4B04A

Crystal structure of the catalytic domain of human dusp26 (c152s)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
152
structure length
152
Chain Sequence
MHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHSAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Crystal Structure of the Catalytic Domain of Human Dual-Specificity Phosphatase 26
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DUAL SPECIFICITY PROTEIN PHOSPHATASE 26
total genus 45
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 4b04A00
1G1FA 1YN9A 1GFYA 4KYRA 2CM3A 1BZJA 1YTNA 2I4HA 2G6ZA 5KACA 1C83A 4B04A 2QBSA 3QCBA 3F9BA 2OC3A 3RGOA 2OUDA 3V0IA 1SUGA 2M3VA 4NX8A 3EMUA 4DGPA 4GFUA 1PYNA 2F6VA 2CM8A 2Q47A 3S3KA 2B49A 2F6TA 2C7SA 2QCTA 4RH5A 1NZ7A 5K9VA 2NV5A 3QCHA 2SHPA 4JBCA 2F70A 4Z6BA 1BZHA 5KA8A 3D44A 4AZ1A 1MKPA 4HJPA 2AHSA 2GWOA 5KA9A 4GRYA 4RH9A 4MBBA 3M4UA 5J8RA 2QBPA 2QBRA 2J16B 2HCMA 1YTSA 1L8KA 4ERCA 3RZ2A 1XRIA 1A5YA 3O5XA 1FPZA 3QCMA 3MMJA 3BLUA 5BZZA 4ZI4A 2CM2A 2CNGA 1ZCLA 3OLRA 1AAXA 4RHGA 4Y14A 5EHRA 3BM8A 2CMAA 3ZM3A 2IMGA 5LXQB 5K22A 1G7FA 1YGUA 4OHIA 1R6HA 4WOHA 4QUMA 2DXPA 1OHEA 1YGRA 3O4UA 2B07A 2HVLA 2VEWA 2F6ZA 1Q6TA 2R0BA 1U26A 3F41A 2NTAA 2I6OA 2CMBA 3QKPA 1KAVA 3O3LA 3QCGA 3MOZA 2MBCA 3LJ8A 1KAKA 4RKKA 4D3QA 2I42A 3V0HA 2A8BA 3OMHA 4YAAA 2P4DA 3V0GA 1RXDA 5K25A 4IKCA 5K24A 4KI9A 1PTYA 2A3KA 2PBNA 2HNPA 2BIJA 1G4WR 3S3HA 2I75A 4JNBA 2CNFA 1X24A 1NL9A 2B3OA 1YTWA 1ZCKA 2CMCA 3I36A 3QCIA 2C46A 1C87A 2NT2A 1T4JA 5IBMA 1OESA 3ZM2A 1PA1A 2H02A 3AWEA 1PA9A 3V0JA 2FJNA 3S3FA 1YWFA 1ONYA 3S4EA 4GFVA 2QEPA 1I57A 3V0DA 1OEMX 1G1HA 4DGXA 3CM3A 4NYHA 2PSZA 3SR9A 2QDPA 2Y2FA 4ICZA 2H4GA 2FH7A 3EU0A 3AWFA 3CWEA 4I8NA 4YR8B 4QBWA 3S4OA 2JJDA 4WU2A 1QZ0A 1PH0A 2AZRA 1I9TA 2I6JA 4H1OA 3A5JA 3ZMPA 4QBEA 5BZXA 4WTYA 2ZMMA 2YDUA 5MMZB 3EAXA 1NO6A 5KADA 3H2XA 4GRZA 3BRHA 1Q1MA 2I6PA 1OETA 1PTVA 2HC2A 1RPMA 1OEVA 1T48A 1Q6MA 3QCCA 3S3EA 1Q6JA 2PI7A 4RDDA 2CM7A 1OEOX 1G4US 2PA5A 1QXKA 1V3AA 1JF7A 2BZLA 1PTTA 3RGQA 3QCLA 3QCFA 2Y96A 5IBSA 3F99A 5HDEA 5K9WA 5EHPA 4GS0A 1LYVA 2OZ5A 2H4KA 4H34A 1LARA 1ZC0A 3ZMQA 5KAAA 2F6WA 3GXGA 2H04A 4HJQA 2E0TA 5BUGA 1D5RA 3ZV2A 1YPTA 4D3RA 4GE2A 1ONZA 1L8GA 4R30A 2ESBA 3NMEA 5I6VA 3D9CA 2J17A 2I1YA 4HRFA 1WRMA 3D1HA 4R0TA 2CJZA 2VEXA 1FQ1A 5KA4A 2QDCA 1PTUA 2CNEA 1I9SA 3N0AA 5KABA 3ZM0A 2I6IA 2I5XA 2PQ5A 2B4OA 3A5KA 2P6XA 4BJOA 2HC1A 1YFOA 1Q6NA 4ZN5A 3PS5A 2GP0A 2CNHA 2I3UA 2I6MA 3I7ZA 4RI5A 2J16A 4QAHA 1Q6SA 3I80A 2Q05A 2H03A 2H4VA 4R0SA 2BGDA 4OHEA 4OHHA 3QCKA 1T49A 2RF6A 3F81A 2CNIA 1XM2A 3B7OA 4NNDA 3ZM1A 2ZN7A 3QCNA 3D42A 2I4EA 2QCJA 1U24A 5KA7A 2CFVA 1GWZA 1G1GA 1WAXA 1JLNA 4RI4A 3GXHA 1M3GA 2BV5A 1XXVA 1XBOA 4NWFA 1C84A 3SMEA 2G59A 1C88A 5KA2A 2GJTA 2HNQA 1J4XA 4S0GA 1VHRA 4KYQA 5M43A 4PYHA 2HB1A 4QAPA 3RO1A 5GTJA 3O4SA 2F6YA 2VEVA 5KA3A 3QCJA 1BZCA 1Q6PA 1XXPA 1C85A 2NT7A 2B4SA 3F9AA 2WGPA 1EENA 1WCHA 3V0EA 3U96A 4GWFA 3QCEA 2BGEA 1ZZWA 4ZRTA 2VEYA 4PVGA 1LQFA 1PXHA 3BLTA 4J51A 5KA0A 1EEOA 2HXPA 2QBQA 5KA1A 1NWLA 3QCDA 4WU3A 4GE5A 1P15A 4D3PA 3D1QA 4QUNA 3EB1A 3V0FA 2F6FA 1NWEA 1ECVA 2QDMA 4BPCA 2NZ6A 3EZZA 4NWGA 4TVVA 5BX1A 3D1OA 2F71A 2OOQA 2I4GA 5K23A 1OHCA 4JMKA 3AWGA 5AWXA 4Y2EA 2F46A 1YZ4A 1OEUA 2B4PA 2VEUA 1FPRA 1G7GA 1C86A 2FJMA 4JMJA 1OHDA 1NNYA 3QKQA 2B4UA 2PT0A 3O4TA 4OHDA 4OHLA 2NLKA 2HY3A 4GE6A 1U25A 3MOWA 2I3RA
chains in the Genus database with same CATH superfamily
1G1FA 1P31A 1YN9A 2AM2A 1GFYA 4KYRA 2CM3A 1W78A 1BZJA 1YTNA 2I4HA 2G6ZA 5KACA 1C83A 4B04A 2QBSA 3QCBA 3ZM6A 3F9BA 2OC3A 3RGOA 2OUDA 3V0IA 1SUGA 1FGSA 2M3VA 4NX8A 3EMUA 4DGPA 4GFUA 1PYNA 2F6VA 2CM8A 1W7KA 2Q47A 3S3KA 2B49A 2F6TA 2C7SA 2QCTA 5A5FA 4RH5A 1NZ7A 5K9VA 1P3DA 2NV5A 3QCHA 2SHPA 4JBCA 2F70A 4Z6BA 1BZHA 5KA8A 3D44A 4AZ1A 1MKPA 4HJPA 2VORA 2AHSA 2GWOA 5KA9A 4GRYA 4RH9A 4MBBA 3M4UA 5J8RA 2QBPA 2QBRA 2J16B 2HCMA 1YTSA 1L8KA 4ERCA 3RZ2A 1XRIA 3N2AA 3UAGA 1A5YA 3O5XA 1FPZA 3QCMA 3MMJA 3BLUA 5BZZA 4ZI4A 2CM2A 2CNGA 1ZCLA 3OLRA 2XJAA 1AAXA 4RHGA 4Y14A 5EHRA 3BM8A 2CMAA 3ZM3A 2IMGA 5LXQB 5K22A 1G7FA 1YGUA 4OHIA 1R6HA 1GQYA 4WOHA 4QUMA 2DXPA 1OHEA 1YGRA 3O4UA 2B07A 2HVLA 2VEWA 2F6ZA 1Q6TA 4BUBA 2R0BA 1U26A 3F41A 1JBVA 2I6OA 2NTAA 2CMBA 3QKPA 1KAVA 3O3LA 3QCGA 3MOZA 2MBCA 3LJ8A 1KAKA 4RKKA 4D3QA 2I42A 3V0HA 2A8BA 2X5OA 3OMHA 4YAAA 2Y66A 2JFGA 2P4DA 3V0GA 1GQQA 1RXDA 5K25A 4IKCA 5K24A 4KI9A 1PTYA 2A3KA 2PBNA 2HNPA 2BIJA 1G4WR 1J6UA 3S3HA 3NRSA 2I75A 3QCZA 4JNBA 2CNFA 1X24A 1NL9A 2B3OA 4ZIYA 1YTWA 1ZCKA 2CMCA 3I36A 3QCIA 2C46A 1UAGA 1C87A 2NT2A 2AM1A 2Y67A 1T4JA 5IBMA 1OESA 3ZM2A 1PA1A 2H02A 3AWEA 1PA9A 4CVLA 3V0JA 2FJNA 3S3FA 1YWFA 1ONYA 3S4EA 4GFVA 2QEPA 1I57A 3V0DA 1OEMX 3HN7A 1G1HA 4DGXA 3CM3A 4NYHA 2PSZA 3SR9A 2QDPA 2WTZA 2Y2FA 4ICZA 2GCAA 2H4GA 2FH7A 3EU0A 3AWFA 3CWEA 4I8NA 4YR8B 4QBWA 3S4OA 3LK7A 2JJDA 4WU2A 1QZ0A 1PH0A 2AZRA 1I9TA 4HV4A 2I6JA 2Y1OA 1O5ZA 4H1OA 3A5JA 3ZMPA 4QBEA 5BZXA 4WTYA 2ZMMA 2YDUA 5MMZB 3EAXA 1NO6A 5KADA 3H2XA 4GRZA 3BRHA 1Q1MA 2I6PA 1OETA 1PTVA 2HC2A 1GG4A 1RPMA 2JFHA 2VTEA 1OEVA 1T48A 1Q6MA 1E0DA 3QCCA 3S3EA 1Q6JA 2PI7A 4RDDA 2GC6A 2CM7A 2GCBA 3PYZA 1OEOX 1G4US 2PA5A 1QXKA 1V3AA 1JF7A 2BZLA 1PTTA 3ZM5A 3RGQA 3QCLA 3QCFA 2Y96A 5IBSA 3F99A 4QF5A 5HDEA 5K9WA 5EHPA 4GS0A 1LYVA 2OZ5A 2UUPA 2H4KA 4H34A 1LARA 1ZC0A 2Y68A 3ZMQA 5KAAA 2F6WA 3GXGA 2H04A 4HJQA 2E0TA 5BUGA 1D5RA 3ZV2A 1YPTA 4D3RA 4GE2A 1ONZA 1L8GA 4R30A 2JFFA 2ESBA 3NMEA 5I6VA 3D9CA 2J17A 2I1YA 3MVNA 5A5EA 4HRFA 1WRMA 3D1HA 4R0TA 2CJZA 2VEXA 1FQ1A 5KA4A 2QDCA 1PTUA 2CNEA 1I9SA 3N0AA 4C13A 5KABA 3ZM0A 2I6IA 2VOSA 2I5XA 2PQ5A 2B4OA 3A5KA 2P6XA 4BJOA 2HC1A 1YFOA 1Q6NA 4ZN5A 3PS5A 2GP0A 2CNHA 2I3UA 2I6MA 3I7ZA 4RI5A 2J16A 4QAHA 1Q6SA 3I80A 2Q05A 2H03A 2H4VA 4R0SA 2BGDA 4OHEA 4OHHA 3QCKA 1T49A 2RF6A 3F81A 2CNIA 1XM2A 3B7OA 4NNDA 3ZM1A 4CVKA 2ZN7A 3QCNA 3D42A 2I4EA 2WJPA 2QCJA 1U24A 4CVMA 5KA7A 2CFVA 1GWZA 2GC5A 1G1GA 1WAXA 1JLNA 4QDIA 4RI4A 3GXHA 1M3GA 2BV5A 2VTDA 1XXVA 1XBOA 4NWFA 1C84A 1EEHA 2G59A 1C88A 3SMEA 5KA2A 2GJTA 2HNQA 1J4XA 4S0GA 1VHRA 3ZL8A 4KYQA 1JBWA 5M43A 4PYHA 2HB1A 4QAPA 3RO1A 5GTJA 3O4SA 2F6YA 2VEVA 5KA3A 3QCJA 1BZCA 1Q6PA 1XXPA 1C85A 2NT7A 2B4SA 3F9AA 2WGPA 1EENA 1WCHA 3V0EA 3U96A 4GWFA 3QCEA 2BGEA 1ZZWA 4ZRTA 2VEYA 1E8CA 4PVGA 1LQFA 1PXHA 3BLTA 4J51A 5KA0A 2UUOA 1EEOA 2F00A 2HXPA 2QBQA 5KA1A 1NWLA 3QCDA 4WU3A 4GE5A 1P15A 4D3PA 3D1QA 4BUCA 4QUNA 3EB1A 3V0FA 2F6FA 1NWEA 1ECVA 2QDMA 4BPCA 2NZ6A 3EZZA 4NWGA 4TVVA 5BX1A 3D1OA 2UAGA 2F71A 2OOQA 2I4GA 5K23A 1OHCA 4JMKA 3AWGA 4UAGA 5AWXA 4Y2EA 2F46A 1YZ4A 1OEUA 2B4PA 2VEUA 1FPRA 1G7GA 1C86A 2FJMA 4JMJA 1OHDA 1NNYA 3QKQA 2B4UA 2PT0A 3O4TA 4OHDA 2XPCA 4OHLA 2NLKA 2HY3A 4GE6A 4C12A 1U25A 3MOWA 2I3RA
chains in the Genus database with same CATH topology
1G1FA 1YN9A 1GFYA 4KYRA 2CM3A 1BZJA 1YTNA 2I4HA 2G6ZA 5KACA 1C83A 4B04A 2QBSA 3QCBA 3F9BA 2OC3A 3RGOA 2OUDA 3V0IA 1SUGA 2M3VA 4NX8A 3EMUA 4DGPA 4GFUA 1PYNA 2F6VA 2CM8A 2Q47A 3S3KA 2B49A 2F6TA 2C7SA 2QCTA 4RH5A 1NZ7A 5K9VA 2NV5A 3QCHA 2SHPA 4JBCA 2F70A 4Z6BA 1BZHA 5KA8A 3D44A 4AZ1A 1MKPA 4HJPA 2AHSA 2GWOA 5KA9A 4GRYA 4RH9A 4MBBA 3M4UA 5J8RA 2QBPA 2QBRA 2J16B 2HCMA 1YTSA 1L8KA 4ERCA 3RZ2A 1XRIA 1A5YA 3O5XA 1FPZA 3QCMA 3MMJA 3BLUA 5BZZA 4ZI4A 2CM2A 2CNGA 1ZCLA 3OLRA 1AAXA 4RHGA 4Y14A 5EHRA 3BM8A 2CMAA 3ZM3A 2IMGA 5LXQB 5K22A 1G7FA 1YGUA 4OHIA 1R6HA 4WOHA 4QUMA 2DXPA 1OHEA 1YGRA 3O4UA 2B07A 2HVLA 2VEWA 2F6ZA 1Q6TA 2R0BA 1U26A 3F41A 2NTAA 2I6OA 2CMBA 3QKPA 1KAVA 3O3LA 3QCGA 3MOZA 2MBCA 3LJ8A 1KAKA 4RKKA 4D3QA 2I42A 3V0HA 2A8BA 3OMHA 4YAAA 2P4DA 3V0GA 1RXDA 5K25A 4IKCA 5K24A 4KI9A 1PTYA 2A3KA 2PBNA 2HNPA 2BIJA 1G4WR 3S3HA 2I75A 4JNBA 2CNFA 1X24A 1NL9A 2B3OA 1YTWA 1ZCKA 2CMCA 3I36A 3QCIA 2C46A 1C87A 2NT2A 1T4JA 5IBMA 1OESA 3ZM2A 1PA1A 2H02A 3AWEA 1PA9A 3V0JA 2FJNA 3S3FA 1YWFA 1ONYA 3S4EA 4GFVA 2QEPA 1I57A 3V0DA 1OEMX 1G1HA 4DGXA 3CM3A 4NYHA 2PSZA 3SR9A 2QDPA 2Y2FA 4ICZA 2H4GA 2FH7A 3EU0A 3AWFA 3CWEA 4I8NA 4YR8B 4QBWA 3S4OA 2JJDA 4WU2A 1QZ0A 1PH0A 2AZRA 1I9TA 2I6JA 4H1OA 3A5JA 3ZMPA 4QBEA 5BZXA 4WTYA 2ZMMA 2YDUA 5MMZB 3EAXA 1NO6A 5KADA 3H2XA 4GRZA 3BRHA 1Q1MA 2I6PA 1OETA 1PTVA 2HC2A 1RPMA 1OEVA 1T48A 1Q6MA 3QCCA 3S3EA 1Q6JA 2PI7A 4RDDA 2CM7A 1OEOX 1G4US 2PA5A 1QXKA 1V3AA 1JF7A 2BZLA 1PTTA 3RGQA 3QCLA 3QCFA 2Y96A 5IBSA 3F99A 5HDEA 5K9WA 5EHPA 4GS0A 1LYVA 2OZ5A 2H4KA 4H34A 1LARA 1ZC0A 3ZMQA 5KAAA 2F6WA 3GXGA 2H04A 4HJQA 2E0TA 5BUGA 1D5RA 3ZV2A 1YPTA 4D3RA 4GE2A 1ONZA 1L8GA 4R30A 2ESBA 3NMEA 5I6VA 3D9CA 2J17A 2I1YA 4HRFA 1WRMA 3D1HA 4R0TA 2CJZA 2VEXA 1FQ1A 5KA4A 2QDCA 1PTUA 2CNEA 1I9SA 3N0AA 5KABA 3ZM0A 2I6IA 2I5XA 2PQ5A 2B4OA 3A5KA 2P6XA 4BJOA 2HC1A 1YFOA 1Q6NA 4ZN5A 3PS5A 2GP0A 2CNHA 2I3UA 2I6MA 3I7ZA 4RI5A 2J16A 4QAHA 1Q6SA 3I80A 2Q05A 2H03A 2H4VA 4R0SA 2BGDA 4OHEA 4OHHA 3QCKA 1T49A 2RF6A 3F81A 2CNIA 1XM2A 3B7OA 4NNDA 3ZM1A 2ZN7A 3QCNA 3D42A 2I4EA 2QCJA 1U24A 5KA7A 2CFVA 1GWZA 1G1GA 1WAXA 1JLNA 4RI4A 3GXHA 1M3GA 2BV5A 1XXVA 1XBOA 4NWFA 1C84A 3SMEA 2G59A 1C88A 5KA2A 2GJTA 2HNQA 1J4XA 4S0GA 1VHRA 4KYQA 5M43A 4PYHA 2HB1A 4QAPA 3RO1A 5GTJA 3O4SA 2F6YA 2VEVA 5KA3A 3QCJA 1BZCA 1Q6PA 1XXPA 1C85A 2NT7A 2B4SA 3F9AA 2WGPA 1EENA 1WCHA 3V0EA 3U96A 4GWFA 3QCEA 2BGEA 1ZZWA 4ZRTA 2VEYA 4PVGA 1LQFA 1PXHA 3BLTA 4J51A 5KA0A 1EEOA 2HXPA 2QBQA 5KA1A 1NWLA 3QCDA 4WU3A 4GE5A 1P15A 4D3PA 3D1QA 4QUNA 3EB1A 3V0FA 2F6FA 1NWEA 1ECVA 2QDMA 4BPCA 2NZ6A 3EZZA 4NWGA 4TVVA 5BX1A 3D1OA 2F71A 2OOQA 2I4GA 5K23A 1OHCA 4JMKA 3AWGA 5AWXA 4Y2EA 2F46A 1YZ4A 1OEUA 2B4PA 2VEUA 1FPRA 1G7GA 1C86A 2FJMA 4JMJA 1OHDA 1NNYA 3QKQA 2B4UA 2PT0A 3O4TA 4OHDA 4OHLA 2NLKA 2HY3A 4GE6A 1U25A 3MOWA 2I3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G1F A;  1YN9 A;  1GFY A;  4KYR A;  2CM3 A;  1BZJ A;  1YTN A;  2I4H A;  2G6Z A;  5KAC A;  1C83 A;  4B04 A;  2QBS A;  3QCB A;  3F9B A;  2OC3 A;  3RGO A;  2OUD A;  3V0I A;  1SUG A;  2M3V A;  4NX8 A;  3EMU A;  4DGP A;  4GFU A;  1PYN A;  2F6V A;  2CM8 A;  2Q47 A;  3S3K A;  2B49 A;  2F6T A;  2C7S A;  2QCT A;  4RH5 A;  1NZ7 A;  5K9V A;  2NV5 A;  3QCH A;  2SHP A;  4JBC A;  2F70 A;  4Z6B A;  1BZH A;  5KA8 A;  3D44 A;  4AZ1 A;  1MKP A;  4HJP A;  2AHS A;  2GWO A;  5KA9 A;  4GRY A;  4RH9 A;  4MBB A;  3M4U A;  5J8R A;  2QBP A;  2QBR A;  2J16 B;  2HCM A;  1YTS A;  1L8K A;  4ERC A;  3RZ2 A;  1XRI A;  1A5Y A;  3O5X A;  1FPZ A;  3QCM A;  3MMJ A;  3BLU A;  5BZZ A;  4ZI4 A;  2CM2 A;  2CNG A;  1ZCL A;  3OLR A;  1AAX A;  4RHG A;  4Y14 A;  5EHR A;  3BM8 A;  2CMA A;  3ZM3 A;  2IMG A;  5LXQ B;  5K22 A;  1G7F A;  1YGU A;  4OHI A;  1R6H A;  4WOH A;  4QUM A;  2DXP A;  1OHE A;  1YGR A;  3O4U A;  2B07 A;  2HVL A;  2VEW A;  2F6Z A;  1Q6T A;  2R0B A;  1U26 A;  3F41 A;  2NTA A;  2I6O A;  2CMB A;  3QKP A;  1KAV A;  3O3L A;  3QCG A;  3MOZ A;  2MBC A;  3LJ8 A;  1KAK A;  4RKK A;  4D3Q A;  2I42 A;  3V0H A;  2A8B A;  3OMH A;  4YAA A;  2P4D A;  3V0G A;  1RXD A;  5K25 A;  4IKC A;  5K24 A;  4KI9 A;  1PTY A;  2A3K A;  2PBN A;  2HNP A;  2BIJ A;  1G4W R;  3S3H A;  2I75 A;  4JNB A;  2CNF A;  1X24 A;  1NL9 A;  2B3O A;  1YTW A;  1ZCK A;  2CMC A;  3I36 A;  3QCI A;  2C46 A;  1C87 A;  2NT2 A;  1T4J A;  5IBM A;  1OES A;  3ZM2 A;  1PA1 A;  2H02 A;  3AWE A;  1PA9 A;  3V0J A;  2FJN A;  3S3F A;  1YWF A;  1ONY A;  3S4E A;  4GFV A;  2QEP A;  1I57 A;  3V0D A;  1OEM X;  1G1H A;  4DGX A;  3CM3 A;  4NYH A;  2PSZ A;  3SR9 A;  2QDP A;  2Y2F A;  4ICZ A;  2H4G A;  2FH7 A;  3EU0 A;  3AWF A;  3CWE A;  4I8N A;  4YR8 B;  4QBW A;  3S4O A;  2JJD A;  4WU2 A;  1QZ0 A;  1PH0 A;  2AZR A;  1I9T A;  2I6J A;  4H1O A;  3A5J A;  3ZMP A;  4QBE A;  5BZX A;  4WTY A;  2ZMM A;  2YDU A;  5MMZ B;  3EAX A;  1NO6 A;  5KAD A;  3H2X A;  4GRZ A;  3BRH A;  1Q1M A;  2I6P A;  1OET A;  1PTV A;  2HC2 A;  1RPM A;  1OEV A;  1T48 A;  1Q6M A;  3QCC A;  3S3E A;  1Q6J A;  2PI7 A;  4RDD A;  2CM7 A;  1OEO X;  1G4U S;  2PA5 A;  1QXK A;  1V3A A;  1JF7 A;  2BZL A;  1PTT A;  3RGQ A;  3QCL A;  3QCF A;  2Y96 A;  5IBS A;  3F99 A;  5HDE A;  5K9W A;  5EHP A;  4GS0 A;  1LYV A;  2OZ5 A;  2H4K A;  4H34 A;  1LAR A;  1ZC0 A;  3ZMQ A;  5KAA A;  2F6W A;  3GXG A;  2H04 A;  4HJQ A;  2E0T A;  5BUG A;  1D5R A;  3ZV2 A;  1YPT A;  4D3R A;  4GE2 A;  1ONZ A;  1L8G A;  4R30 A;  2ESB A;  3NME A;  5I6V A;  3D9C A;  2J17 A;  2I1Y A;  4HRF A;  1WRM A;  3D1H A;  4R0T A;  2CJZ A;  2VEX A;  1FQ1 A;  5KA4 A;  2QDC A;  1PTU A;  2CNE A;  1I9S A;  3N0A A;  5KAB A;  3ZM0 A;  2I6I A;  2I5X A;  2PQ5 A;  2B4O A;  3A5K A;  2P6X A;  4BJO A;  2HC1 A;  1YFO A;  1Q6N A;  4ZN5 A;  3PS5 A;  2GP0 A;  2CNH A;  2I3U A;  2I6M A;  3I7Z A;  4RI5 A;  2J16 A;  4QAH A;  1Q6S A;  3I80 A;  2Q05 A;  2H03 A;  2H4V A;  4R0S A;  2BGD A;  4OHE A;  4OHH A;  3QCK A;  1T49 A;  2RF6 A;  3F81 A;  2CNI A;  1XM2 A;  3B7O A;  4NND A;  3ZM1 A;  2ZN7 A;  3QCN A;  3D42 A;  2I4E A;  2QCJ A;  1U24 A;  5KA7 A;  2CFV A;  1GWZ A;  1G1G A;  1WAX A;  1JLN A;  4RI4 A;  3GXH A;  1M3G A;  2BV5 A;  1XXV A;  1XBO A;  4NWF A;  1C84 A;  3SME A;  2G59 A;  1C88 A;  5KA2 A;  2GJT A;  2HNQ A;  1J4X A;  4S0G A;  1VHR A;  4KYQ A;  5M43 A;  4PYH A;  2HB1 A;  4QAP A;  3RO1 A;  5GTJ A;  3O4S A;  2F6Y A;  2VEV A;  5KA3 A;  3QCJ A;  1BZC A;  1Q6P A;  1XXP A;  1C85 A;  2NT7 A;  2B4S A;  3F9A A;  2WGP A;  1EEN A;  1WCH A;  3V0E A;  3U96 A;  4GWF A;  3QCE A;  2BGE A;  1ZZW A;  4ZRT A;  2VEY A;  4PVG A;  1LQF A;  1PXH A;  3BLT A;  4J51 A;  5KA0 A;  1EEO A;  2HXP A;  2QBQ A;  5KA1 A;  1NWL A;  3QCD A;  4WU3 A;  4GE5 A;  1P15 A;  4D3P A;  3D1Q A;  4QUN A;  3EB1 A;  3V0F A;  2F6F A;  1NWE A;  1ECV A;  2QDM A;  4BPC A;  2NZ6 A;  3EZZ A;  4NWG A;  4TVV A;  5BX1 A;  3D1O A;  2F71 A;  2OOQ A;  2I4G A;  5K23 A;  1OHC A;  4JMK A;  3AWG A;  5AWX A;  4Y2E A;  2F46 A;  1YZ4 A;  1OEU A;  2B4P A;  2VEU A;  1FPR A;  1G7G A;  1C86 A;  2FJM A;  4JMJ A;  1OHD A;  1NNY A;  3QKQ A;  2B4U A;  2PT0 A;  3O4T A;  4OHD A;  4OHL A;  2NLK A;  2HY3 A;  4GE6 A;  1U25 A;  3MOW A;  2I3R A; 
#chains in the Genus database with same CATH topology
 1G1F A;  1P31 A;  1YN9 A;  2AM2 A;  1GFY A;  4KYR A;  2CM3 A;  1W78 A;  1BZJ A;  1YTN A;  2I4H A;  2G6Z A;  5KAC A;  1C83 A;  4B04 A;  2QBS A;  3QCB A;  3ZM6 A;  3F9B A;  2OC3 A;  3RGO A;  2OUD A;  3V0I A;  1SUG A;  1FGS A;  2M3V A;  4NX8 A;  3EMU A;  4DGP A;  4GFU A;  1PYN A;  2F6V A;  2CM8 A;  1W7K A;  2Q47 A;  3S3K A;  2B49 A;  2F6T A;  2C7S A;  2QCT A;  5A5F A;  4RH5 A;  1NZ7 A;  5K9V A;  1P3D A;  2NV5 A;  3QCH A;  2SHP A;  4JBC A;  2F70 A;  4Z6B A;  1BZH A;  5KA8 A;  3D44 A;  4AZ1 A;  1MKP A;  4HJP A;  2VOR A;  2AHS A;  2GWO A;  5KA9 A;  4GRY A;  4RH9 A;  4MBB A;  3M4U A;  5J8R A;  2QBP A;  2QBR A;  2J16 B;  2HCM A;  1YTS A;  1L8K A;  4ERC A;  3RZ2 A;  1XRI A;  3N2A A;  3UAG A;  1A5Y A;  3O5X A;  1FPZ A;  3QCM A;  3MMJ A;  3BLU A;  5BZZ A;  4ZI4 A;  2CM2 A;  2CNG A;  1ZCL A;  3OLR A;  2XJA A;  1AAX A;  4RHG A;  4Y14 A;  5EHR A;  3BM8 A;  2CMA A;  3ZM3 A;  2IMG A;  5LXQ B;  5K22 A;  1G7F A;  1YGU A;  4OHI A;  1R6H A;  1GQY A;  4WOH A;  4QUM A;  2DXP A;  1OHE A;  1YGR A;  3O4U A;  2B07 A;  2HVL A;  2VEW A;  2F6Z A;  1Q6T A;  4BUB A;  2R0B A;  1U26 A;  3F41 A;  1JBV A;  2I6O A;  2NTA A;  2CMB A;  3QKP A;  1KAV A;  3O3L A;  3QCG A;  3MOZ A;  2MBC A;  3LJ8 A;  1KAK A;  4RKK A;  4D3Q A;  2I42 A;  3V0H A;  2A8B A;  2X5O A;  3OMH A;  4YAA A;  2Y66 A;  2JFG A;  2P4D A;  3V0G A;  1GQQ A;  1RXD A;  5K25 A;  4IKC A;  5K24 A;  4KI9 A;  1PTY A;  2A3K A;  2PBN A;  2HNP A;  2BIJ A;  1G4W R;  1J6U A;  3S3H A;  3NRS A;  2I75 A;  3QCZ A;  4JNB A;  2CNF A;  1X24 A;  1NL9 A;  2B3O A;  4ZIY A;  1YTW A;  1ZCK A;  2CMC A;  3I36 A;  3QCI A;  2C46 A;  1UAG A;  1C87 A;  2NT2 A;  2AM1 A;  2Y67 A;  1T4J A;  5IBM A;  1OES A;  3ZM2 A;  1PA1 A;  2H02 A;  3AWE A;  1PA9 A;  4CVL A;  3V0J A;  2FJN A;  3S3F A;  1YWF A;  1ONY A;  3S4E A;  4GFV A;  2QEP A;  1I57 A;  3V0D A;  1OEM X;  3HN7 A;  1G1H A;  4DGX A;  3CM3 A;  4NYH A;  2PSZ A;  3SR9 A;  2QDP A;  2WTZ A;  2Y2F A;  4ICZ A;  2GCA A;  2H4G A;  2FH7 A;  3EU0 A;  3AWF A;  3CWE A;  4I8N A;  4YR8 B;  4QBW A;  3S4O A;  3LK7 A;  2JJD A;  4WU2 A;  1QZ0 A;  1PH0 A;  2AZR A;  1I9T A;  4HV4 A;  2I6J A;  2Y1O A;  1O5Z A;  4H1O A;  3A5J A;  3ZMP A;  4QBE A;  5BZX A;  4WTY A;  2ZMM A;  2YDU A;  5MMZ B;  3EAX A;  1NO6 A;  5KAD A;  3H2X A;  4GRZ A;  3BRH A;  1Q1M A;  2I6P A;  1OET A;  1PTV A;  2HC2 A;  1GG4 A;  1RPM A;  2JFH A;  2VTE A;  1OEV A;  1T48 A;  1Q6M A;  1E0D A;  3QCC A;  3S3E A;  1Q6J A;  2PI7 A;  4RDD A;  2GC6 A;  2CM7 A;  2GCB A;  3PYZ A;  1OEO X;  1G4U S;  2PA5 A;  1QXK A;  1V3A A;  1JF7 A;  2BZL A;  1PTT A;  3ZM5 A;  3RGQ A;  3QCL A;  3QCF A;  2Y96 A;  5IBS A;  3F99 A;  4QF5 A;  5HDE A;  5K9W A;  5EHP A;  4GS0 A;  1LYV A;  2OZ5 A;  2UUP A;  2H4K A;  4H34 A;  1LAR A;  1ZC0 A;  2Y68 A;  3ZMQ A;  5KAA A;  2F6W A;  3GXG A;  2H04 A;  4HJQ A;  2E0T A;  5BUG A;  1D5R A;  3ZV2 A;  1YPT A;  4D3R A;  4GE2 A;  1ONZ A;  1L8G A;  4R30 A;  2JFF A;  2ESB A;  3NME A;  5I6V A;  3D9C A;  2J17 A;  2I1Y A;  3MVN A;  5A5E A;  4HRF A;  1WRM A;  3D1H A;  4R0T A;  2CJZ A;  2VEX A;  1FQ1 A;  5KA4 A;  2QDC A;  1PTU A;  2CNE A;  1I9S A;  3N0A A;  4C13 A;  5KAB A;  3ZM0 A;  2I6I A;  2VOS A;  2I5X A;  2PQ5 A;  2B4O A;  3A5K A;  2P6X A;  4BJO A;  2HC1 A;  1YFO A;  1Q6N A;  4ZN5 A;  3PS5 A;  2GP0 A;  2CNH A;  2I3U A;  2I6M A;  3I7Z A;  4RI5 A;  2J16 A;  4QAH A;  1Q6S A;  3I80 A;  2Q05 A;  2H03 A;  2H4V A;  4R0S A;  2BGD A;  4OHE A;  4OHH A;  3QCK A;  1T49 A;  2RF6 A;  3F81 A;  2CNI A;  1XM2 A;  3B7O A;  4NND A;  3ZM1 A;  4CVK A;  2ZN7 A;  3QCN A;  3D42 A;  2I4E A;  2WJP A;  2QCJ A;  1U24 A;  4CVM A;  5KA7 A;  2CFV A;  1GWZ A;  2GC5 A;  1G1G A;  1WAX A;  1JLN A;  4QDI A;  4RI4 A;  3GXH A;  1M3G A;  2BV5 A;  2VTD A;  1XXV A;  1XBO A;  4NWF A;  1C84 A;  1EEH A;  2G59 A;  1C88 A;  3SME A;  5KA2 A;  2GJT A;  2HNQ A;  1J4X A;  4S0G A;  1VHR A;  3ZL8 A;  4KYQ A;  1JBW A;  5M43 A;  4PYH A;  2HB1 A;  4QAP A;  3RO1 A;  5GTJ A;  3O4S A;  2F6Y A;  2VEV A;  5KA3 A;  3QCJ A;  1BZC A;  1Q6P A;  1XXP A;  1C85 A;  2NT7 A;  2B4S A;  3F9A A;  2WGP A;  1EEN A;  1WCH A;  3V0E A;  3U96 A;  4GWF A;  3QCE A;  2BGE A;  1ZZW A;  4ZRT A;  2VEY A;  1E8C A;  4PVG A;  1LQF A;  1PXH A;  3BLT A;  4J51 A;  5KA0 A;  2UUO A;  1EEO A;  2F00 A;  2HXP A;  2QBQ A;  5KA1 A;  1NWL A;  3QCD A;  4WU3 A;  4GE5 A;  1P15 A;  4D3P A;  3D1Q A;  4BUC A;  4QUN A;  3EB1 A;  3V0F A;  2F6F A;  1NWE A;  1ECV A;  2QDM A;  4BPC A;  2NZ6 A;  3EZZ A;  4NWG A;  4TVV A;  5BX1 A;  3D1O A;  2UAG A;  2F71 A;  2OOQ A;  2I4G A;  5K23 A;  1OHC A;  4JMK A;  3AWG A;  4UAG A;  5AWX A;  4Y2E A;  2F46 A;  1YZ4 A;  1OEU A;  2B4P A;  2VEU A;  1FPR A;  1G7G A;  1C86 A;  2FJM A;  4JMJ A;  1OHD A;  1NNY A;  3QKQ A;  2B4U A;  2PT0 A;  3O4T A;  4OHD A;  2XPC A;  4OHL A;  2NLK A;  2HY3 A;  4GE6 A;  4C12 A;  1U25 A;  3MOW A;  2I3R A; 
#chains in the Genus database with same CATH homology
 1G1F A;  1YN9 A;  1GFY A;  4KYR A;  2CM3 A;  1BZJ A;  1YTN A;  2I4H A;  2G6Z A;  5KAC A;  1C83 A;  4B04 A;  2QBS A;  3QCB A;  3F9B A;  2OC3 A;  3RGO A;  2OUD A;  3V0I A;  1SUG A;  2M3V A;  4NX8 A;  3EMU A;  4DGP A;  4GFU A;  1PYN A;  2F6V A;  2CM8 A;  2Q47 A;  3S3K A;  2B49 A;  2F6T A;  2C7S A;  2QCT A;  4RH5 A;  1NZ7 A;  5K9V A;  2NV5 A;  3QCH A;  2SHP A;  4JBC A;  2F70 A;  4Z6B A;  1BZH A;  5KA8 A;  3D44 A;  4AZ1 A;  1MKP A;  4HJP A;  2AHS A;  2GWO A;  5KA9 A;  4GRY A;  4RH9 A;  4MBB A;  3M4U A;  5J8R A;  2QBP A;  2QBR A;  2J16 B;  2HCM A;  1YTS A;  1L8K A;  4ERC A;  3RZ2 A;  1XRI A;  1A5Y A;  3O5X A;  1FPZ A;  3QCM A;  3MMJ A;  3BLU A;  5BZZ A;  4ZI4 A;  2CM2 A;  2CNG A;  1ZCL A;  3OLR A;  1AAX A;  4RHG A;  4Y14 A;  5EHR A;  3BM8 A;  2CMA A;  3ZM3 A;  2IMG A;  5LXQ B;  5K22 A;  1G7F A;  1YGU A;  4OHI A;  1R6H A;  4WOH A;  4QUM A;  2DXP A;  1OHE A;  1YGR A;  3O4U A;  2B07 A;  2HVL A;  2VEW A;  2F6Z A;  1Q6T A;  2R0B A;  1U26 A;  3F41 A;  2NTA A;  2I6O A;  2CMB A;  3QKP A;  1KAV A;  3O3L A;  3QCG A;  3MOZ A;  2MBC A;  3LJ8 A;  1KAK A;  4RKK A;  4D3Q A;  2I42 A;  3V0H A;  2A8B A;  3OMH A;  4YAA A;  2P4D A;  3V0G A;  1RXD A;  5K25 A;  4IKC A;  5K24 A;  4KI9 A;  1PTY A;  2A3K A;  2PBN A;  2HNP A;  2BIJ A;  1G4W R;  3S3H A;  2I75 A;  4JNB A;  2CNF A;  1X24 A;  1NL9 A;  2B3O A;  1YTW A;  1ZCK A;  2CMC A;  3I36 A;  3QCI A;  2C46 A;  1C87 A;  2NT2 A;  1T4J A;  5IBM A;  1OES A;  3ZM2 A;  1PA1 A;  2H02 A;  3AWE A;  1PA9 A;  3V0J A;  2FJN A;  3S3F A;  1YWF A;  1ONY A;  3S4E A;  4GFV A;  2QEP A;  1I57 A;  3V0D A;  1OEM X;  1G1H A;  4DGX A;  3CM3 A;  4NYH A;  2PSZ A;  3SR9 A;  2QDP A;  2Y2F A;  4ICZ A;  2H4G A;  2FH7 A;  3EU0 A;  3AWF A;  3CWE A;  4I8N A;  4YR8 B;  4QBW A;  3S4O A;  2JJD A;  4WU2 A;  1QZ0 A;  1PH0 A;  2AZR A;  1I9T A;  2I6J A;  4H1O A;  3A5J A;  3ZMP A;  4QBE A;  5BZX A;  4WTY A;  2ZMM A;  2YDU A;  5MMZ B;  3EAX A;  1NO6 A;  5KAD A;  3H2X A;  4GRZ A;  3BRH A;  1Q1M A;  2I6P A;  1OET A;  1PTV A;  2HC2 A;  1RPM A;  1OEV A;  1T48 A;  1Q6M A;  3QCC A;  3S3E A;  1Q6J A;  2PI7 A;  4RDD A;  2CM7 A;  1OEO X;  1G4U S;  2PA5 A;  1QXK A;  1V3A A;  1JF7 A;  2BZL A;  1PTT A;  3RGQ A;  3QCL A;  3QCF A;  2Y96 A;  5IBS A;  3F99 A;  5HDE A;  5K9W A;  5EHP A;  4GS0 A;  1LYV A;  2OZ5 A;  2H4K A;  4H34 A;  1LAR A;  1ZC0 A;  3ZMQ A;  5KAA A;  2F6W A;  3GXG A;  2H04 A;  4HJQ A;  2E0T A;  5BUG A;  1D5R A;  3ZV2 A;  1YPT A;  4D3R A;  4GE2 A;  1ONZ A;  1L8G A;  4R30 A;  2ESB A;  3NME A;  5I6V A;  3D9C A;  2J17 A;  2I1Y A;  4HRF A;  1WRM A;  3D1H A;  4R0T A;  2CJZ A;  2VEX A;  1FQ1 A;  5KA4 A;  2QDC A;  1PTU A;  2CNE A;  1I9S A;  3N0A A;  5KAB A;  3ZM0 A;  2I6I A;  2I5X A;  2PQ5 A;  2B4O A;  3A5K A;  2P6X A;  4BJO A;  2HC1 A;  1YFO A;  1Q6N A;  4ZN5 A;  3PS5 A;  2GP0 A;  2CNH A;  2I3U A;  2I6M A;  3I7Z A;  4RI5 A;  2J16 A;  4QAH A;  1Q6S A;  3I80 A;  2Q05 A;  2H03 A;  2H4V A;  4R0S A;  2BGD A;  4OHE A;  4OHH A;  3QCK A;  1T49 A;  2RF6 A;  3F81 A;  2CNI A;  1XM2 A;  3B7O A;  4NND A;  3ZM1 A;  2ZN7 A;  3QCN A;  3D42 A;  2I4E A;  2QCJ A;  1U24 A;  5KA7 A;  2CFV A;  1GWZ A;  1G1G A;  1WAX A;  1JLN A;  4RI4 A;  3GXH A;  1M3G A;  2BV5 A;  1XXV A;  1XBO A;  4NWF A;  1C84 A;  3SME A;  2G59 A;  1C88 A;  5KA2 A;  2GJT A;  2HNQ A;  1J4X A;  4S0G A;  1VHR A;  4KYQ A;  5M43 A;  4PYH A;  2HB1 A;  4QAP A;  3RO1 A;  5GTJ A;  3O4S A;  2F6Y A;  2VEV A;  5KA3 A;  3QCJ A;  1BZC A;  1Q6P A;  1XXP A;  1C85 A;  2NT7 A;  2B4S A;  3F9A A;  2WGP A;  1EEN A;  1WCH A;  3V0E A;  3U96 A;  4GWF A;  3QCE A;  2BGE A;  1ZZW A;  4ZRT A;  2VEY A;  4PVG A;  1LQF A;  1PXH A;  3BLT A;  4J51 A;  5KA0 A;  1EEO A;  2HXP A;  2QBQ A;  5KA1 A;  1NWL A;  3QCD A;  4WU3 A;  4GE5 A;  1P15 A;  4D3P A;  3D1Q A;  4QUN A;  3EB1 A;  3V0F A;  2F6F A;  1NWE A;  1ECV A;  2QDM A;  4BPC A;  2NZ6 A;  3EZZ A;  4NWG A;  4TVV A;  5BX1 A;  3D1O A;  2F71 A;  2OOQ A;  2I4G A;  5K23 A;  1OHC A;  4JMK A;  3AWG A;  5AWX A;  4Y2E A;  2F46 A;  1YZ4 A;  1OEU A;  2B4P A;  2VEU A;  1FPR A;  1G7G A;  1C86 A;  2FJM A;  4JMJ A;  1OHD A;  1NNY A;  3QKQ A;  2B4U A;  2PT0 A;  3O4T A;  4OHD A;  4OHL A;  2NLK A;  2HY3 A;  4GE6 A;  1U25 A;  3MOW A;  2I3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...