT A;  1WD3 A;  2G9F A;  2J42 A;  2DVD A;  3TYJ A;  5FQ0 A;  3AMH A;  1OA4 A;  2HWB 1;  1H1A A;  2JD4 A;  4FOW A;  4LBQ B;  3S7I A;  3DEC A;  3U37 A;  4JGZ C;  2K0G A;  4XHB A;  3HT1 A;  4YW7 A;  5FZC A;  2VZO A;  2WFF 3;  3J7L A;  4UBH A;  3LEM A;  1UZ0 A;  1YIP A;  3A21 A;  5HV4 A;  5EYY A;  3T4V A;  2ZAB A;  5F5A A;  1I9R A;  4AYU A;  5IAV A;  5LRR A;  1W8H A;  2BRT A;  4NHY A;  2J7M A;  3I3Q A;  1IHM A;  3VD7 A;  5A3P A;  4B4P A;  3TBD A;  4CDW A;  3E5Q A;  2ZHK A;  4I30 A;  1NT0 A;  1ASJ 2;  1LRH A;  3D6E A;  2JD9 A;  5H9R A;  4AWD A;  5BNN A;  4OHX A;  3HPN A;  5FZK A;  4TZD A;  3SCH A;  5JZG C;  3PTR B;  4AVC A;  1V9U 1;  1ZBE 2;  1LOE A;  4CDX A;  2FDK A;  4R9D A;  3CQO A;  1PVC 1;  1YIF A;  2YFU A;  4B8E A;  5F2W A;  4AI0 A;  1Q8V A;  4BE3 A;  5AFE A;  1UYZ A;  2ZHL A;  3JUU A;  4FPC A;  4CUB A;  3M7A A;  3OUJ A;  3WQB A;  4JX0 A;  3QCW A;  1HLC A;  2G9G A;  3AC0 A;  2VOW A;  3OPT A;  4BQ2 A;  1UX7 A;  4MXV A;  3AFK A;  4Y4Y A;  1Y7B A;  4QPI C;  1BMV 1;  2C24 A;  4DUW A;  4Z82 A;  3DPR A;  4QGM A;  5L9V A;  2GMP A;  3AZX A;  4KWK A;  2Z5W A;  3IN9 A;  1CZV A;  5A7Q A;  1N47 A;  2B8M A;  4OFG A;  3HEI A;  2SLI A;  2HH9 A;  2JIC A;  4UF0 B;  1J3P A;  5C4W C;  2D7F A;  4R9A A;  1QNY A;  3D3A A;  4Q4V 2;  1XJA A;  1W6P B;  4GKY A;  3CBN A;  4N7I A;  4LT5 A;  5T5O A;  2XJU A;  1UN1 A;  2GMM A;  3K2O A;  3VBU C;  4OUM A;  3JZV A;  5JI7 A;  3LB9 A;  4DEV A;  1JOP A;  4PQ9 A;  3USS A;  1X82 A;  2BOJ A;  2ZGQ A;  4L9B A;  2VW2 A;  5L7O B;  2D3S A;  4CDQ B;  3AKQ A;  2RM2 3;  5JIA A;  4FXG B;  3RZG A;  3WR0 A;  1D4V B;  4LO6 B;  4BCU A;  2V73 A;  3I2I A;  4LTA A;  2XHK A;  2QQU A;  3AZV A;  4MGI E;  4NID A;  1O5U A;  4LMF A;  4Q26 A;  1QXP A;  4ZY9 A;  2XQR A;  5FPV A;  3MF9 A;  2Z79 A;  3E6B A;  4Q4Y 1;  1ST8 A;  3J7N A;  2PA7 A;  5BNO A;  2D6P A;  4XFI A;  1RED A;  1XE0 A;  3DYO A;  3OBZ A;  2VMF A;  2KM2 A;  5FQ0 B;  2GP5 A;  1RHI 1;  4OZX A;  1EV1 2;  4XAE A;  4PCR A;  4V1P A;  4LKF A;  5GZC A;  1CD3 G;  4X6R B;  2ADE A;  4MZU A;  4PHZ A;  2VTF A;  3UES A;  2WQZ C;  1W2T A;  1MS9 A;  2NN8 A;  3PDQ A;  5DUX A;  1OFN A;  3M70 A;  1MS0 A;  1POV 0;  3RPQ A;  3RRD A;  1W3X A;  3VDA A;  1UMZ A;  2DFB A;  5DXD A;  3S6P A;  1PX3 A;  1QWR A;  2Y34 A;  4NMI A;  3S57 A;  3MID A;  1WKY A;  3B93 A;  1AR8 3;  5FKC A;  3RZZ A;  4YFZ A;  1E5H A;  1NA1 C;  3HVD A;  5FZD A;  4CA9 A;  4YG3 A;  4CCN A;  2WAB A;  1RXG A;  3PLQ A;  1RUF 2;  2HEW F;  2OQ6 A;  5HXM A;  4CRQ A;  4YVW A;  2W3J A;  3CNA A;  3EHK A;  1F5J A;  4LUL A;  2EXJ A;  2W95 A;  4XUN A;  4YW6 A;  3WDY A;  3I59 B;  5SV5 A;  3ZXL A;  1RC6 A;  1GZT A;  2RR1 3;  4CPB A;  1J83 A;  4E4D X;  1AR9 2;  5A6Y A;  1VBC 2;  4MO3 M;  1YCI A;  1OVP A;  3POI A;  2ARA A;  3T2O A;  2C9A A;  3ZFG B;  3NV4 A;  3SEP A;  5F6K A;  2BJS A;  2XOM A;  4Q0Q A;  1OQE A;  1W6Q A;  3MIB A;  5BY5 A;  4XFB A;  3WF3 A;  5JDB A;  2ZEX A;  4L99 A;  1O8P A;  2CL2 A;  3H50 A;  4NVP A;  2IFW A;  4MXW A;  3RGB A;  2HWB 2;  2QQP A;  1OLM E;  4B3N A;  2OXB A;  4P9Y A;  3VBU A;  4JGZ B;  5CVR A;  4KU8 A;  1AXY A;  1EYB A;  4OVE A;  4SBV A;  4GQ7 A;  4OHY A;  2I74 A;  1LR5 A;  3W9A A;  4QM8 A;  1SDD B;  2XWB B;  3W20 A;  1LOG A;  3KS7 A;  3ZKY A;  2W1Q A;  2RJL A;  5IWF A;  4DXS A;  4X8P A;  2CNA A;  4NHM A;  2RS3 2;  4JV4 A;  4S2G A;  1FMD 1;  3PUR A;  3NNL A;  1RMU 3;  1JS9 A;  2YB7 A;  4N43 C;  1U5Z A;  4HON A;  4RS5 A;  4JHT A;  2WII B;  3WIN E;  4XUO A;  1G86 A;  2WSV A;  2YG0 A;  1GR3 A;  1OKO A;  2ZEW A;  1AYN 3;  4WVZ A;  4A4A A;  3Q8F A;  2BWC A;  2ZMN A;  5SV8 A;  5C8C C;  5A3O A;  1TMF 3;  3RI9 A;  1ULC A;  1QJZ A;  1CAX B;  3FLR A;  5FZ8 A;  1SFP A;  5EJ3 A;  4B1L A;  1DF0 A;  5I0S A;  3TN9 1;  4RGA A;  3AKR A;  4DEQ A;  3H3U A;  4GMP 3;  2ZAA A;  3ZM8 A;  4JKM A;  4CDQ A;  2VZT A;  5E1R A;  5L7O A;  1LEC A;  1OPM A;  2VQU A;  1VBC 1;  4MYE A;  4ASL A;  1D4M 3;  4D69 A;  4Y1X A;  5A1L A;  3J26 N;  1CPN A;  2UY9 A;  4HXC A;  2R04 1;  3OUH A;  3KT1 A;  2WT1 A;  4AGR A;  2ORZ A;  3T2P A;  5CKQ A;  3TWI A;  1W6O B;  2RDN A;  1PM7 A;  2DCZ A;  1MVQ A;  3G7D A;  1J58 A;  1ND3 C;  4YM0 A;  5C71 A;  1X50 A;  5AVP A;  2P6C A;  3QOP A;  5GZD A;  3KCC A;  4MX3 A;  1EAH 2;  4QDR A;  4YRD A;  1AL2 1;  1J3Q A;  4LBM A;  1RVF 3;  2GC3 A;  4CCD A;  1N3O A;  3RWK X;  4BQW A;  5FAX A;  4FPH A;  1HN1 A;  2DBI A;  4KG0 A;  2WAO A;  5I8S A;  5FUN A;  3VBO C;  4QU2 A;  4XIO A;  4MAD A;  4UYB A;  4LE3 A;  4NRP A;  1EV1 1;  5FPZ A;  3O1V A;  5AC9 3;  4RR3 C;  2P17 A;  4NPR A;  5IFP A;  4C1W A;  3ACG A;  5BNN C;  1HJF A;  2B4K A;  4Q1R A;  4BIF A;  1BZW A;  4URT A;  2VAU A;  1FX5 A;  4PDW C;  2BU9 A;  1S55 A;  1K5J A;  2DUP A;  2PFW A;  5FP3 A;  1WCD J;  5A3W A;  3ZXJ A;  2PLV 3;  3WF1 A;  5I8T A;  5JZG B;  3MLJ A;  1BXH A;  4DOU A;  3KB5 A;  3T2T A;  3LA7 A;  1D2Q A;  1YYN A;  4LBO A;  1A3K A;  2A73 B;  4AED B;  4IEV A;  2YXS A;  4QGL A;  4CXY A;  2LUW A;  1W6P A;  3ZX7 A;  5DAW A;  1TG7 A;  1S0I A;  2BDR A;  3ECQ A;  3U4X A;  2P5B A;  3BOP A;  3FC0 A;  3LAG A;  3MUY 1;  4XXA A;  1X7N A;  3AP9 A;  1ULG A;  1PM4 A;  3TN9 3;  4L11 A;  1PX4 A;  4BOW A;  4AFB A;  1XSQ A;  5IT6 A;  4IER A;  4D8M A;  2JDH A;  5IAX A;  2FCV A;  1ZRC A;  2RHP A;  3HT2 A;  2R07 2;  2EID A;  4JQR A;  4B1M A;  1Y9Q A;  4QX2 A;  4CDQ C;  4LQR A;  4COW A;  1FOD 3;  1OH4 A;  1LHU A;  1TME 2;  5A32 B;  5CAZ A;  2BWA A;  1K5M A;  2RR1 1;  4IGO A;  4ZU5 A;  3T0D A;  1S2E A;  2IZW A;  5FCC A;  2K2S A;  2Q8E A;  4COU A;  1EY2 A;  3SCG A;  4JCK A;  4HVQ A;  1BMV 2;  3WW2 A;  2ZAH A;  1JYW A;  4BQ3 A;  1ZA4 A;  2D3R A;  4AK3 A;  2JDN A;  5C3P A;  1JUH A;  2BQP A;  3C3V A;  2BUK A;  2AEZ A;  2IXK A;  5JR2 A;  1KFX L;  2MHF A;  3CDZ B;  1RUH 2;  4K3U A;  4QX5 A;  1RVF 2;  1V00 A;  3DN7 A;  1RUJ 2;  5FP7 A;  5JXJ A;  3CJX A;  2UY8 A;  3I49 A;  4NN0 A;  4MGT A;  4XTP A;  2ZHN A;  4P9L A;  2BPA 2;  1VBE 3;  1WBL A;  2ZX4 A;  1S1A A;  5LBB A;  1RGS A;  1RUI 3;  1KD7 A;  4LJH A;  1GSL A;  5A1A A;  1ZBE 1;  5CU1 A;  3TEZ A;  5CFD C;  2H0V A;  2ZGS A;  1FOD 1;  1W9Y A;  4UW3 A;  2WNV B;  1RUD 3;  2WZR 3;  3MEP A;  4R4X A;  4UW6 A;  5BPX A;  4CDU A;  5L36 A;  1XC6 A;  3M1H A;  3AP5 A;  4FVV A;  2DVG A;  1RIR A;  4Q4W 1;  2VTX J;  2F6B A;  1VRH 1;  2GND A;  3QLQ A;  1CON A;  4PJY A;  3AKS A;  1RUE 2;  4LUM A;  4CEW C;  5C4W B;  1UMI A;  2RS5 3;  3OGS A;  4DS0 A;  3B5L B;  1ZRR A;  4DRR A;  2E9Q A;  3BPZ A;  3ZIX A;  3NNG A;  1YFX A;  4B7K A;  2WN3 A;  3D0S A;  5IYY A;  1ZZC A;  3N35 A;  4IEY A;  2EXI A;  3ETP A;  3C2U A;  4H3W A;  1MEC 2;  3OGG A;  3PL0 A;  1MEC 1;  3I2J A;  4G4F A;  1F5F A;  3VV1 A;  3UJQ A;  4Y5S A;  1LOF C;  4IEU A;  3WW4 A;  3ZIW A;  4BK5 A;  2ES3 A;  4F3J A;  1VIW B;  1UZW A;  2W5F A;  3BCW A;  4HAN A;  2XVG A;  3O0X A;  5FBJ A;  3FFZ A;  4M0N A;  5DUU A;  5HI0 A;  2J1V A;  5T50 A;  1S4C A;  5FMO S;  4CEW B;  5A3M A;  2QQV A;  1GZW A;  4J1X A;  4XBL A;  4Z07 A;  3ZYG A;  4EYU A;  4MLO A;  1MAC A;  4XEZ A;  3N4M A;  3VHN A;  1AXK A;  1S0G A;  2R07 1;  4M3C B;  1QJX 2;  2V4V A;  1PO1 1;  1JYT A;  4CDW C;  2R49 A;  3KT7 A;  3GDB A;  4PT6 A;  1XPW A;  5K4L A;  2XH6 A;  2VC9 A;  2B5H A;  5GM0 A;  5BNO B;  1UU4 A;  2XBO 3;  1ZRE A;  4XTM A;  1SG3 A;  1W3V A;  1E5S A;  3N9Q A;  3DEM A;  1RVF 1;  2P2K A;  2Z42 A;  5F3I A;  1G9A A;  2VO5 A;  4EE2 A;  1PVC 3;  5FO9 B;  1ND2 C;  1OLM A;  4H55 A;  5F5I A;  1AZD A;  1N3Q A;  2DCJ A;  3K48 A;  1LGN A;  1QDC A;  4JDN A;  4I3G A;  4N53 C;  2JDM A;  4N90 A;  4AEJ A;  1V9U 3;  4IEP A;  5JXI A;  2E7T A;  4XFF A;  2VXJ A;  1RUJ 3;  3ZDS A;  1K5M C;  1V6J A;  1JH5 A;  4XAC A;  2E63 A;  5A80 A;  1XE7 A;  1RUC 3;  4FPJ A;  2ZX3 A;  5LA2 A;  2NP0 A;  2VG9 A;  3NNM A;  4RR3 B;  5JXH A;  1HV0 A;  1MS1 A;  2W39 A;  3BOW A;  5J48 A;  5LAT A;  1POV 3;  2GC1 A;  4I01 A;  4IV3 B;  4TSV A;  3H8X A;  3VDD A;  5F39 A;  2VUL A;  1NY7 1;  3FHI B;  1AYM 2;  3ZSM A;  3VKF C;  3HR9 A;  3R05 A;  1V6I A;  1YO8 A;  1W6O A;  4RGG A;  3B02 A;  4ATE A;  3E6D A;  1NCQ B;  3INA A;  4NIG A;  2FBE A;  3KCY A;  2WYF A;  4NIA A;  3VUO A;  2Y60 A;  1LHW A;  4GMP 1;  3FL7 A;  4QKD A;  1TEI A;  2PLV 1;  3U4S A;  2IVJ A;  1GP5 A;  2VM9 A;  5DZF A;  4AHX A;  1AL2 2;  1X9T A;  3LA2 A;  5FZH A;  4GJZ A;  4CEY C;  1UPI A;  3BAL A;  4JDM A;  2R1B A;  2XG3 A;  5AVA A;  4TN7 A;  4XUR A;  1CAW B;  2NLR A;  5IHR A;  2VMH A;  4PLM A;  2VME A;  1HIX A;  3PVN A;  2HWD 2;  5F1R A;  5DDJ 2;  1VPH A;  4N8M A;  1BVV A;  2EXH A;  3KVA A;  4H2A A;  5F8P A;  2TBV A;  1HKD A;  4MHU A;  3ES4 A;  1DQ6 A;  4IW3 A;  3VBR A;  1FPN 3;  1XNC A;  5F5Q A;  1DGR N;  1R08 1;  4GIQ A;  1PK6 B;  1I5P A;  1GU3 A;  2EA7 A;  5DDJ 3;  1AR7 3;  3WUD A;  3FHA A;  2VQA A;  1BBT 1;  1PGW 2;  4O61 A;  3SQO A;  3VBH B;  2P3Y A;  4Y4R A;  4OUE A;  3AJY A;  4QPI A;  5FXZ A;  5FOB B;  4CU9 A;  1X8E A;  2YGL A;  1UY2 A;  3NKT A;  4Y22 A;  2DCY A;  3AYD A;  4KU7 A;  1X8M A;  3HJR A;  3RFR A;  2XL7 A;  5ACA 1;  1LOB A;  2DU0 A;  4XET A;  2ILM A;  3PU8 A;  1EAH 1;  3I2G A;  4YVS B;  1HB4 A;  1ZM1 A;  3H3L A;  4BIO A;  4O9G A;  4YW3 A;  2YDE A;  4YZ3 A;  2QZ3 A;  1AHS A;  5ERL A;  2DYC A;  1OD5 A;  3VHP A;  1XYP A;  4E9K A;  3PIG A;  2HYX A;  3OOX A;  1LJ7 A;  4GWJ A;  1RUG 3;  3MIE A;  2FHR A;  2R04 2;  1LES A;  4AXO A;  1FPN 1;  1CZT A;  2QBX A;  2XL9 A;  1VJ2 A;  1G9B A;  3DGT A;  3GAL A;  1ZRI A;  4LKD A;  1FV3 A;  2D3P A;  3SC7 X;  4C1X A;  5ABJ B;  1UMH A;  5D1I A;  3P1I A;  2IXH A;  3TAY A;  2WZR 1;  2WQ8 A;  1DGL A;  3ZN4 A;  2ZXQ A;  4Q0P A;  3B69 A;  5FY9 A;  3IPV B;  1ZBA 1;  3KCX A;  3TN9 2;  2GNT A;  1F4H A;  4KWL A;  4B29 A;  4RFR B;  2QVS B;  2O0O A;  2WO7 A;  4UI9 L;  5K0U B;  2J1E A;  2JG8 B;  2IFR A;  1S2K A;  1ZBA 2;  4BXF A;  1SZB A;  4GUL A;  3I3M A;  5FKB A;  5A3T A;  5FMC A;  2VD7 A;  5GKA C;  1HJG A;  1MEC 3;  2R7E B;  1H9P A;  2H6B A;  4C90 A;  4GB3 2;  4S2D A;  5FUP A;  1XB9 A;  2QUO A;  2YPD A;  5FDB A;  1S0E A;  4RQP A;  1FI2 A;  1U5I A;  1V6N A;  2DTW A;  4XHX A;  1GWK A;  1DZR A;  4Q1P A;  3KQR A;  4N43 B;  3ZYH A;  3ZXD A;  1GIC A;  4LR4 A;  1Q8O A;  3ZYI B;  1QJY 3;  4NPM A;  4XFC A;  1DLL A;  2EVX A;  2IUW A;  3POF A;  4BQ1 A;  1TZO A;  1XSR A;  2V4A A;  1W2O A;  2DVB A;  4GB3 3;  4RS5 B;  3TNQ A;  5KC5 A;  4PF5 A;  4Q0S A;  5FUI A;  1VBD 1;  2OVU A;  5HCB A;  4Q0U A;  4Z92 B;  4YGC A;  5J98 B;  2YFZ A;  4XQ4 A;  4HKO A;  3RZL A;  3LWC A;  5ANN A;  1O7F A;  4OZO A;  2RVA A;  4C0B A;  3WG1 A;  2XJS A;  1G7Y A;  2V09 A;  2JE8 A;  1LU1 A;  2YHJ A;  1OBN A;  4HPK B;  2TEP A;  1OQD A;  4PI0 A;  4XBN A;  4ZXK A;  1KJL A;  2JDZ A;  2W9X A;  4R9C A;  3SKJ E;  3VBS B;  3O1U A;  1W04 A;  3PUS A;  3SCF A;  1SBD A;  4XMI A;  3DKW A;  4EV0 A;  2P1B A;  2JB8 A;  5C5T A;  1AR6 3;  3JB4 C;  3GF6 A;  4HVO A;  4I0A A;  3H8U A;  2X05 A;  3FFQ A;  2FCU A;  2BER A;  4M00 A;  1B09 A;  3RJ2 X;  1RUF 1;  4IES A;  4MSV A;  3QBQ A;  1JI6 A;  5LZ6 A;  1WMF A;  5GLT A;  5CB7 A;  4JRA A;  4ZHN A;  3HBK A;  3JD7 2;  3AKT A;  3R6S A;  1POV 1;  5CIS A;  4K40 A;  3PVO A;  4Z2W A;  4O65 A;  2PXJ A;  2Q30 A;  3MFC A;  3D5O A;  2VZR A;  1IS4 A;  1J59 A;  4WVM A;  2XDV A;  1GP4 A;  4P9J A;  1HX6 A;  2ZX2 A;  3M3O A;  3V56 A;  4V2W A;  2RV9 A;  1D0H A;  2WNU A;  3JBG 3;  3LEK A;  3SH3 A;  4DY3 A;  1WLD A;  1OQ1 A;  1RHI 2;  5FZF A;  3WSO A;  5FPB A;  2Q0A A;  2D5F A;  1W06 A;  3WG4 A;  1PZ8 A;  4Q4Y 2;  3K4D A;  3OSD A;  4Y5T A;  1XE8 A;  2CU5 A;  4XUP A;  3ZXA C;  1ZRF A;  1W39 A;  5FV3 A;  5K7P A;  1OMI A;  3K75 B;  1NKG A;  5KWR A;  3NNJ A;  4EWA A;  2VVD A;  2OA2 A;  3I3D A;  2XON A;  4YPJ A;  4B4Q A;  5C8W A;  3T4H B;  3S5Q A;  2HBU A;  1Q43 A;  3AB0 A;  4LE4 A;  4ZU4 A;  3APB A;  3OPZ A;  4QQO A;  4JKL A;  1PK6 A;  1QU0 A;  1VRB A;  3VBS C;  4DXT A;  1I5Z A;  2VZ1 A;  4FFG A;  1QJY 2;  1BBT 3;  1W6N B;  3KSC A;  3OD0 A;  4IEW A;  5FYZ A;  2A1X A;  5FZL A;  2VNR A;  5FYM A;  4FTE A;  3LSD A;  3VDC A;  2OZ6 A;  2VVF A;  4BME A;  4J6G A;  2Q8D A;  2RM2 2;  3HNB M;  2ZGP A;  1OSG A;  2ZGT A;  2J22 A;  3OPW A;  1FV2 A;  5F37 A;  5F2S A;  5JMO A;  5LEK A;  4QDS A;  2DUQ A;  1CAX A;  2R0H A;  1J3R A;  3O1T A;  1V9U 2;  3I2O A;  1CPM A;  2PAM A;  4LIU A;  1CGP A;  3B94 A;  3I3E A;  1HRI 2;  2HWF 1;  2RDS A;  2XUE A;  4FPG A;  2V72 A;  2VZP A;  3P6B A;  2VZ3 A;  4FXK B;  1XXN A;  4D6Q A;  3IM0 A;  4ZS2 A;  4J25 A;  5J96 B;  2P3K A;  4HOO A;  5JOY A;  1CQ9 A;  3NST A;  4AI1 A;  1XBF A;  3V64 A;  4IET A;  3ZFE C;  4GMP 0;  4V2V A;  3VZK A;  3GJA A;  4XJ8 A;  1H30 A;  3AZZ A;  4QPY A;  4X8N A;  1XRU A;  3OEA A;  3S0M A;  2WZE A;  4IL7 A;  1JU3 A;  2VZU A;  4CP1 A;  3B9I A;  5I0D A;  1OOP C;  1LHO A;  1WMD A;  4P14 A;  1NCQ C;  5JSP A;  1UU5 A;  3L9J T;  2LAL A;  3KVB A;  1RXF A;  1C3H A;  3A7Q A;  2JXA A;  3ZYF A;  5HPO A;  1ND2 B;  1KXG A;  1W8N A;  5I91 A;  2W47 A;  4BQY A;  1Q8P A;  1KDM A;  5FRE A;  3U14 A;  5K0U C;  4HK9 A;  4JGZ A;  3ZYJ B;  1GZ9 A;  3POB A;  2VTX A;  1W6M B;  3BTA A;  3SIS A;  5K9Y A;  1I3H A;  1J1L A;  2Y6F A;  2W87 A;  1AR7 1;  5DZE A;  4XAA A;  3WW3 A;  2A6X A;  4XVH A;  3FWE A;  5C5U A;  5EJZ B;  2MNG A;  1ASJ 1;  2NYY A;  3AZY A;  3WNP A;  1N1V A;  1SMV A;  5AFB A;  1W6Q B;  4W6W A;  4Q8L A;  5L19 A;  2VBB A;  2PQQ A;  5LK5 A;  4F83 A;  1ZYB A;  1YFY A;  3ACH A;  4XCA A;  3LFI A;  1HRV 1;  4AFD A;  5LK7 B;  3RWN A;  2DWR A;  1GNY A;  1C8M 3;  1CAV B;  2QQK A;  3BN6 A;  3M3E A;  5FRA A;  2E31 A;  2GNM A;  4MUV A;  1LED A;  2ET7 A;  4K1Y A;  5FMB A;  2W08 A;  1ODM A;  2Y6G A;  2UYB A;  4XIL A;  4AAX A;  4Y1U A;  3FE5 A;  4KH9 A;  4OUS A;  1UIJ A;  3THT A;  1KIT A;  1NYW A;  2GP3 A;  1QOO A;  2R1D A;  4UFL A;  1IS6 A;  4UAP A;  2AYH A;  3PJQ A;  4KG8 A;  3BTY A;  5F6L B;  3NAP A;  2RS1 2;  5BV6 A;  2DDU A;  4XF3 A;  5JIU A;  1JHJ A;  2KXL A;  4AE2 A;  2ZGK A;  3M8L A;  5FZM A;  5JPM B;  3V0A A;  4KGQ A;  5IVY A;  2RS5 2;  4YGB A;  1UNB A;  5FZA A;  2HBT A;  2HWC 2;  1OF3 A;  2RJK A;  1WMX A;  2UWC A;  4OHW A;  4P02 B;  1ODN A;  3CJI C;  4CU6 A;  3PHM A;  4A6O A;  1T2X A;  1XYO A;  2W92 A;  4ARX A;  3MW2 A;  1ND2 A;  5ISL A;  1SBF A;  4FFI A;  2MEV 1;  3AJZ A;  4FQZ A;  4QXB A;  4XUT A;  5FYH A;  2PHW A;  3LF7 A;  5FP8 A;  5FP9 A;  3ZMO A;  4EN8 B;  4FFF A;  1S0F A;  4HSL A;  2WFF 1;  5FMD A;  3N7M A;  2Q8C A;  3HN3 A;  4BWO A;  3CU7 A;  1JZ4 A;  4CDU C;  1ZNP A;  2A6Y A;  3Q9O A;  2XVK A;  2LRP A;  4AEK A;  4W50 A;  1GMM A;  3G6J B;  3A0K A;  1N1T A;  1VBB 2;  4E8D A;  4TWT A;  1CJD A;  1LGB A;  1O3R A;  3I54 A;  3W5M A;  1H8T C;  1VBD 3;  3CJI B;  5KBF A;  3J8F 3;  4M0H A;  2GNB A;  3LIH A;  5FPU A;  3QAC A;  4WZF A;  5A3L A;  1MQT B;  4LOR A;  1QJU 1;  3K3O A;  4FOV A;  5JSO A;  5JOZ A;  1UXX X;  3KD4 A;  4W4Z A;  3ZR6 A;  3ILR A;  1DGR A;  3ZFG A;  4ZZ5 A;  4K1Z A;  1SLL A;  2IXL A;  2UWA A;  4ARY A;  5KHG A;  3WCR A;  3NL1 A;  2RMU 1;  3MIF A;  1AR9 3;  2IXI A;  1UYY A;  2D40 A;  3ENR A;  3NJY A;  4L92 A;  5DAV A;  3WZ1 A;  3WNN A;  4PLN A;  4E2G A;  1W6M A;  3AP7 A;  3ITQ A;  1WLW A;  2MEV 2;  2B42 B;  2FCT A;  4XF1 A;  4XE9 A;  4N9I A;  3JQW A;  4K8R B;  3POE A;  4PIY A;  5HCA A;  4BDV B;  2ZGR A;  4AAP A;  3PNA A;  3OGJ A;  4AVV A;  5CEH A;  2XVL A;  1CX1 A;  1H4G A;  5FXW A;  3WUC A;  1AYM 1;  4TLG A;  4BPZ A;  3WF2 A;  1H6Y A;  2Q1Z B;  2QQN A;  4Q4X 1;  5IVE A;  3U0Z A;  2W2I A;  2D98 A;  2ORX A;  5FYY A;  3SKV A;  2WS9 1;  2Q5T A;  1KFU L;  2WNO A;  3VDD B;  4FPF A;  2ETE A;  2W1S A;  4QXK A;  1H9W A;  1JW6 A;  2XWJ B;  2CHH A;  4WM7 B;  5KHK A;  1UCX A;  2C0Z A;  2E26 A;  4P08 A;  2FDG A;  1WA6 X;  3T08 A;  1M4W A;  5IVV A;  5BNN B;  4GD4 A;  4N53 B;  3VBH C;  1CN1 A;  3MV1 1;  1OD3 A;  2W94 A;  4NO4 A;  4COY A;  5JZG A;  1PIV 1;  2W0X A;  4ES8 A;  5KHI A;  1RB8 G;  1LHV A;  5IAT A;  3ES1 A;  3EB7 A;  3PME A;  3D8C A;  1U5X A;  2AR6 A;  2X53 S;  2Y0I A;  3IAP A;  4K9S A;  5FYV A;  4YGE A;  4EZH A;  4QPG A;  1Y9M A;  3QH7 A;  1AL0 G;  1ND3 A;  2VU9 A;  2LW8 A;  5LEJ A;  4WVW A;  2B45 X;  4NHL A;  1SLI A;  5CYY A;  5CFC B;  4YYO A;  4AED C;  3DYP A;  1QIQ A;  3T1M A;  4KBB A;  4BZ4 A;  2EIG A;  4RHV 2;  1VAL A;  5ACA 3;  3VZJ A;  3ZSL A;  2YBS A;  5BNP C;  2WLQ A;  2DTY A;  1W8T A;  3RJR A;  3CJI A;  1YQC A;  3POS A;  3UJO A;  2YC2 A;  1YRZ A;  2Y26 A;  2R06 2;  2JG9 A;  2VR4 A;  3VBS A;  4Q4Y 3;  3ZFF C;  3VZL A;  2J1A A;  4JHZ A;  1LKN A;  1SLT A;  5CG8 A;  3NWK A;  4AI3 A;  4B4R A;  3LEG A;  1NXD 1;  3B00 A;  5FK7 A;  3C7E A;  3HBZ A;  4XJU A;  4UF0 A;  4G9S B;  4JDO A;  5K8S A;  4DFS A;  3UK9 A;  4OHZ A;  1GZC A;  2PHX A;  3VKL A;  1O3Q A;  1GUI A;  3E5U A;  1D0G A;  1EP0 A;  3N7J A;  4HG6 B;  1APN A;  3M3Q A;  3WD5 A;  1OKQ A;  3O5S A;  5DAQ A;  4Y3O A;  1GBG A;  4UOJ A;  3GBG A;  4YLZ A;  1FT9 A;  1RUI 2;  2Z2S B;  4MGK E;  1O59 A;  4AG4 A;  1PNG A;  3DPR B;  1UWW A;  4AVT A;  4Q5O A;  4MXW B;  4AQS A;  2HWF 3;  2PN5 A;  4YAR A;  3H8R A;  1QNW A;  1UZV A;  1C8M 2;  4LA2 A;  3ZO0 B;  3RI8 A;  1DQ5 A;  1KRI A;  3H7J A;  2C6S A;  1AX2 A;  5JWP A;  2PHR A;  3VN4 A;  3S7E A;  2AEY A;  4AL9 A;  1KS4 A;  3NAP B;  2GN3 A;  4MV2 A;  2WFP A;  1JOD A;  1QJU 3;  5F3C A;  1IQD C;  1YLL A;  3IIA A;  3T1L A;  3W21 A;  3BU7 A;  3LDK A;  1HRI 1;  2BP6 A;  1NQD A;  2HWF 2;  2IXJ A;  2YBP A;  2J1U A;  5FWJ A;  3IMM A;  4NHK A;  2HWE 3;  4GXL A;  2ZCW A;  1KQR A;  3CO2 A;  5EJ1 B;  5FZ9 A;  1OC1 A;  5IVF A;  1ZZ7 A;  2YYO A;  1I1E A;  2R30 A;  4GAZ A;  3KHC A;  2AH2 A;  5K0U A;  2G1M A;  5BUV A;  1F2N A;  4QQL A;  4Y22 B;  1UL9 A;  1ZZ6 A;  5DAX A;  3LPF A;  1QJY 1;  4PBP A;  4BH9 A;  1AXZ A;  4QPG C;  2VNG A;  2ZS6 B;  4YSF A;  1WUV A;  2QQJ A;  1PZ7 A;  2BGO A;  1KJR A;  5EV7 A;  1UAI A;  1UF2 C;  2C5D A;  2WSU A;  3ALQ A;  3I4I A;  4E4S A;  4DPN A;  4F7Z A;  2FMD A;  4CUC A;  4IV1 B;  5FY5 A;  1V6L A;  4JGY A;  1C28 A;  2RR1 2;  3E97 A;  5BYN A;  3OBR A;  4YW2 A;  3ME2 A;  4LO8 A;  4BIS A;  4LBN A;  5F3E A;  2XJQ A;  3E6C C;  2R06 3;  1CAU A;  4YVW C;  1DYO A;  4UT5 A;  3ILN A;  4OUL A;  4PDW A;  4ZU7 A;  3KV4 A;  1TQ5 A;  2UUR A;  4XDP A;  2ZGL A;  3KV9 A;  1IKQ A;  4QHB A;  3TEX A;  5FZ1 A;  1SAC A;  4UFH A;  5LBC A;  5J3U A;  3ORJ A;  5A7W A;  2GDF A;  1MZE A;  1O4Y A;  3JU9 A;  1ONA A;  1ZRD A;  1CR7 A;  5JAX A;  4AFA A;  1ZZ9 A;  1JZ7 A;  1K42 A;  2H0B A;  2RS1 3;  3LCP A;  4FPO B;  1JBC A;  4CXW A;  1Y43 B;  1HW5 A;  1ULP A;  3F2Z A;  3NMB A;  4QX7 A;  2Q1M A;  1YQ6 A;  2G4I A;  4LXL A;  3SH5 A;  3WNM A;  4CEY B;  3VLB B;  2CAU A;  3RMY A;  3ZFE B;  1JYX A;  2HEV F;  2VCA A;  4CZS A;  1H2M A;  2YPJ A;  5DQ0 A;  2NM1 A;  3VKM A;  1QF3 A;  2OQ7 A;  1Y4W A;  4LBQ D;  2MEV 3;  3O1S A;  4KMQ A;  1BYH A;  1V70 A;  4P5Y A;  1SDW A;  4EN6 B;  5JR7 B;  1SCS A;  4YZ4 A;  1UO9 A;  3CZU A;  3LSE A;  2JG9 B;  2CGO A;  2WA3 A;  4HKL A;  1ENS A;  2X5I B;  3M3I A;  3Q8A A;  3GM8 A;  5FPX A;  5EHD A;  1OI6 A;  1V6K A;  3H0O A;  4BYY A;  1IG0 A;  5FXV A;  5GAL A;  4WVM B;  4R9B A;  1XYN A;  2DBN A;  3BIW E;  3IT8 A;  4UFJ A;  1COV 1;  1W6N A;  3MBW A;  5CFC A;  4A2U A;  4UW5 A;  1Z7S 3;  2LS6 A;  1VBD 2;  4YVS A;  1ND3 B;  3OB8 A;  4KL1 A;  5JCT A;  4XC9 A;  5DMY A;  4FTB A;  3TRS B;  2AEN A;  4QKB A;  1A8D A;  1MPX A;  3OY8 A;  1OUX A;  3PMS A;  1GV9 A;  1SFN A;  2C26 A;  2W52 A;  3BKZ A;  2OII A;  3N7L A;  2FZ1 A;  2QQW A;  2AZ5 A;  4R8H A;  5DN2 A;  3ZFE A;  4AR2 A;  2ID4 A;  3B3Q E;  4KI5 M;  1EUT A;  2JX9 A;  1UU6 A;  1SLC A;  3JQX A;  3N9L A;  1FAT A;  4ES9 A;  1QOT A;  3CF6 E;  5A1F A;  1BCX A;  1AYN 1;  1YNA A;  3LZZ A;  4TXW A;  2CSG A;  4QB2 A;  4XOG A;  5A70 A;  1YJK A;  2BFU S;  4JQT A;  5C8C B;  1PNF A;  5ANQ A;  4A44 A;  2MPF A;  2VOX A;  1YQ2 A;  2JEN A;  4LK7 A;  3SMH A;  3ZKU A;  4IXL A;  1WW4 A;  1V6O A;  2LM3 A;  1E57 A;  2XPJ A;  3K3N A;  3VKO A;  1DBN A;  4JGY C;  1W0O A;  2VXR A;  4ATF A;  5KC6 A;  3ZN6 A;  4HZF A;  2R04 3;  4WZC A;  5EZW A;  5T55 A;  1S0D A;  3LQC A;  1OLR A;  4WBB A;  1LU2 A;  1IGO A;  5FBZ A;  4EJR A;  4A45 A;  3LGR A;  2EAL A;  4XCB A;  4Y1Y A;  2AUY A;  2VBD A;  4BK4 A;  3AYE A;  1GQG A;  3KWV A;  3ZOI A;  5LA0 A;  4M01 A;  1IG3 A;  1XNK A;  4DO0 A;  2ZZQ A;  4HL0 A;  5GLV A;  3WG3 A;  3MI8 A;  4KWU A;  4A7Y A;  1O5L A;  2ZHM A;  3ZDV A;  4LK6 A;  1OT5 A;  4Y1Z A;  1QJF A;  2XGX A;  2YU1 A;  1W2U A;  3GGL A;  4RHV 3;  3WLU A;  1ZBA 3;  4DMI A;  2GAU A;  2Y0O A;  1O4T A;  1XNA A;  2QDN A;  2ZZJ A;  3TB0 A;  3Q8E A;  3IDE A;  1NA1 A;  4DY5 A;  1GFF 2;  3ZSJ A;  1VBE 1;  2R6Q A;  1R1A 2;  3FX3 A;  2A6Z A;  3FBM A;  3O1R A;  3HN1 A;  4Q29 A;  4YGD A;  2W91 A;  4TYS A;  1WZX A;  2OS2 A;  4RQP B;  5J36 A;  2R07 3;  4G3Y C;  4FSJ A;  3VL9 A;  3MIC A;  2WIN B;  2E51 A;  4RD7 A;  1AR8 1;  3WDV A;  1WA4 A;  4HLT A;  2OX0 A;  2WS9 2;  5A3N A;  1QKQ A;  2ZKL A;  1QDO A;  1IPS A;  3TEW A;  1US2 A;  2HWD 1;  3AMP A;  5FPA A;  1OUR A;  4AOC A;  4DIN B;  4CU8 A;  1O91 A;  2VOV A;  4XQD A;  4DRV A;  3EO6 A;  4NOT A;  2RG4 A;  4M3C A;  5IW0 A;  5IK4 A;  1WME A;  5GZE A;  1W2A X;  3U07 A;  2ERF A;  2WAA A;  2YGM A;  3I2D A;  4CYD A;  2CAV A;  1UX6 A;  5A33 B;  4XZU G;  3LE0 A;  2ZMK A;  4QX3 A;  3BIE A;  1QOS A;  2FQP A;  5G04 L;  5IK8 A;  3SXW A;  5CG9 A;  5A6X A;  3ZMN A;  2D6O X;  2O8Q A;  2OKX A;  4ITC A;  3VD9 A;  1H8T A;  3ZVX A;  5LA1 A;  4WM7 C;  1W8U A;  4BLJ A;  1NQJ A;  5D8A C;  1NCR A;  2ARX A;  3CEW A;  1B35 A;  5FLH A;  3OBT A;  4DUV A;  1UKG A;  4JTN A;  5LW9 A;  1W05 A;  4QXH A;  1HQL A;  2PHU A;  4N43 A;  1ZX5 A;  5HXV A;  1RUG 2;  1ENR A;  3HNM A;  1S0B A;  1JZ5 A;  1XU1 A;  3WXP A;  1VBB 1;  1N1Y A;  3AMN A;  4RYD A;  1PO2 3;  1DCS A;  1UOJ A;  3BOD A;  3GBW A;  3ST7 A;  2QDR A;  1AR6 1;  2ZAC A;  3PUQ A;  4YZ2 A;  2J1R A;  3IAQ A;  1W0P A;  1NE4 A;  3A22 A;  4CP0 A;  5A7O A;  1W28 A;  3O1P A;  2PTM A;  1RL3 A;  4UWD A;  1H4H A;  2W68 A;  3FMG A;  1BEV 1;  1TME 3;  1M06 G;  1EV1 3;  1C57 A;  1RJ8 A;  4BQ5 A;  3NV1 A;  4QQH A;  4BMB A;  3BVC A;  3ELN A;  3BU0 A;  2AAC A;  4P9W A;  1CWP A;  1W8O A;  2B39 A;  1D4M 2;  3ABZ A;  4GWI A;  1O8S A;  5FY4 A;  4D7T A;  4K7J A;  4XW3 A;  3WP4 A;  2HWC 1;  2JDK A;  1T6B X;  2ZGO A;  1OFS A;  3K46 A;  2DUO A;  3MFA A;  5F5C A;  5FYS A;  5T3N A;  1VB2 A;  2VW1 A;  1F4A A;  2KR2 A;  2RS1 1;  3WP6 A;  2Y33 A;  5E8A A;  2BNM A;  5LCW L;  3HOB A;  1AF9 A;  5L9B A;  3OF1 A;  1XNB A;  5LBE A;  2BNO A;  2VL4 A;  3IZO A;  3AMM A;  2Q4S A;  4YW4 A;  4EN9 B;  2QTW B;  4D0Q A;  1GNZ A;  1YC6 1;  4Q8K A;  3KV6 A;  1K3I A;  3OCP A;  3WG2 A;  2I45 A;  4AHW A;  2SBA A;  2Y38 A;  5LWB A;  2XBO 2;  1OLQ A;  1GYK A;  3DXU A;  4K8F A;  2ZA9 A;  4LO5 B;  4A3Z A;  1MR5 A;  3HAG A;  1H2N A;  3GCW A;  1DP0 A;  2WDB A;  1BQP A;  3H9A A;  1IKP A;  4LPL A;  4R4Z A;  4YM1 A;  3VBF C;  2QQM A;  3N7K A;  2F4P A;  1B35 B;  1H1I A;  1ULE A;  5FMO L;  4ASM B;  2D97 A; 
#chains in the Genus database with same CATH homology
 5FMD A;  4FFG A;  3KF5 A;  4UFL A;  2ADE A;  3SC7 X;  2QQV A;  2AEY A;  3U75 A;  4CCC A;  1W2T A;  4UFI A;  3U1X A;  4UFJ A;  5FK7 A;  4JQT A;  3LDK A;  3NMB A;  2AEZ A;  4HXC A;  1UYP A;  4QHZ A;  3LDR A;  3PIJ A;  3IMM A;  3LFI A;  1Y9G A;  1Y9M A;  3UGG A;  4CCE A;  5FKC A;  3ZR5 A;  2QQU A;  2ADD A;  3H3L A;  5FK8 A;  3OSD A;  5FIX A;  2OXB A;  1Y4W A;  3LIH A;  2AC1 A;  3U14 A;  2XQR A;  3KF3 A;  3LEM A;  3LIG A;  3PIG A;  4FFH A;  5FMB A;  4B1M A;  4UFK A;  1ST8 A;  3HBK A;  4AZZ A;  3UGF A;  4FFI A;  5ANN A;  3RWK X;  3S5Q A;  3ZR6 A;  2QQW A;  4UFH A;  4B1L A;  4EQV A;  5FKB A;  4CCD A;  3LF7 A;  4UFM A;  5FMC A;  4FFF A;  3UGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...