4B11A

Plasmodium vivax n-myristoyltransferase with a bound benzofuran inhibitor (compound 13)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Design and Synthesis of Inhibitors of Plasmodium Falciparum N-Myristoyltransferase, a Promising Target for Anti-Malarial Drug Discovery.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 116
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4b11A00
4C68A 4CYOA 2YNCA 2YNDA 3IU2A 5G20A 3IU1A 4B10A 4C7HA 4CGNA 5A28A 5G1ZA 4BBHA 4UFXA 4CAEA 4UFWA 4CYQA 4UCMA 4CGMA 4A31A 4A32A 5AG7A 4B13A 4CYNA 4CGPA 4B12A 5G22A 4UCPA 2WUUA 4UCNA 5A27A 5AG4A 2WSAA 2YNCC 4UFVA 3JTKA 4CAFA 4CGLA 4A2ZA 5AG5A 4C2ZA 4C7IA 4CYPA 4CGOA 4A30A 3IWEA 5AGEA 5AG6A 5G21A 4B11A 4C2XA 3H5ZA 4A95A 4A33A 2YNEA 4B14A 4C2YA
chains in the Genus database with same CATH superfamily
3KKWA 3FBUA 4Y49C 2VZZA 3W6XA 1K4JA 5HH1A 1ZLHA 3TE4A 1TXRA 5HVFA 2FS5A 3KI9A 3IC1A 1CP7A 1Y0YA 3FEDA 4Q7AA 5AG7A 1OBRA 1WWZA 3I3GA 3BJ8A 4UEFA 1FY7A 1MJBA 1TKHA 2FIAA 4UFVA 1S60A 1IOIA 1QQ9A 3SHPA 3BI0A 2P6EA 4GXHA 4C7IA 3FEEA 4MMOA 1I12A 3IWGA 4RN7A 2VL1A 4B11A 3IWWA 4KOWA 1YSJA 1FNOA 2ZEFA 3CPAA 1IYKA 1YK3A 4QUSA 4RI1A 3S6KA 4M85A 4CYOA 3KGQA 4X8IA 4MHDA 3DLJA 2B4DA 5G20A 4MFLA 4PSWA 3IO1A 1Z2LA 4E8OA 4UFWA 3T90A 3K9TA 2ZW5A 3D7FA 3VATA 4J3GA 1QSNA 3B2YA 1AMPA 4OADA 1KZFA 1YLOA 1S7KA 2PR8A 4NFRA 6CPAA 1EE3P 3FIXA 3KZWA 3N5FA 5KTDA 5BWAB 2FE7A 4EMEA 3KL9A 4C2ZA 4ZY0A 4DNCA 1VHOA 3S9LA 3QNVA 3R9GA 3S6GA 4NGPA 3IFEA 5F49A 2QECA 1S5KA 2Z0ZA 2AFWA 4BINA 2AFUA 1Y7EA 2GU2A 3FH4A 3RYOA 1PYTB 2B4DB 4MCQA 2PIYA 2FVGA 2NMTA 1S7FA 3KR4A 2B3UA 2ZOFA 3DR6A 4XNHC 3TCVA 5CBMA 1P4NA 1RO5A 5DWNA 4KORA 3FECA 3QAHA 2F8HA 4F6AA 1H8LA 2ZEEA 3BXMA 3WC5A 2HB6A 4YGOA 4B13A 1IU8A 3LD2A 4KUBA 2V8HA 3FXTA 1LAMA 2C6CA 2HV2A 3F0AA 1CP6A 2EO8A 4MXUA 4JXQA 2Z3PA 3SJGA 2WZNA 4KOUA 3D4UA 4KOTA 1TKFA 3GUXA 5CPAA 4OMEA 3DSBA 3D7DA 3IWEA 4ZY1A 1JQGA 4Q38A 2OR4A 2R1IA 5EMIA 4A95A 2DEAA 4Q36A 4FWUA 1BAVA 4C2YA 5F09A 1B87A 2Q4VA 3FNCA 5HVGA 1IIDA 3GY9A 1S7LA 4P4BA 3TT2A 4P4JA 4UFXA 3TC8A 1HEEA 4FD7A 1XIXA 3QAYA 1VGYA 3CXSA 1S7NA 3F5BA 5IX3A 1M4DA 3C26A 2JDCA 5AG4A 2J8MA 2YNCC 2C6PA 1VHSA 1L0CA 4NCZA 2PJCA 4FBEA 2DPSA 5THWA 1P0HA 3D2MA 2IJZA 4AVCA 3PB9X 1RTQA 2BUEA 4AXVA 2BO9A 4L8AA 4RUHA 2JLMA 3P2HA 1F2PA 2PJ1A 2POKA 4NGMA 1NE9A 1LANA 4GS4A 1B6BA 2PJ8A 4FD6A 1IGBA 2RFHA 2ZW4A 4MRIA 4F8ZA 2WYRA 2PJ2A 1AYEA 1ARMA 1ZG7A 2PJBA 2Z11A 3H8GA 4EVYA 4CGNA 1DTDA 2G3AA 4M6IA 2PCUA 2VZYA 1R43A 3D3SA 2Z3KA 4A32A 5K8NA 5KTAA 3NH4A 4Y49B 1MJAA 1VIXA 1XE4A 1CX8A 4NGSA 2D4OA 2NSMA 3B7IA 1M4LA 3D2PA 1BPNA 5F48A 3WR7A 2ZEMA 1CPSA 3A9LA 2PVVA 1M4GA 3EY5A 3FRMA 4XPKA 1ELLP 1CPXA 3RAMA 2HQYA 2XEIA 2PJ7A 1XJOA 2B5GB 3S6HA 3TFYA 4U9ZA 4AVAA 1IOFA 1BOBA 1XRYA 4R7MA 3KASA 4DUKA 4E0AA 4MFPA 1X12A 1S3ZA 3PZJA 1XMTA 3IEHA 4CRYB 4PXEA 4O23A 3PB7X 1I1DA 1IICA 2OH1A 3FVLA 2QJ8A 4C7HA 1QSMA 2PIZA 2R7HA 2OU2A 2GLFA 3D7HA 4HKFA 5FVJA 1Z8XA 4A37A 4BBHA 4CYQA 3BJ7A 4F0XA 4JJXA 4X2TA 1XEBA 3GYAA 2AFMA 3DDDA 2FXFA 2PJ5A 2EBJA 4UEEA 2EK9A 3WT4A 2ZEOA 4OC4A 2PQ8A 3CT9A 5D8NA 3RBUA 5IB9A 2I79A 4P45A 1XOVA 2BEIA 2C27A 4PK3A 4NGNA 4BMHA 4OLLA 2Z3MA 5K8OA 2V8DA 3CPXA 4M6GA 5LRJA 5DS0A 5G21A 3ZZIA 4NGTA 3S9NA 1Z9UA 2YNEA 3D66A 2J9AA 3S6FA 4OKOA 4PK2A 4KLVA 3KQZA 3MN8A 2YNDA 4B10A 1BO4A 3SI1A 3T8WA 1R3NA 2PJAA 5A28A 4NF1A 3PP9A 3TO7A 4KSAA 1F2OA 2PJ3A 1XF8A 4Z65A 5C88A 4HPSA 2C6GA 3WABA 5JPHA 2QVPA 3V7ZA 1NSLA 4NJQA 1YLEA 4XNHB 1TKJA 5J1QA 4UCNA 4MBUA 2Z3NA 3JTKA 5HVHA 4NGQA 5AG5A 2ATRA 4P4DA 3PB8X 3G3SA 3V38A 4IHMA 4PXCA 2JEVA 4FD5A 3VH9A 2Z10A 2OZGA 4KZTA 2OOTA 4P10A 4A33A 4CAVA 1RXTA 4XPDC 2Q43A 4UBRA 1M44A 2CNMA 4AG7A 2HC9A 2YNCA 3SJFA 1HDQA 2ZEGA 4OC5A 2ABZA 2P6FA 3RNZA 5LYIA 4OAEA 2B4BA 4KVXA 4L89A 4B6ZA 2VXKA 3GLJA 3SI0A 4A31A 3FYNA 2XEJA 2Q7SA 5G22A 1LCPA 4R57A 3S9MA 4ZY2A 3MRUA 1ARLA 4I49A 4KVOE 5H86A 2FIWA 4OC1A 4H6UA 5F47A 4MCPA 4LQ6A 3FJUA 2JEWA 1Q2DA 2Q0YA 3JRUA 2PRQA 2YGWA 4ONWA 5EC4A 3ZJ0A 4AB7A 2Q4ZA 2VEZA 1M4IA 5D29A 4F0YA 2CTBA 2RB7A 4KSIA 3VARA 3NE8A 2KCWA 4DYOA 2V77A 1GYTA 1PCAA 4A94A 1TF8A 4MHPA 2PVWA 5LYFA 1R57A 3IIBA 5E96A 2IL4A 1QSOA 3IU2A 2AFXA 4ZI6A 1X10A 2ZOGA 3R9FA 1SQHA 3PB4X 4CAEA 3P2FA 1ON0A 2Y0MA 2OB0A 3DNSA 2GREA 2CTCA 4UA3A 2JBKA 3B3VA 5EBVA 3FF3A 1ELMP 1A2ZA 1YGHA 4KOXA 1PUAA 5ISVA 4A2ZA 2ZEHA 4K3NA 2JBJA 3VWEA 4ZGYB 4YWYA 2IQ6A 1JWQA 4YFJA 2J8RA 3F8KA 2CNSA 4LQGA 1BPMA 1Z8LA 2XEFA 4IAVA 2P6GA 4C2XA 3GKRA 4OC3A 2VI7A 1Q2CA 2O28A 3NE7A 4P44A 4CAFA 2B5GA 3LMSA 3TX8A 1LRZA 2X7BA 3PFEA 1YREA 3FMCA 4ZBGA 5CNPA 5KTCA 4UIAA 2Q44A 2REEA 3K2KA 3D67A 4JWPA 4UWJA 3KQXA 1IB1E 2AFSA 2B3VA 1OZPA 2A4NA 1U6MA 3B3WA 4R8FA 1M1DA 3ISZA 4WWVA 4YU9A 3RZAA 1QSRA 3PFOA 2ZW6A 1DE4C 2ZEDA 2FT0A 4BD9A 3PBEA 1Z8WA 2BSWA 3H4QA 3LODA 2XEGA 2JDDA 3JUWA 2BOAA 4HNWB 3TTHA 2CY2A 4MFKA 5HXDA 5JQ4A 4X5KA 2C1CA 1GHEA 2PE3A 5GCNA 4AVBA 1KUVA 4KOVA 2EWBA 3DGVA 3FX6A 1ZO0A 3G8WA 4MHZA 2QIRA 3IU1A 4R3LA 5G1ZA 4CS0B 1ZLIA 1Y9WA 2Z3OA 3PRTA 4R87A 2V8VA 1KUXA 3WC6A 2PR1A 5C82A 5JH9A 5H84A 4H6ZA 1YMEA 4KSFA 2EK8A 4JXRA 3EO4A 2PJ0A 4FD4A 4MY3A 2VBQA 1UFHA 2WSAA 4R6TA 2ZW7A 4PSXA 3GIUA 1CJWA 4UEZA 3RO0A 4G1PA 4KVME 4KOYA 1UWYA 2ANPA 2O4HA 4X3RA 4P4EA 2GLJA 4UWIA 3NH5A 3I9SA 3UY5A 4B14A 3PBBA 4MHYA 3E0KA 2Z3LA 4JLYA 4MCRA 2F5IA 3EXNA 1YW6A 4R3KA 4IUSA 3T9YA 3N7ZA 2GFQA 2I3CA 4XPDB 4IK2A 5LYDA 4YRHA 3BI1A 4CAXA 1Z4RA 2AFZA 2ODFA 4UIBA 4A38A 5DWMA 4ZX8A 1YX0A 2CF4A 3B35A 3CDXA 4NEXA 3SXOA 4A39A 4F9UA 2WPXA 1VKCA 4M3SA 5JGFA 2Q4YA 1LOKA 3D68A 5IB0A 2FCKA 2CIJA 5ELYA 3KHZA 3OWCA 4PXBA 4PPZA 4MFQA 4QC6A 4UF4A 2FL4A 4CYPA 3IJ3A 3PB6X 4KUAA 4OC2A 2OZUA 2VQYA 5LRGA 1IY7A 3JVNA 1TF9A 5LRKA 2REFA 4II9A 3FB3A 1WK4A 4MHNA 1ZG8A 2RC4A 4EFDA 4MFJA 4MY0A 3LWUA 1NSAA 4KOSA 4UCMA 4CGMA 3EFAA 2EVNA 4NSQA 1MJ9A 1MK4A 1V0CA 3CXQA 3ISXA 4JYWA 4PQAA 1YVKA 3SJEA 4MI4A 4TWEA 3SXNA 4KS9A 4AG9A 4B12A 3DR8A 4LUAA 4OIDA 4XPLA 3QB8A 5A27A 3NH8A 5K8PA 2PJ4A 4P4FA 2ZELA 3V8IA 2AJ6A 2G3TA 1IYLA 3IGRA 1Z4EA 3CZXA 3R96A 3VWDA 5AG6A 5F46A 1CBXA 1HDUA 5LYLA 3MGDA 4M6HA 3NA6A 2F7VA 1CG2A 4ZX9A 2ZEPA 3BLNA 4P4IA 2Q04A 3TO9A 3B3CA 3LACA 4ZYQA 2QYVA 3SJXA 2R98A 1XFOA 3PGPA 4MFZA 1VHEA 3R9EA 2CXAA 5I0CA 3NFZA 4EWTA 2H5MA 1LAPA 1AUGA 1YVOA 4NJRA 4KLWA 2PJ6A 4MJ8A 2ARHA 2WUUA 1F57A 2PJ9A 1Y9KA 4OC0A 1PU9A 2V8GA 5I4MA 4QB9A 1YW4A 3GB0A 5HMNA 4DJLA 4CGOA 4CRZB 2ZXVA 2GE3A 1ZG9A 4FAIA 1CM0A 4OP4A 2I00A 3EC4A 2FSRA 4PXDA 2DPTA 4C68A 2PDOA 4MCSA 3PEIA 1TIQA 4PV6A 4ONUA 1LFWA 3L2NA 2DXQA 2R8VA 2ZENA 2PRBA 4B5OA 1XBUA 5IV0A 3KHXA 2AE6A 2GIVA 3D7GA 8CPAA 4R9MA 1QSTA 1KWMA 2BL1A 4CGPA 2NYQA 2PC1A 1KUYA 4W9YA 4CGLA 2AFOA 5JM6A 4ORFA 2G0BA 2ZPAA 1N71A 3HUVA 3HLPA 3W91A 5AGEA 3H8FA 2J8NA 2OZHA 1BLLE 3B3TA 3H5ZA 4K30A 7CPAA 1QMUA 1XMBA 2PSWA 2QMLA 3R1KA 4H2KA 3TOAA 5K8MA 2WPWA 4NXYA 3WC7A 3H8EA 1Z5RA 2GANA 4B5PA 4H89A 4IF5A 4R76A 2IMOA 1Q7LA 4E2AA 2K5TA 2P0WA 3TO6A 3I1UA 1Y7RA 2BCOA 2Q51A 3B8GA 4F9VA 3D8PA 1Z8TA 4HNYB 4CAWA 3B3SA 5J8CA 4U5YA 1Q2YA 4CYNA 4CPAA 4WJBA 2B58A 4HNXB 4UCPA 3SI2A 2CNTA 3BHXA 1Y0RA 4LX9A 4QVTA 4JZ0A 2HUZA 2Q7BA 4NGRA 3R95A 4FUUA 1FT7A 1YR0A 2EUIA 3KR5A 3K9UA 4TNUA 1J4JA 1I21A 3CXPA 3TOBA 4A30A 2DF5A 4P6YA 4QBJA 1NMTA 1YQEA 4GM5A 2G9DA 4JD6A 2D4PA 4RS2A 2O53A 3W6SA 4OIWA 4B5PB 5J8FA 4U9YA
chains in the Genus database with same CATH topology
3KKWA 3FBUA 4Y49C 2VZZA 3W6XA 1K4JA 5HH1A 3TE4A 2FS5A 5AG7A 1WWZA 3I3GA 3BJ8A 1FY7A 1MJBA 2FIAA 4UFVA 1S60A 3SHPA 4C7IA 2P6EA 1I12A 3IWGA 4B11A 4KOWA 1IYKA 1YK3A 4QUSA 4RI1A 3S6KA 4M85A 4CYOA 4MHDA 5G20A 2B4DA 4MFLA 4PSWA 4E8OA 4UFWA 3T90A 2ZW5A 4J3GA 1QSNA 4OADA 1KZFA 2PR8A 1S7KA 3FIXA 5KTDA 5BWAB 2FE7A 4C2ZA 4DNCA 3S6GA 3R9GA 5F49A 2QECA 1S5KA 2Z0ZA 3RYOA 2B4DB 2NMTA 1S7FA 3TCVA 2B3UA 3DR6A 4XNHC 1P4NA 1RO5A 5DWNA 4KORA 3QAHA 4F6AA 4YGOA 4B13A 3LD2A 4KUBA 3FXTA 2HV2A 3F0AA 4JXQA 2Z3PA 4KOUA 4KOTA 3DSBA 3IWEA 4Q38A 2R1IA 4A95A 4Q36A 4C2YA 1B87A 2Q4VA 3FNCA 1IIDA 3GY9A 1S7LA 3TT2A 4UFXA 4FD7A 1XIXA 3CXSA 1S7NA 3F5BA 5IX3A 1M4DA 3C26A 2JDCA 5AG4A 2J8MA 2YNCC 1VHSA 1L0CA 4NCZA 2DPSA 1P0HA 3D2MA 4AVCA 2BUEA 4L8AA 2JLMA 3P2HA 1NE9A 4GS4A 1B6BA 4FD6A 2ZW4A 4EVYA 2Z11A 4CGNA 2G3AA 2VZYA 3D3SA 2Z3KA 4A32A 5KTAA 4Y49B 1MJAA 1XE4A 2D4OA 3D2PA 5F48A 3WR7A 3A9LA 1M4GA 3EY5A 3FRMA 4XPKA 2HQYA 2B5GB 3S6HA 3TFYA 4U9ZA 4AVAA 1BOBA 4E0AA 4MFPA 1S3ZA 3PZJA 1XMTA 4CRYB 1I1DA 1IICA 2OH1A 4C7HA 1QSMA 2R7HA 2OU2A 4HKFA 5FVJA 4BBHA 4CYQA 3BJ7A 4F0XA 4JJXA 1XEBA 3GYAA 3DDDA 2FXFA 2PQ8A 2I79A 2BEIA 2C27A 4PK3A 4BMHA 4OLLA 2Z3MA 5G21A 3ZZIA 1Z9UA 2YNEA 3S6FA 4PK2A 4KLVA 2YNDA 4B10A 1BO4A 5A28A 4NF1A 3PP9A 3TO7A 4KSAA 1XF8A 5C88A 5JPHA 1NSLA 1YLEA 4XNHB 4UCNA 4MBUA 2Z3NA 3JTKA 5AG5A 2ATRA 3G3SA 2JEVA 4FD5A 2Z10A 2OZGA 4KZTA 4A33A 4CAVA 1RXTA 4XPDC 4UBRA 1M44A 2CNMA 4AG7A 2YNCA 2P6FA 4OAEA 2B4BA 4KVXA 4L89A 2VXKA 4A31A 3FYNA 5G22A 4R57A 4I49A 4KVOE 5H86A 2FIWA 4H6UA 5F47A 1Q2DA 2Q0YA 5EC4A 2YGWA 4AB7A 3ZJ0A 4F0YA 2VEZA 1M4IA 2KCWA 1R57A 5E96A 2IL4A 1QSOA 3IU2A 3R9FA 1SQHA 4CAEA 3P2FA 1ON0A 2Y0MA 2OB0A 3DNSA 4UA3A 5EBVA 1YGHA 4KOXA 1PUAA 5ISVA 4A2ZA 3VWEA 4ZGYB 4YFJA 2J8RA 3F8KA 2CNSA 2P6GA 4C2XA 3GKRA 2VI7A 1Q2CA 2O28A 3NE7A 4CAFA 2B5GA 1LRZA 2X7BA 1YREA 4ZBGA 5CNPA 5KTCA 2Q44A 2REEA 4UWJA 4JWPA 1IB1E 2B3VA 1OZPA 2A4NA 1U6MA 1M1DA 1QSRA 2ZW6A 2FT0A 2BSWA 3H4QA 3LODA 2JDDA 3JUWA 4HNWB 3TTHA 2CY2A 4MFKA 5JQ4A 4X5KA 1GHEA 5GCNA 4AVBA 1KUVA 4KOVA 1ZO0A 3G8WA 2QIRA 3IU1A 4R3LA 5G1ZA 4CS0B 1Y9WA 2Z3OA 4R87A 5C82A 1KUXA 2PR1A 5H84A 4H6ZA 4KSFA 4JXRA 3EO4A 4FD4A 4MY3A 2VBQA 1UFHA 2WSAA 2ZW7A 4PSXA 1CJWA 4KVME 4KOYA 4UWIA 3UY5A 3I9SA 4B14A 3E0KA 2Z3LA 4JLYA 2F5IA 3EXNA 4R3KA 4IUSA 3T9YA 3N7ZA 4XPDB 4YRHA 4CAXA 1Z4RA 5DWMA 1YX0A 4NEXA 3SXOA 2WPXA 1VKCA 4M3SA 2Q4YA 5IB0A 2FCKA 4CYPA 3OWCA 4QC6A 4MFQA 2FL4A 4KUAA 2OZUA 2VQYA 3JVNA 2REFA 3FB3A 1WK4A 2RC4A 4MFJA 4MY0A 4KOSA 4UCMA 4CGMA 3EFAA 2EVNA 4NSQA 1MJ9A 1MK4A 1V0CA 3CXQA 1YVKA 4MI4A 4B12A 3SXNA 4KS9A 4AG9A 3DR8A 4LUAA 4XPLA 5A27A 3QB8A 3V8IA 2AJ6A 2G3TA 1IYLA 3IGRA 1Z4EA 3R96A 3VWDA 5F46A 5AG6A 3MGDA 3BLNA 3TO9A 2Q04A 2R98A 4MFZA 3PGPA 3R9EA 2CXAA 5I0CA 2H5MA 1YVOA 4KLWA 4MJ8A 2ARHA 2WUUA 1Y9KA 1PU9A 4QB9A 5HMNA 4CGOA 4CRZB 2ZXVA 2GE3A 1CM0A 2I00A 3EC4A 2FSRA 2DPTA 4C68A 2PDOA 1TIQA 4PV6A 4ONUA 2DXQA 2R8VA 5IV0A 2PRBA 4B5OA 2AE6A 2GIVA 4R9MA 1QSTA 2BL1A 4CGPA 2PC1A 1KUYA 4CGLA 4ORFA 2G0BA 2ZPAA 1N71A 3W91A 5AGEA 2J8NA 2OZHA 3H5ZA 4K30A 2PSWA 2QMLA 3R1KA 3TOAA 2WPWA 4NXYA 2GANA 4B5PA 4H89A 4IF5A 4E2AA 2K5TA 2P0WA 3TO6A 1Y7RA 3B8GA 3D8PA 4HNYB 4CAWA 5J8CA 4U5YA 1Q2YA 4CYNA 2B58A 4HNXB 4UCPA 2CNTA 4LX9A 4QVTA 2HUZA 2Q7BA 3R95A 1YR0A 2EUIA 3K9UA 1J4JA 1I21A 3CXPA 3TOBA 4A30A 4QBJA 1NMTA 4RS2A 4II9A 4B5PB 4JD6A 2D4PA 3W6SA 5J8FA 4U9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C68 A;  4CYO A;  2YNC A;  2YND A;  3IU2 A;  5G20 A;  3IU1 A;  4B10 A;  4C7H A;  4CGN A;  5A28 A;  5G1Z A;  4BBH A;  4UFX A;  4CAE A;  4UFW A;  4CYQ A;  4UCM A;  4CGM A;  4A31 A;  4A32 A;  5AG7 A;  4B13 A;  4CYN A;  4CGP A;  4B12 A;  5G22 A;  4UCP A;  2WUU A;  4UCN A;  5A27 A;  5AG4 A;  2WSA A;  2YNC C;  4UFV A;  3JTK A;  4CAF A;  4CGL A;  4A2Z A;  5AG5 A;  4C2Z A;  4C7I A;  4CYP A;  4CGO A;  4A30 A;  3IWE A;  5AGE A;  5AG6 A;  5G21 A;  4B11 A;  4C2X A;  3H5Z A;  4A95 A;  4A33 A;  2YNE A;  4B14 A;  4C2Y A; 
#chains in the Genus database with same CATH topology
 3KKW A;  3FBU A;  4Y49 C;  2VZZ A;  3W6X A;  1K4J A;  5HH1 A;  1ZLH A;  3TE4 A;  1TXR A;  5HVF A;  2FS5 A;  3KI9 A;  3IC1 A;  1CP7 A;  1Y0Y A;  3FED A;  4Q7A A;  5AG7 A;  1OBR A;  1WWZ A;  3I3G A;  3BJ8 A;  4UEF A;  1FY7 A;  1MJB A;  1TKH A;  2FIA A;  4UFV A;  1S60 A;  1IOI A;  1QQ9 A;  3SHP A;  3BI0 A;  2P6E A;  4GXH A;  4C7I A;  3FEE A;  4MMO A;  1I12 A;  3IWG A;  4RN7 A;  2VL1 A;  4B11 A;  3IWW A;  4KOW A;  1YSJ A;  1FNO A;  2ZEF A;  3CPA A;  1IYK A;  1YK3 A;  4QUS A;  4RI1 A;  3S6K A;  4M85 A;  4CYO A;  3KGQ A;  4X8I A;  4MHD A;  3DLJ A;  2B4D A;  5G20 A;  4MFL A;  4PSW A;  3IO1 A;  1Z2L A;  4E8O A;  4UFW A;  3T90 A;  3K9T A;  2ZW5 A;  3D7F A;  3VAT A;  4J3G A;  1QSN A;  3B2Y A;  1AMP A;  4OAD A;  1KZF A;  1YLO A;  1S7K A;  2PR8 A;  4NFR A;  6CPA A;  1EE3 P;  3FIX A;  3KZW A;  3N5F A;  5KTD A;  5BWA B;  2FE7 A;  4EME A;  3KL9 A;  4C2Z A;  4ZY0 A;  4DNC A;  1VHO A;  3S9L A;  3QNV A;  3R9G A;  3S6G A;  4NGP A;  3IFE A;  5F49 A;  2QEC A;  1S5K A;  2Z0Z A;  2AFW A;  4BIN A;  2AFU A;  1Y7E A;  2GU2 A;  3FH4 A;  3RYO A;  1PYT B;  2B4D B;  4MCQ A;  2PIY A;  2FVG A;  2NMT A;  1S7F A;  3KR4 A;  2B3U A;  2ZOF A;  3DR6 A;  4XNH C;  3TCV A;  5CBM A;  1P4N A;  1RO5 A;  5DWN A;  4KOR A;  3FEC A;  3QAH A;  2F8H A;  4F6A A;  1H8L A;  2ZEE A;  3BXM A;  3WC5 A;  2HB6 A;  4YGO A;  4B13 A;  1IU8 A;  3LD2 A;  4KUB A;  2V8H A;  3FXT A;  1LAM A;  2C6C A;  2HV2 A;  3F0A A;  1CP6 A;  2EO8 A;  4MXU A;  4JXQ A;  2Z3P A;  3SJG A;  2WZN A;  4KOU A;  3D4U A;  4KOT A;  1TKF A;  3GUX A;  5CPA A;  4OME A;  3DSB A;  3D7D A;  3IWE A;  4ZY1 A;  1JQG A;  4Q38 A;  2OR4 A;  2R1I A;  5EMI A;  4A95 A;  2DEA A;  4Q36 A;  4FWU A;  1BAV A;  4C2Y A;  5F09 A;  1B87 A;  2Q4V A;  3FNC A;  5HVG A;  1IID A;  3GY9 A;  1S7L A;  4P4B A;  3TT2 A;  4P4J A;  4UFX A;  3TC8 A;  1HEE A;  4FD7 A;  1XIX A;  3QAY A;  1VGY A;  3CXS A;  1S7N A;  3F5B A;  5IX3 A;  1M4D A;  3C26 A;  2JDC A;  5AG4 A;  2J8M A;  2YNC C;  2C6P A;  1VHS A;  1L0C A;  4NCZ A;  2PJC A;  4FBE A;  2DPS A;  5THW A;  1P0H A;  3D2M A;  2IJZ A;  4AVC A;  3PB9 X;  1RTQ A;  2BUE A;  4AXV A;  2BO9 A;  4L8A A;  4RUH A;  2JLM A;  3P2H A;  1F2P A;  2PJ1 A;  2POK A;  4NGM A;  1NE9 A;  1LAN A;  4GS4 A;  1B6B A;  2PJ8 A;  4FD6 A;  1IGB A;  2RFH A;  2ZW4 A;  4MRI A;  4F8Z A;  2WYR A;  2PJ2 A;  1AYE A;  1ARM A;  1ZG7 A;  2PJB A;  2Z11 A;  3H8G A;  4EVY A;  4CGN A;  1DTD A;  2G3A A;  4M6I A;  2PCU A;  2VZY A;  1R43 A;  3D3S A;  2Z3K A;  4A32 A;  5K8N A;  5KTA A;  3NH4 A;  4Y49 B;  1MJA A;  1VIX A;  1XE4 A;  1CX8 A;  4NGS A;  2D4O A;  2NSM A;  3B7I A;  1M4L A;  3D2P A;  1BPN A;  5F48 A;  3WR7 A;  2ZEM A;  1CPS A;  3A9L A;  2PVV A;  1M4G A;  3EY5 A;  3FRM A;  4XPK A;  1ELL P;  1CPX A;  3RAM A;  2HQY A;  2XEI A;  2PJ7 A;  1XJO A;  2B5G B;  3S6H A;  3TFY A;  4U9Z A;  4AVA A;  1IOF A;  1BOB A;  1XRY A;  4R7M A;  3KAS A;  4DUK A;  4E0A A;  4MFP A;  1X12 A;  1S3Z A;  3PZJ A;  1XMT A;  3IEH A;  4CRY B;  4PXE A;  4O23 A;  3PB7 X;  1I1D A;  1IIC A;  2OH1 A;  3FVL A;  2QJ8 A;  4C7H A;  1QSM A;  2PIZ A;  2R7H A;  2OU2 A;  2GLF A;  3D7H A;  4HKF A;  5FVJ A;  1Z8X A;  4A37 A;  4BBH A;  4CYQ A;  3BJ7 A;  4F0X A;  4JJX A;  4X2T A;  1XEB A;  3GYA A;  2AFM A;  3DDD A;  2FXF A;  2PJ5 A;  2EBJ A;  4UEE A;  2EK9 A;  3WT4 A;  2ZEO A;  4OC4 A;  2PQ8 A;  3CT9 A;  5D8N A;  3RBU A;  5IB9 A;  2I79 A;  4P45 A;  1XOV A;  2BEI A;  2C27 A;  4PK3 A;  4NGN A;  4BMH A;  4OLL A;  2Z3M A;  5K8O A;  2V8D A;  3CPX A;  4M6G A;  5LRJ A;  5DS0 A;  5G21 A;  3ZZI A;  4NGT A;  3S9N A;  1Z9U A;  2YNE A;  3D66 A;  2J9A A;  3S6F A;  4OKO A;  4PK2 A;  4KLV A;  3KQZ A;  3MN8 A;  2YND A;  4B10 A;  1BO4 A;  3SI1 A;  3T8W A;  1R3N A;  2PJA A;  5A28 A;  4NF1 A;  3PP9 A;  3TO7 A;  4KSA A;  1F2O A;  2PJ3 A;  1XF8 A;  4Z65 A;  5C88 A;  4HPS A;  2C6G A;  3WAB A;  5JPH A;  2QVP A;  3V7Z A;  1NSL A;  4NJQ A;  1YLE A;  4XNH B;  1TKJ A;  5J1Q A;  4UCN A;  4MBU A;  2Z3N A;  3JTK A;  5HVH A;  4NGQ A;  5AG5 A;  2ATR A;  4P4D A;  3PB8 X;  3G3S A;  3V38 A;  4IHM A;  4PXC A;  2JEV A;  4FD5 A;  3VH9 A;  2Z10 A;  2OZG A;  4KZT A;  2OOT A;  4P10 A;  4A33 A;  4CAV A;  1RXT A;  4XPD C;  2Q43 A;  4UBR A;  1M44 A;  2CNM A;  4AG7 A;  2HC9 A;  2YNC A;  3SJF A;  1HDQ A;  2ZEG A;  4OC5 A;  2ABZ A;  2P6F A;  3RNZ A;  5LYI A;  4OAE A;  2B4B A;  4KVX A;  4L89 A;  4B6Z A;  2VXK A;  3GLJ A;  3SI0 A;  4A31 A;  3FYN A;  2XEJ A;  2Q7S A;  5G22 A;  1LCP A;  4R57 A;  3S9M A;  4ZY2 A;  3MRU A;  1ARL A;  4I49 A;  4KVO E;  5H86 A;  2FIW A;  4OC1 A;  4H6U A;  5F47 A;  4MCP A;  4LQ6 A;  3FJU A;  2JEW A;  1Q2D A;  2Q0Y A;  3JRU A;  2PRQ A;  2YGW A;  4ONW A;  5EC4 A;  3ZJ0 A;  4AB7 A;  2Q4Z A;  2VEZ A;  1M4I A;  5D29 A;  4F0Y A;  2CTB A;  2RB7 A;  4KSI A;  3VAR A;  3NE8 A;  2KCW A;  4DYO A;  2V77 A;  1GYT A;  1PCA A;  4A94 A;  1TF8 A;  4MHP A;  2PVW A;  5LYF A;  1R57 A;  3IIB A;  5E96 A;  2IL4 A;  1QSO A;  3IU2 A;  2AFX A;  4ZI6 A;  1X10 A;  2ZOG A;  3R9F A;  1SQH A;  3PB4 X;  4CAE A;  3P2F A;  1ON0 A;  2Y0M A;  2OB0 A;  3DNS A;  2GRE A;  2CTC A;  4UA3 A;  2JBK A;  3B3V A;  5EBV A;  3FF3 A;  1ELM P;  1A2Z A;  1YGH A;  4KOX A;  1PUA A;  5ISV A;  4A2Z A;  2ZEH A;  4K3N A;  2JBJ A;  3VWE A;  4ZGY B;  4YWY A;  2IQ6 A;  1JWQ A;  4YFJ A;  2J8R A;  3F8K A;  2CNS A;  4LQG A;  1BPM A;  1Z8L A;  2XEF A;  4IAV A;  2P6G A;  4C2X A;  3GKR A;  4OC3 A;  2VI7 A;  1Q2C A;  2O28 A;  3NE7 A;  4P44 A;  4CAF A;  2B5G A;  3LMS A;  3TX8 A;  1LRZ A;  2X7B A;  3PFE A;  1YRE A;  3FMC A;  4ZBG A;  5CNP A;  5KTC A;  4UIA A;  2Q44 A;  2REE A;  3K2K A;  3D67 A;  4JWP A;  4UWJ A;  3KQX A;  1IB1 E;  2AFS A;  2B3V A;  1OZP A;  2A4N A;  1U6M A;  3B3W A;  4R8F A;  1M1D A;  3ISZ A;  4WWV A;  4YU9 A;  3RZA A;  1QSR A;  3PFO A;  2ZW6 A;  1DE4 C;  2ZED A;  2FT0 A;  4BD9 A;  3PBE A;  1Z8W A;  2BSW A;  3H4Q A;  3LOD A;  2XEG A;  2JDD A;  3JUW A;  2BOA A;  4HNW B;  3TTH A;  2CY2 A;  4MFK A;  5HXD A;  5JQ4 A;  4X5K A;  2C1C A;  1GHE A;  2PE3 A;  5GCN A;  4AVB A;  1KUV A;  4KOV A;  2EWB A;  3DGV A;  3FX6 A;  1ZO0 A;  3G8W A;  4MHZ A;  2QIR A;  3IU1 A;  4R3L A;  5G1Z A;  4CS0 B;  1ZLI A;  1Y9W A;  2Z3O A;  3PRT A;  4R87 A;  2V8V A;  1KUX A;  3WC6 A;  2PR1 A;  5C82 A;  5JH9 A;  5H84 A;  4H6Z A;  1YME A;  4KSF A;  2EK8 A;  4JXR A;  3EO4 A;  2PJ0 A;  4FD4 A;  4MY3 A;  2VBQ A;  1UFH A;  2WSA A;  4R6T A;  2ZW7 A;  4PSX A;  3GIU A;  1CJW A;  4UEZ A;  3RO0 A;  4G1P A;  4KVM E;  4KOY A;  1UWY A;  2ANP A;  2O4H A;  4X3R A;  4P4E A;  2GLJ A;  4UWI A;  3NH5 A;  3I9S A;  3UY5 A;  4B14 A;  3PBB A;  4MHY A;  3E0K A;  2Z3L A;  4JLY A;  4MCR A;  2F5I A;  3EXN A;  1YW6 A;  4R3K A;  4IUS A;  3T9Y A;  3N7Z A;  2GFQ A;  2I3C A;  4XPD B;  4IK2 A;  5LYD A;  4YRH A;  3BI1 A;  4CAX A;  1Z4R A;  2AFZ A;  2ODF A;  4UIB A;  4A38 A;  5DWM A;  4ZX8 A;  1YX0 A;  2CF4 A;  3B35 A;  3CDX A;  4NEX A;  3SXO A;  4A39 A;  4F9U A;  2WPX A;  1VKC A;  4M3S A;  5JGF A;  2Q4Y A;  1LOK A;  3D68 A;  5IB0 A;  2FCK A;  2CIJ A;  5ELY A;  3KHZ A;  3OWC A;  4PXB A;  4PPZ A;  4MFQ A;  4QC6 A;  4UF4 A;  2FL4 A;  4CYP A;  3IJ3 A;  3PB6 X;  4KUA A;  4OC2 A;  2OZU A;  2VQY A;  5LRG A;  1IY7 A;  3JVN A;  1TF9 A;  5LRK A;  2REF A;  4II9 A;  3FB3 A;  1WK4 A;  4MHN A;  1ZG8 A;  2RC4 A;  4EFD A;  4MFJ A;  4MY0 A;  3LWU A;  1NSA A;  4KOS A;  4UCM A;  4CGM A;  3EFA A;  2EVN A;  4NSQ A;  1MJ9 A;  1MK4 A;  1V0C A;  3CXQ A;  3ISX A;  4JYW A;  4PQA A;  1YVK A;  3SJE A;  4MI4 A;  4TWE A;  3SXN A;  4KS9 A;  4AG9 A;  4B12 A;  3DR8 A;  4LUA A;  4OID A;  4XPL A;  3QB8 A;  5A27 A;  3NH8 A;  5K8P A;  2PJ4 A;  4P4F A;  2ZEL A;  3V8I A;  2AJ6 A;  2G3T A;  1IYL A;  3IGR A;  1Z4E A;  3CZX A;  3R96 A;  3VWD A;  5AG6 A;  5F46 A;  1CBX A;  1HDU A;  5LYL A;  3MGD A;  4M6H A;  3NA6 A;  2F7V A;  1CG2 A;  4ZX9 A;  2ZEP A;  3BLN A;  4P4I A;  2Q04 A;  3TO9 A;  3B3C A;  3LAC A;  4ZYQ A;  2QYV A;  3SJX A;  2R98 A;  1XFO A;  3PGP A;  4MFZ A;  1VHE A;  3R9E A;  2CXA A;  5I0C A;  3NFZ A;  4EWT A;  2H5M A;  1LAP A;  1AUG A;  1YVO A;  4NJR A;  4KLW A;  2PJ6 A;  4MJ8 A;  2ARH A;  2WUU A;  1F57 A;  2PJ9 A;  1Y9K A;  4OC0 A;  1PU9 A;  2V8G A;  5I4M A;  4QB9 A;  1YW4 A;  3GB0 A;  5HMN A;  4DJL A;  4CGO A;  4CRZ B;  2ZXV A;  2GE3 A;  1ZG9 A;  4FAI A;  1CM0 A;  4OP4 A;  2I00 A;  3EC4 A;  2FSR A;  4PXD A;  2DPT A;  4C68 A;  2PDO A;  4MCS A;  3PEI A;  1TIQ A;  4PV6 A;  4ONU A;  1LFW A;  3L2N A;  2DXQ A;  2R8V A;  2ZEN A;  2PRB A;  4B5O A;  1XBU A;  5IV0 A;  3KHX A;  2AE6 A;  2GIV A;  3D7G A;  8CPA A;  4R9M A;  1QST A;  1KWM A;  2BL1 A;  4CGP A;  2NYQ A;  2PC1 A;  1KUY A;  4W9Y A;  4CGL A;  2AFO A;  5JM6 A;  4ORF A;  2G0B A;  2ZPA A;  1N71 A;  3HUV A;  3HLP A;  3W91 A;  5AGE A;  3H8F A;  2J8N A;  2OZH A;  1BLL E;  3B3T A;  3H5Z A;  4K30 A;  7CPA A;  1QMU A;  1XMB A;  2PSW A;  2QML A;  3R1K A;  4H2K A;  3TOA A;  5K8M A;  2WPW A;  4NXY A;  3WC7 A;  3H8E A;  1Z5R A;  2GAN A;  4B5P A;  4H89 A;  4IF5 A;  4R76 A;  2IMO A;  1Q7L A;  4E2A A;  2K5T A;  2P0W A;  3TO6 A;  3I1U A;  1Y7R A;  2BCO A;  2Q51 A;  3B8G A;  4F9V A;  3D8P A;  1Z8T A;  4HNY B;  4CAW A;  3B3S A;  5J8C A;  4U5Y A;  1Q2Y A;  4CYN A;  4CPA A;  4WJB A;  2B58 A;  4HNX B;  4UCP A;  3SI2 A;  2CNT A;  3BHX A;  1Y0R A;  4LX9 A;  4QVT A;  4JZ0 A;  2HUZ A;  2Q7B A;  4NGR A;  3R95 A;  4FUU A;  1FT7 A;  1YR0 A;  2EUI A;  3KR5 A;  3K9U A;  4TNU A;  1J4J A;  1I21 A;  3CXP A;  3TOB A;  4A30 A;  2DF5 A;  4P6Y A;  4QBJ A;  1NMT A;  1YQE A;  4GM5 A;  2G9D A;  4JD6 A;  2D4P A;  4RS2 A;  2O53 A;  3W6S A;  4OIW A;  4B5P B;  5J8F A;  4U9Y A; 
#chains in the Genus database with same CATH homology
 3KKW A;  3FBU A;  4Y49 C;  2VZZ A;  3W6X A;  1K4J A;  5HH1 A;  3TE4 A;  2FS5 A;  5AG7 A;  1WWZ A;  3I3G A;  3BJ8 A;  1FY7 A;  1MJB A;  2FIA A;  4UFV A;  1S60 A;  3SHP A;  4C7I A;  2P6E A;  1I12 A;  3IWG A;  4B11 A;  4KOW A;  1IYK A;  1YK3 A;  4QUS A;  4RI1 A;  3S6K A;  4M85 A;  4CYO A;  4MHD A;  5G20 A;  2B4D A;  4MFL A;  4PSW A;  4E8O A;  4UFW A;  3T90 A;  2ZW5 A;  4J3G A;  1QSN A;  4OAD A;  1KZF A;  2PR8 A;  1S7K A;  3FIX A;  5KTD A;  5BWA B;  2FE7 A;  4C2Z A;  4DNC A;  3S6G A;  3R9G A;  5F49 A;  2QEC A;  1S5K A;  2Z0Z A;  3RYO A;  2B4D B;  2NMT A;  1S7F A;  3TCV A;  2B3U A;  3DR6 A;  4XNH C;  1P4N A;  1RO5 A;  5DWN A;  4KOR A;  3QAH A;  4F6A A;  4YGO A;  4B13 A;  3LD2 A;  4KUB A;  3FXT A;  2HV2 A;  3F0A A;  4JXQ A;  2Z3P A;  4KOU A;  4KOT A;  3DSB A;  3IWE A;  4Q38 A;  2R1I A;  4A95 A;  4Q36 A;  4C2Y A;  1B87 A;  2Q4V A;  3FNC A;  1IID A;  3GY9 A;  1S7L A;  3TT2 A;  4UFX A;  4FD7 A;  1XIX A;  3CXS A;  1S7N A;  3F5B A;  5IX3 A;  1M4D A;  3C26 A;  2JDC A;  5AG4 A;  2J8M A;  2YNC C;  1VHS A;  1L0C A;  4NCZ A;  2DPS A;  1P0H A;  3D2M A;  4AVC A;  2BUE A;  4L8A A;  2JLM A;  3P2H A;  1NE9 A;  4GS4 A;  1B6B A;  4FD6 A;  2ZW4 A;  4EVY A;  2Z11 A;  4CGN A;  2G3A A;  2VZY A;  3D3S A;  2Z3K A;  4A32 A;  5KTA A;  4Y49 B;  1MJA A;  1XE4 A;  2D4O A;  3D2P A;  5F48 A;  3WR7 A;  3A9L A;  1M4G A;  3EY5 A;  3FRM A;  4XPK A;  2HQY A;  2B5G B;  3S6H A;  3TFY A;  4U9Z A;  4AVA A;  1BOB A;  4E0A A;  4MFP A;  1S3Z A;  3PZJ A;  1XMT A;  4CRY B;  1I1D A;  1IIC A;  2OH1 A;  4C7H A;  1QSM A;  2R7H A;  2OU2 A;  4HKF A;  5FVJ A;  4BBH A;  4CYQ A;  3BJ7 A;  4F0X A;  4JJX A;  1XEB A;  3GYA A;  3DDD A;  2FXF A;  2PQ8 A;  2I79 A;  2BEI A;  2C27 A;  4PK3 A;  4BMH A;  4OLL A;  2Z3M A;  5G21 A;  3ZZI A;  1Z9U A;  2YNE A;  3S6F A;  4PK2 A;  4KLV A;  2YND A;  4B10 A;  1BO4 A;  5A28 A;  4NF1 A;  3PP9 A;  3TO7 A;  4KSA A;  1XF8 A;  5C88 A;  5JPH A;  1NSL A;  1YLE A;  4XNH B;  4UCN A;  4MBU A;  2Z3N A;  3JTK A;  5AG5 A;  2ATR A;  3G3S A;  2JEV A;  4FD5 A;  2Z10 A;  2OZG A;  4KZT A;  4A33 A;  4CAV A;  1RXT A;  4XPD C;  4UBR A;  1M44 A;  2CNM A;  4AG7 A;  2YNC A;  2P6F A;  4OAE A;  2B4B A;  4KVX A;  4L89 A;  2VXK A;  4A31 A;  3FYN A;  5G22 A;  4R57 A;  4I49 A;  4KVO E;  5H86 A;  2FIW A;  4H6U A;  5F47 A;  1Q2D A;  2Q0Y A;  5EC4 A;  2YGW A;  4AB7 A;  3ZJ0 A;  4F0Y A;  2VEZ A;  1M4I A;  2KCW A;  1R57 A;  5E96 A;  2IL4 A;  1QSO A;  3IU2 A;  3R9F A;  1SQH A;  4CAE A;  3P2F A;  1ON0 A;  2Y0M A;  2OB0 A;  3DNS A;  4UA3 A;  5EBV A;  1YGH A;  4KOX A;  1PUA A;  5ISV A;  4A2Z A;  3VWE A;  4ZGY B;  4YFJ A;  2J8R A;  3F8K A;  2CNS A;  2P6G A;  4C2X A;  3GKR A;  2VI7 A;  1Q2C A;  2O28 A;  3NE7 A;  4CAF A;  2B5G A;  1LRZ A;  2X7B A;  1YRE A;  4ZBG A;  5CNP A;  5KTC A;  2Q44 A;  2REE A;  4UWJ A;  4JWP A;  1IB1 E;  2B3V A;  1OZP A;  2A4N A;  1U6M A;  1M1D A;  1QSR A;  2ZW6 A;  2FT0 A;  2BSW A;  3H4Q A;  3LOD A;  2JDD A;  3JUW A;  4HNW B;  3TTH A;  2CY2 A;  4MFK A;  5JQ4 A;  4X5K A;  1GHE A;  5GCN A;  4AVB A;  1KUV A;  4KOV A;  1ZO0 A;  3G8W A;  2QIR A;  3IU1 A;  4R3L A;  5G1Z A;  4CS0 B;  1Y9W A;  2Z3O A;  4R87 A;  5C82 A;  1KUX A;  2PR1 A;  5H84 A;  4H6Z A;  4KSF A;  4JXR A;  3EO4 A;  4FD4 A;  4MY3 A;  2VBQ A;  1UFH A;  2WSA A;  2ZW7 A;  4PSX A;  1CJW A;  4KVM E;  4KOY A;  4UWI A;  3UY5 A;  3I9S A;  4B14 A;  3E0K A;  2Z3L A;  4JLY A;  2F5I A;  3EXN A;  4R3K A;  4IUS A;  3T9Y A;  3N7Z A;  4XPD B;  4YRH A;  4CAX A;  1Z4R A;  5DWM A;  1YX0 A;  4NEX A;  3SXO A;  2WPX A;  1VKC A;  4M3S A;  2Q4Y A;  5IB0 A;  2FCK A;  4CYP A;  3OWC A;  4QC6 A;  4MFQ A;  2FL4 A;  4KUA A;  2OZU A;  2VQY A;  3JVN A;  2REF A;  3FB3 A;  1WK4 A;  2RC4 A;  4MFJ A;  4MY0 A;  4KOS A;  4UCM A;  4CGM A;  3EFA A;  2EVN A;  4NSQ A;  1MJ9 A;  1MK4 A;  1V0C A;  3CXQ A;  1YVK A;  4MI4 A;  4B12 A;  3SXN A;  4KS9 A;  4AG9 A;  3DR8 A;  4LUA A;  4XPL A;  5A27 A;  3QB8 A;  3V8I A;  2AJ6 A;  2G3T A;  1IYL A;  3IGR A;  1Z4E A;  3R96 A;  3VWD A;  5F46 A;  5AG6 A;  3MGD A;  3BLN A;  3TO9 A;  2Q04 A;  2R98 A;  4MFZ A;  3PGP A;  3R9E A;  2CXA A;  5I0C A;  2H5M A;  1YVO A;  4KLW A;  4MJ8 A;  2ARH A;  2WUU A;  1Y9K A;  1PU9 A;  4QB9 A;  5HMN A;  4CGO A;  4CRZ B;  2ZXV A;  2GE3 A;  1CM0 A;  2I00 A;  3EC4 A;  2FSR A;  2DPT A;  4C68 A;  2PDO A;  1TIQ A;  4PV6 A;  4ONU A;  2DXQ A;  2R8V A;  5IV0 A;  2PRB A;  4B5O A;  2AE6 A;  2GIV A;  4R9M A;  1QST A;  2BL1 A;  4CGP A;  2PC1 A;  1KUY A;  4CGL A;  4ORF A;  2G0B A;  2ZPA A;  1N71 A;  3W91 A;  5AGE A;  2J8N A;  2OZH A;  3H5Z A;  4K30 A;  2PSW A;  2QML A;  3R1K A;  3TOA A;  2WPW A;  4NXY A;  2GAN A;  4B5P A;  4H89 A;  4IF5 A;  4E2A A;  2K5T A;  2P0W A;  3TO6 A;  1Y7R A;  3B8G A;  3D8P A;  4HNY B;  4CAW A;  5J8C A;  4U5Y A;  1Q2Y A;  4CYN A;  2B58 A;  4HNX B;  4UCP A;  2CNT A;  4LX9 A;  4QVT A;  2HUZ A;  2Q7B A;  3R95 A;  1YR0 A;  2EUI A;  3K9U A;  1J4J A;  1I21 A;  3CXP A;  3TOB A;  4A30 A;  4QBJ A;  1NMT A;  4RS2 A;  4II9 A;  4B5P B;  4JD6 A;  2D4P A;  3W6S A;  5J8F A;  4U9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...