4B11A

Plasmodium vivax n-myristoyltransferase with a bound benzofuran inhibitor (compound 13)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and Synthesis of Inhibitors of Plasmodium Falciparum N-Myristoyltransferase, a Promising Target for Anti-Malarial Drug Discovery.
pubmed doi rcsb
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
molecule tags Transferase
source organism Plasmodium vivax
total genus 116
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4b11A00
4UFXA 4C2XA 2YNCA 4BBHA 2YNEA 5A28A 4UFVA 4CGOA 3JTKA 5AGEA 5AG7A 5G20A 4A30A 5AG5A 2YNDA 4B12A 2YNCC 2WSAA 3H5ZA 3IU1A 4CGPA 3IU2A 4A33A 4A32A 4CAEA 2WUUA 4CYOA 5AG6A 4CGNA 4CGLA 4UCMA 4B10A 4A2ZA 5AG4A 4UCPA 4B11A 4CAFA 5G1ZA 4A31A 4CGMA 4A95A 4B14A 4C68A 4C7IA 4CYPA 4UFWA 5G22A 4B13A 4CYNA 4C2ZA 3IWEA 4CYQA 5A27A 5G21A 4C2YA 4C7HA 4UCNA
chains in the Genus database with same CATH superfamily
2ZXVA 2KCWA 4C2XA 2YNCA 2WYRA 4P4DA 4H2KA 2C6GA 2Q43A 2A4NA 3NH5A 2YNDA 2WSAA 4XNHB 4A33A 3CXQA 1UFHA 4UWIA 3FXTA 3NH8A 1B6BA 4I49A 4OC5A 4B10A 1BLLE 3P2FA 2JBKA 3SI0A 5G1ZA 5F46A 4UEFA 4X2TA 1X12A 2V8DA 8CPAA 1R57A 3DSBA 1MJBA 4OKOA 2VZZA 3IWEA 2Z3LA 4NJQA 5THWA 4UIBA 1YVOA 1XF8A 2ZOGA 3PBEA 4KOXA 4B5PB 1PCAA 3RAMA 4UFXA 4ZY0A 3B3SA 4DJLA 1S7FA 3D7DA 1NSAA 2PJ4A 1K4JA 1VIXA 3PB6X 4P10A 1Q2DA 5DS0A 3G8WA 2AFMA 1CX8A 4M3SA 1TKHA 5J8FA 1QQ9A 1FY7A 1CP6A 2Q7SA 1MJAA 2Q51A 2R8VA 4R8FA 1FNOA 4CGNA 1S7LA 4R57A 4P4BA 5F47A 2DPTA 1CM0A 3V8IA 1PYTB 2FT0A 2Q4VA 4M6GA 3R9GA 4U9ZA 4C7IA 2RC4A 5CPAA 1S7KA 1TXRA 4Q38A 3TTHA 4AVCA 5JPHA 2ZEGA 3IGRA 4II9A 1KUXA 4RS2A 3CPXA 5G21A 1WK4A 2GFQA 4P4JA 3ZJ0A 3LWUA 3MN8A 2I79A 2ZW4A 2BOAA 3P2HA 2WZNA 4IHMA 5H86A 4Z65A 1RXTA 1BPNA 1ZG7A 4MFPA 4WJBA 4DNCA 1ZLIA 2DEAA 3TE4A 2OZGA 4MI4A 4P6YA 5LYDA 5J8CA 3GY9A 1F2PA 1I12A 3PGPA 3DGVA 2WUUA 3H8FA 1VHOA 4KOUA 4XPDC 5AG6A 4NJRA 3D8PA 4P4FA 3EXNA 5K8OA 2PCUA 3PRTA 2FSRA 5I0CA 4ZX8A 3VWDA 2B58A 2GU2A 4R7MA 4XPLA 2BEIA 4KOWA 1ZLHA 5KTCA 4YU9A 4WWVA 3S6GA 4UFWA 5G22A 3S6FA 3FIXA 3R9EA 3GIUA 3QB8A 4ONUA 3QNVA 3FBUA 4KUAA 4YFJA 3KHZA 3PEIA 4OIWA 4EMEA 2GLFA 3FVLA 3HUVA 1DTDA 3KR4A 4F9VA 2VI7A 3FB3A 4OC2A 4OMEA 2DPSA 1U6MA 2PRQA 4PSWA 4UFVA 1M4IA 3V7ZA 4OP4A 2XEFA 3IJ3A 2B5GB 2Z11A 2PJCA 4J3GA 3IC1A 3FX6A 1Y9WA 3D7GA 4Y49B 3GLJA 2FXFA 2Y0MA 2FS5A 2V8VA 2G9DA 1TKJA 4KSIA 4B13A 4OIDA 4NGMA 4GS4A 2R1IA 2YGWA 1BOBA 4MHPA 1L0CA 2ZEFA 4CRZB 1M4LA 5LYLA 5HMNA 4NGQA 2Q4ZA 1PUAA 3IO1A 4MCPA 4AVAA 5F49A 2FE7A 2YNCC 2Z3KA 1CBXA 1CJWA 1Y9KA 2EK8A 3B7IA 4FUUA 5CBMA 1YREA 2G0BA 3BI0A 4MCSA 2XEIA 2I3CA 1QSMA 4UWJA 3FH4A 2QVPA 3RYOA 2CTCA 4L8AA 4TWEA 4EWTA 3BHXA 2OZHA 4PXDA 3WT4A 4A95A 3JVNA 4C68A 3R95A 5ISVA 4MY0A 1UWYA 3D2PA 3W91A 3SHPA 1IOFA 1KZFA 1VKCA 4M6IA 3I1UA 2ZW5A 1YR0A 2V8GA 1RO5A 2PR8A 4RUHA 2QMLA 1Z8TA 1NE9A 2QIRA 4JXRA 1M4GA 4KS9A 1VHEA 1XBUA 1KWMA 4HPSA 3TOBA 2O28A 4CGPA 2QYVA 4P45A 3S6KA 4QBJA 4IK2A 4PQAA 2PSWA 4MCQA 2B4DB 1Y0RA 2J8RA 4PSXA 3N7ZA 1QSTA 4K3NA 1YW6A 3BI1A 4QUSA 1LANA 3VWEA 2O53A 2IQ6A 1Y7EA 3CXPA 4PK2A 2OOTA 4BD9A 1IU8A 2ZEHA 4A37A 4AG7A 2ZEPA 3D67A 3IFEA 2OZUA 3S9NA 4PXBA 3BJ7A 4FAIA 3OWCA 4P44A 4YRHA 3PZJA 4AVBA 3IEHA 4W9YA 5I4MA 2CIJA 1Z4RA 2JEVA 4AXVA 1QSRA 4KSAA 4X3RA 3WC6A 4DUKA 2P6EA 2ZENA 2JLMA 1N71A 3DDDA 3PBBA 4A30A 3EC4A 4PV6A 1ELLP 1GYTA 2ZPAA 3LODA 5AG5A 2PJ1A 4AG9A 3SJXA 2OH1A 1YSJA 4Y49C 3SJEA 3T9YA 4A32A 4CYOA 5JGFA 1LAPA 3FRMA 5F09A 1H8LA 3LMSA 2ATRA 3BJ8A 3CXSA 3F8KA 2F8HA 2I00A 2DXQA 4CAFA 4CRYB 4FBEA 6CPAA 1NMTA 2Z10A 2IL4A 2PIZA 1DE4C 3R1KA 4PK3A 1ELMP 3TT2A 4LQGA 4CYPA 3DLJA 1HEEA 2GLJA 3KKWA 2AJ6A 4IF5A 1YK3A 4G1PA 4KOTA 3NA6A 2EO8A 4R87A 5HH1A 2B5GA 5LRJA 4H6UA 4ORFA 1S5KA 2GREA 2AFOA 5F48A 2AFWA 2ANPA 3R9FA 2P0WA 2ZEEA 2H5MA 5HVGA 4JD6A 4MCRA 2B3UA 5EMIA 3KASA 4F8ZA 1IYLA 2FVGA 3JRUA 5GCNA 2BO9A 3PB8X 3PB4X 2BCOA 4NFRA 4UCMA 5CNPA 3I3GA 5E96A 2IJZA 4YWYA 3D68A 3F5BA 1EE3P 1P0HA 4M6HA 4RN7A 3SI1A 3W6XA 1XEBA 2GE3A 4JJXA 1LFWA 4PXCA 1M4DA 1AUGA 1IICA 3I9SA 2OU2A 4C2YA 2HV2A 3PFOA 4F0YA 2NSMA 3S9MA 2PJ8A 4FD7A 1ZG9A 4KOYA 2F5IA 3TCVA 4BBHA 3EFAA 3JTKA 4XNHC 1YGHA 2ZEMA 2AFXA 2PRBA 2ZELA 3NE8A 5G20A 1MK4A 3RBUA 2R7HA 3SJFA 2FCKA 2ZW6A 4LQ6A 3VATA 4H6ZA 1OBRA 1XE4A 1Z8XA 2ZEDA 4UF4A 2ODFA 3S6HA 1QSOA 4MFKA 4U5YA 2PC1A 3D7HA 1YQEA 3WABA 4P4EA 3BLNA 4JZ0A 3FMCA 2CNTA 2NYQA 2V8HA 4H89A 4A31A 4BMHA 4C7HA 4FD6A 4AB7A 5IB0A 3H4QA 5DWNA 3HLPA 3KL9A 1Z2LA 3D4UA 4LX9A 3SJGA 3RZAA 2BUEA 3R96A 1S3ZA 4ZX9A 4NGPA 5LRKA 4FD5A 4OC0A 1Y0YA 4K30A 5A28A 2B4DA 4MFZA 4CGOA 3GB0A 4FWUA 2XEGA 2OR4A 3FEEA 3F0AA 1IB1E 4RI1A 2PIYA 4NSQA 4B12A 2RB7A 3IU1A 3IWGA 3PB7X 2J8MA 2P6FA 1LRZA 1LCPA 2HB6A 3D66A 3K2KA 2QECA 3ISXA 1XOVA 4TNUA 5H84A 3CT9A 5LRGA 1B87A 2Z0ZA 4HNXB 3UY5A 4OC1A 5C82A 3B8GA 1VHSA 2RFHA 3B2YA 1AMPA 3B3CA 3BXMA 2REEA 4FD4A 1HDQA 4IAVA 3NE7A 2POKA 2V77A 4MFLA 3TO6A 3KGQA 4NGRA 4NF1A 1SQHA 2PJ5A 3DNSA 3WC7A 1LAMA 1QMUA 2ZEOA 3KHXA 2PJ9A 1R3NA 1TKFA 2ZOFA 4R3LA 5KTDA 2PJAA 1AYEA 3D7FA 2CNMA 2DF5A 4KOSA 4ZI6A 1ARMA 5K8NA 2Q7BA 2PVVA 3TO7A 4U9YA 1IGBA 3TO9A 1ARLA 1BO4A 4XPDB 4A2ZA 4L89A 3WR7A 1S7NA 4JLYA 2VZYA 2VL1A 2C27A 2PQ8A 4KZTA 5ELYA 4F6AA 4M85A 2BL1A 1Y7RA 3PFEA 4NGNA 4OC3A 2P6GA 3FNCA 4P4IA 3DR8A 4CGMA 2REFA 2C6CA 4QC6A 3FEDA 2Q04A 1XMTA 1IOIA 4KVXA 3WC5A 1XFOA 4MBUA 4CYQA 4NGTA 2B4BA 3E0KA 3K9UA 4B5OA 4MHDA 2X7BA 2AFZA 2VEZA 4NEXA 4F9UA 2ABZA 2Q44A 4KORA 1IIDA 3G3SA 3B35A 2HQYA 5AGEA 5JM6A 5AG7A 1LOKA 4QB9A 4A94A 1TF8A 2D4OA 2EK9A 2QJ8A 3T8WA 3B3VA 2EBJA 3B3TA 2PE3A 2PR1A 3PP9A 3KI9A 5JH9A 1R43A 2IMOA 3D2MA 4HNYB 1KUYA 5EBVA 3LACA 1I21A 2Z3OA 4UEZA 1CP7A 1TF9A 4R9MA 4MHZA 4DYOA 4ZGYB 2WPWA 5KTAA 1XIXA 3VARA 5BWAB 5HVHA 1F2OA 3GUXA 3CZXA 3FYNA 2VQYA 1HDUA 3EO4A 4JXQA 3SXNA 5HXDA 4NGSA 1GHEA 1S60A 1YX0A 1FT7A 5LYFA 4UCNA 3TOAA 5IX3A 2PJ6A 2PJ0A 1X10A 3LD2A 2YNEA 3TFYA 3GYAA 1VGYA 1Q7LA 3N5FA 1ON0A 4MJ8A 1KUVA 2Q0YA 5IV0A 4ZY2A 3S9LA 2K5TA 4A38A 5IB9A 2PJ3A 3JUWA 3MRUA 4O23A 5K8PA 4JYWA 4NXYA 3QAYA 3ISZA 2PJ7A 4ZY1A 3CDXA 4MRIA 3PB9X 4KLWA 4OADA 1CG2A 4MMOA 3EY5A 1Z4EA 1Z5RA 5DWMA 4UIAA 2PDOA 4CS0B 1J4JA 4F0XA 3IWWA 1QSNA 2CNSA 2GIVA 4C2ZA 4ONWA 1Q2CA 5A27A 2C1CA 2Z3MA 2JBJA 1RTQA 2Z3NA 1YLOA 4MFQA 1F57A 2VBQA 2VXKA 4OAEA 1A2ZA 5K8MA 1WWZA 3NH4A 4X5KA 3RO0A 3DR6A 1M1DA 4E2AA 1Z9UA 1Z8LA 4KOVA 4CAEA 2JEWA 3KR5A 4MHYA 2Z3PA 3V38A 5JQ4A 4HKFA 3QAHA 3A9LA 4Q7AA 4X8IA 2WPXA 5AG4A 3ZZIA 3L2NA 5D8NA 4R3KA 4ZYQA 4IUSA 4MXUA 3VH9A 3KQXA 2Q4YA 3K9TA 4KVME 3CPAA 4CYNA 2O4HA 1YMEA 3B3WA 2D4PA 2NMTA 4KLVA 3KZWA 1IYKA 1YVKA 2PJBA 2CF4A 4CAXA 2G3TA 2AE6A 4GXHA 1JQGA 2PJ2A 2G3AA 2CXAA 3FF3A 3MGDA 4NCZA 4XPKA 4E8OA 1Z8WA 4HNWB 2FIWA 4JWPA 5FVJA 3D3SA 2FIAA 3TC8A 2C6PA 5LYIA 1XRYA 2F7VA 3FJUA 3H8GA 3IIBA 5J1QA 4UA3A 1XMBA 2GANA 2HC9A 4KSFA 2JDCA 3IU2A 2AFUA 3C26A 1IY7A 2R98A 4QVTA 4YGOA 3RNZA 3SI2A 2OB0A 1PU9A 2ARHA 4LUAA 4UCPA 1M44A 4A39A 3NFZA 4UBRA 5C88A 2EUIA 5EC4A 1CPSA 1XJOA 4OC4A 3T90A 2CTBA 3SXOA 1BAVA 4PPZA 4ZBGA 4UEEA 3KQZA 3TX8A 1V0CA 5HVFA 1Q2YA 3FECA 4CAWA 4MHNA 4GM5A 4OLLA 1CPXA 1YLEA 2EWBA 5D29A 1P4NA 4EFDA 4B6ZA 1MJ9A 1I1DA 3H5ZA 1TIQA 2JDDA 4CPAA 2AFSA 4MFJA 4CAVA 1ZG8A 2J8NA 1OZPA 4CGLA 2CY2A 3H8EA 2BSWA 4B11A 2EVNA 1BPMA 4PXEA 4R76A 4EVYA 4B5PA 1YW4A 2FL4A 4B14A 4R6TA 4BINA 2J9AA 3GKRA 1ZO0A 7CPAA 2ZW7A 3W6SA 4KVOE 2HUZA 1NSLA 2XEJA 1JWQA 4E0AA 4MY3A 2PVWA 4KUBA 2B3VA 4Q36A
chains in the Genus database with same CATH topology
2ZXVA 2KCWA 4C2XA 2YNCA 2A4NA 2YNDA 2WSAA 4XNHB 4A33A 3CXQA 1UFHA 4UWIA 3FXTA 1B6BA 4I49A 4B10A 3P2FA 5G1ZA 5F46A 1R57A 3DSBA 1MJBA 2VZZA 3IWEA 2Z3LA 1YVOA 1XF8A 4KOXA 4B5PB 4UFXA 1S7FA 1K4JA 1Q2DA 3G8WA 4M3SA 5J8FA 2R8VA 1FY7A 1MJAA 4CGNA 1S7LA 4R57A 5F47A 2DPTA 1CM0A 3V8IA 2FT0A 2Q4VA 3R9GA 4U9ZA 4C7IA 2RC4A 1S7KA 4Q38A 3TTHA 4AVCA 5JPHA 3IGRA 4II9A 1KUXA 4RS2A 5G21A 1WK4A 3ZJ0A 2I79A 2ZW4A 3P2HA 5H86A 1RXTA 4MFPA 4DNCA 3TE4A 2OZGA 4MI4A 5J8CA 3GY9A 3PGPA 1I12A 4XPDC 2WUUA 4KOUA 5AG6A 3D8PA 3EXNA 2FSRA 5I0CA 3VWDA 2B58A 4XPLA 2BEIA 4KOWA 5KTCA 3S6GA 4UFWA 5G22A 3S6FA 3FIXA 3R9EA 3QB8A 4ONUA 3FBUA 4KUAA 4YFJA 2VI7A 3FB3A 2DPSA 1U6MA 4PSWA 4UFVA 1M4IA 2B5GB 2Z11A 4J3GA 1Y9WA 4Y49B 2FXFA 2Y0MA 2FS5A 4B13A 4GS4A 2R1IA 2YGWA 1BOBA 1L0CA 4CRZB 5HMNA 4AVAA 1PUAA 5F49A 2FE7A 2YNCC 2Z3KA 1CJWA 1Y9KA 1YREA 2G0BA 1QSMA 4UWJA 3RYOA 4L8AA 2OZHA 4A95A 3JVNA 4C68A 3R95A 5ISVA 4MY0A 3D2PA 3W91A 3SHPA 1KZFA 1VKCA 2ZW5A 1YR0A 1RO5A 2PR8A 2QMLA 1NE9A 2QIRA 4JXRA 1M4GA 4KS9A 3TOBA 2O28A 4CGPA 3S6KA 4QBJA 2PSWA 2B4DB 2J8RA 4PSXA 3N7ZA 1QSTA 4QUSA 3VWEA 3CXPA 4PK2A 4AG7A 2OZUA 3BJ7A 3OWCA 4YRHA 3PZJA 4AVBA 1Z4RA 2JEVA 1QSRA 4KSAA 2P6EA 3DDDA 2JLMA 1N71A 4A30A 3EC4A 4PV6A 5AG5A 2ZPAA 3LODA 4AG9A 2OH1A 4Y49C 4A32A 3T9YA 4CYOA 3FRMA 2ATRA 3BJ8A 3CXSA 3F8KA 2I00A 4CRYB 2DXQA 4CAFA 1NMTA 2Z10A 2IL4A 4PK3A 3R1KA 4CYPA 3TT2A 3KKWA 2AJ6A 4IF5A 1YK3A 4KOTA 4R87A 5HH1A 2B5GA 4H6UA 4ORFA 1S5KA 5F48A 3R9FA 2P0WA 2H5MA 4JD6A 2B3UA 1IYLA 5GCNA 4UCMA 5CNPA 3I3GA 5E96A 3F5BA 1P0HA 3W6XA 1XEBA 2GE3A 4JJXA 1M4DA 1IICA 3I9SA 2OU2A 4C2YA 2HV2A 4F0YA 4FD7A 4BBHA 4KOYA 2F5IA 3TCVA 3EFAA 3JTKA 4XNHC 1YGHA 5G20A 2PRBA 1MK4A 2R7HA 2FCKA 2ZW6A 4H6ZA 1XE4A 3S6HA 1QSOA 4MFKA 4U5YA 2PC1A 3BLNA 4A31A 4BMHA 2CNTA 4H89A 5IB0A 4FD6A 4AB7A 3H4QA 5DWNA 4LX9A 2BUEA 3R96A 1S3ZA 4FD5A 4K30A 5A28A 2B4DA 4MFZA 4CGOA 3F0AA 1IB1E 4RI1A 4B12A 4NSQA 3IU1A 3IWGA 2J8MA 2P6FA 1LRZA 2QECA 5H84A 1B87A 2Z0ZA 4HNXB 3UY5A 5C82A 3B8GA 1VHSA 2REEA 4FD4A 3NE7A 4MFLA 3TO6A 4NF1A 1SQHA 3DNSA 4R3LA 5KTDA 2CNMA 4KOSA 2Q7BA 3TO7A 4U9YA 3TO9A 4XPDB 1BO4A 4A2ZA 4L89A 3WR7A 1S7NA 4JLYA 2VZYA 2C27A 2PQ8A 4KZTA 4F6AA 4M85A 2BL1A 1Y7RA 4CGMA 2P6GA 3FNCA 3DR8A 2REFA 4QC6A 2Q04A 1XMTA 4KVXA 4MBUA 4CYQA 2B4BA 3E0KA 3K9UA 4B5OA 4MHDA 2X7BA 2VEZA 4NEXA 2Q44A 4KORA 1IIDA 3G3SA 2HQYA 5AGEA 5AG7A 4QB9A 2D4OA 2PR1A 3PP9A 3D2MA 4HNYB 1KUYA 5EBVA 1I21A 2Z3OA 4R9MA 4ZGYB 2WPWA 5KTAA 1XIXA 5BWAB 3FYNA 2VQYA 3EO4A 4JXQA 3SXNA 1GHEA 1S60A 1YX0A 4UCNA 3TOAA 5IX3A 3LD2A 2YNEA 3TFYA 3GYAA 1ON0A 4MJ8A 1KUVA 2Q0YA 5IV0A 2K5TA 3JUWA 4NXYA 4KLWA 4OADA 3EY5A 1Z4EA 5DWMA 2PDOA 4CS0B 1J4JA 4F0XA 1QSNA 2CNSA 2GIVA 4C2ZA 1Q2CA 5A27A 2Z3MA 2Z3NA 4MFQA 2VBQA 2VXKA 4OAEA 1WWZA 4X5KA 3DR6A 1M1DA 4E2AA 1Z9UA 4KOVA 4CAEA 2Z3PA 5JQ4A 4HKFA 3QAHA 3A9LA 2WPXA 5AG4A 3ZZIA 4R3KA 4IUSA 2Q4YA 4KVME 4CYNA 2D4PA 2NMTA 4KLVA 1IYKA 1YVKA 4CAXA 2G3TA 2AE6A 2G3AA 2CXAA 3MGDA 4NCZA 4XPKA 4E8OA 4HNWB 2FIWA 4JWPA 5FVJA 3D3SA 2FIAA 4UA3A 2GANA 4KSFA 2JDCA 3IU2A 3C26A 2R98A 4QVTA 4YGOA 2OB0A 1PU9A 2ARHA 4LUAA 4UCPA 1M44A 4UBRA 5C88A 2EUIA 5EC4A 3T90A 3SXOA 4ZBGA 1V0CA 1Q2YA 4CAWA 4OLLA 1YLEA 1P4NA 1MJ9A 1I1DA 3H5ZA 1TIQA 2JDDA 4CAVA 4MFJA 2J8NA 1OZPA 4CGLA 2CY2A 2BSWA 4B11A 2EVNA 4EVYA 4B5PA 2FL4A 4B14A 3GKRA 1ZO0A 2ZW7A 3W6SA 4KVOE 2HUZA 1NSLA 4E0AA 4MY3A 4C7HA 4KUBA 2B3VA 4Q36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UFX A;  4C2X A;  2YNC A;  4BBH A;  2YNE A;  5A28 A;  4UFV A;  4CGO A;  3JTK A;  5AGE A;  5AG7 A;  5G20 A;  4A30 A;  5AG5 A;  2YND A;  4B12 A;  2YNC C;  2WSA A;  3H5Z A;  3IU1 A;  4CGP A;  3IU2 A;  4A33 A;  4A32 A;  4CAE A;  2WUU A;  4CYO A;  5AG6 A;  4CGN A;  4CGL A;  4UCM A;  4B10 A;  4A2Z A;  5AG4 A;  4UCP A;  4B11 A;  4CAF A;  5G1Z A;  4A31 A;  4CGM A;  4A95 A;  4B14 A;  4C68 A;  4C7I A;  4CYP A;  4UFW A;  5G22 A;  4B13 A;  4CYN A;  4C2Z A;  3IWE A;  4CYQ A;  5A27 A;  5G21 A;  4C2Y A;  4C7H A;  4UCN A; 
#chains in the Genus database with same CATH topology
 2ZXV A;  2KCW A;  4C2X A;  2YNC A;  2WYR A;  4P4D A;  4H2K A;  2C6G A;  2Q43 A;  2A4N A;  3NH5 A;  2YND A;  2WSA A;  4XNH B;  4A33 A;  3CXQ A;  1UFH A;  4UWI A;  3FXT A;  3NH8 A;  1B6B A;  4I49 A;  4OC5 A;  4B10 A;  1BLL E;  3P2F A;  2JBK A;  3SI0 A;  5G1Z A;  5F46 A;  4UEF A;  4X2T A;  1X12 A;  2V8D A;  8CPA A;  1R57 A;  3DSB A;  1MJB A;  4OKO A;  2VZZ A;  3IWE A;  2Z3L A;  4NJQ A;  5THW A;  4UIB A;  1YVO A;  1XF8 A;  2ZOG A;  3PBE A;  4KOX A;  4B5P B;  1PCA A;  3RAM A;  4UFX A;  4ZY0 A;  3B3S A;  4DJL A;  1S7F A;  3D7D A;  1NSA A;  2PJ4 A;  1K4J A;  1VIX A;  3PB6 X;  4P10 A;  1Q2D A;  5DS0 A;  3G8W A;  2AFM A;  1CX8 A;  4M3S A;  1TKH A;  5J8F A;  1QQ9 A;  1FY7 A;  1CP6 A;  2Q7S A;  1MJA A;  2Q51 A;  2R8V A;  4R8F A;  1FNO A;  4CGN A;  1S7L A;  4R57 A;  4P4B A;  5F47 A;  2DPT A;  1CM0 A;  3V8I A;  1PYT B;  2FT0 A;  2Q4V A;  4M6G A;  3R9G A;  4U9Z A;  4C7I A;  2RC4 A;  5CPA A;  1S7K A;  1TXR A;  4Q38 A;  3TTH A;  4AVC A;  5JPH A;  2ZEG A;  3IGR A;  4II9 A;  1KUX A;  4RS2 A;  3CPX A;  5G21 A;  1WK4 A;  2GFQ A;  4P4J A;  3ZJ0 A;  3LWU A;  3MN8 A;  2I79 A;  2ZW4 A;  2BOA A;  3P2H A;  2WZN A;  4IHM A;  5H86 A;  4Z65 A;  1RXT A;  1BPN A;  1ZG7 A;  4MFP A;  4WJB A;  4DNC A;  1ZLI A;  2DEA A;  3TE4 A;  2OZG A;  4MI4 A;  4P6Y A;  5LYD A;  5J8C A;  3GY9 A;  1F2P A;  1I12 A;  3PGP A;  3DGV A;  2WUU A;  3H8F A;  1VHO A;  4KOU A;  4XPD C;  5AG6 A;  4NJR A;  3D8P A;  4P4F A;  3EXN A;  5K8O A;  2PCU A;  3PRT A;  2FSR A;  5I0C A;  4ZX8 A;  3VWD A;  2B58 A;  2GU2 A;  4R7M A;  4XPL A;  2BEI A;  4KOW A;  1ZLH A;  5KTC A;  4YU9 A;  4WWV A;  3S6G A;  4UFW A;  5G22 A;  3S6F A;  3FIX A;  3R9E A;  3GIU A;  3QB8 A;  4ONU A;  3QNV A;  3FBU A;  4KUA A;  4YFJ A;  3KHZ A;  3PEI A;  4OIW A;  4EME A;  2GLF A;  3FVL A;  3HUV A;  1DTD A;  3KR4 A;  4F9V A;  2VI7 A;  3FB3 A;  4OC2 A;  4OME A;  2DPS A;  1U6M A;  2PRQ A;  4PSW A;  4UFV A;  1M4I A;  3V7Z A;  4OP4 A;  2XEF A;  3IJ3 A;  2B5G B;  2Z11 A;  2PJC A;  4J3G A;  3IC1 A;  3FX6 A;  1Y9W A;  3D7G A;  4Y49 B;  3GLJ A;  2FXF A;  2Y0M A;  2FS5 A;  2V8V A;  2G9D A;  1TKJ A;  4KSI A;  4B13 A;  4OID A;  4NGM A;  4GS4 A;  2R1I A;  2YGW A;  1BOB A;  4MHP A;  1L0C A;  2ZEF A;  4CRZ B;  1M4L A;  5LYL A;  5HMN A;  4NGQ A;  2Q4Z A;  1PUA A;  3IO1 A;  4MCP A;  4AVA A;  5F49 A;  2FE7 A;  2YNC C;  2Z3K A;  1CBX A;  1CJW A;  1Y9K A;  2EK8 A;  3B7I A;  4FUU A;  5CBM A;  1YRE A;  2G0B A;  3BI0 A;  4MCS A;  2XEI A;  2I3C A;  1QSM A;  4UWJ A;  3FH4 A;  2QVP A;  3RYO A;  2CTC A;  4L8A A;  4TWE A;  4EWT A;  3BHX A;  2OZH A;  4PXD A;  3WT4 A;  4A95 A;  3JVN A;  4C68 A;  3R95 A;  5ISV A;  4MY0 A;  1UWY A;  3D2P A;  3W91 A;  3SHP A;  1IOF A;  1KZF A;  1VKC A;  4M6I A;  3I1U A;  2ZW5 A;  1YR0 A;  2V8G A;  1RO5 A;  2PR8 A;  4RUH A;  2QML A;  1Z8T A;  1NE9 A;  2QIR A;  4JXR A;  1M4G A;  4KS9 A;  1VHE A;  1XBU A;  1KWM A;  4HPS A;  3TOB A;  2O28 A;  4CGP A;  2QYV A;  4P45 A;  3S6K A;  4QBJ A;  4IK2 A;  4PQA A;  2PSW A;  4MCQ A;  2B4D B;  1Y0R A;  2J8R A;  4PSX A;  3N7Z A;  1QST A;  4K3N A;  1YW6 A;  3BI1 A;  4QUS A;  1LAN A;  3VWE A;  2O53 A;  2IQ6 A;  1Y7E A;  3CXP A;  4PK2 A;  2OOT A;  4BD9 A;  1IU8 A;  2ZEH A;  4A37 A;  4AG7 A;  2ZEP A;  3D67 A;  3IFE A;  2OZU A;  3S9N A;  4PXB A;  3BJ7 A;  4FAI A;  3OWC A;  4P44 A;  4YRH A;  3PZJ A;  4AVB A;  3IEH A;  4W9Y A;  5I4M A;  2CIJ A;  1Z4R A;  2JEV A;  4AXV A;  1QSR A;  4KSA A;  4X3R A;  3WC6 A;  4DUK A;  2P6E A;  2ZEN A;  2JLM A;  1N71 A;  3DDD A;  3PBB A;  4A30 A;  3EC4 A;  4PV6 A;  1ELL P;  1GYT A;  2ZPA A;  3LOD A;  5AG5 A;  2PJ1 A;  4AG9 A;  3SJX A;  2OH1 A;  1YSJ A;  4Y49 C;  3SJE A;  3T9Y A;  4A32 A;  4CYO A;  5JGF A;  1LAP A;  3FRM A;  5F09 A;  1H8L A;  3LMS A;  2ATR A;  3BJ8 A;  3CXS A;  3F8K A;  2F8H A;  2I00 A;  2DXQ A;  4CAF A;  4CRY B;  4FBE A;  6CPA A;  1NMT A;  2Z10 A;  2IL4 A;  2PIZ A;  1DE4 C;  3R1K A;  4PK3 A;  1ELM P;  3TT2 A;  4LQG A;  4CYP A;  3DLJ A;  1HEE A;  2GLJ A;  3KKW A;  2AJ6 A;  4IF5 A;  1YK3 A;  4G1P A;  4KOT A;  3NA6 A;  2EO8 A;  4R87 A;  5HH1 A;  2B5G A;  5LRJ A;  4H6U A;  4ORF A;  1S5K A;  2GRE A;  2AFO A;  5F48 A;  2AFW A;  2ANP A;  3R9F A;  2P0W A;  2ZEE A;  2H5M A;  5HVG A;  4JD6 A;  4MCR A;  2B3U A;  5EMI A;  3KAS A;  4F8Z A;  1IYL A;  2FVG A;  3JRU A;  5GCN A;  2BO9 A;  3PB8 X;  3PB4 X;  2BCO A;  4NFR A;  4UCM A;  5CNP A;  3I3G A;  5E96 A;  2IJZ A;  4YWY A;  3D68 A;  3F5B A;  1EE3 P;  1P0H A;  4M6H A;  4RN7 A;  3SI1 A;  3W6X A;  1XEB A;  2GE3 A;  4JJX A;  1LFW A;  4PXC A;  1M4D A;  1AUG A;  1IIC A;  3I9S A;  2OU2 A;  4C2Y A;  2HV2 A;  3PFO A;  4F0Y A;  2NSM A;  3S9M A;  2PJ8 A;  4FD7 A;  1ZG9 A;  4KOY A;  2F5I A;  3TCV A;  4BBH A;  3EFA A;  3JTK A;  4XNH C;  1YGH A;  2ZEM A;  2AFX A;  2PRB A;  2ZEL A;  3NE8 A;  5G20 A;  1MK4 A;  3RBU A;  2R7H A;  3SJF A;  2FCK A;  2ZW6 A;  4LQ6 A;  3VAT A;  4H6Z A;  1OBR A;  1XE4 A;  1Z8X A;  2ZED A;  4UF4 A;  2ODF A;  3S6H A;  1QSO A;  4MFK A;  4U5Y A;  2PC1 A;  3D7H A;  1YQE A;  3WAB A;  4P4E A;  3BLN A;  4JZ0 A;  3FMC A;  2CNT A;  2NYQ A;  2V8H A;  4H89 A;  4A31 A;  4BMH A;  4C7H A;  4FD6 A;  4AB7 A;  5IB0 A;  3H4Q A;  5DWN A;  3HLP A;  3KL9 A;  1Z2L A;  3D4U A;  4LX9 A;  3SJG A;  3RZA A;  2BUE A;  3R96 A;  1S3Z A;  4ZX9 A;  4NGP A;  5LRK A;  4FD5 A;  4OC0 A;  1Y0Y A;  4K30 A;  5A28 A;  2B4D A;  4MFZ A;  4CGO A;  3GB0 A;  4FWU A;  2XEG A;  2OR4 A;  3FEE A;  3F0A A;  1IB1 E;  4RI1 A;  2PIY A;  4NSQ A;  4B12 A;  2RB7 A;  3IU1 A;  3IWG A;  3PB7 X;  2J8M A;  2P6F A;  1LRZ A;  1LCP A;  2HB6 A;  3D66 A;  3K2K A;  2QEC A;  3ISX A;  1XOV A;  4TNU A;  5H84 A;  3CT9 A;  5LRG A;  1B87 A;  2Z0Z A;  4HNX B;  3UY5 A;  4OC1 A;  5C82 A;  3B8G A;  1VHS A;  2RFH A;  3B2Y A;  1AMP A;  3B3C A;  3BXM A;  2REE A;  4FD4 A;  1HDQ A;  4IAV A;  3NE7 A;  2POK A;  2V77 A;  4MFL A;  3TO6 A;  3KGQ A;  4NGR A;  4NF1 A;  1SQH A;  2PJ5 A;  3DNS A;  3WC7 A;  1LAM A;  1QMU A;  2ZEO A;  3KHX A;  2PJ9 A;  1R3N A;  1TKF A;  2ZOF A;  4R3L A;  5KTD A;  2PJA A;  1AYE A;  3D7F A;  2CNM A;  2DF5 A;  4KOS A;  4ZI6 A;  1ARM A;  5K8N A;  2Q7B A;  2PVV A;  3TO7 A;  4U9Y A;  1IGB A;  3TO9 A;  1ARL A;  1BO4 A;  4XPD B;  4A2Z A;  4L89 A;  3WR7 A;  1S7N A;  4JLY A;  2VZY A;  2VL1 A;  2C27 A;  2PQ8 A;  4KZT A;  5ELY A;  4F6A A;  4M85 A;  2BL1 A;  1Y7R A;  3PFE A;  4NGN A;  4OC3 A;  2P6G A;  3FNC A;  4P4I A;  3DR8 A;  4CGM A;  2REF A;  2C6C A;  4QC6 A;  3FED A;  2Q04 A;  1XMT A;  1IOI A;  4KVX A;  3WC5 A;  1XFO A;  4MBU A;  4CYQ A;  4NGT A;  2B4B A;  3E0K A;  3K9U A;  4B5O A;  4MHD A;  2X7B A;  2AFZ A;  2VEZ A;  4NEX A;  4F9U A;  2ABZ A;  2Q44 A;  4KOR A;  1IID A;  3G3S A;  3B35 A;  2HQY A;  5AGE A;  5JM6 A;  5AG7 A;  1LOK A;  4QB9 A;  4A94 A;  1TF8 A;  2D4O A;  2EK9 A;  2QJ8 A;  3T8W A;  3B3V A;  2EBJ A;  3B3T A;  2PE3 A;  2PR1 A;  3PP9 A;  3KI9 A;  5JH9 A;  1R43 A;  2IMO A;  3D2M A;  4HNY B;  1KUY A;  5EBV A;  3LAC A;  1I21 A;  2Z3O A;  4UEZ A;  1CP7 A;  1TF9 A;  4R9M A;  4MHZ A;  4DYO A;  4ZGY B;  2WPW A;  5KTA A;  1XIX A;  3VAR A;  5BWA B;  5HVH A;  1F2O A;  3GUX A;  3CZX A;  3FYN A;  2VQY A;  1HDU A;  3EO4 A;  4JXQ A;  3SXN A;  5HXD A;  4NGS A;  1GHE A;  1S60 A;  1YX0 A;  1FT7 A;  5LYF A;  4UCN A;  3TOA A;  5IX3 A;  2PJ6 A;  2PJ0 A;  1X10 A;  3LD2 A;  2YNE A;  3TFY A;  3GYA A;  1VGY A;  1Q7L A;  3N5F A;  1ON0 A;  4MJ8 A;  1KUV A;  2Q0Y A;  5IV0 A;  4ZY2 A;  3S9L A;  2K5T A;  4A38 A;  5IB9 A;  2PJ3 A;  3JUW A;  3MRU A;  4O23 A;  5K8P A;  4JYW A;  4NXY A;  3QAY A;  3ISZ A;  2PJ7 A;  4ZY1 A;  3CDX A;  4MRI A;  3PB9 X;  4KLW A;  4OAD A;  1CG2 A;  4MMO A;  3EY5 A;  1Z4E A;  1Z5R A;  5DWM A;  4UIA A;  2PDO A;  4CS0 B;  1J4J A;  4F0X A;  3IWW A;  1QSN A;  2CNS A;  2GIV A;  4C2Z A;  4ONW A;  1Q2C A;  5A27 A;  2C1C A;  2Z3M A;  2JBJ A;  1RTQ A;  2Z3N A;  1YLO A;  4MFQ A;  1F57 A;  2VBQ A;  2VXK A;  4OAE A;  1A2Z A;  5K8M A;  1WWZ A;  3NH4 A;  4X5K A;  3RO0 A;  3DR6 A;  1M1D A;  4E2A A;  1Z9U A;  1Z8L A;  4KOV A;  4CAE A;  2JEW A;  3KR5 A;  4MHY A;  2Z3P A;  3V38 A;  5JQ4 A;  4HKF A;  3QAH A;  3A9L A;  4Q7A A;  4X8I A;  2WPX A;  5AG4 A;  3ZZI A;  3L2N A;  5D8N A;  4R3K A;  4ZYQ A;  4IUS A;  4MXU A;  3VH9 A;  3KQX A;  2Q4Y A;  3K9T A;  4KVM E;  3CPA A;  4CYN A;  2O4H A;  1YME A;  3B3W A;  2D4P A;  2NMT A;  4KLV A;  3KZW A;  1IYK A;  1YVK A;  2PJB A;  2CF4 A;  4CAX A;  2G3T A;  2AE6 A;  4GXH A;  1JQG A;  2PJ2 A;  2G3A A;  2CXA A;  3FF3 A;  3MGD A;  4NCZ A;  4XPK A;  4E8O A;  1Z8W A;  4HNW B;  2FIW A;  4JWP A;  5FVJ A;  3D3S A;  2FIA A;  3TC8 A;  2C6P A;  5LYI A;  1XRY A;  2F7V A;  3FJU A;  3H8G A;  3IIB A;  5J1Q A;  4UA3 A;  1XMB A;  2GAN A;  2HC9 A;  4KSF A;  2JDC A;  3IU2 A;  2AFU A;  3C26 A;  1IY7 A;  2R98 A;  4QVT A;  4YGO A;  3RNZ A;  3SI2 A;  2OB0 A;  1PU9 A;  2ARH A;  4LUA A;  4UCP A;  1M44 A;  4A39 A;  3NFZ A;  4UBR A;  5C88 A;  2EUI A;  5EC4 A;  1CPS A;  1XJO A;  4OC4 A;  3T90 A;  2CTB A;  3SXO A;  1BAV A;  4PPZ A;  4ZBG A;  4UEE A;  3KQZ A;  3TX8 A;  1V0C A;  5HVF A;  1Q2Y A;  3FEC A;  4CAW A;  4MHN A;  4GM5 A;  4OLL A;  1CPX A;  1YLE A;  2EWB A;  5D29 A;  1P4N A;  4EFD A;  4B6Z A;  1MJ9 A;  1I1D A;  3H5Z A;  1TIQ A;  2JDD A;  4CPA A;  2AFS A;  4MFJ A;  4CAV A;  1ZG8 A;  2J8N A;  1OZP A;  4CGL A;  2CY2 A;  3H8E A;  2BSW A;  4B11 A;  2EVN A;  1BPM A;  4PXE A;  4R76 A;  4EVY A;  4B5P A;  1YW4 A;  2FL4 A;  4B14 A;  4R6T A;  4BIN A;  2J9A A;  3GKR A;  1ZO0 A;  7CPA A;  2ZW7 A;  3W6S A;  4KVO E;  2HUZ A;  1NSL A;  2XEJ A;  1JWQ A;  4E0A A;  4MY3 A;  2PVW A;  4KUB A;  2B3V A;  4Q36 A; 
#chains in the Genus database with same CATH homology
 2ZXV A;  2KCW A;  4C2X A;  2YNC A;  2A4N A;  2YND A;  2WSA A;  4XNH B;  4A33 A;  3CXQ A;  1UFH A;  4UWI A;  3FXT A;  1B6B A;  4I49 A;  4B10 A;  3P2F A;  5G1Z A;  5F46 A;  1R57 A;  3DSB A;  1MJB A;  2VZZ A;  3IWE A;  2Z3L A;  1YVO A;  1XF8 A;  4KOX A;  4B5P B;  4UFX A;  1S7F A;  1K4J A;  1Q2D A;  3G8W A;  4M3S A;  5J8F A;  2R8V A;  1FY7 A;  1MJA A;  4CGN A;  1S7L A;  4R57 A;  5F47 A;  2DPT A;  1CM0 A;  3V8I A;  2FT0 A;  2Q4V A;  3R9G A;  4U9Z A;  4C7I A;  2RC4 A;  1S7K A;  4Q38 A;  3TTH A;  4AVC A;  5JPH A;  3IGR A;  4II9 A;  1KUX A;  4RS2 A;  5G21 A;  1WK4 A;  3ZJ0 A;  2I79 A;  2ZW4 A;  3P2H A;  5H86 A;  1RXT A;  4MFP A;  4DNC A;  3TE4 A;  2OZG A;  4MI4 A;  5J8C A;  3GY9 A;  3PGP A;  1I12 A;  4XPD C;  2WUU A;  4KOU A;  5AG6 A;  3D8P A;  3EXN A;  2FSR A;  5I0C A;  3VWD A;  2B58 A;  4XPL A;  2BEI A;  4KOW A;  5KTC A;  3S6G A;  4UFW A;  5G22 A;  3S6F A;  3FIX A;  3R9E A;  3QB8 A;  4ONU A;  3FBU A;  4KUA A;  4YFJ A;  2VI7 A;  3FB3 A;  2DPS A;  1U6M A;  4PSW A;  4UFV A;  1M4I A;  2B5G B;  2Z11 A;  4J3G A;  1Y9W A;  4Y49 B;  2FXF A;  2Y0M A;  2FS5 A;  4B13 A;  4GS4 A;  2R1I A;  2YGW A;  1BOB A;  1L0C A;  4CRZ B;  5HMN A;  4AVA A;  1PUA A;  5F49 A;  2FE7 A;  2YNC C;  2Z3K A;  1CJW A;  1Y9K A;  1YRE A;  2G0B A;  1QSM A;  4UWJ A;  3RYO A;  4L8A A;  2OZH A;  4A95 A;  3JVN A;  4C68 A;  3R95 A;  5ISV A;  4MY0 A;  3D2P A;  3W91 A;  3SHP A;  1KZF A;  1VKC A;  2ZW5 A;  1YR0 A;  1RO5 A;  2PR8 A;  2QML A;  1NE9 A;  2QIR A;  4JXR A;  1M4G A;  4KS9 A;  3TOB A;  2O28 A;  4CGP A;  3S6K A;  4QBJ A;  2PSW A;  2B4D B;  2J8R A;  4PSX A;  3N7Z A;  1QST A;  4QUS A;  3VWE A;  3CXP A;  4PK2 A;  4AG7 A;  2OZU A;  3BJ7 A;  3OWC A;  4YRH A;  3PZJ A;  4AVB A;  1Z4R A;  2JEV A;  1QSR A;  4KSA A;  2P6E A;  3DDD A;  2JLM A;  1N71 A;  4A30 A;  3EC4 A;  4PV6 A;  5AG5 A;  2ZPA A;  3LOD A;  4AG9 A;  2OH1 A;  4Y49 C;  4A32 A;  3T9Y A;  4CYO A;  3FRM A;  2ATR A;  3BJ8 A;  3CXS A;  3F8K A;  2I00 A;  4CRY B;  2DXQ A;  4CAF A;  1NMT A;  2Z10 A;  2IL4 A;  4PK3 A;  3R1K A;  4CYP A;  3TT2 A;  3KKW A;  2AJ6 A;  4IF5 A;  1YK3 A;  4KOT A;  4R87 A;  5HH1 A;  2B5G A;  4H6U A;  4ORF A;  1S5K A;  5F48 A;  3R9F A;  2P0W A;  2H5M A;  4JD6 A;  2B3U A;  1IYL A;  5GCN A;  4UCM A;  5CNP A;  3I3G A;  5E96 A;  3F5B A;  1P0H A;  3W6X A;  1XEB A;  2GE3 A;  4JJX A;  1M4D A;  1IIC A;  3I9S A;  2OU2 A;  4C2Y A;  2HV2 A;  4F0Y A;  4FD7 A;  4BBH A;  4KOY A;  2F5I A;  3TCV A;  3EFA A;  3JTK A;  4XNH C;  1YGH A;  5G20 A;  2PRB A;  1MK4 A;  2R7H A;  2FCK A;  2ZW6 A;  4H6Z A;  1XE4 A;  3S6H A;  1QSO A;  4MFK A;  4U5Y A;  2PC1 A;  3BLN A;  4A31 A;  4BMH A;  2CNT A;  4H89 A;  5IB0 A;  4FD6 A;  4AB7 A;  3H4Q A;  5DWN A;  4LX9 A;  2BUE A;  3R96 A;  1S3Z A;  4FD5 A;  4K30 A;  5A28 A;  2B4D A;  4MFZ A;  4CGO A;  3F0A A;  1IB1 E;  4RI1 A;  4B12 A;  4NSQ A;  3IU1 A;  3IWG A;  2J8M A;  2P6F A;  1LRZ A;  2QEC A;  5H84 A;  1B87 A;  2Z0Z A;  4HNX B;  3UY5 A;  5C82 A;  3B8G A;  1VHS A;  2REE A;  4FD4 A;  3NE7 A;  4MFL A;  3TO6 A;  4NF1 A;  1SQH A;  3DNS A;  4R3L A;  5KTD A;  2CNM A;  4KOS A;  2Q7B A;  3TO7 A;  4U9Y A;  3TO9 A;  4XPD B;  1BO4 A;  4A2Z A;  4L89 A;  3WR7 A;  1S7N A;  4JLY A;  2VZY A;  2C27 A;  2PQ8 A;  4KZT A;  4F6A A;  4M85 A;  2BL1 A;  1Y7R A;  4CGM A;  2P6G A;  3FNC A;  3DR8 A;  2REF A;  4QC6 A;  2Q04 A;  1XMT A;  4KVX A;  4MBU A;  4CYQ A;  2B4B A;  3E0K A;  3K9U A;  4B5O A;  4MHD A;  2X7B A;  2VEZ A;  4NEX A;  2Q44 A;  4KOR A;  1IID A;  3G3S A;  2HQY A;  5AGE A;  5AG7 A;  4QB9 A;  2D4O A;  2PR1 A;  3PP9 A;  3D2M A;  4HNY B;  1KUY A;  5EBV A;  1I21 A;  2Z3O A;  4R9M A;  4ZGY B;  2WPW A;  5KTA A;  1XIX A;  5BWA B;  3FYN A;  2VQY A;  3EO4 A;  4JXQ A;  3SXN A;  1GHE A;  1S60 A;  1YX0 A;  4UCN A;  3TOA A;  5IX3 A;  3LD2 A;  2YNE A;  3TFY A;  3GYA A;  1ON0 A;  4MJ8 A;  1KUV A;  2Q0Y A;  5IV0 A;  2K5T A;  3JUW A;  4NXY A;  4KLW A;  4OAD A;  3EY5 A;  1Z4E A;  5DWM A;  2PDO A;  4CS0 B;  1J4J A;  4F0X A;  1QSN A;  2CNS A;  2GIV A;  4C2Z A;  1Q2C A;  5A27 A;  2Z3M A;  2Z3N A;  4MFQ A;  2VBQ A;  2VXK A;  4OAE A;  1WWZ A;  4X5K A;  3DR6 A;  1M1D A;  4E2A A;  1Z9U A;  4KOV A;  4CAE A;  2Z3P A;  5JQ4 A;  4HKF A;  3QAH A;  3A9L A;  2WPX A;  5AG4 A;  3ZZI A;  4R3K A;  4IUS A;  2Q4Y A;  4KVM E;  4CYN A;  2D4P A;  2NMT A;  4KLV A;  1IYK A;  1YVK A;  4CAX A;  2G3T A;  2AE6 A;  2G3A A;  2CXA A;  3MGD A;  4NCZ A;  4XPK A;  4E8O A;  4HNW B;  2FIW A;  4JWP A;  5FVJ A;  3D3S A;  2FIA A;  4UA3 A;  2GAN A;  4KSF A;  2JDC A;  3IU2 A;  3C26 A;  2R98 A;  4QVT A;  4YGO A;  2OB0 A;  1PU9 A;  2ARH A;  4LUA A;  4UCP A;  1M44 A;  4UBR A;  5C88 A;  2EUI A;  5EC4 A;  3T90 A;  3SXO A;  4ZBG A;  1V0C A;  1Q2Y A;  4CAW A;  4OLL A;  1YLE A;  1P4N A;  1MJ9 A;  1I1D A;  3H5Z A;  1TIQ A;  2JDD A;  4CAV A;  4MFJ A;  2J8N A;  1OZP A;  4CGL A;  2CY2 A;  2BSW A;  4B11 A;  2EVN A;  4EVY A;  4B5P A;  2FL4 A;  4B14 A;  3GKR A;  1ZO0 A;  2ZW7 A;  3W6S A;  4KVO E;  2HUZ A;  1NSL A;  4E0A A;  4MY3 A;  4C7H A;  4KUB A;  2B3V A;  4Q36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...