4B11A

Plasmodium vivax n-myristoyltransferase with a bound benzofuran inhibitor (compound 13)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and Synthesis of Inhibitors of Plasmodium Falciparum N-Myristoyltransferase, a Promising Target for Anti-Malarial Drug Discovery.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 116
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4b11A00
4CYNA 4CYOA 5AG6A 5G21A 5AG7A 4A31A 4CYQA 5A28A 4A30A 5AGEA 4C2ZA 4UCMA 4B10A 3H5ZA 2YNCC 5G1ZA 5G22A 5AG4A 4CGPA 2YNDA 2WUUA 4C7IA 4C2YA 4CGNA 2WSAA 3IWEA 5AG5A 4C2XA 4B11A 4C68A 4UCPA 4UCNA 4CYPA 3IU2A 4C7HA 4UFWA 4A95A 4UFVA 4CGLA 4UFXA 4B12A 4CAEA 4BBHA 4A2ZA 2YNEA 4B13A 4B14A 3IU1A 4CGMA 3JTKA 4A32A 2YNCA 4CGOA 4A33A 5G20A 4CAFA 5A27A
chains in the Genus database with same CATH superfamily
3PBBA 1SQHA 4R7MA 2X7BA 4MJ8A 3IWGA 3PB4X 4NGRA 4R87A 5CBMA 1JWQA 2Q4YA 2IJZA 4MBUA 5DWMA 2PJBA 4FUUA 1MJ9A 1R43A 4KOYA 3TX8A 2PJ2A 2VQYA 2ZEPA 3SJEA 2FIWA 3SI0A 2BO9A 1YGHA 3BJ8A 5FVJA 4PXDA 1ZO0A 3B2YA 3V8IA 1YVKA 3QAHA 4F0YA 2FSRA 5K8OA 2GE3A 1YMEA 1YK3A 4OAEA 3R9GA 4CRZB 1A2ZA 2B3VA 2GANA 4UFVA 4UFXA 4BINA 1LCPA 3TC8A 3ISXA 3EC4A 4OIDA 3GKRA 4JJXA 1M44A 4GS4A 3JTKA 4OLLA 3R9FA 4CGMA 4ZBGA 4YWYA 3JVNA 1L0CA 1QQ9A 2C6PA 3D68A 4NFRA 4QBJA 3KGQA 4A39A 2CNSA 1LANA 4NGSA 2XEIA 2XEGA 2Q51A 3D67A 2JBKA 3PFEA 3DNSA 3TFYA 3L2NA 4OKOA 1F2OA 5EBVA 4NGTA 4P4BA 3EFAA 3V7ZA 3I1UA 2J9AA 1YREA 4K30A 2NSMA 3S9MA 1XEBA 3H4QA 1F57A 2IL4A 3QAYA 3VATA 1QSRA 2DF5A 2PJ8A 3RBUA 3SJFA 4R76A 2Z3PA 1H8LA 3TOAA 4JWPA 1YSJA 2BL1A 2REFA 2CNTA 2HB6A 4U5YA 2QYVA 2PJ6A 4PK3A 3N5FA 4IF5A 2FCKA 3FMCA 1Q7LA 4MRIA 3R9EA 5G21A 5A28A 3DDDA 4JXQA 4A30A 4MCRA 1LAPA 4OC0A 1VHSA 1IIDA 3KHZA 5KTDA 4MI4A 2CXAA 2BEIA 4FD6A 3CXSA 3S6HA 1Z8LA 3CPXA 2DPTA 3K9TA 3D7DA 4CGNA 4HPSA 2B58A 2PJCA 2POKA 3KZWA 2HQYA 3PB8X 2B5GA 2ODFA 2VZYA 4JXRA 1FY7A 4PSXA 5IX3A 1YW6A 1M1DA 3I9SA 5EC4A 3GUXA 4E0AA 4GXHA 2ZW4A 5LRJA 1XIXA 4KLWA 4NGQA 3NFZA 3WT4A 5BWAB 2Z3NA 4R3LA 1S3ZA 4RI1A 4R8FA 3F0AA 1QSTA 2CIJA 2PIZA 4CAWA 5AG7A 3D2PA 3BHXA 1QSMA 4U9ZA 1Z8TA 3IC1A 1TF9A 2Z3LA 2ZW7A 3GLJA 4G1PA 1NE9A 4IAVA 3VARA 2OZUA 3W91A 3WC6A 2PJ9A 4H2KA 4A37A 4LQGA 3JUWA 1JQGA 2V8VA 2CY2A 4UCNA 2GLFA 2HV2A 3LD2A 4KOXA 2F5IA 4OC2A 4NEXA 3GB0A 1YLOA 4NJRA 3S6KA 2J8NA 4NCZA 2AE6A 3D4UA 4R57A 3KQZA 1XFOA 3PB7X 3RAMA 4B5PA 2QECA 3WABA 5ISVA 4XNHB 4B5OA 2AFUA 2JLMA 4MY0A 5GCNA 4OIWA 4CYQA 4P4DA 2AFXA 4IHMA 5DWNA 4E8OA 1S7FA 4R6TA 3RYOA 3FF3A 4R3KA 3CPAA 3S9LA 4NF1A 4PK2A 1UFHA 2ZXVA 2PIYA 3TO7A 4EMEA 2C6CA 2Y0MA 3IIBA 4MHPA 2AJ6A 4UCPA 2CTBA 3S6FA 1IICA 2F7VA 3RNZA 2ANPA 1OBRA 3BLNA 1RTQA 4NGNA 4PXCA 4MHYA 1DTDA 1M4LA 2Z11A 4KOVA 5HMNA 2BOAA 2YNEA 1RXTA 4KVXA 3NE8A 1DE4C 4CAXA 2ZEDA 1Z4EA 3TE4A 1VGYA 3K9UA 4LX9A 2K5TA 5IB0A 1V0CA 1AUGA 4Q7AA 2Q44A 2PR8A 4A31A 2PC1A 3IEHA 2WYRA 4UA3A 4P4FA 4UIBA 4UEFA 3SJGA 2B3UA 2EO8A 3EY5A 2OZHA 2J8MA 4WJBA 4DUKA 3D7FA 2I3CA 3W6XA 3KHXA 3FEEA 4F6AA 2KCWA 3FVLA 3VWDA 1J4JA 5EMIA 2PJ5A 3PBEA 1B87A 2EK9A 4KZTA 1AYEA 4QC6A 5J1QA 4KORA 4AB7A 1S5KA 5JH9A 2I79A 1TKJA 3TOBA 4Y49B 2WZNA 4X8IA 4CGLA 3QNVA 2NMTA 2NYQA 3WC5A 4X2TA 1GYTA 1IOFA 2R7HA 5CPAA 4B5PB 1CX8A 4C68A 4ZY2A 2C1CA 2EWBA 2QVPA 4MCQA 2FS5A 5JM6A 4AG9A 1PUAA 1Y9KA 4HNYB 4MFQA 3FYNA 1FT7A 1U6MA 1P4NA 4JYWA 4F9UA 4CAFA 1CBXA 5C88A 2V8DA 2YNDA 4XPDC 4QVTA 4KSIA 4BD9A 2PE3A 1HEEA 3S6GA 2Q4ZA 4ZY0A 1TKFA 3LODA 3JRUA 4OADA 3VH9A 5IV0A 4M6IA 3SI1A 2ZOFA 1X12A 4L8AA 4BMHA 1S7NA 1WWZA 1R3NA 4NJQA 4TWEA 5J8FA 3TO6A 4AG7A 1CP6A 5F46A 1AMPA 1Q2CA 2JDDA 2ABZA 4ZGYB 3LWUA 5LYFA 1LFWA 2OB0A 1K4JA 1P0HA 1QMUA 3D7HA 2AFOA 2Z3MA 4AVBA 1I21A 4J3GA 4X5KA 1TXRA 2GLJA 4FD5A 4NXYA 1M4DA 3G8WA 3DSBA 1IU8A 5K8PA 2PCUA 4ZI6A 2YNCC 2VBQA 4P10A 1Y0RA 3SXNA 4KOSA 4FWUA 3B3VA 4OC1A 3NH8A 4Y49C 4I49A 3FX6A 4M6HA 4LUAA 1KWMA 1RO5A 2B4DA 3N7ZA 2PJ7A 4FD7A 4KOUA 4KOTA 4M6GA 4NSQA 3TO9A 4OP4A 3RZAA 2J8RA 4DJLA 4P6YA 4RUHA 2Q43A 5H84A 3ISZA 1XF8A 4MFZA 5ELYA 3PB6X 2OU2A 1TKHA 4P4JA 2FIAA 1IB1E 1BPNA 4UIAA 1ZLHA 4MY3A 3B3TA 3PEIA 4FBEA 2B4DB 2ZPAA 1BLLE 1S7LA 4YFJA 4KVME 4X3RA 3R96A 4Q36A 1IY7A 1N71A 3S9NA 3H8FA 2VL1A 4NGPA 4Z65A 1ELMP 3LACA 5LRKA 3V38A 1MJBA 3FJUA 2XEFA 2WUUA 4CAVA 1OZPA 1Q2DA 2R98A 2HUZA 1XJOA 5C82A 1PU9A 3NA6A 4MFPA 4F0XA 1Z8WA 5I4MA 2JBJA 3FB3A 3BJ7A 2CTCA 3IFEA 4UFWA 4ZX8A 5LYLA 4B12A 3BI0A 4KLVA 4A2ZA 4Q38A 5IB9A 4LQ6A 1I12A 2Q0YA 1Z2LA 4W9YA 4F9VA 4U9YA 1Q2YA 2C6GA 1Y7EA 4KS9A 2BSWA 1CP7A 2EBJA 2PJ1A 4CS0B 2PVWA 1KUYA 2OZGA 3OWCA 3DR6A 4M3SA 1Y0YA 1Z5RA 1CPSA 1IOIA 3TTHA 2AFZA 2QJ8A 4HNXB 2I00A 5HVFA 3T9YA 1ZG7A 2H5MA 3B3WA 5G22A 4OC4A 5AG4A 4NGMA 4CGPA 1XRYA 3FXTA 5DS0A 1ZG9A 3IWEA 4IK2A 2ARHA 1TIQA 3IU2A 4TNUA 4EFDA 2PR1A 4JLYA 1QSNA 3KASA 3CXPA 5I0CA 3IU1A 2ZOGA 2ZW6A 2YNCA 2IMOA 4IUSA 4O23A 4A94A 3E0KA 3MGDA 5G20A 4R9MA 2Q7BA 5THWA 2YGWA 5AG6A 2D4OA 3NH4A 4OC3A 4PXEA 3EXNA 4UCMA 3ZZIA 4HNWB 1KZFA 2RB7A 1IYKA 5JQ4A 4C7IA 2ZW5A 2JEVA 2DEAA 2ZEEA 4C2YA 1TF8A 1CJWA 4XPLA 4MCSA 1Z9UA 4CRYB 2AFSA 2FVGA 2OH1A 3D3SA 4B11A 1IGBA 3PRTA 3MN8A 2QMLA 1ON0A 4UEEA 2D4PA 4EVYA 2FXFA 3FIXA 4QB9A 4QUSA 2P6EA 1XBUA 2O28A 4BBHA 3SJXA 4YGOA 1VHEA 4P44A 1Z4RA 2PRQA 1KUVA 4ORFA 4MXUA 2CF4A 4K3NA 5K8NA 4UBRA 1BPMA 2JEWA 1S7KA 2PVVA 2ZEHA 3DGVA 1S60A 2VXKA 4CYNA 5HVGA 4E2AA 4OC5A 1VIXA 2Q4VA 3PP9A 2ZEGA 1XMBA 4P4IA 2V8HA 3G3SA 4JZ0A 2GFQA 2ZEMA 5F48A 7CPAA 2DXQA 4ZYQA 3B3SA 3CXQA 2Z3OA 5LRGA 3B3CA 3VWEA 2WPWA 3HLPA 4MHZA 4UWJA 5K8MA 3D8PA 3T90A 1GHEA 3H8GA 4C7HA 2PJ3A 2O53A 2ZELA 4L89A 4A95A 3FH4A 4B14A 1CG2A 3DR8A 1Z8XA 2CNMA 4ONWA 3T8WA 4XPDB 2A4NA 1FNOA 3IJ3A 3KR5A 1M4IA 1I1DA 4CYOA 1B6BA 1HDQA 3SHPA 4II9A 1MK4A 3KI9A 5AGEA 3D7GA 2PJAA 2OOTA 3PB9X 3IO1A 4H6ZA 1ZLIA 2PDOA 5F49A 4B10A 2BUEA 2WPXA 3F5BA 2F8HA 4MFJA 4KVOE 1LAMA 2G9DA 2REEA 2VI7A 3GIUA 2P0WA 3KQXA 2WSAA 4UF4A 2V8GA 5D8NA 3CDXA 2EVNA 4OMEA 4YU9A 4KSFA 3NH5A 3DLJA 1X10A 1VKCA 3R95A 1NMTA 3KKWA 5KTCA 3UY5A 1QSOA 2JDCA 2PSWA 4CAEA 4XNHC 4DYOA 4B13A 2IQ6A 3TCVA 1F2PA 2AFMA 4CGOA 2PQ8A 2EUIA 2Z10A 1YQEA 2B5GB 2ZENA 4KUBA 4PV6A 5LYIA 4A33A 3FBUA 4ZY1A 1Y7RA 4MFLA 4UEZA 4B6ZA 1IYLA 4PPZA 2AFWA 2P6GA 3SXOA 1BAVA 2GREA 2PRBA 5LYDA 2QIRA 1ARLA 3WC7A 5H86A 5G1ZA 1YW4A 2Q04A 5D29A 3ZJ0A 4F8ZA 4HKFA 1LOKA 4XPKA 5A27A 2VZZA 4C2XA 5F47A 3GYAA 4CYPA 4GM5A 1HDUA 3C26A 2PJ0A 1CPXA 4H89A 3RO0A 5JGFA 4FAIA 1YX0A 3B35A 3BXMA 1XE4A 3KR4A 4KUAA 3BI1A 3FEDA 1PCAA 4M85A 1NSAA 5F09A 4P4EA 3D66A 4A32A 4RN7A 3R1KA 1PYTB 4KOWA 1BO4A 3EO4A 4ZX9A 1XMTA 4MCPA 5J8CA 3A9LA 3MRUA 2G3TA 2O4HA 3FNCA 5HH1A 3B8GA 4C2ZA 1KUXA 1YLEA 1EE3P 2B4BA 3H5ZA 1M4GA 5JPHA 4MMOA 4WWVA 2DPSA 2G3AA 3GY9A 3IGRA 4UWIA 5AG5A 3P2HA 2FT0A 2OR4A 3PZJA 3W6SA 4PSWA 1MJAA 1NSLA 2VEZA 3FECA 4PQAA 6CPAA 5CNPA 5E96A 2XEJA 2G0BA 1CM0A 1VHOA 3TT2A 3I3GA 4MFKA 1R57A 1ELLP 4FD4A 3KL9A 3PGPA 4PXBA 1WK4A 1YVOA 2ZEOA 1LRZA 2V77A 2C27A 4RS2A 2GU2A 3CT9A 2P6FA 1UWYA 2Q7SA 3FRMA 1ZG8A 3PFOA 2EK8A 4EWTA 2BCOA 2R8VA 4MHNA 4KSAA 2ATRA 2PJ4A 3CZXA 2HC9A 8CPAA 1XOVA 4AVCA 4A38A 2Z3KA 4AXVA 1Y9WA 3NE7A 1YR0A 3P2FA 1BOBA 1ARMA 3H8EA 2ZEFA 3F8KA 3HUVA 4P45A 5HXDA 3B7IA 2RC4A 2R1IA 4ONUA 3IWWA 4YRHA 4AVAA 2GIVA 4DNCA 5HVHA 3WR7A 3SI2A 4JD6A 2Z0ZA 3QB8A 4MHDA 2RFHA 3LMSA 3K2KA 2FL4A 4CPAA 5KTAA 3D2MA 2FE7A 4H6UA
chains in the Genus database with same CATH topology
1SQHA 2X7BA 4MJ8A 3IWGA 4R87A 2Q4YA 4MBUA 5DWMA 1MJ9A 4KOYA 2VQYA 2FIWA 3BJ8A 1YGHA 5FVJA 1ZO0A 3V8IA 1YVKA 3QAHA 4F0YA 2FSRA 2GE3A 3R9GA 1YK3A 4OAEA 4CRZB 2B3VA 2GANA 4UFVA 4UFXA 3EC4A 3GKRA 4JJXA 1M44A 4GS4A 3JTKA 4OLLA 3R9FA 4CGMA 4ZBGA 3JVNA 1L0CA 4QBJA 2CNSA 3DNSA 3TFYA 5EBVA 3EFAA 1YREA 4K30A 1XEBA 3H4QA 2IL4A 1QSRA 3TOAA 2Z3PA 4JWPA 2BL1A 2REFA 2CNTA 4PK3A 4IF5A 2FCKA 3R9EA 5G21A 5A28A 3DDDA 4JXQA 4A30A 1VHSA 1IIDA 5KTDA 4MI4A 2CXAA 2BEIA 4FD6A 3CXSA 3S6HA 2DPTA 4CGNA 2B58A 4PSXA 2HQYA 2B5GA 5IX3A 2VZYA 4JXRA 1FY7A 1M1DA 3I9SA 5EC4A 4E0AA 2ZW4A 1XIXA 4KLWA 5BWAB 2Z3NA 4R3LA 1S3ZA 4RI1A 3F0AA 1QSTA 4CAWA 5AG7A 3D2PA 4U9ZA 1QSMA 2Z3LA 2ZW7A 3W91A 1NE9A 2OZUA 3JUWA 2CY2A 4UCNA 4KOXA 2HV2A 3LD2A 2F5IA 4NEXA 3S6KA 2J8NA 4NCZA 2AE6A 2FE7A 4R57A 5ISVA 4B5PA 2QECA 4XNHB 4B5OA 2JLMA 4MY0A 5GCNA 4CYQA 5DWNA 4E8OA 1S7FA 3RYOA 4R3KA 4NF1A 4PK2A 1UFHA 2ZXVA 3TO7A 2Y0MA 2AJ6A 4UCPA 3S6FA 1IICA 3BLNA 2Z11A 4KOVA 5HMNA 2YNEA 1RXTA 4KVXA 4CAXA 1Z4EA 3TE4A 3K9UA 4LX9A 5IB0A 2K5TA 1V0CA 2Q44A 2PR8A 4A31A 2PC1A 4UA3A 2B3UA 3EY5A 2OZHA 2J8MA 3W6XA 4F6AA 2KCWA 3VWDA 1J4JA 1B87A 4KZTA 4QC6A 4KORA 4AB7A 1S5KA 2I79A 3TOBA 4Y49B 4CGLA 2NMTA 2R7HA 4B5PB 4C68A 2FS5A 4AG9A 1PUAA 1Y9KA 4HNYB 4MFQA 3FYNA 1U6MA 1P4NA 4CAFA 5C88A 2YNDA 4XPDC 4QVTA 3S6GA 3LODA 4OADA 5IV0A 4BMHA 4L8AA 1S7NA 1WWZA 5J8FA 3TO6A 4AG7A 5F46A 1Q2CA 2JDDA 4ZGYB 2OB0A 1K4JA 1P0HA 4AVBA 2Z3MA 1I21A 4J3GA 4X5KA 4FD5A 4NXYA 1M4DA 3G8WA 3DSBA 2YNCC 2VBQA 3SXNA 4KOSA 4Y49C 4I49A 4LUAA 1RO5A 3N7ZA 2B4DA 4FD7A 4KOUA 4NSQA 4KOTA 4U5YA 3TO9A 2J8RA 5H84A 1XF8A 4MFZA 2OU2A 2FIAA 1IB1E 4MY3A 2B4DB 2ZPAA 1S7LA 4YFJA 4KVME 3R96A 4Q36A 1N71A 1MJBA 2WUUA 4CAVA 1OZPA 1Q2DA 2R98A 2HUZA 5C82A 1PU9A 4MFPA 4F0XA 3FB3A 3BJ7A 4UFWA 4B12A 4KLVA 4A2ZA 4Q38A 1I12A 2Q0YA 4U9YA 1Q2YA 4KS9A 2BSWA 4CS0B 1KUYA 2OZGA 3OWCA 3DR6A 4M3SA 3TTHA 4HNXB 2I00A 3T9YA 2H5MA 5G22A 5AG4A 4CGPA 3FXTA 3IWEA 2ARHA 1TIQA 3IU2A 2PR1A 4JLYA 1QSNA 3CXPA 5I0CA 3IU1A 2ZW6A 2YNCA 4IUSA 3E0KA 3MGDA 5G20A 4R9MA 2Q7BA 2YGWA 5AG6A 2D4OA 3EXNA 4UCMA 3ZZIA 4HNWB 1KZFA 1IYKA 5JQ4A 4C7IA 2ZW5A 2JEVA 4C2YA 4XPLA 1CJWA 4CRYB 1Z9UA 4B11A 2OH1A 3D3SA 2QMLA 1ON0A 4EVYA 2D4PA 2FXFA 3FIXA 4QB9A 4QUSA 2P6EA 2O28A 4BBHA 4YGOA 1Z4RA 1KUVA 4ORFA 4UBRA 1S7KA 1S60A 2VXKA 4CYNA 4E2AA 2Q4VA 3PP9A 3G3SA 5F48A 2DXQA 3CXQA 2Z3OA 3VWEA 2WPWA 4UWJA 3D8PA 3T90A 1GHEA 4C7HA 4L89A 4A95A 4B14A 3DR8A 2CNMA 4XPDB 2A4NA 1M4IA 1I1DA 4CYOA 1B6BA 3SHPA 4II9A 1MK4A 5AGEA 4H6ZA 2PDOA 5F49A 4B10A 2BUEA 2WPXA 3F5BA 4MFJA 4KVOE 2VI7A 2P0WA 2WSAA 2EVNA 4KSFA 1VKCA 3R95A 1NMTA 3KKWA 5KTCA 3UY5A 1QSOA 2JDCA 2PSWA 4CAEA 4XNHC 4B13A 3TCVA 4CGOA 2PQ8A 2EUIA 2Z10A 2B5GB 4KUBA 4PV6A 4A33A 3FBUA 1Y7RA 4MFLA 1IYLA 2P6GA 3SXOA 2PRBA 2QIRA 5H86A 5G1ZA 2Q04A 3ZJ0A 4HKFA 4XPKA 5A27A 2VZZA 4C2XA 5F47A 3GYAA 4CYPA 3C26A 4H89A 1YX0A 4KUAA 1XE4A 4M85A 4A32A 3R1KA 4KOWA 1BO4A 3EO4A 1XMTA 5J8CA 3A9LA 2G3TA 3FNCA 5HH1A 3B8GA 4C2ZA 1KUXA 1YLEA 3H5ZA 2B4BA 1M4GA 5JPHA 2DPSA 2G3AA 3GY9A 3IGRA 4UWIA 5AG5A 3P2HA 2FT0A 3PZJA 3W6SA 4PSWA 1MJAA 1NSLA 2VEZA 5CNPA 5E96A 2G0BA 1CM0A 3TT2A 3I3GA 4MFKA 1R57A 4FD4A 3PGPA 1WK4A 1YVOA 1LRZA 2C27A 4RS2A 2P6FA 3FRMA 2R8VA 4KSAA 2ATRA 4AVCA 2Z3KA 1Y9WA 3NE7A 1YR0A 3P2FA 1BOBA 3F8KA 2RC4A 2R1IA 4ONUA 4YRHA 4AVAA 4DNCA 2GIVA 3WR7A 4JD6A 2Z0ZA 3QB8A 4MHDA 2FL4A 5KTAA 3D2MA 2REEA 4H6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYN A;  4CYO A;  5AG6 A;  5G21 A;  5AG7 A;  4A31 A;  4CYQ A;  5A28 A;  4A30 A;  5AGE A;  4C2Z A;  4UCM A;  4B10 A;  3H5Z A;  2YNC C;  5G1Z A;  5G22 A;  5AG4 A;  4CGP A;  2YND A;  2WUU A;  4C7I A;  4C2Y A;  4CGN A;  2WSA A;  3IWE A;  5AG5 A;  4C2X A;  4B11 A;  4C68 A;  4UCP A;  4UCN A;  4CYP A;  3IU2 A;  4C7H A;  4UFW A;  4A95 A;  4UFV A;  4CGL A;  4UFX A;  4B12 A;  4CAE A;  4BBH A;  4A2Z A;  2YNE A;  4B13 A;  4B14 A;  3IU1 A;  4CGM A;  3JTK A;  4A32 A;  2YNC A;  4CGO A;  4A33 A;  5G20 A;  4CAF A;  5A27 A; 
#chains in the Genus database with same CATH topology
 3PBB A;  1SQH A;  4R7M A;  2X7B A;  4MJ8 A;  3IWG A;  3PB4 X;  4NGR A;  4R87 A;  5CBM A;  1JWQ A;  2Q4Y A;  2IJZ A;  4MBU A;  5DWM A;  2PJB A;  4FUU A;  1MJ9 A;  1R43 A;  4KOY A;  3TX8 A;  2PJ2 A;  2VQY A;  2ZEP A;  3SJE A;  2FIW A;  3SI0 A;  2BO9 A;  1YGH A;  3BJ8 A;  5FVJ A;  4PXD A;  1ZO0 A;  3B2Y A;  3V8I A;  1YVK A;  3QAH A;  4F0Y A;  2FSR A;  5K8O A;  2GE3 A;  1YME A;  1YK3 A;  4OAE A;  3R9G A;  4CRZ B;  1A2Z A;  2B3V A;  2GAN A;  4UFV A;  4UFX A;  4BIN A;  1LCP A;  3TC8 A;  3ISX A;  3EC4 A;  4OID A;  3GKR A;  4JJX A;  1M44 A;  4GS4 A;  3JTK A;  4OLL A;  3R9F A;  4CGM A;  4ZBG A;  4YWY A;  3JVN A;  1L0C A;  1QQ9 A;  2C6P A;  3D68 A;  4NFR A;  4QBJ A;  3KGQ A;  4A39 A;  2CNS A;  1LAN A;  4NGS A;  2XEI A;  2XEG A;  2Q51 A;  3D67 A;  2JBK A;  3PFE A;  3DNS A;  3TFY A;  3L2N A;  4OKO A;  1F2O A;  5EBV A;  4NGT A;  4P4B A;  3EFA A;  3V7Z A;  3I1U A;  2J9A A;  1YRE A;  4K30 A;  2NSM A;  3S9M A;  1XEB A;  3H4Q A;  1F57 A;  2IL4 A;  3QAY A;  3VAT A;  1QSR A;  2DF5 A;  2PJ8 A;  3RBU A;  3SJF A;  4R76 A;  2Z3P A;  1H8L A;  3TOA A;  4JWP A;  1YSJ A;  2BL1 A;  2REF A;  2CNT A;  2HB6 A;  4U5Y A;  2QYV A;  2PJ6 A;  4PK3 A;  3N5F A;  4IF5 A;  2FCK A;  3FMC A;  1Q7L A;  4MRI A;  3R9E A;  5G21 A;  5A28 A;  3DDD A;  4JXQ A;  4A30 A;  4MCR A;  1LAP A;  4OC0 A;  1VHS A;  1IID A;  3KHZ A;  5KTD A;  4MI4 A;  2CXA A;  2BEI A;  4FD6 A;  3CXS A;  3S6H A;  1Z8L A;  3CPX A;  2DPT A;  3K9T A;  3D7D A;  4CGN A;  4HPS A;  2B58 A;  2PJC A;  2POK A;  3KZW A;  2HQY A;  3PB8 X;  2B5G A;  2ODF A;  2VZY A;  4JXR A;  1FY7 A;  4PSX A;  5IX3 A;  1YW6 A;  1M1D A;  3I9S A;  5EC4 A;  3GUX A;  4E0A A;  4GXH A;  2ZW4 A;  5LRJ A;  1XIX A;  4KLW A;  4NGQ A;  3NFZ A;  3WT4 A;  5BWA B;  2Z3N A;  4R3L A;  1S3Z A;  4RI1 A;  4R8F A;  3F0A A;  1QST A;  2CIJ A;  2PIZ A;  4CAW A;  5AG7 A;  3D2P A;  3BHX A;  1QSM A;  4U9Z A;  1Z8T A;  3IC1 A;  1TF9 A;  2Z3L A;  2ZW7 A;  3GLJ A;  4G1P A;  1NE9 A;  4IAV A;  3VAR A;  2OZU A;  3W91 A;  3WC6 A;  2PJ9 A;  4H2K A;  4A37 A;  4LQG A;  3JUW A;  1JQG A;  2V8V A;  2CY2 A;  4UCN A;  2GLF A;  2HV2 A;  3LD2 A;  4KOX A;  2F5I A;  4OC2 A;  4NEX A;  3GB0 A;  1YLO A;  4NJR A;  3S6K A;  2J8N A;  4NCZ A;  2AE6 A;  3D4U A;  4R57 A;  3KQZ A;  1XFO A;  3PB7 X;  3RAM A;  4B5P A;  2QEC A;  3WAB A;  5ISV A;  4XNH B;  4B5O A;  2AFU A;  2JLM A;  4MY0 A;  5GCN A;  4OIW A;  4CYQ A;  4P4D A;  2AFX A;  4IHM A;  5DWN A;  4E8O A;  1S7F A;  4R6T A;  3RYO A;  3FF3 A;  4R3K A;  3CPA A;  3S9L A;  4NF1 A;  4PK2 A;  1UFH A;  2ZXV A;  2PIY A;  3TO7 A;  4EME A;  2C6C A;  2Y0M A;  3IIB A;  4MHP A;  2AJ6 A;  4UCP A;  2CTB A;  3S6F A;  1IIC A;  2F7V A;  3RNZ A;  2ANP A;  1OBR A;  3BLN A;  1RTQ A;  4NGN A;  4PXC A;  4MHY A;  1DTD A;  1M4L A;  2Z11 A;  4KOV A;  5HMN A;  2BOA A;  2YNE A;  1RXT A;  4KVX A;  3NE8 A;  1DE4 C;  4CAX A;  2ZED A;  1Z4E A;  3TE4 A;  1VGY A;  3K9U A;  4LX9 A;  2K5T A;  5IB0 A;  1V0C A;  1AUG A;  4Q7A A;  2Q44 A;  2PR8 A;  4A31 A;  2PC1 A;  3IEH A;  2WYR A;  4UA3 A;  4P4F A;  4UIB A;  4UEF A;  3SJG A;  2B3U A;  2EO8 A;  3EY5 A;  2OZH A;  2J8M A;  4WJB A;  4DUK A;  3D7F A;  2I3C A;  3W6X A;  3KHX A;  3FEE A;  4F6A A;  2KCW A;  3FVL A;  3VWD A;  1J4J A;  5EMI A;  2PJ5 A;  3PBE A;  1B87 A;  2EK9 A;  4KZT A;  1AYE A;  4QC6 A;  5J1Q A;  4KOR A;  4AB7 A;  1S5K A;  5JH9 A;  2I79 A;  1TKJ A;  3TOB A;  4Y49 B;  2WZN A;  4X8I A;  4CGL A;  3QNV A;  2NMT A;  2NYQ A;  3WC5 A;  4X2T A;  1GYT A;  1IOF A;  2R7H A;  5CPA A;  4B5P B;  1CX8 A;  4C68 A;  4ZY2 A;  2C1C A;  2EWB A;  2QVP A;  4MCQ A;  2FS5 A;  5JM6 A;  4AG9 A;  1PUA A;  1Y9K A;  4HNY B;  4MFQ A;  3FYN A;  1FT7 A;  1U6M A;  1P4N A;  4JYW A;  4F9U A;  4CAF A;  1CBX A;  5C88 A;  2V8D A;  2YND A;  4XPD C;  4QVT A;  4KSI A;  4BD9 A;  2PE3 A;  1HEE A;  3S6G A;  2Q4Z A;  4ZY0 A;  1TKF A;  3LOD A;  3JRU A;  4OAD A;  3VH9 A;  5IV0 A;  4M6I A;  3SI1 A;  2ZOF A;  1X12 A;  4L8A A;  4BMH A;  1S7N A;  1WWZ A;  1R3N A;  4NJQ A;  4TWE A;  5J8F A;  3TO6 A;  4AG7 A;  1CP6 A;  5F46 A;  1AMP A;  1Q2C A;  2JDD A;  2ABZ A;  4ZGY B;  3LWU A;  5LYF A;  1LFW A;  2OB0 A;  1K4J A;  1P0H A;  1QMU A;  3D7H A;  2AFO A;  2Z3M A;  4AVB A;  1I21 A;  4J3G A;  4X5K A;  1TXR A;  2GLJ A;  4FD5 A;  4NXY A;  1M4D A;  3G8W A;  3DSB A;  1IU8 A;  5K8P A;  2PCU A;  4ZI6 A;  2YNC C;  2VBQ A;  4P10 A;  1Y0R A;  3SXN A;  4KOS A;  4FWU A;  3B3V A;  4OC1 A;  3NH8 A;  4Y49 C;  4I49 A;  3FX6 A;  4M6H A;  4LUA A;  1KWM A;  1RO5 A;  2B4D A;  3N7Z A;  2PJ7 A;  4FD7 A;  4KOU A;  4KOT A;  4M6G A;  4NSQ A;  3TO9 A;  4OP4 A;  3RZA A;  2J8R A;  4DJL A;  4P6Y A;  4RUH A;  2Q43 A;  5H84 A;  3ISZ A;  1XF8 A;  4MFZ A;  5ELY A;  3PB6 X;  2OU2 A;  1TKH A;  4P4J A;  2FIA A;  1IB1 E;  1BPN A;  4UIA A;  1ZLH A;  4MY3 A;  3B3T A;  3PEI A;  4FBE A;  2B4D B;  2ZPA A;  1BLL E;  1S7L A;  4YFJ A;  4KVM E;  4X3R A;  3R96 A;  4Q36 A;  1IY7 A;  1N71 A;  3S9N A;  3H8F A;  2VL1 A;  4NGP A;  4Z65 A;  1ELM P;  3LAC A;  5LRK A;  3V38 A;  1MJB A;  3FJU A;  2XEF A;  2WUU A;  4CAV A;  1OZP A;  1Q2D A;  2R98 A;  2HUZ A;  1XJO A;  5C82 A;  1PU9 A;  3NA6 A;  4MFP A;  4F0X A;  1Z8W A;  5I4M A;  2JBJ A;  3FB3 A;  3BJ7 A;  2CTC A;  3IFE A;  4UFW A;  4ZX8 A;  5LYL A;  4B12 A;  3BI0 A;  4KLV A;  4A2Z A;  4Q38 A;  5IB9 A;  4LQ6 A;  1I12 A;  2Q0Y A;  1Z2L A;  4W9Y A;  4F9V A;  4U9Y A;  1Q2Y A;  2C6G A;  1Y7E A;  4KS9 A;  2BSW A;  1CP7 A;  2EBJ A;  2PJ1 A;  4CS0 B;  2PVW A;  1KUY A;  2OZG A;  3OWC A;  3DR6 A;  4M3S A;  1Y0Y A;  1Z5R A;  1CPS A;  1IOI A;  3TTH A;  2AFZ A;  2QJ8 A;  4HNX B;  2I00 A;  5HVF A;  3T9Y A;  1ZG7 A;  2H5M A;  3B3W A;  5G22 A;  4OC4 A;  5AG4 A;  4NGM A;  4CGP A;  1XRY A;  3FXT A;  5DS0 A;  1ZG9 A;  3IWE A;  4IK2 A;  2ARH A;  1TIQ A;  3IU2 A;  4TNU A;  4EFD A;  2PR1 A;  4JLY A;  1QSN A;  3KAS A;  3CXP A;  5I0C A;  3IU1 A;  2ZOG A;  2ZW6 A;  2YNC A;  2IMO A;  4IUS A;  4O23 A;  4A94 A;  3E0K A;  3MGD A;  5G20 A;  4R9M A;  2Q7B A;  5THW A;  2YGW A;  5AG6 A;  2D4O A;  3NH4 A;  4OC3 A;  4PXE A;  3EXN A;  4UCM A;  3ZZI A;  4HNW B;  1KZF A;  2RB7 A;  1IYK A;  5JQ4 A;  4C7I A;  2ZW5 A;  2JEV A;  2DEA A;  2ZEE A;  4C2Y A;  1TF8 A;  1CJW A;  4XPL A;  4MCS A;  1Z9U A;  4CRY B;  2AFS A;  2FVG A;  2OH1 A;  3D3S A;  4B11 A;  1IGB A;  3PRT A;  3MN8 A;  2QML A;  1ON0 A;  4UEE A;  2D4P A;  4EVY A;  2FXF A;  3FIX A;  4QB9 A;  4QUS A;  2P6E A;  1XBU A;  2O28 A;  4BBH A;  3SJX A;  4YGO A;  1VHE A;  4P44 A;  1Z4R A;  2PRQ A;  1KUV A;  4ORF A;  4MXU A;  2CF4 A;  4K3N A;  5K8N A;  4UBR A;  1BPM A;  2JEW A;  1S7K A;  2PVV A;  2ZEH A;  3DGV A;  1S60 A;  2VXK A;  4CYN A;  5HVG A;  4E2A A;  4OC5 A;  1VIX A;  2Q4V A;  3PP9 A;  2ZEG A;  1XMB A;  4P4I A;  2V8H A;  3G3S A;  4JZ0 A;  2GFQ A;  2ZEM A;  5F48 A;  7CPA A;  2DXQ A;  4ZYQ A;  3B3S A;  3CXQ A;  2Z3O A;  5LRG A;  3B3C A;  3VWE A;  2WPW A;  3HLP A;  4MHZ A;  4UWJ A;  5K8M A;  3D8P A;  3T90 A;  1GHE A;  3H8G A;  4C7H A;  2PJ3 A;  2O53 A;  2ZEL A;  4L89 A;  4A95 A;  3FH4 A;  4B14 A;  1CG2 A;  3DR8 A;  1Z8X A;  2CNM A;  4ONW A;  3T8W A;  4XPD B;  2A4N A;  1FNO A;  3IJ3 A;  3KR5 A;  1M4I A;  1I1D A;  4CYO A;  1B6B A;  1HDQ A;  3SHP A;  4II9 A;  1MK4 A;  3KI9 A;  5AGE A;  3D7G A;  2PJA A;  2OOT A;  3PB9 X;  3IO1 A;  4H6Z A;  1ZLI A;  2PDO A;  5F49 A;  4B10 A;  2BUE A;  2WPX A;  3F5B A;  2F8H A;  4MFJ A;  4KVO E;  1LAM A;  2G9D A;  2REE A;  2VI7 A;  3GIU A;  2P0W A;  3KQX A;  2WSA A;  4UF4 A;  2V8G A;  5D8N A;  3CDX A;  2EVN A;  4OME A;  4YU9 A;  4KSF A;  3NH5 A;  3DLJ A;  1X10 A;  1VKC A;  3R95 A;  1NMT A;  3KKW A;  5KTC A;  3UY5 A;  1QSO A;  2JDC A;  2PSW A;  4CAE A;  4XNH C;  4DYO A;  4B13 A;  2IQ6 A;  3TCV A;  1F2P A;  2AFM A;  4CGO A;  2PQ8 A;  2EUI A;  2Z10 A;  1YQE A;  2B5G B;  2ZEN A;  4KUB A;  4PV6 A;  5LYI A;  4A33 A;  3FBU A;  4ZY1 A;  1Y7R A;  4MFL A;  4UEZ A;  4B6Z A;  1IYL A;  4PPZ A;  2AFW A;  2P6G A;  3SXO A;  1BAV A;  2GRE A;  2PRB A;  5LYD A;  2QIR A;  1ARL A;  3WC7 A;  5H86 A;  5G1Z A;  1YW4 A;  2Q04 A;  5D29 A;  3ZJ0 A;  4F8Z A;  4HKF A;  1LOK A;  4XPK A;  5A27 A;  2VZZ A;  4C2X A;  5F47 A;  3GYA A;  4CYP A;  4GM5 A;  1HDU A;  3C26 A;  2PJ0 A;  1CPX A;  4H89 A;  3RO0 A;  5JGF A;  4FAI A;  1YX0 A;  3B35 A;  3BXM A;  1XE4 A;  3KR4 A;  4KUA A;  3BI1 A;  3FED A;  1PCA A;  4M85 A;  1NSA A;  5F09 A;  4P4E A;  3D66 A;  4A32 A;  4RN7 A;  3R1K A;  1PYT B;  4KOW A;  1BO4 A;  3EO4 A;  4ZX9 A;  1XMT A;  4MCP A;  5J8C A;  3A9L A;  3MRU A;  2G3T A;  2O4H A;  3FNC A;  5HH1 A;  3B8G A;  4C2Z A;  1KUX A;  1YLE A;  1EE3 P;  2B4B A;  3H5Z A;  1M4G A;  5JPH A;  4MMO A;  4WWV A;  2DPS A;  2G3A A;  3GY9 A;  3IGR A;  4UWI A;  5AG5 A;  3P2H A;  2FT0 A;  2OR4 A;  3PZJ A;  3W6S A;  4PSW A;  1MJA A;  1NSL A;  2VEZ A;  3FEC A;  4PQA A;  6CPA A;  5CNP A;  5E96 A;  2XEJ A;  2G0B A;  1CM0 A;  1VHO A;  3TT2 A;  3I3G A;  4MFK A;  1R57 A;  1ELL P;  4FD4 A;  3KL9 A;  3PGP A;  4PXB A;  1WK4 A;  1YVO A;  2ZEO A;  1LRZ A;  2V77 A;  2C27 A;  4RS2 A;  2GU2 A;  3CT9 A;  2P6F A;  1UWY A;  2Q7S A;  3FRM A;  1ZG8 A;  3PFO A;  2EK8 A;  4EWT A;  2BCO A;  2R8V A;  4MHN A;  4KSA A;  2ATR A;  2PJ4 A;  3CZX A;  2HC9 A;  8CPA A;  1XOV A;  4AVC A;  4A38 A;  2Z3K A;  4AXV A;  1Y9W A;  3NE7 A;  1YR0 A;  3P2F A;  1BOB A;  1ARM A;  3H8E A;  2ZEF A;  3F8K A;  3HUV A;  4P45 A;  5HXD A;  3B7I A;  2RC4 A;  2R1I A;  4ONU A;  3IWW A;  4YRH A;  4AVA A;  2GIV A;  4DNC A;  5HVH A;  3WR7 A;  3SI2 A;  4JD6 A;  2Z0Z A;  3QB8 A;  4MHD A;  2RFH A;  3LMS A;  3K2K A;  2FL4 A;  4CPA A;  5KTA A;  3D2M A;  2FE7 A;  4H6U A; 
#chains in the Genus database with same CATH homology
 1SQH A;  2X7B A;  4MJ8 A;  3IWG A;  4R87 A;  2Q4Y A;  4MBU A;  5DWM A;  1MJ9 A;  4KOY A;  2VQY A;  2FIW A;  3BJ8 A;  1YGH A;  5FVJ A;  1ZO0 A;  3V8I A;  1YVK A;  3QAH A;  4F0Y A;  2FSR A;  2GE3 A;  3R9G A;  1YK3 A;  4OAE A;  4CRZ B;  2B3V A;  2GAN A;  4UFV A;  4UFX A;  3EC4 A;  3GKR A;  4JJX A;  1M44 A;  4GS4 A;  3JTK A;  4OLL A;  3R9F A;  4CGM A;  4ZBG A;  3JVN A;  1L0C A;  4QBJ A;  2CNS A;  3DNS A;  3TFY A;  5EBV A;  3EFA A;  1YRE A;  4K30 A;  1XEB A;  3H4Q A;  2IL4 A;  1QSR A;  3TOA A;  2Z3P A;  4JWP A;  2BL1 A;  2REF A;  2CNT A;  4PK3 A;  4IF5 A;  2FCK A;  3R9E A;  5G21 A;  5A28 A;  3DDD A;  4JXQ A;  4A30 A;  1VHS A;  1IID A;  5KTD A;  4MI4 A;  2CXA A;  2BEI A;  4FD6 A;  3CXS A;  3S6H A;  2DPT A;  4CGN A;  2B58 A;  4PSX A;  2HQY A;  2B5G A;  5IX3 A;  2VZY A;  4JXR A;  1FY7 A;  1M1D A;  3I9S A;  5EC4 A;  4E0A A;  2ZW4 A;  1XIX A;  4KLW A;  5BWA B;  2Z3N A;  4R3L A;  1S3Z A;  4RI1 A;  3F0A A;  1QST A;  4CAW A;  5AG7 A;  3D2P A;  4U9Z A;  1QSM A;  2Z3L A;  2ZW7 A;  3W91 A;  1NE9 A;  2OZU A;  3JUW A;  2CY2 A;  4UCN A;  4KOX A;  2HV2 A;  3LD2 A;  2F5I A;  4NEX A;  3S6K A;  2J8N A;  4NCZ A;  2AE6 A;  2FE7 A;  4R57 A;  5ISV A;  4B5P A;  2QEC A;  4XNH B;  4B5O A;  2JLM A;  4MY0 A;  5GCN A;  4CYQ A;  5DWN A;  4E8O A;  1S7F A;  3RYO A;  4R3K A;  4NF1 A;  4PK2 A;  1UFH A;  2ZXV A;  3TO7 A;  2Y0M A;  2AJ6 A;  4UCP A;  3S6F A;  1IIC A;  3BLN A;  2Z11 A;  4KOV A;  5HMN A;  2YNE A;  1RXT A;  4KVX A;  4CAX A;  1Z4E A;  3TE4 A;  3K9U A;  4LX9 A;  5IB0 A;  2K5T A;  1V0C A;  2Q44 A;  2PR8 A;  4A31 A;  2PC1 A;  4UA3 A;  2B3U A;  3EY5 A;  2OZH A;  2J8M A;  3W6X A;  4F6A A;  2KCW A;  3VWD A;  1J4J A;  1B87 A;  4KZT A;  4QC6 A;  4KOR A;  4AB7 A;  1S5K A;  2I79 A;  3TOB A;  4Y49 B;  4CGL A;  2NMT A;  2R7H A;  4B5P B;  4C68 A;  2FS5 A;  4AG9 A;  1PUA A;  1Y9K A;  4HNY B;  4MFQ A;  3FYN A;  1U6M A;  1P4N A;  4CAF A;  5C88 A;  2YND A;  4XPD C;  4QVT A;  3S6G A;  3LOD A;  4OAD A;  5IV0 A;  4BMH A;  4L8A A;  1S7N A;  1WWZ A;  5J8F A;  3TO6 A;  4AG7 A;  5F46 A;  1Q2C A;  2JDD A;  4ZGY B;  2OB0 A;  1K4J A;  1P0H A;  4AVB A;  2Z3M A;  1I21 A;  4J3G A;  4X5K A;  4FD5 A;  4NXY A;  1M4D A;  3G8W A;  3DSB A;  2YNC C;  2VBQ A;  3SXN A;  4KOS A;  4Y49 C;  4I49 A;  4LUA A;  1RO5 A;  3N7Z A;  2B4D A;  4FD7 A;  4KOU A;  4NSQ A;  4KOT A;  4U5Y A;  3TO9 A;  2J8R A;  5H84 A;  1XF8 A;  4MFZ A;  2OU2 A;  2FIA A;  1IB1 E;  4MY3 A;  2B4D B;  2ZPA A;  1S7L A;  4YFJ A;  4KVM E;  3R96 A;  4Q36 A;  1N71 A;  1MJB A;  2WUU A;  4CAV A;  1OZP A;  1Q2D A;  2R98 A;  2HUZ A;  5C82 A;  1PU9 A;  4MFP A;  4F0X A;  3FB3 A;  3BJ7 A;  4UFW A;  4B12 A;  4KLV A;  4A2Z A;  4Q38 A;  1I12 A;  2Q0Y A;  4U9Y A;  1Q2Y A;  4KS9 A;  2BSW A;  4CS0 B;  1KUY A;  2OZG A;  3OWC A;  3DR6 A;  4M3S A;  3TTH A;  4HNX B;  2I00 A;  3T9Y A;  2H5M A;  5G22 A;  5AG4 A;  4CGP A;  3FXT A;  3IWE A;  2ARH A;  1TIQ A;  3IU2 A;  2PR1 A;  4JLY A;  1QSN A;  3CXP A;  5I0C A;  3IU1 A;  2ZW6 A;  2YNC A;  4IUS A;  3E0K A;  3MGD A;  5G20 A;  4R9M A;  2Q7B A;  2YGW A;  5AG6 A;  2D4O A;  3EXN A;  4UCM A;  3ZZI A;  4HNW B;  1KZF A;  1IYK A;  5JQ4 A;  4C7I A;  2ZW5 A;  2JEV A;  4C2Y A;  4XPL A;  1CJW A;  4CRY B;  1Z9U A;  4B11 A;  2OH1 A;  3D3S A;  2QML A;  1ON0 A;  4EVY A;  2D4P A;  2FXF A;  3FIX A;  4QB9 A;  4QUS A;  2P6E A;  2O28 A;  4BBH A;  4YGO A;  1Z4R A;  1KUV A;  4ORF A;  4UBR A;  1S7K A;  1S60 A;  2VXK A;  4CYN A;  4E2A A;  2Q4V A;  3PP9 A;  3G3S A;  5F48 A;  2DXQ A;  3CXQ A;  2Z3O A;  3VWE A;  2WPW A;  4UWJ A;  3D8P A;  3T90 A;  1GHE A;  4C7H A;  4L89 A;  4A95 A;  4B14 A;  3DR8 A;  2CNM A;  4XPD B;  2A4N A;  1M4I A;  1I1D A;  4CYO A;  1B6B A;  3SHP A;  4II9 A;  1MK4 A;  5AGE A;  4H6Z A;  2PDO A;  5F49 A;  4B10 A;  2BUE A;  2WPX A;  3F5B A;  4MFJ A;  4KVO E;  2VI7 A;  2P0W A;  2WSA A;  2EVN A;  4KSF A;  1VKC A;  3R95 A;  1NMT A;  3KKW A;  5KTC A;  3UY5 A;  1QSO A;  2JDC A;  2PSW A;  4CAE A;  4XNH C;  4B13 A;  3TCV A;  4CGO A;  2PQ8 A;  2EUI A;  2Z10 A;  2B5G B;  4KUB A;  4PV6 A;  4A33 A;  3FBU A;  1Y7R A;  4MFL A;  1IYL A;  2P6G A;  3SXO A;  2PRB A;  2QIR A;  5H86 A;  5G1Z A;  2Q04 A;  3ZJ0 A;  4HKF A;  4XPK A;  5A27 A;  2VZZ A;  4C2X A;  5F47 A;  3GYA A;  4CYP A;  3C26 A;  4H89 A;  1YX0 A;  4KUA A;  1XE4 A;  4M85 A;  4A32 A;  3R1K A;  4KOW A;  1BO4 A;  3EO4 A;  1XMT A;  5J8C A;  3A9L A;  2G3T A;  3FNC A;  5HH1 A;  3B8G A;  4C2Z A;  1KUX A;  1YLE A;  3H5Z A;  2B4B A;  1M4G A;  5JPH A;  2DPS A;  2G3A A;  3GY9 A;  3IGR A;  4UWI A;  5AG5 A;  3P2H A;  2FT0 A;  3PZJ A;  3W6S A;  4PSW A;  1MJA A;  1NSL A;  2VEZ A;  5CNP A;  5E96 A;  2G0B A;  1CM0 A;  3TT2 A;  3I3G A;  4MFK A;  1R57 A;  4FD4 A;  3PGP A;  1WK4 A;  1YVO A;  1LRZ A;  2C27 A;  4RS2 A;  2P6F A;  3FRM A;  2R8V A;  4KSA A;  2ATR A;  4AVC A;  2Z3K A;  1Y9W A;  3NE7 A;  1YR0 A;  3P2F A;  1BOB A;  3F8K A;  2RC4 A;  2R1I A;  4ONU A;  4YRH A;  4AVA A;  4DNC A;  2GIV A;  3WR7 A;  4JD6 A;  2Z0Z A;  3QB8 A;  4MHD A;  2FL4 A;  5KTA A;  3D2M A;  2REE A;  4H6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...