4B16A

Crystal structure of tamarind chitinase like lectin (tcll) complexed with n-acetyl glucosamine (glcnac)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
266
structure length
266
Chain Sequence
GGNIVVYWGQGGSDNSEGSLKEACKSGHYNMIVLEELITYDNGRDPDLNLGAHCVNCTSLQQEIKYCQLKLIKILLQIGQVTPTKEDTKDTTKDLSQYLDSNFFSGKSGPLGEVYLDGIDIASVPEGLNLKFDELVQALNDSATSRRIYLSASPNCVYPDYYLDKAIQTQKLDFLFVQFFYALPCIYTQGLPEDLFQAMKTWTSNVPESKIFMALPATPDLNGYIPPRVLNKEILPAVTQASNFAGVMIFDRYFDRFRKYSSKIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITINASE LIKE LECTIN
publication title Structural Investigation of a Novel N-Acetyl Glucosamine Binding Chi-Lectin which Reveals Evolutionary Relationship with Class III Chitinases.
pubmed doi rcsb
molecule tags Hydrolase
total genus 92
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4b16A00
2GUYA 3W24A 5CLTA 4PYSA 4Q7NA 2VL4A 4AZ7A 3OA5A 3NDYA 3ZT6A 3W53A 4M1RA 4UFLA 4BQ2A 2WM0A 2BY3A 4CU6A 4DUWA 3VIMA 3WDRA 4BS0A 5I3DA 4JIEA 1HJSA 4AD1A 3PTMA 3DYMA 1H2JA 3W4RA 4J3TA 1RH9A 3M07A 4P7OA 2YBTA 4UQDA 1J0KA 5A69A 3MUY1 2CKRA 1DWJM 3UERA 3ZT5A 3T08A 1V0MA 2WHJA 4JKMA 5E09A 1NOWA 4PTMA 4W85A 3TP4A 5E0FA 3E1F1 4CGTA 2YA2A 1B30A 5CLWA 3ZSTA 3CZGA 5I23A 4ACZB 3J7HA 3RCNA 3THCA 1ZB5A 4AZCB 3BAXA 2J7BA 2Z1SA 1UQYA 3UESA 5A6LA 3PZIA 1ZU8A 1GJWA 3FHAA 5GQBA 2UY2A 2VX4A 4X0VA 1JL8A 3RJYA 1BVNP 3GBEA 1C3FA 1B3VA 1MQQA 4KGJA 1VBRA 4ACYA 2OSWA 2D0HA 3BCDA 3AMLA 3VMNA 1UH3A 2ZXBA 1HJUA 4H2CA 3W38A 3AYRA 1TUXA 1DWAM 3GYCA 1B3WA 3KL3A 4HMCA 5BXTA 1X6NA 3BCFA 4E4PA 1GPFA 3AS0A 2EPMX 2GJXB 3CBWA 2NW0A 2EXOA 2EEXA 2JIWA 3WDQA 1M03A 1BQCA 5BWFA 4MJ2A 1VJZA 4ZEPA 2A3BA 2HISA 3AS2A 1QHZA 1W9XA 4PMVA 1UR2A 2G3NA 3ARVA 3WD2A 3GH5A 1B90A 3WY1A 1E43A 3GNRA 4MB5A 1CECA 2DSUA 2VRKA 3WH8A 1UG6A 1M04A 4JFVA 2BHUA 2XFYA 3I3DA 3N12A 3WNNA 1B2YA 3UG3A 1AQMA 3DYOA 4GI9A 1TFVA 2WVSA 4DUXA 4P8VA 1KWKA 1XD1A 3ARWA 5F7UA 2DSWA 2OSYA 2YLLA 5I79A 4AISA 3CZJA 2BVYA 1UKOA 1US3A 1CWYA 1TE1A 2J75A 3CMGA 4PMQA 5JBFA 3FY1A 5BYWA 3VU2A 1UD5A 2PF0A 4YPJA 4AZIA 4RL3A 4WSJA 1V0LA 5AYIA 5I5RA 3MUZ1 2QPUA 4CCCA 1PZ2A 5E9AA 3VGBA 2E3ZA 1R85A 1ZJAA 2GK1B 4XZBA 3L2MA 1G01A 1KXTA 1H4PA 1XV8A 4DWSB 2O92A 1UWTA 1Y7VA 4V28A 1CDGA 1UWQA 3WUBA 3WQ6A 4HA3A 4JHOA 5DMYA 1KQZA 3QOKA 1W9DM 5BROA 1AQ0A 4UNIA 2BXYA 3VIKA 3W37A 4PMOA 3W82A 1WB0A 1UR8A 2YKKA 1UR9A 3BAYA 4UFJA 2XFRA 1KFWA 2WVTA 4PCSA 4AD2A 1V3MA 4PMZA 3GM8A 1ESWA 2J8GA 1W3LA 4AC1X 1CYGA 1FHLA 3A47A 3L4TA 3NUKA 1VEOA 5LYRA 4PEEA 2Y8KA 2IXVA 2UY5A 3MU7A 2EBNA 3VGDA 1JNEA 3FHQA 4WF7A 2ZUWA 1Q4NX 1BHGA 2G3MA 5BXRA 3AOFA 3SUVA 2E8YA 4AD5A 3W6LA 1MWOA 3VM5A 2ZX8A 1OIMA 1PIGA 2J4GA 2W4XA 3MMDA 1NM9A 1JD7A 5FIPA 1W1YA 2DSVA 3MUIA 1GQJA 2J74A 2VZOA 4JAWA 4F9DA 3WUFA 1JG9A 1GORA 1WO2A 3LPPA 3QOMA 1FH8A 2BVDA 1BYDA 3VGHA 2VURA 2Q8XA 1XRVA 2DH3A 1TA3B 2CBIA 2WHLA 3WEMA 2Y8VA 3BMVA 1NH6A 3ZR6A 1DWGM 2D1ZA 2A3HA 4Z2LA 3SCWA 2BVTA 3VIHA 4Z2HA 1GQLA 5HPOA 5CSUA 3NSNA 4W7VA 3PZGA 1NOFA 1CENA 3MO4A 3G6MA 3KWXA 1UD2A 4W8AA 1H3GA 3AHVA 2VZVA 1OBAA 2Y2WA 3B8SA 4PMRA 2DH2A 2WLZA 1HL8A 4LX4A 3MV11 1UD3A 1FH7A 2FHBA 2WVVA 3MS8A 4LXFA 2V3FA 2C8NA 1QW8A 3SUUA 3VDAA 4AMCA 1XCWA 1B3YA 3AMDA 3EDJA 4P8UA 3VDHA 4PTVA 4HOZA 1KBBA 4WLCA 3WF3A 4MB1A 4U33A 2QMKA 1W1PA 3WD3A 1CGUA 3TTOA 3ZR5A 1UKSA 1LWHA 2D3NA 1QNQA 2VOTA 3GXMA 1ZJBA 1PEZA 2J7EA 4NZCA 5EB8A 1LJYA 5IFTA 4D1IA 2VCCA 4URIA 1EGZA 3OLEA 3DECA 4M29A 4BF7A 1CXHA 4PSPA 1K9FA 4J7RA 1Q6CA 2DT0A 3OIHA 3F4VA 2XG9A 3AJ7A 3TTYA 3RMEA 2D24A 1ODUA 3AIRA 1E0VA 3GDBA 2PWDA 4WJXA 1ITCA 1XH0A 2YJQA 1BGGA 4CU7A 1WDPA 3AIQA 5HXMA 2BY0A 2VX6A 3ARUA 3AHTA 1GQKA 1D7FA 2BHYA 4AZHA 1NQ6A 1RP9A 4IPNB 1UZ1A 4AZGA 1CPUA 2E9MA 3CMJA 1SMDA 1US2A 1XSKA 1ZBWA 1GUVA 1G5AA 4ZE5A 3S2CA 4B16A 4NSBA 5A6SA 2Y5EA 2XIBA 2CBJA 1E4MM 1TVPA 3W26A 1CEOA 3ARPA 4PMUA 3APGA 2OYLA 5DT7A 3CHFA 1FFRA 1UA3A 2WAGA 2G3JA 3WDIA 3UETA 3CPUA 1B1YA 3FAWA 3AZTA 4OOUA 4AD0A 4D6HA 2XGBA 1E56A 2VUYA 1W1VA 3DHPA 4GKLA 3OLDA 5AC5A 2WKLA 2WZEA 4PUEA 4UFIA 5EFFA 3CGTA 3ARYA 1VB9A 5E6YA 1CLXA 1EDQA 2ZXDA 4BZYA 3WMCA 4BCEA 5I2UA 1I75A 2ZUNA 4W84A 2VT0A 3SCPA 3PTKA 2YBUA 5CPTA 3QHOA 2Y24A 3VD7A 2WWCA 3POHA 2CCRA 1CXEA 1J0IA 1HN1A 3IAQA 1EIBA 3SURA 2GDVA 1MXDA 1BPLB 1UKQA 3ARRA 3PZNA 1GQIA 2NSXA 2PBGA 2XYLA 1UH2A 4KMQA 1FP9A 2WB5A 2OWCA 1L0PA 1B9ZA 6TAAA 3VIIA 1FP8A 3K8LA 1GHSA 2V3GA 4MNJA 2GVYA 1B31A 3WUEA 4TTGA 2W67A 2JALA 1CXKA 5ABGA 3GBDA 3NJ3A 3S6TA 3RO8A 1B3XA 1V3IA 4CVWA 3UEQA 4DWSD 4QLKA 1WZMA 4WK9A 3A4XA 4TX6A 2V3EA 1JD9A 1JZ4A 4UQBA 3EBVA 2IXUA 5C8BB 3N11A 5A2BA 1BG9A 4FMVA 4ML4A 4PRWA 3WH6A 5A8MA 3M6DA 3T0AA 4ACZA 3ECQA 3EDKA 3VO0A 4AZ6A 4AZCA 1QI0A 2O9PA 2YA1A 3L4YA 1KWGA 2J8FA 1KQYA 2WCGA 3RM9A 2VQTA 4F66A 3VDBA 1BG4A 1MFVA 1UD8A 3VDCA 1MQPA 3M7SA 1E1EA 3LPFA 3VKKA 5GNXA 2DSKA 4XV0A 3SUTA 7CGTA 1WDSA 5BRQA 1E71M 3WF2A 3MKKA 1PAMA 4HA4A 3ZJ7A 2VX5A 1WDQA 2QMJA 4QDMA 5JIPA 2D0FA 2FH6A 5DF0A 1O6IA 4WKHA 1Z32X 4H04A 2X0HA 2GJXA 2XVLA 3MSDA 1TZ7A 2NT1A 3U57A 1E0XA 3CUIA 4CD6A 1OSEA 5HPCA 1NWTA 5ABFB 4QFUA 1W3KA 3BC9A 1HJVA 2VTFA 3UG5A 4GO9A 3KL5A 1V6WA 3SCOA 4CN6A 4UTFA 1UA7A 4UQCA 3AFBA 4B3KA 4LPCA 1DWHM 4UR9A 2J25A 3QHNA 1FH9A 1JZ3A 4ZXLA 4D6FA 4P8WA 5EBAA 1OGBA 1CZ1A 4EK7A 3EDFA 4HPGA 3CUGA 4BQ4A 3VIGA 4LGXA 1E1FA 1V3KA 2FH8A 3ALGA 3PTQA 1KR1A 4PSRA 1CXFA 3VMOA 5A8PA 1R7OA 2VVSA 3HMCA 1AQHA 2YIHA 4CVUA 1HL9A 3GH7A 1WP6A 4HZ7A 3WNPA 4H8UA 2VO5A 5CG0A 1V6XA 1E6SM 1KXHA 3WBEA 1K6AA 4Y7EA 3T2PA 4GQRA 1RD6A 2FGLA 1V02A 2ZWYA 2E8ZA 1C8QA 3ZM8A 4QAWA 2ZX7A 3A4AA 1GONA 2PB1A 1KGWA 2GK1A 1VFOA 2CESA 3AMCA 3D3AA 1WE5A 1EH9A 4TTUA 2VQUA 3EMCA 2YDRA 1BYCA 4U2YA 1WKYA 2CXGA 2J7DA 4FLQA 4DWSA 5HNNA 2GSJA 1S46A 5D9PA 3KL0A 4MDOA 1EQCA 3W28A 1C7SA 4HA1A 5D4YA 2DSZA 1J0YA 3B9AA 5LA1A 1UKTA 3HJEA 1MYRA 1LG2A 1VEPA 3IAPA 4UQEA 4OOZA 4D6CA 3WSUA 4GZEA 2WSPA 2J77A 3AI0A 2EPOA 4F9JA 4J27A 1H41A 3SCNA 3WQVA 2WZHA 3MMWA 3AYSA 1W91A 3VGFA 3RJXA 3SCVA 3AXHA 2QV4A 3SUSA 2O9RA 2DEPA 1V6UA 3KZSA 1MVYA 4OUEA 1ODZA 1Q6DA 4GXPA 3K46A 4YN5A 4YHGA 4MPKA 3FN9A 3MANA 2DT3A 5CXPA 2F2HA 2YLAA 1OINA 1BGAA 1DWIM 1E3ZA 1TMQA 2WPGA 2AOSA 1Q6GA 1K9DA 1JAKA 4IPLA 5CZKA 2XUCA 1GOWA 5CJ5A 1CBGA 4AIEA 1VFFA 1E5JA 3ZSSA 4PCTA 3CZEA 1UR1A 2WC7A 3OGVA 5BXPA 1F4HA 1E4IA 2O9OA 2VZUA 1UD4A 3WDPP 2PC8A 3VIOA 1PZ3A 1EHAA 3CHCA 2JFEX 5A6MA 3RIKA 4TOQA 3N9KA 1OD8A 2CBVA 4H7VA 4V2XA 2WMHA 2YL9A 4W5ZA 2BHZA 1E72M 1U33A 3N13A 1TA3A 2CERA 1DP0A 1SYTA 3OZOA 1V08A 5M17A 2CEQA 4MB3A 5JBDA 4PMXA 5DO8A 4OZOA 2E4TA 2OLHA 1C7TA 3FXYA 2QHAA 3GTNA 2XWDA 1IT0A 3CO4A 3WELA 1QPKA 3O6AA 4U5KA 2CPUA 4B3LA 2PI6A 4M80A 1N82A 2G3IA 3KEHA 4L4PA 3GNPA 3ZT7A 2CETA 2EPNA 3WEOA 3G6LA 3K8MA 2W63A 5D8ZA 2X05A 2ZWZA 1JZ5A 4A3YA 1OIFA 2BNJA 2ZE0A 4JL1A 4S3JA 5CGTA 5D9NA 3WNOA 4B15A 2WCAA 1C90A 2ESCA 4FK9A 3T09A 2TAAA 1J10A 1V0KA 4GI8A 4D6IA 3ZIZA 1QHOA 1Q6EA 3VNYA 1U30A 2ZX9A 3NYDA 4TXEA 3UCQA 3WH7A 4P7QA 5FOOA 3OLIA 3UR7A 5E0CA 3ZJKA 2V5DA 1GZJA 1V0NA 4PMYA 5GNYA 5I77A 4KRUA 3AISA 9CGTA 4JFSA 1E4LA 3W0KA 5IFPA 2ZXQA 4A4AA 1E3XA 3VD3A 1H49A 2MANA 1KGXA 4GPNA 4CCEA 2VZTA 4JFUA 4UOZA 1VBUA 2B31A 2DGAA 2DT2A 3W6MA 1XC6A 2WKGA 2YL6A 5FL1A 4CKQA 2XFFA 5JUVA 1KXQA 4W7UA 1MXGA 3WENA 1CIUA 1G9HA 4AIOA 1J0HA 1FA2A 4J3VA 1SR0A 1HKIA 4ATLA 4KRTA 3SEPA 4C7FA 5BXSA 1WZLA 3RPMA 1BYBA 2J47A 3T2OA 2VI0A 1LF1A 3AROA 4U2ZA 2W5FA 4M24A 4CN4A 3ZMRA 1F4AA 5ABEA 1NWSA 4AY1A 2YOCA 2EQDA 1UHVA 1R86A 2D20A 1RPKA 3AIEA 2VR4A 5GPRA 5KZ6A 4AW7A 2UY3A 4PTWA 3VX1A 3MMUA 2O9TA 4M82A 4MJ4A 1KGUA 3IJ7A 2WLYA 1D3CA 1PPIA 3AIWA 4BA0A 3U7VA 3VIPA 1E9LA 3WQWA 1XD0A 4DWSC 3ARTA 2DIEA 1GOIA 3F5JA 3BLPX 1GHRA 4X9YA 4JKLA 1EO5A 4KGLA 3VUPA 3WQ5A 2E40A 3DYPA 3WF1A 4W8BA 1EOKA 4WKFA 2CYGA 5FKYA 2A3CA 5DEZA 2J7HA 3VGEA 3IJ8A 4C7DA 1UR4A 3SUWA 1M7XA 3RM8A 3W29A 4AWEA 4AD4A 1GOMA 3T2QA 1PIFA 4TVDA 1HVQA 1JXJA 4NI3A 3RM4A 1B3ZA 3F5KA 2VC9A 4NRSA 5CQ1A 1SMAA 1JFHA 4P7RA 3VD4A 2VCBA 1A3HA 4AEEA 4WIWA 2BXZA 5D9MA 1XSIA 1WDRA 1LL6A 1QNOA 4S3KA 1O7AA 1QI2A 1ZBKA 3WBAA 3WN6A 2WMIB 2YL8A 1BTCA 4HMDA 4JL2A 3L4WA 5IHRA 4AZBA 1UWUA 1XYZA 4IM4A 5EFDA 4U3AA 4AD3A 3L4XA 1FHDA 1JAEA 1HX0A 3GXIA 4FLOA 5A94A 3W25A 4KH2A 1E15A 1JFXA 1HKMA 4JCMA 3ZOAA 3VTRA 4EANA 1GCYA 4P8XA 8A3HA 4UOQA 3AS3A 1VJSA 5D8WA 1ECEA 5A3HA 2J7CA 1XH1A 1KCLA 5TD4A 3VINA 2WBGA 4CD8A 1HJQA 5BRPA 2QPSA 1VENA 3AQUA 2E0PA 2XGIA 2WVUA 4PUDA 3VD9A 4J3WA 1BVZA 2WC3A 4AYSA 1NP0A 2XVKA 2JF6A 1J0JA 3SCUA 1JNDA 1JDDA 5ABFA 2VRQA 3ARQA 1UZ4A 1W3HA 4D6DA 2XVPA 3PHAA 4QP0A 1VF8A 2V5CA 2WANA 4CN1A 3KE0A 4XB3A 2D22A 3CZKA 2J78A 2OWWA 2BY2A 3VD5A 1TG7A 1EDGA 1JZ6A 1VIWA 1G0CA 3OGRA 1VEMA 1E70M 5E70A 3FAXA 3SCRA 1HP4A 1QNRA 3IANA 5A2AA 3CUFA 3L4ZA 1ISXA 4MTVA 4MB4A 2FDMA 3VILA 1WNOA 2W61A 4D72A 4P7NA 4UZUA 2XM2A 4D1JA 1V3LA 1CGXA 1OGGA 3VM7A 3SCTA 1H09A 4CU8A 1BLIA 3RILA 4NRRA 1CLVA 1HP5A 3SCQA 4CD7A 3WF0A 3WDJA 2VNCA 3WFZA 1J9YA 4R5EA 1HKJA 1V6YA 3VOCA 1E5NA 1H0GA 4W89A 4GINA 1IZKA 1OGSA 2WK2A 1FOBA 5C70A 4GO8A 2ZUVA 4GZJA 2RGLA 5JBEA 2WNWA 5DFAA 1AMYA 3VIJA 2VVNA 1WCGA 3AMKA 3ZQ9A 5E6ZA 1EDTA 3O9NA 2BFGA 2DT1A 4TVUA 3WMSA 1XCXA 2AAAA 1G94A 3ALFA 1QOXA 2V38A 5AY7A 4B9ZA 2JEQA 2WXDM 4RE4A 4AIUA 2X8RA 4AXNA 4P7LA 1UD6A 4XUYA 1DHKA 1WAWA 4HOWA 1W3JA 1E6ZA 4HZ6A 3W81A 3GH4A 3WNKA 1C91A 1TR1A 1OT1A 3PZVA 1MQRA 1E6XM 3NSXA 3BGAA 4AEFA 3BH4A 1HT6A 2XVNA 2VJXA 3WD4A 4KWUA 1SFSA 2EPLX 3NDZA 3CZ8A 4XZWA 2J7FA 1VAHA 3K8KA 1NOUA 1KCKA 2FHFA 3W27A 1G1YA 4JCLA 2E9BA 2VZSA 3WH9A 3L4VA 2EO7A 4Z2GA 1VFMA 2W92A 3PZQA 4BQ3A 2BY1A 3CHEA 3CH9A 1B0IA 3L2LA 3VNZA 5IHSA 2V3DA 2ZXAA 2EJ1A 4HOXA 5A6KA 1JF5A 4D6JA 5CPSA 1R87A 4CD5A 1CGTA 2XJ7A 1J0ZA 1I1WA 4F8XA 2W91A 2X0YA 4Z2JA 3PN8A 1CGWA 1QVBA 1V03A 1QNPA 4JHZA 1ISYA 3K1DA 3II1A 1W2PA 2DDXA 1QI3A 2D2OA 4E8CA 2FGZA 3BAWA 1PBGA 3EYPA 3WIJA 1JYNA 1JDCA 4LYPA 1LWJA 5A6AA 4WSKA 3UG4A 3AHXA 1V3JA 4W5UA 1UOKA 1HXJA 6A3HA 1W9BM 1MW1A 3BAJA 3LPOA 2EPKX 2OYMA 2YDSA 2XVGA 1QBAA 2PBOA 1BFNA 5C71A 4Q22A 4GIAA 3WL0A 2CITA 2G8ZA 3WKZA 3T0DA 2XSBA 1JYVA 5A2CA 2OYKA 3A4WA 1HNYA 4U31A 1L8NA 3BMWA 4DM1A 3A6OA 1GOKA 1BYAA 2DPEA 2VRJA 3TONA 2XIIA 4UFMA 3D5HA 4NF7A 1BAGA 1CGVA 2X2YA 4F79A 3HN3A 3MV01 2CKSA 1UUQA 4MAZA 4UZSA 3AHYA 3N15A 4PBGA 4D71A 4H41A 4W87A 5I24A 4TUFA 2C7FA 1FFQA 1W32A 1X6LA 1PJ9A 1V3HA 3EMZA 1NARA 1H11A 2FHCA 4MNKA 1HF6A 3CUJA 5IXEA 4N0RA 2WHMA 1C8YA 3CLWA 8CGTA 2CHNA 2ZUSA 4Z2IA 3N04A 5DT5A 2WYSA 3BXWA 2WWDA 3GXDA 3VPLA 3AXXA 3OZPA 1VFUA 2VMFA 5IDIA 5M5DA 4GI6A 1OT2A 1MW0A 3THDA 1IZJA 5A1AA 1QI4A 3QHMA 5LA2A 1ISZA 1H1NA 3WFLA 3WL1A 4A3HA 2CNCA 1LQ0A 4HZ8A 3ZJ6A 3VVGA 3IJ9A 3L4UA 4H8HA 4J3XA 3QGVA 2GDUA 3WNMA 3PZMA 4UFKA 3OB8A 2DQXA 1XYFA 2WMFA 3N1AA 5A8NA 1JYXA 3SIMA 3AICA 1M53A 4HMEA 1JI1A 3CIVA 1XSJA 1JI2A 3U5UA 1OD0A 4GZIA 3WMBA 4V27A 4HPHA 3I3EA 1XH2A 4QCEA 1J01A 1UYQA 3AMGA 2XSAA 1QBBA 1EQPA 1HKKA 4ZE4A 1GW1A 1OM0A 5M03A 4ZENA 2UY4A 2HVMA 2GJPA 5A6BD 2WMJA 3EDDA 1W9PA 2XHYA 1K9TA 4E2OA 1I1XA 1GJUA 5D9OA 1KR0A 2AMGA 4PN2A 1ISWA 3AIUA 2J79A 3TTSA 1HJWA 4GQQA 3BAKA 5LA0A 1XGZA 1UR0A 3VIFA 2ZUTA 1W2VA 4CD4A 2WMIA 3ARXA 1EHNA 4L4OA 2BS9A 2RGMA 1ZBCA 3I3BA 5I78A 2PWFA 3HU7A 3LMYA 1AVAA 1NWRA 1EXPA 4MNMA 5HBFA 3GZAA 2IUZA 4OBSA 1JYWA 4W8LA 2WMGA 3PZTA 5I0DA 4E8DA 4K68A 1LG1A 2G41A 4UCFA 2ZX6A 5HDRA 3CZLA 2ZIDA 4IUGA 5ABHA 1JZ2A 1PX4A 1MW3A 1YQ2A 5CPQA 3MUAA 3WDHA 3F5LA 4JKKA 4U5IA 1E6PA 3PZ9A 3OBAA 5AYBA 5FL0A 6CGTA 2XPKA 4JFWA 2JF7A 1MW2A 4D6EA 2ZOXA 2VCAA 1HJXA 4MDPA 3PZUA 2GFTA 1J11A 1V6VA 4PMNA 4XX6A 4MNLA 1CGYA 3WQ8A 2J62A 3AHZA 1UWIA 2ZUUA 4Z2KA 2WZIA 3AIBA 4RE3A 3FNDA 2WC4A 1QW9A 2YDQA 3IK2A 4M8UA 2PWGA 3SCSA 3N18A 3BSGA 3B9EA 3ZO9A 3PZOA 1LLOA 2D3LA 3GNOA 1R7AA 3WQ4A 1E6QM 3WUGA 4TVCA 3OG2A 3AS1A 3FW6A 1JZ7A 1DWFM 1R8LA 2C0HA 4QLJA 4YHEA 1BSIA 4M56A 3DHUA 3U7BA 2D0GA 1QHPA 3T0BA 1LL4A 2QF8A 3BAIA 1CXLA 1GVIA 4PMDA 1CTNA 1GVYA 5BCAA 1BF2A 2XWEA 1PX8A 5EMYA 4EAMA 2X1IA 1Q6FA 2VX7A 1YHTA 3ARSA 5A6BA 2A3EA 1W1TA 3POCA 4FLSA 2WHKA 1E6NA 2WW5A 1MFUA 3ARZA 4UOJA 3CHDA 1W9VA 1H0IA 2CHOA 4JZ5A 3TA9A 1C92A 4W86A 1OWQA 1ZBVA 1DTUA 3M46A 3AZSA 2WMKA 4H8VA 1M01A 3N17A 2UWFA 3WH5A 1UQZA 4X0NA 2CIPA 1GOOA 1J18A 2WCSA 3O2LA 4HU8A 2PWHA 2W62A 2XM1A 2JE8A 4W93A 2WBKA 5HOSA 4OKDA 2VR5A 4U3CA 4BQ5A 5KEZA 1JGIA 4IISA 3CTTA 1EOMA 3LPGA 1OB0A 1HVXA 1CNVA 4OBRA 4UFHA 4HTYA 1EO7A 1OCQA 2JIEA 4FLRA 5I6SA 2CBUA 1NP2A 3AZRA 2F61A 4UQAA 4FF5A 1UKPA 2JEPA 5AC4A 4ZXOA 4N42A 4CCDA 3TOPA 4CUCA 2NT0A 7TAAA 4AZ5A 3JUGA 4MADA 4M81A 4OIFA 2ZUMA 5FCZA 1D2KA 2WVVB 1E6RA 1JF6A 4TX8A 4J3UA 1CXIA 4C7GA 5A6JA 1GOQA 1A47A 3U5YA 4WKAA 1E55A 2ZX5A 4PTXA 1ITXA 3K4DA 2YA0A 5CGMA 1C93A 4UQ9A 4R27A 1UH4A 3EDEA 4HP5A 3NSMA 1E73M 4B9YA 1DEDA 1JZ8A 1VRXA 1HIZA 4ATDA 1J12A 2D23A 2PWEA 1W9UA 1C8XA 2XTKA 3BSHA 3NCOA 2GJRA 4MAVA 2OWXA 4OJYA 3WD1A 2WSKA 4JFTA 2A3AA 4EKJA 3MSGA 2BV9A 4LYQA 1P6WA 3VMPA 1X1NA 3QR3A 7A3HA 3BLKA 3NIYA 2F8QA 3AIVA 5JIWA 5GNZA 1EA9C 4DUVA 4J28A 1E4NA 5ECUA 3WNLA 4DM2A 1JDAA 1PX3A 4QCFA 3ZJ8A 1GNXA 1NWUA 3OLGA 2OSXA 2DIJA 1LL7A 2QLYA 1WPCA 1ZL1A 1UWRA 1TVNA 1U2YA 5FD0A 2W66A 3WD0A 4W88A 2X09A 3VX0A 2J7GA 1ZS2A 2G4FA 3PBGA 1ISVA 3EMQA 3WEZA 1V02E 5A8QA 3A3HA 1WZAA 1H5VA 4J3SA 3OGSA 4HU0A 3AXIA 1KB3A 4QLLA 1IV8A 3GXFA 3VGGA 5CSYA 3UR8A 2Y4SA 3B9DA 5A95A 2Z1KA 4ZFMA 4ATWA 5A8OA 4EE9A 2YL5A 3TTQA 4LQ1A 4RE2A 1E40A 3CUHA 5M3WA 1JIBA 2ZICA 4W7WA 4D6GA 1QI5A 1QNSA 1KBKA 1XHGA 4LYRA 1JXKA 3RDKA 3WF4A 1RP8A 3K4AA 1TCMA 1UWSA 3DC0A 1K9EA 1WZKA 1KXVA 2E9LA 1E0WA
chains in the Genus database with same CATH superfamily
2C6QA 2GUYA 1KA9F 4WXZA 5CLTA 4LW7A 3LI1A 1HQTA 3NDYA 4XIMA 2ZZ5A 3ZT6A 2Z2AA 4BQ2A 1FXQA 1L6SA 3S5NA 2QJIA 4J9JA 2BLEA 3CUZA 3LG3A 4I9TA 1HJSA 3BW2A 4JIEA 5DELA 5I3DA 3K5XA 3UD6A 3TYDA 3D6NA 1H2JA 3R25A 3H70A 2FYMA 3STGA 3W7LA 4J3TA 3LHWA 4E2VA 3LX9A 3IVTA 3NL6A 5A69A 3MUY1 2ALDA 3HV9A 1DWJM 3ANVA 1UASA 3ZT5A 1V0MA 2WHJA 4RNHA 4JKMA 2Z24A 4JX4A 4C1NB 5I09A 2E7FA 4PTMA 2HJPA 3TP4A 5E0FA 1GEHA 2PDBA 1TJRA 3RPTA 3P61A 3W22A 1VFHA 3CZGA 2GVEA 3CQHA 4HGXA 4L61A 3RU6A 3THCA 2J7BA 1IR2A 2BP1A 3DKJA 3PZIA 1GJWA 2Y1HA 2VX4A 4KFPA 1JL8A 3RJYA 1C3FA 1PDYA 1MQQA 4KGJA 4LCQA 1SJCA 4Z1DA 4NJJA 3BCDA 3AMLA 3KUMA 4WCJA 3SRHA 3TK7A 1FWHC 2I9UA 1S2WA 3W38A 1UW9A 2FZ9A 1ZY9A 2WKJA 1HUVA 1PCWA 1B3WA 1DJGA 1T41A 3A5FA 3FJ6A 4MMWA 3UA3A 1GWJA 1GPFA 3AS0A 2VGGA 2GJXB 3CBWA 3WDQA 4TX9A 1TZ9A 1M03A 2NQZA 2QJMA 1HFBA 2QCHA 1US0A 2A3BA 3AS2A 1QHZA 2CZVA 3VKCA 2JGQA 4KIEA 3ARVA 5AHFA 2YCKX 1EEPA 2PEVA 1M04A 2VELA 4IGNA 1LBMA 3GHTA 3PUEA 4ZSUA 1YNYA 1B2YA 3ZLHA 3SGUA 4JS3A 1TFVA 3IPWA 4P8VA 2OSYA 3FJLA 4LC6A 4Q4OA 3CZJA 5JBFA 3CMGA 3PWIA 3KOWA 4DXXA 5CZJA 4O57A 2IMRA 5D2YA 1EGMA 3TN4A 2PU1A 4C5YA 4DY1A 4JN7A 4HVXA 3IWPA 5E9AA 2HQAA 3KVMA 2E3ZA 2E5BA 1R85A 1ZJAA 1KM2A 3WBXA 4DJED 3QY8A 1G01A 3VZZA 3HPSA 2NXIA 4KCVA 1KBLA 4DWSB 3BGGA 4V28A 4EF8A 3NOEA 4HA3A 5M2FX 1D3HA 2ZRUA 2Z4GA 3S2NA 3TNOA 3NL5A 4I5RA 3HIJA 4UNIA 3NA8A 3GX9A 4PMOA 3W82A 4FOJA 2YKKA 5F2IA 4J2MA 3BAYA 3H4WA 4CQBA 1T8QA 1KFWA 2RHGA 5JU6A 4PCSA 1V3MA 4AC1X 1QRQA 4JTKA 4FXJA 3NUKA 2Z2BA 4GKTA 1MEIA 5G2HA 3FJNA 3NWRA 2IXVA 3UZJA 3T8QA 2UY5A 1A5SA 4I5UA 1W5NA 4IQDA 1WX0A 3GNXA 3P5ZA 4FB7A 3AOFA 1L8PA 4AD5A 5HQLA 1MWOA 4F0HA 3T44A 1KBIA 5F2LA 3M0ZA 2Y6ZA 2CZFA 1FRBA 3WUFA 3W88A 1AQFA 2ZVRA 1WO2A 3BOXA 3F7JA 2I56A 1BYDA 3FYPA 5C5YA 3TR9A 1Q8AA 2PDLA 1Q7QA 4NASA 3L0KA 3BMVA 3WBWA 1OYBA 1KV5A 3NQDA 4REQA 2D1ZA 3SCWA 4XQ6A 4IIDA 4PB3A 4B92A 4YTSA 3NQEA 4O0QA 1UD2A 2H8ZA 1FWNA 2Y2WA 4NG3A 1SGJA 3F4WA 2WLZA 1QXLA 3MV11 1FH7A 5KINA 2WVVA 4LXFA 1HTIA 5C9WA 3NQAA 3AMDA 4NZJA 2G3FA 4RJEA 3KBWA 4RPQA 3WF3A 3VZYA 4C6EA 4NYUA 3NQ2A 1QNQA 3GNDA 4GVHA 2J7EA 3FV9A 5EB8A 3SM0A 2VCCA 4URIA 3OLEA 5ENLA 1CXHA 1IXQA 3OIHA 1DQUA 1S3TC 1YMYA 3U2CA 4MY9A 3AJXA 4NZ3A 1BGGA 2VENA 4BWLC 1GQKA 3RLVA 1NQ6A 4IPNB 1UZ1A 4AZGA 1KC7A 2E9MA 3CMJA 1SMDA 3L0NA 4XZLX 3O6DA 4PODA 4QDWA 2XSXA 4PCNA 2ZC1A 4NQ1A 4XZ9A 2CBJA 3AXKA 2PUZA 2OXNA 4F0RA 3APGA 2OYLA 1POJA 2G95A 5F4XA 3QXBA 1KM5A 4BF9A 3UR2A 3FAWA 3AZTA 5TF0A 3NQ7A 4AD0A 1F74A 4M6QA 2XGBA 5LHEA 3JZEA 1XIFA 1H7XA 2WZEA 3APYA 1P5BA 2OZ0A 1EDQA 2ZXDA 3WMCA 4Q4SA 3E38A 2YBUA 2ZDRA 3H26A 2INFA 3EX6A 2FZ8A 2Y24A 3VD7A 4ALDA 3GNNA 4AXKA 1CXEA 1SR9A 2PODA 1EIBA 3ZVHB 2GDVA 1MXDA 1D3GA 1N7KA 5IDZA 1XPYA 2Y63A 3QQ0A 1FP9A 2OWCA 1GYMA 1AJZA 1XPGA 4AHOA 3BJTA 4MNJA 1B31A 4LVAA 3WUEA 4TTGA 3T7VA 3O6YX 1EL3A 5LGZA 4S3AA 1ELSA 3RO8A 3DZ1A 3UEQA 4XISA 4WK9A 2RFGA 2V3EA 1JD9A 3RLUA 4Q3MA 2C18A 4OV9A 4DQWA 1R3VA 5CC6A 2I5IA 3TJLA 5MHBA 4ACZA 2E1WA 1KM4A 2HVOA 3PPCA 3VO0A 1KWGA 3T42A 4PRRA 2WCGA 3KLKA 3N2TA 2A4AA 4O11A 1XRSA 5GNXA 2DSKA 1R46A 5BRQA 5MKGA 1E71M 5E9XA 3MKKA 4P2VA 4HK7A 1P43A 4FX7A 3IGSA 1O6IA 1TREA 4MY8A 3P2VA 4WKHA 1Z32X 3NZPA 4O19A 1Q3NA 2XVLA 3WLPA 3NURA 3H2CA 2NT1A 3RG6A 5HPCA 3V7PA 4PCPA 3ZWSA 5BWAA 2XZ9A 1BWLA 4FOUA 1V6WA 1XL9A 4GIEA 3AFBA 2Q01A 4WDTA 1DWHM 2W0UA 1V93A 3QHNA 1FH9A 4I3GA 4D6FA 4XZMX 3C3NA 1QO5A 1FDYA 3UW6A 4GBUA 4US6A 2OKTA 4JGDA 1E1FA 2HWGA 3PTDA 3PK7A 3PTQA 4JHMA 4ZZ9A 4PSRA 3EKLA 3SY8A 3PC0A 1LTDA 5A8PA 1R7OA 2H9AB 3UBPC 3HMCA 1AQHA 3GH7A 1DV7A 4HZ7A 3WNPA 4H8UA 1V6XA 3T2PA 4KPLA 2ZWYA 1C8QA 4DNMA 4EPEC 4QAWA 1EC9A 4L4LA 4FI4A 1KM3A 4NXKA 1IEVA 5JQ9A 3AMCA 1M9HA 4TTUA 2VQUA 4X63A 1H7OA 2YDRA 4R33A 3DGRA 4FLQA 4QJ4B 5D9PA 1S46A 3T55A 3KL0A 3BGJA 3W28A 1C7SA 2V5JA 2DSZA 1PCKA 4YTTA 1TIWA 3W7CA 1NIUA 4PMJA 1YPFA 5L9FA 3C56A 3WSUA 1YXYA 5C9ZA 2J77A 3AI0A 3GKFA 4J27A 3SCNA 2I14A 3KTCA 3WQVA 2YDAA 3VGFA 4AYGA 3LXAA 1FBAA 3T78A 3FEQA 1Q6DA 4GXPA 4QE1A 4YHGA 2FFCA 3CAKA 1JEZA 1Q6GA 3QGKC 1B3OA 3RF9A 2XUCA 5CJ5A 4PCTA 2XN2A 2G96A 2DVUA 4F48A 4HPJA 3WDPP 3ZVIA 4K36A 4GBDA 1EHAA 3CHCA 5FA5A 3RIKA 3BQ5A 4EF9A 4QNWA 3WQFA 4H7VA 3MPGA 4V2XA 2WMHA 1WBJA 4HCHA 1BVWA 2HXUA 1U33A 3N13A 3OZMA 3EOEA 4MWAA 4DF2A 1SYTA 3K30A 3IVUA 2FGBA 4IGHA 4K7YA 2QJJA 2OLHA 1C7TA 3FXYA 3TXZA 4DYEA 1IT0A 4GMEA 2CPUA 1FWJC 3AAMA 1OFOA 2AKZA 4M80A 3DOPA 5MF5A 2XFWA 3BDKA 3NPVA 3GS6A 2D2HA 3WEOA 1F7BA 4FS9A 2W63A 2QAFA 3PPGA 1JZ5A 3HV8A 4QR6A 3QTGA 3ITVA 2V68A 5J8LA 4JL1A 2HSAA 2AL2B 3F2BA 3WNOA 4B15A 4I6KA 2GGGA 3W07A 2TAAA 1TV7A 4GI8A 4NJGA 1TPC1 3ITGA 5FOOA 3OLIA 1H51A 1K8XA 2ASHA 1GZJA 3DFNA 1QTWA 5D04C 3H4GA 3GU2A 4IFKA 3BZJA 4Q8TA 3GIPA 4L7ZA 5D2XA 1TX2A 1PKNA 1EJ7L 3KRBA 2Q02A 2Y7DA 3W0KA 5IFPA 2ZXQA 3FSTA 2QUMA 3VD3A 2A85A 1YX1A 5EGRA 3RLHA 4CCEA 5C0QA 1JJKA 4OVXA 2B31A 1LUCB 1MNZA 2WKGA 3BLLA 3IIPA 1A5AA 4GUHA 5JUVA 5HULA 5XIAA 4BI7A 4IZGA 1MNSA 1MXGA 3WENA 1CIUA 4AX7A 1J0HA 3TX9A 3GAKA 1SR0A 1RY0A 2HBVA 1HKIA 2IPWA 3GDTA 1XIHA 1GJPA 5I00A 3WJYA 2J47A 1VQTA 5LIXX 2W5FA 1PIIA 2AKMA 5FAGA 3ZMRA 1XIJA 3I7RA 4WUIA 3TYEA 3V0SA 1OADA 2A6NA 3LLDA 1R86A 2D20A 3S2MA 4AW7A 4ADTA 4MKSA 3VX1A 4ADSA 4A8IA 4MJ4A 2YCIX 5DMLA 2QCDA 1QASA 2DJXA 3V36A 2RH9A 4MY1A 3AIWA 5I07A 3T81A 4QG8A 1GVSA 1FTXA 4GK8A 4C60A 4DWSC 2C16A 3ARTA 3F5JA 3BVJA 1GHRA 4X9YA 2B81A 1EO5A 4JKLA 4KGLA 3WQ5A 2E40A 2JGYA 3NPXA 3P82A 4WKFA 4DO6A 3I68A 3NGFA 4KBXA 5FKYA 3OYZA 1MSSA 1GVRA 1Z41A 1UR4A 1TPDA 3EWZA 1H1ZA 4FNRA 1HVQA 4C6BA 3DUGA 2VC9A 4NRSA 5CQ1A 3B8DA 3SRFA 3VD4A 1LT8A 2VCBA 3L65A 1WDRA 4M6PA 4S3KA 1K7EA 2YL8A 1YDOA 4I8DA 3STEA 1O12A 4JDBA 4MOZA 3FYOA 5LGXA 4E0CA 3DFHA 3BSMA 1EZWA 4AD3A 1WXZA 3GXIA 1HKMA 1P48A 4JCMA 4ZQNA 5AKQA 3MKVA 1GCYA 5D8WA 3WLQA 2XIQA 1XH1A 3BW3A 1R9YA 3DI0A 1LOQA 3M47A 1UC4A 5BRPA 3LHVA 2VFGA 1W37A 3W1TA 4L9YA 3UJRA 2GZXA 3AQUA 2E0PA 3UPMA 3VD9A 2CLEA 4J3WA 3LTYA 2WC3A 4J1OA 4XZHA 2JF6A 3SCUA 1JDDA 3TQ0A 5ABFA 2VR2A 4RNJA 4D6DA 4LUSB 3W7MA 3MO7A 4F0SA 2OZ8A 2V5CA 2ZTJA 3QLDA 3W1XA 4GXMA 3W1AA 3R7MA 1FHVA 1FVPA 3WLRA 4A8LA 2OLSA 3KE0A 5C7VA 2QT3A 2D22A 2OWWA 4XK2A 1C29A 3LYEA 2RAGA 5LIKX 1SJAA 1TG7A 1EDGA 1ONRA 1L9WA 1M5WA 3PWAA 1DIOA 3OVPA 4NZ4A 3OGRA 5KZDA 5E70A 4ERGA 2GOKA 1KCXA 4ZCWA 1HP4A 4M0XA 1XRFA 3NTYA 3G1HA 3M5XA 4B91A 1XKJA 1TX0A 2OX1A 3HB9A 3L4ZA 4MTVA 1WNOA 4D72A 1X8CA 3B06A 3RPDA 4D1JA 2HNEA 2YR1A 3TE9A 3A23A 3SCTA 4CU8A 4NRRA 1VHNA 3TTEA 3M0XA 3WDJA 1SW0A 5EYWA 1R3YA 5EU9A 3O15A 1KKRA 1TRIA 4PB4A 4AHPA 4GINA 4B5TA 2HRWA 4XAZA 4JTEA 5LIYX 3S1UA 2WZMA 5C70A 4GO8A 3G18A 3U8GA 4N9BA 2QCMA 1WCGA 3UA4A 5E93A 1R3QA 2R91A 4TVUA 4S3FA 3DERA 3WMSA 2FTYA 2V38A 5AY7A 4B9ZA 4S3CA 2WXDM 4AIUA 1UD6A 3UCCA 5XINA 3CTLA 2VP8A 4IMDA 4S1FA 4XUYA 1DHKA 3L68A 1E6ZA 1RZMA 3FDKA 4XAPA 2E67A 3WNKA 4FX8A 6XIAA 5D30A 4DBEA 1W1ZA 4C1KA 3B0XA 1HT6A 5CEWA 2VJXA 4KWUA 2EPLX 4E2BA 2CU0A 1Q7MA 2J7FA 4XZWA 3K8KA 1G1YA 4JCLA 1TTQA 3L4VA 1PTGA 1M7JA 3BOLA 2C3ZA 3G1XA 1B0IA 3L2LA 5IHSA 5FJUA 2V3DA 4HCLA 5A6KA 4D6JA 2ZA3A 4JOMA 3BV4A 1P7TA 1IR1A 4EPBC 4MGGA 3CV6A 8XIMA 3KCOA 3H12A 4O8AA 3VOHA 4MLRA 3PN8A 1QVBA 4DVOA 1NY1A 4K38A 1ISYA 4C6NA 3PULA 2D2OA 3BAWA 1F3WA 3EYPA 2V8ZA 1TMLA 2D2JA 4DF0A 5A6AA 3BG5A 4W5UA 1RLDA 2GQ8A 4JTJA 2V6AA 3EEGA 2HE8A 1HXJA 3UWZA 6A3HA 2QIIA 2E5CA 4GIRA 4HHLA 4GUIA 3CAWA 3PUDA 3OBKA 4IHCA 4QJ5B 2XVGA 3W7RA 1QBAA 4F4RA 5IOBA 1KLYA 3KOZA 4Q22A 1WXJA 2NV2A 1QOPA 1XLBA 2CITA 3WKZA 2O7QA 3Q2DA 3LENA 3A3WA 1IWPA 3UXAA 3A6OA 2QEZA 3NZ1A 5H6HA 2VRJA 4QEHA 1J5TA 4NF7A 1BAGA 3GDLA 2CKSA 4A3UA 3B03A 2C91A 5B80A 3RCYA 4D71A 1XQKA 4KETA 1JPMA 5I24A 3KBSA 2EJAA 4TUFA 3UXKA 4EAYA 1PJ9A 3R1ZA 3E12A 1H11A 1E0TA 3G8EA 1HF6A 3GR4A 5AZ1A 1WDDA 3MP4A 3W75A 4O1AA 2WHMA 3RXZA 3CLWA 4S39A 1Z44A 5DT5A 3BXWA 3LDVA 3MC5A 5CAHA 4RDWA 4K37A 3VC5A 4GI6A 1MW0A 5A1AA 2NLYA 3LERA 3H2EA 4PCFA 1EJRC 4YTUA 4HZ8A 2VDHA 3VVGA 1K8YA 3L4UA 1MI3A 1UBPC 4J3XA 3QGVA 2GDUA 2PDYA 3C5QA 3WNMA 1EJSC 1GVFA 2WMFA 3LXBA 2BODX 5AYYA 1IGSA 4K1WA 2QGHA 3S2JA 3E0VA 1JI1A 3CIVA 1XSJA 1GVOA 2Y8UA 3MCOA 4HPHA 1QWGA 4IH3A 4QCEA 3VNLA 1J01A 3L2IA 3WZ0E 4JY8A 1QBBA 1EQPA 2NUWA 1GW1A 1VFTA 1OM0A 3GUWA 3RO6A 2Y5SA 3ZYZA 3USBA 5M03A 1XIMA 2HVMA 4Y96A 3RFAA 3KBNA 4UNLA 1YW1A 3G24A 3V16A 2BVWA 1GJUA 1ISWA 1PUDA 3KHDA 4JTIA 3S5ZA 3OBEA 3ZFHA 1H1YA 1HJWA 1XGZA 3MUCA 3TSMA 4CD4A 3ARXA 4OT7A 1EHNA 1FWRA 1FWFC 2J6XA 4C6DA 1K6WA 1AVAA 1NWRA 1I4NA 1EXPA 1U5HA 1U1UA 1NTHA 4YWSA 1EJVC 3S4TA 3GZAA 2IUZA 4Q33A 1JYWA 3CEUA 2PTXA 1T99A 2QR6A 2WMGA 1F2JA 4K68A 3KDNA 3M0YA 1A5MC 4MJZA 1SM9A 2ZIDA 5ABHA 2OO0A 1JZ2A 2CWXA 1PHWA 2L5HA 3KX6A 5EY5A 1DPMA 3KM8A 4AVOA 4JXCA 1EC8A 4FA3A 4GNJA 2OOFA 2PTDA 6CGTA 1G69A 4UXDA 1Z7AA 3OVGA 2PGRA 4GY7A 3W7HA 1JQXA 2JF7A 1MW2A 3LD5A 1TMHA 4GUGA 2VCAA 3LGGA 1DQXA 4MDPA 1NAL1 1J11A 1MZHA 3IJDA 3C2VA 2BDQA 1N8IA 1CGYA 1TZZA 4FX6M 3B05A 2GVGA 1FWCC 3TUUA 3V5CA 1V6TA 4Z2KA 2WZIA 1B54A 1ONEA 1QW9A 2YDQA 3IK2A 2ALRA 3B9EA 1RUSA 3PANA 3PZOA 5BMXA 1R7AA 5TAOA 1FWTA 4B5WA 1KRMA 3UJEA 3E2RA 3AS1A 3FW6A 3STFA 1DWFM 3TSBA 1R8LA 1Y8BA 1AW5A 3H2AA 1BSIA 4UTUA 2PE4A 6REQB 2PP3A 2YCLB 4JQ1A 3BAIA 1RV8A 3NZQA 1SW7A 1GVYA 2XWEA 1S39A 1PX8A 3RGTA 5EMYA 2HPMA 3I4EA 4KESA 4I7VA 4WXYA 3OZYA 4BHYA 4C6IA 1I2PA 2VX7A 1YHTA 1TB3A 2DY3A 4Z1YA 1S1PA 5A6BA 5DXXA 3VZXA 3POCA 3LEPA 4DO4A 1E6NA 1MFUA 1Q45A 4UOJA 1OC7A 1TVLA 3HO8A 4NZ5A 4H6EA 4C6PA 1EB3A 1H0IA 1Q2SA 2WJDA 4JZ5A 1R9ZA 3U4AA 3C0QA 3PNUA 1OWQA 1K03A 1ZBVA 4A21A 1DTUA 3N4EA 3HG5A 2YXOA 4Q4KA 2CLKA 2V67A 2UWFA 1TKKA 2YZ5A 2NX9A 4R53A 4MFDA 2GPTA 3B04A 1THFD 4LY8A 3LTSA 2A6LA 3ABQA 2XM1A 3V0UA 4W93A 2WBKA 2E1DA 5HOSA 2VR5A 1VH7A 4BQ5A 2UBPC 4WY0B 5CBIA 2PTWA 1JCMP 1SZNA 2EG8A 3CTTA 4BI5A 3ITOA 4NNBA 1RBAA 1CNVA 4UFHA 3EOOA 4B5XA 4ZGYA 2G50A 2X16A 3S1GA 1PO9A 5C9UA 3H8AA 2F61A 4UQAA 3EXSA 1AH0A 1SO4A 4CCDA 4CUCA 2NT0A 3HBLA 4DBUA 3KCLA 4TIMA 1VPQA 1KCZA 5FCZA 1D2KA 3IGHX 1E6RA 3UPWA 4J3UA 3E6EA 4C7GA 1GOQA 1A47A 2ZX5A 4PTXA 3KS6A 9XIMA 3K4DA 2YA0A 4MZ1A 3GKAA 3ZLGA 1R3WA 3N29A 2RDUA 4DO7A 1NQKA 1ZCOA 4GC4A 1MEHA 3D3FA 3W1MA 2VFHA 4K8EA 3BSHA 4WVXA 1ZHAA 4CEXC 1UIPA 3DHFA 2GJRA 4MAVA 4CNOA 4ZO7A 3S3GA 2OWXA 2ZVIA 4OJYA 4RNFA 2WSKA 1KRCC 1PS9A 1AUSL 4EKJA 1XM3A 2OU4A 3WQCA 3A5VA 1IXOA 4RDVA 7A3HA 3S1VA 5D09A 1R3SA 3B8IA 1E4NA 4XD6A 3BMXA 2NUYA 3GTXA 1K7XA 3SRDA 3WNLA 4DM2A 5K9CA 4QCFA 1S2VA 1NWUA 3OLGA 2OSXA 1T8XA 1TO3A 2OJPA 3S9IA 4KFOA 1R9XA 2VC6A 1M3UA 1TVNA 3VX0A 2DP3A 2G4FA 3LRKA 4IIFA 4FSAA 3PBGA 1ISVA 1Q65A 3W7EA 2R1KA 3LLFA 3OVRA 1E9YB 2YCEA 2F9RA 1ICPA 5C55A 4WD0A 4X61A 5A95A 1V4YA 1E40A 3BWWA 3CUHA 3TN3A 5M3WA 1JIBA 4W7WA 1QI5A 1QNSA 1KBKA 4GHRA 1Z8AA 1K9EA 2EG6A 8RUCA 3U0HA 1UPPA 2NUXA 2VL4A 4Q7NA 3UJSA 3A9BA 4DRSA 1Q7ZA 4K3ZA 2OGYA 3OYXA 4UFLA 3FK4A 2OOGA 3GB6A 1RCXB 2WSQA 4BS0A 1XICA 4UWMA 1RK5A 4NU7A 1QR7A 1RH9A 5H91A 1LLZA 4ILSA 2D73A 4BFAA 1J0KA 4HYVA 1YDNA 3PFMA 4ZA0A 4I8YA 2J8TA 1GYNA 4TR9A 3T08A 5B7ZA 3G22A 1W5QA 3UWVA 4JTQA 5A5WA 3TWAA 5E09A 1I2NA 5HWMA 4CGTA 3OP2A 1NDVA 4IP7A 1B30A 3CIXA 3ZSTA 2BGQA 3B8TA 1TV3A 3CIWA 4EPKA 4AZCB 1ZB5A 3WJSA 2BXVA 1UQYA 5A6LA 3SECA 1OCBA 1ZU8A 4S3BA 3B97A 1F61A 3LBMA 4X0VA 3GBEA 1B3VA 2FMOA 1VBRA 2D0HA 3CB8A 3KOFA 3VMNA 2ZXBA 4NAEB 1H7WA 3TJ4A 4RZ6A 3NO5A 4U4MA 1RA0A 3AYRA 2A2IA 4H2HA 1TUXA 3NQFA 1OK4A 3FA3A 3GYCA 4FAMA 3KL3A 4ZQPA 1K7FA 2F84A 3TCEA 1X6NA 1AZ2A 3BCFA 2EPMX 3NM1A 2EXOA 2EEXA 2JIWA 5HMSA 4A22A 3ZS4A 3H2FA 5FJPA 1GG1A 2BSLA 3TDFA 1W17A 3G1DA 1XFBA 2QVHA 2C71A 1VGAA 3WD2A 2REQA 1Z89A 3OVQA 3TMLA 3GNRA 1CECA 3WH8A 1R6WA 1TV2A 2TODA 3ANYA 2BWGA 4PTNA 2BHUA 1EA0A 4K6AA 2OLAA 1Y0EA 4G1NA 3BG3A 3DFPA 4GUJA 1XIDA 3VYLA 4GI9A 4RCXA 1A80A 1XX1A 1XD1A 4ZTYA 3ARWA 3PR2A 3ISIX 5I79A 4MUPA 2ZRWA 3WMLA 2BVYA 1US3A 1CWYA 1EUAA 1Y5VA 3GQYA 5BYWA 3W2KA 3M4HA 4FIRA 1EJUC 3VU2A 2PF0A 3PB2A 4RL3A 5AYIA 1R0MA 3MUZ1 2ACRA 2A3LA 1PZ2A 4AB4A 3LNPA 1UP3A 3W6YA 1KFEA 2GK1B 4XZBA 2V2HA 1IGWA 3EOUA 1DHPA 3PF3A 1UWTA 3LSBA 4DWDA 3WUBA 3M0HA 3G0XA 4RZBA 4C6KA 2FFIA 1HKVA 1W9DM 3DH7A 4GVIA 4EVZA 4P5UA 2KZHA 4O1BA 3UCDA 1UR9A 1Q4WA 1YTEA 4LAUA 4F3HA 2WVTA 4AD2A 1EBHA 1F8MA 3GM8A 1ESWA 1W3LA 4BR1A 1ALDA 3A47A 4ORIA 4KEUA 1VEOA 3Q45A 5LYRA 4LT9A 3E0WA 3MU7A 5AHEA 3IJ6A 2ZA1A 1OABA 2ZUWA 1Q4NX 3M5YA 3H2OA 4RZ5A 4L6DA 2E8YA 4A35A 3W6LA 3VM5A 2ZX8A 4ZOAA 5HA7A 1PIGA 3V1HA 3MMDA 1XLMA 3P6LA 4J4KA 3A22A 4PA8A 1BRLA 3BPWA 3RMJA 4F9DA 2CHRA 1U5JA 1ZRQA 4RW3A 3W01A 4AWTA 3GU9A 4G8TA 1GORA 3QOMA 5EL1A 4GY1A 1FH8A 2BVDA 3TLLA 1ME7A 2VURA 3CT7A 4Y6GA 3CC1A 1GYLA 1TA3B 2WHLA 3P8JA 3C8FA 4YL2A 1X1OA 4AU0A 1AG1O 1X7FA 1A3WA 3QH2A 4Z2HA 4KCWA 3R2GA 4ZMGA 3DIPA 2CZDA 2ZZ1A 4W7VA 3OODA 3VNIA 2FJUB 3LCLA 1H3GA 3IEBA 3REQA 2O4MA 1OBAA 1JUEA 1Z48A 1JUBA 1S38A 1W31A 2DH2A 3L12A 3OIXA 3LRLA 3OOQA 3MS8A 3S47A 3AWNA 2ANUA 4ZBCA 2DZTA 4PL2A 3VDAA 4AMCA 4QROA 3F2CA 4IGMA 1XCWA 1B3YA 3EDJA 4HOZA 3QM3A 1ITUA 2YFNA 1KBBA 4U33A 2QMKA 4DJEA 1W1PA 3CMFA 3ZR5A 3T1GA 4W9TA 2VOTA 5IFTA 4D1IA 3DECA 3BARA 3CEPA 4PSPA 1K9FA 3F4VA 3CO8A 4DBDA 3NQMA 4KEZA 2D24A 1XYLA 3XISA 5AC6A 2PWDA 5CJNA 4WJXA 1AJ0A 1WDPA 4PH6A 1FCUA 1X96A 2VX6A 3AHTA 4AZHA 1RP9A 4IJCA 1XSKA 3EWCA 1GUVA 5JH1A 4O0ZA 4ICMA 1R2SA 4DXKA 3M5VA 4NSBA 2OKOA 5ABTA 1UPMB 2Y5EA 4FEZA 1KO0A 2XIBA 2YYTA 4HHMA 2NWRA 3MI3A 3DFTA 3QF0A 5DT7A 4RE0A 4U10A 3CHFA 4LBUA 3F4DA 2G3JA 3CQ0A 1RQHA 3RX3A 4OOUA 3DHPA 3LGDA 4GKLA 3FX4A 5AC5A 2WKLA 4UFIA 5EFFA 3OA3A 3ARYA 4JIRA 5K7JA 1OX6A 1K3UA 5I2UA 4Q8UA 5E0KA 3O0KA 3PTKA 3V5OA 5U7SA 4ADUA 5B7YA 1EX1A 3F4CA 2WWCA 4B4HA 1J0IA 3BW4A 3VK5A 2XISA 3PZNA 2Z29A 1GQIA 3QPZA 2IKGA 3FA4A 1F05A 2PFHA 4Y9OA 4JEQA 5F4SA 5FAJA 4EACA 2POZA 4R88A 4XTDA 3KS5A 6TAAA 2RJHA 5HUPA 3LRMA 1FP8A 3VIIA 4L65A 2W67A 2FTPA 2JALA 4V15A 3KBVA 3UJFA 1XLAA 4E6MA 2WPBA 4JQ3A 4IX0A 3VOFA 5AHNA 1S1RA 1B3XA 4CVWA 1XYBA 4DWSD 1GG0A 4UTWC 1WZMA 3G1SA 4G2DA 3SJNA 4UQBA 3CXOA 1SFTA 2C1GA 1M1BA 2QXWA 5I3HA 4FMVA 3TYAA 3M6DA 3LXCA 1TR9A 3MBFA 5T8GA 3T0AA 3WQPA 3ECQA 3R12A 4GYFA 3EDKA 4DZIA 2O9PA 2YA1A 2OB3A 3L4YA 4YXGA 4IXXA 4N4PA 4F66A 3VDBA 1BG4A 3W70A 1UD8A 1XP3A 5EMMA 1XBZA 1CI1A 1MQPA 3VDCA 3M7SA 2XIJA 4Q8NA 3SO7A 3VKKA 7CGTA 4HJWA 1WDSA 1PXGA 5SWUA 4Y90A 2VX5A 2FH6A 4DF1A 4UTMA 4H04A 2X0HA 3WLIA 5HNTA 4NJKA 1TZ7A 2FVKA 3ITLA 4ML9A 3SFWA 2O7SA 4CD6A 1WBHA 3IRSA 4HNOA 4QFUA 3T0CA 3G5EA 1HJVA 3UG5A 1BTMA 1HZYA 3UZWA 1FWIC 4POCA 3LZ3A 4UTFA 1KFKA 1LP6A 3LU2A 4LPCA 4WR3A 2R24A 3AUJA 5U4NA 4UR9A 6TIMA 3WJWA 3FSUA 2J25A 4ZXLA 1CZ1A 4LBRA 4GJJA 4EK7A 3EDFA 4HPGA 4TMBA 4IF2A 3JZUA 1XBVA 4NJIA 5HR6A 4LAZA 3QQ1A 1QNVA 2V63A 4QQUA 3W87A 2WNQA 3VMOA 1FDJA 1VLIA 5DANA 4IPPA 2YIHA 1HL9A 4LUJA 4H9TA 5ECVA 3WBEA 1K6AA 3HQ1A 1YNQA 4HSHA 2FGLA 1V02A 3H55A 5CC7A 4IL0A 1VFOA 4N9EA 3WQGA 1EH9A 1R2TA 3EMCA 1RLCL 3QPEA 3QC3A 1WKYA 2CXGA 2J7DA 1EQCA 5CCZA 5D4YA 2JKEA 1TE6A 2OX4A 4GA8A 3B9AA 1F8IA 3NVDA 4OE7A 3BJFA 4X2PA 1MYRA 1ZAHA 4IJRA 2PWUA 3PBVA 2ZYFA 2WSPA 2E6DA 4F9JA 4NNCA 1XLCA 4DN1A 3GLCA 5GJPA 5DQPA 4FNTA 3BLFA 1YXDA 3LI0A 3AXHA 3RITA 3N9RA 2QV4A 3SUSA 4PTDA 2O9RA 3ZLFA 4GJIA 2DEPA 3KZSA 1MVYA 1QUMA 4B5VA 4YN5A 4MPKA 4WSHA 3MANA 4HK6A 5CXPA 2F2HA 2WQDA 2YLAA 3OTRA 1E3ZA 1TMQA 2AOSA 2DUAA 5CZKA 4BJHA 1GOWA 4TMCA 3WQDA 2DZBA 2WC7A 3OGVA 1G7UA 1F4HA 1E4IA 2O9OA 4Q32A 3W7IA 2VZUA 1UD4A 5G2IA 1PZ3A 3Q37A 1IF2A 3KWSA 3QV7A 3GC4A 3U2OA 1OD8A 2VFIA 3P5YA 2YL9A 2AMXA 2A1YA 4NHVA 1TWIA 5HINA 3OZOA 2CEQA 3MWAA 4PMXA 3WBYA 3E2SA 2E4TA 2CLIA 3WO8A 2VWSA 5DMMA 1OX4A 1QPKA 5LXEA 1A0EA 1HO4A 2V5LA 1SZRA 3SAZA 3W7NA 1N82A 5DCBA 3ZT7A 2HROA 3JVAA 2EKGA 4R7OA 2PURA 2CETA 5CPOA 3O07A 1AJ2A 4YWIA 3G6LA 1EBGA 5D8ZA 2X05A 2BGNE 1YKWA 3E02A 4QSHA 4QJ1A 4KIRA 3MVIA 4XBJA 4QAIA 3PJWA 3GHUA 3WJXA 2PZNA 2WCAA 4ZOCA 1C90A 1GOXA 1RJPA 2ESCA 3T09A 6REQA 2YCLA 1J10A 4ZB0A 4I6VA 1DJQA 2IKHA 2PGFA 1Q6EA 3B8UA 1QK2A 4U28A 5T9CE 1XR2A 3NYDA 4TXEA 5FJTA 3UCQA 5BW6A 2IKIA 2INZA 2PGEA 1J8VA 2A7PA 1FWEC 1NSJA 5I77A 4MF4A 1HGYA 2PCQA 1XS2A 3E5BA 2QDGA 4JIQA 4A4AA 1H49A 2MANA 1UUOA 1KFCA 4GPNA 2DUZA 4JFUA 4XKYB 4H6KA 2DT2A 3W6MA 2X1SA 4WX2A 5DRCA 4YIWA 1F6KA 1TPH1 4UR8A 4CKQA 3R0KA 4HPNA 2WV8A 3CL8A 4B5NA 1X6UA 2GQ9A 4AIOA 4A05A 4J3VA 1VYSX 3NQCA 4ATLA 2RDWA 3RR4A 3UY8A 4KRTA 5BXSA 1TPEA 1WZLA 4QRNA 2VD9A 3RPMA 1W1B1 1BYBA 5AB3A 2HK0A 3G3DA 5JH2A 4U2ZA 4M24A 4CN4A 2ATSA 3W7QA 1F4AA 3B40A 3R8GA 1UP0A 1RD5A 1UHVA 3P80A 4DBWA 4LB4A 5GPRA 5KZ6A 2QCLA 1RCQA 2QF7A 4PTWA 2O9TA 4LF2A 2HE5A 3I6EA 2P1FA 1KGUA 3IJ7A 3GTFA 5KITA 5FF0A 2WLYA 4LY4A 1X98A 1PPIA 2YBVA 3WLLA 4FNPA 4LOCA 1V77A 1E9LA 3PNZA 3UZZA 3WQWA 1XD0A 1POKA 3WJZA 1DJIA 4A3RA 2WO5A 1O5QA 1OK6A 3HA1A 3MHGA 3QY7A 4J5NA 1G4SA 5H8UA 2H90A 1RR2A 3DYPA 3WF1A 3GYEA 3DENA 4GYKA 4Q8OA 1WKEA 4XAYA 1YEYA 3MMTA 3SI9A 5CH9A 3SUWA 3R13A 3RM8A 3SR7A 3WK1A 5HMFA 2X1TA 3FOKA 1PIFA 2AGKA 4LS1A 1JXJA 2PDJA 3DKLA 1B3ZA 1W5OA 3GTIA 4NAFA 4QJ3B 1SMAA 1JFHA 5FSEC 2D69A 3DBNA 1ZSXA 4L5ZA 3Q94A 3IVSA 3VDGA 4OBTA 3CWOX 4ZOEA 3CAQA 3WBAA 1GTEA 3B4YA 2POTA 3C2YA 4AZBA 1XYZA 5CC3A 4U3AA 3L4XA 4I9MA 5LZLA 1JCLA 1L6YA 4XD4A 5A94A 3W25A 4KH2A 1E15A 1JFXA 3H7RA 3ZOAA 4LU0A 1G7VA 4QEEA 4EANA 8A3HA 2XIOA 4UOQA 3AS3A 3W74A 3MDWA 4OV4A 4CQDA 1ECEA 3UVAA 3U4FA 3GTHA 5TD4A 2WBGA 1XYMA 3VC6A 1VHCA 3CNYA 4GH1A 2R1LA 1UIOA 1BVZA 1YBQB 4AYSA 2PF8A 4HNVA 1J0JA 4GIYA 1I0DA 3TQKA 5FEWA 4LTSA 3KOYA 1LCOA 1TCDA 3FGCA 1UZ4A 1W3HA 3SSZA 2ABAA 2YXXA 4FHAA 4GGHA 4G7EA 3WQOA 1VF8A 4AWSA 2WANA 3R58A 1OFPA 3WK3A 3RR1A 4OTKA 1TPFA 3CZKA 5DBUA 3NZRA 2BOEX 3A4JA 4F40A 1H50A 1G0CA 1JPKA 2PTYA 3C2FA 1IE7C 3RNDA 1PWLA 4FZIA 5A2AA 4MZ8A 1ISXA 2C14A 3VILA 2W61A 3KRZA 4P7NA 3GC2A 5C9RA 4ZQOA 1KTCA 3EAUA 1V3LA 4H00A 3SFKA 1CGXA 4CQCA 3U6WA 1OGGA 3VM7A 3H24A 3NXFA 3W1UA 1E1CA 3GY1A 3E5PA 5BOFA 3SCQA 4MYXA 4E3VA 3SJ3A 3WF0A 2I17A 1J9YA 3MY9A 4OU1A 5CBBA 3U2ZA 3VOCA 2P8CA 3CQIA 3STCA 4LV4A 3M0JA 3R0DA 4GQ0A 5TIMA 1IEIA 4C6OA 2ZUVA 2RGLA 4C6FA 1AMYA 3VIJA 2VVNA 2B7PA 1EDTA 3TEVA 2DT1A 3EWUA 1UZDA 2AGTA 4L4MA 1Q6QA 4Q7BA 4BI6A 4QNEA 2QKFA 4RE4A 2VHLA 1OFEA 3O16A 1H7NA 2ISFA 3QFEA 4DYKA 3QJAA 3I7QA 2BMBA 3CYVA 3V1PA 4HOWA 4RLIA 2NXHA 1C91A 1KW1A 5CPNA 1TR1A 4RX0A 1OYAA 1M68A 3BH4A 2PDCA 5EPDA 2GGJA 3WD4A 1SFSA 5HQMA 2Q3OA 4FO4A 3NDZA 4Q4RA 2OVLA 3CZ8A 1OFRA 1VAHA 1KCKA 4H7CA 4B2DD 3WH9A 2EO7A 2QCFA 3L9CA 3H53A 2PDNA 3CH9A 4DI8A 2ZXAA 3OW1A 1VPXA 4JIIX 2X2GA 1JF5A 4US5D 1MEWA 4HHHA 1REQA 5XIMA 1EJWC 4WZHA 2XJ7A 4H7ZA 4GRSA 2WNZA 5T26A 1CGWA 4O17A 1V03A 1C8VA 2A5HA 3IIZA 1NFPA 4JHZA 3II1A 3F2DA 1RSCA 1W2PA 1QI3A 1PZ1A 3EXRA 2ZADA 4I7WA 3RX4A 1LWJA 4WSKA 3UG4A 4DZAA 3AHXA 3BLDA 2GWGA 3W7GA 3V18A 4A29A 3ABSA 1MUCA 3TNBA 1W9BM 4GXWA 4UTHA 3BAJA 2DJLA 3BO9A 3LPOA 4DXVA 2EPKX 4A2RA 2OYMA 2YDSA 3M44A 3QLLA 4JQAA 4FXFA 4OFCA 1BFNA 2ZE3A 4GIAA 3WL0A 1IXNA 5C2XA 3NL2A 3T0DA 5HWNA 3GR8A 1ZLPA 3NGJA 1W8GA 1L6FA 4U31A 1KNWA 3BMWA 4JX5A 4PB5A 3TONA 2XIIA 3QRHA 3D5HA 4Z42C 1CGVA 2G37A 3M0LA 3MV01 4F79A 3QV6A 1UUQA 4MAZA 4UZSA 3MT1A 1MMFA 1K02A 1J5SA 4O54A 4PBGA 4K1GA 4H41A 3NEVA 2R1PA 1FCVA 4KWOA 2C7FA 4GNKB 1FFQA 1IWBA 5HUOA 1W32A 1Q85A 3EMZA 1NARA 4MNKA 5IXEA 4WJEA 3N2MA 3UP8A 4Z2IA 3N04A 2B7NA 2JKPA 2WWDA 4C1LA 3GXDA 3VPLA 3AXXA 4TV5A 2VMFA 1OT2A 1G6CA 3VKDA 2X30A 3M6YA 3CT2A 3MVTA 4GQGA 2JKAA 3UF9A 1QI4A 1RJQA 4IUOA 3QHMA 3LCXA 4AH7A 6PTDA 3WL1A 3EB4A 1DJNA 2GJLA 3EPOA 2QIWA 3IJ9A 1UMLA 4D9PA 3R6IA 3OB8A 3W7DA 3R94A 1YDVA 1XIGA 3OJGA 4D8AA 5A8NA 3KTSA 3HG4A 1TV8A 1JYXA 1FWSA 1SZFA 2XN1A 3DDMA 2IQ0A 3W23A 1JI2A 3ZR4A 3U5UA 1OD0A 4GZIA 3WMBA 4V27A 3U9IA 1WUFA 3I3EA 1K4GA 4GYPC 2LLEA 3QBUA 3QMSA 3AMGA 1HKKA 2UY4A 4FIQA 3P7YA 2NQJA 2FLIA 1GKRA 1JULA 3EDDA 3THAA 1W9PA 1K9TA 4YTQA 1I1XA 1UR3M 2AMGA 4PN2A 1ZGDA 4KW2A 2DQWA 3BAKA 1PSCA 5CSSA 1UR0A 3VIFA 2J9XA 3HFYA 1W2VA 3LNMA 1FWDC 2WMIA 2ACUA 2VFEA 2PWFA 4KS0A 4L1WA 4D8ZA 1S5VA 4CNTA 2HZGA 4QQ3A 1DXEA 2C0AA 5EBUA 4W8LA 1EJTC 3PZTA 4ASTA 5HMDA 2FZNA 1EWEA 4UCFA 2ZX6A 4XVDA 5HDRA 3T0TA 4IUGA 1PX4A 3FKKA 5CPQA 3WDHA 2OQHA 1E6PA 4R85A 3OBAA 4LWWA 5D33A 3TYCA 1A4MA 3FCPA 3LM7A 2ZZ3A 3NQVA 1XKYA 3ES8A 4H83A 2ZOXA 2QDDA 1YYAA 4GWEA 3SB0A 3PZUA 1LRTA 4H9UA 1V6VA 3U48A 1Q8JA 4AC7C 4MNLA 2J62A 3I4KA 3P14A 3R10A 4FF7A 3A13A 1N55A 1YPIA 4GCXA 2PWGA 3SCSA 3HGJA 3WLKX 3N3MA 3ZO9A 1LLOA 3C4UA 4Z08A 3VUSA 3JU2A 3WUGA 4TVCA 1YRRA 3P0WA 3CHVA 1JZ7A 1XLHA 3HPZA 3RLGA 1F6YA 2C0HA 4WDXA 1NJJA 1I6NA 1XGDA 4GG9A 2PRHA 1DJZA 1ZCCA 3ANUA 1QHPA 1ZALA 3T0BA 1LL4A 3CH0A 2V0TA 1XYCA 4PMDA 2CLPA 1WAUA 4KCTA 2OEKA 2GSHA 1IEXA 2X1IA 4Y9PA 3L0GA 4IL2A 4C6LA 4B3ZA 3GC5A 3PBMA 2IS7A 1SO5A 2A3EA 1VS1A 4HZMA 4FLSA 2WHKA 2WW5A 1SFLA 3ARZA 3A12A 3R0UA 1OJXA 1W9VA 4NY2A 2PPGA 1C92A 4DHGA 3M46A 3AZSA 2Q3RA 3MP3A 3U2EA 4UTKA 4H8VA 1M01A 3N17A 3MYOA 4G5DA 5K9DA 3L5AA 3P74A 2WCSA 3STPA 1XUZA 1KM6A 1H7RA 5L6UA 3S8HA 3PBWA 2JE8A 3YPIA 2PDUA 4IIBA 5KEZA 5H2ZA 4TO8A 4REQB 4IISA 3IIVA 1EOMA 1OB0A 4IIGA 4OBRA 1GTHA 1EO7A 4Q6JA 2Z1XA 1JCTA 5I6SA 1RK6A 2CBUA 2VGIA 5LKYA 3MJMA 4IG2A 4FF5A 4DAIA 1UKPA 1CLKA 4LRTA 3GWQA 4MADA 4M81A 4OIFA 3TSDA 1PKLA 3KOXA 4L1XA 2WVVB 3PAJA 5A6JA 4CQAA 3U5YA 3T4CA 1XQLA 3PPFA 2OG9A 1TYGA 2E6AA 1XW8A 3URQA 1UH4A 5FF4A 1E73M 4YS1A 1OF6A 5LNWA 1VRXA 3RUBL 4ATDA 1VPYA 3URAA 2PWEA 5AHLA 1WA3A 3B4UA 3VAVA 2XTKA 3EOLA 3NCOA 3FIGA 4RK8A 3IUDA 3GR7A 4LYQA 1ZPTA 3QR3A 3BLKA 1ICSA 3UWEA 3AIVA 5JIWA 3PG8A 5ECUA 2VFDA 5C7HA 1TRDA 3M43A 3LTPA 2DIJA 3K4WA 1XJBA 2QLYA 2GGIA 3W1RA 1J96A 1UWRA 2GGHA 1LQAA 1DL3A 1JGMA 2Z7KA 1WKFA 3P8IA 3BL3A 5FF7A 3R43A 2EAWA 4C6QA 1FWWA 4W88A 2X09A 1EF2A 3MZNA 2Z27A 3TIMA 1TTIA 3EMQA 3ABOA 3WK2A 3HZ3A 2HMCA 4J3SA 3OGSA 1S2AA 4HU0A 5G4EA 4DELA 3VGGA 3IIXA 5CSYA 4MKVA 2R94A 4RW5A 1VCVA 4BEUA 1UWAA 4ZFMA 5A8OA 3GDRA 2YL5A 4UCGA 4O0KA 1XDMA 1RJRA 1CT5A 4K8HA 4LYRA 1ZZMA 4JTRA 3WF4A 5CKSA 4H9MA 2ZRZA 1KXVA 4XAGA 1E0WA 4I7UA 3W24A 4PUUA 3OA5A 2VEIA 3DFOA 3W53A 2WM0A 3W1NA 1QFEA 3MUXA 4JQ4A 4QISA 2YPIA 3VIMA 3H4XA 4AD1A 3PTMA 1JR1A 3M07A 2YBTA 4UQDA 1P1MA 1H60A 1GW9A 2CKRA 3W02A 4ENLA 3UERA 1SZEA 3PJTA 4N6FA 1O66A 1VBGA 1UROA 5FJIA 3E1F1 3BQ6A 3D0CA 3FKRA 4JEJA 1F3EA 2HS6A 4WDUA 3EX4A 5I23A 5FJOA 4ACZB 4GFSA 3RCNA 3UESA 5CZTA 3FHAA 5GQBA 4FALA 3LS9A 1BVNP 4MWAE 1GKQA 3MZ2A 2E09A 3C0LA 1GKPA 2OSWA 1BF6A 3FLUA 2PS2A 3L66A 1HJUA 5MKGB 2OQYA 1AK5A 4DZ5A 1IIGA 1MZRA 1PZ0A 3AU2A 1DWAM 1QK0A 1XFCA 3HTWA 2BX7A 2Q8ZA 4HMCA 5BXTA 4E4PA 4DLMA 4M51A 2NW0A 4BWLA 2V30A 1K70A 2MUCA 5BWFA 4MJ2A 2ABBA 3O6CA 1VJZA 1UP2A 2HISA 4LEFA 1OX5A 5LNUA 4PMVA 2CWNA 1UR2A 4PL1A 2ZZ7A 1B90A 1E43A 4MB5A 4IMGA 2DSUA 3TJIA 2VRKA 3DG3A 3VE7A 4JFVA 3IV8A 3S1WA 2XFYA 2DZVA 1W3TA 1QMLA 3WNNA 3TFXA 3UG3A 1OFAA 1S5TA 2BTMA 5FEPA 2WVSA 4H01A 3VNKA 5D05A 3P60A 2DSWA 2ODOA 1VJIA 2J66A 2Y85A 2P0OA 4PMQA 1UKOA 2WJFA 3G1RA 1XDJA 3W7JA 1V51A 3ABXA 3QW4B 4XVEA 4YPJA 4AZIA 3MQTA 4WSJA 3TW7A 1V0LA 3GVQA 2QPUA 4UMAA 3W2UA 4CCCA 4GY0A 5I3JA 3VGBA 1K1DA 2P0IA 1FKWA 3UYCA 3GW3A 4XWUA 3L2MA 2GQAA 1KXTA 3CAVA 2Z7GA 3CV1A 3QEZA 2XH4A 4RR4A 3NM3A 3L7RA 1Y7VA 2ON3A 1CDGA 1UWQA 4Q4QA 3WQ6A 4HSNA 1FHUA 1SUXA 5DMYA 4AEOA 2QAPA 1KQZA 4QHRA 3QOKA 4JY9A 3VIKA 3G1AA 4UUIA 1FWBC 4PMZA 2J8GA 1BKHA 1KTNA 1FHLA 3QMRA 3W86A 1TJ1A 4WQ6A 4IICA 4N9CA 1VRDA 4PEEA 2VEGA 1F76A 3VGDA 1JNEA 3FHQA 1UOZA 3UJ2A 3BG9A 3DFSA 1TTPA 2G3MA 3SIZA 1EWDA 3VOJA 4AWUA 1W3NA 3B0VC 4MFEA 3C3UA 2PRMA 3SUVA 3NQ6A 3NPUA 1W6TA 3LM3A 1OIMA 3OO2A 5C9XA 3CK5A 2W4XA 1GZ1A 5LIUX 4DLFA 1NM9A 1JD7A 5FIPA 1W1YA 2P8BA 1GQJA 3C2OA 4A3QA 2J74A 2VZOA 2BASA 4JAWA 2E28A 2CLHA 4ZO9A 3I65A 4FNSA 3DAQA 2AQVA 2Q8XA 1XRVA 1J4EA 2DH3A 1JPDX 3WEMA 4MWAB 1NH6A 1DWGM 4Z2LA 3VIHA 1GQLA 4C6CA 5CSUA 3NSNA 3PZGA 2IPFA 3HOJA 1CENA 1DJWA 3MO4A 3G6MA 4W8AA 3AHVA 1B57A 3F1QA 3GVWA 4HNNA 2J24A 3B8SA 1JDEA 4S2BA 4YYFA 3ENLA 4PMRA 3LBCA 4LNCA 1HL8A 4LX4A 2P53A 1UD3A 3QZ6A 4LAKA 4RKAA 5IBXC 3QGAC 4YJ5A 2C8NA 1QW8A 3B0UX 2P50A 4WJ8A 2OZ3A 3KRSA 1OZQA 4GZ7A 3P0XA 2FKPA 4HTBA 4P8UA 3VDHA 2OZTA 4JYEA 4KEVA 2J9ZA 3B0YA 4MB1A 3WD3A 3NO3A 4UMCA 1GGOA 2D3NA 4AF0A 1PEZA 5C6MA 2BBFA 1GPWA 1AMKA 1EGZA 5G4HC 4M29A 4BF7A 2R1MA 3XIMA 3KP0A 3GW0A 2DT0A 3P93A 2WQPA 3AJ7A 1N8WA 4ZO6A 3TTYA 4IFKB 1ODUA 3F4NA 3NZGA 1G4TA 3GDBA 1OZMA 2YJQA 4CU7A 4GNVA 5HXMA 3AIQA 5BNKA 2PZ0A 1P6BA 3QR0A 1D7FA 3EWWA 4JN8A 1TJ2A 1CPUA 4IOTA 4LUTA 4LUIA 1US2A 1SJDA 3KRUA 3ZZ1A 4B16A 1WXYA 4MVAA 1TVPA 4C6JA 4JTUA 3TC6A 2BZNA 3DESA 2WAGA 4XSMA 3WDIA 3UETA 1B1YA 2FPYA 1E56A 1W1VA 3PG9A 3GO2A 1PDZA 1O60A 3M9YA 4ROPA 4PUEA 1Q13A 3T9PA 2GYIA 1VB9A 5E6YA 1VC4A 3QV9A 5DRIA 3CASA 4XBKA 1CLXA 3TYBA 4BCEA 2ZUNA 7REQA 4KF1A 1RY8A 1MUWA 2J6VA 4CNPA 4Q6XA 2EG7A 2QCDB 3QHOA 4H9VA 1SW3A 2PDIA 3POHA 1VD6A 1T0OA 3IACA 1AW2A 1HN1A 2CLLA 3IAQA 3SURA 1BPLB 1UKQA 4IT1A 3G1VA 2RJGA 2Z25A 2R14A 2EF9A 2NSXA 2ZKMX 4NZFA 1MDRA 1QW7A 2G0WA 3W2LA 4KMQA 2GDQA 3H6OA 3E74A 3G0SA 3LA4A 1B9ZA 3HGRA 3K8LA 1GHSA 2V3GA 1MXSA 5D02A 4MLJA 1EZ2A 1A0DA 1CXKA 5ABGA 2CLMA 3NJ3A 2PDGA 3S6TA 3HPFA 4NVTA 5CG7A 1A5UA 1V3IA 2EPHA 3URBA 2PTZA 1JPIA 3QKEA 5DCEA 4TX6A 4Z1AA 4C1NA 3EBVA 3ME3A 5C8BB 3PPHA 4H8NA 3N11A 3N2XA 4H9YA 3ITCA 1OCNA 3URNA 5A2BA 1GEQA 3UT0A 5KSWA 4PRWA 4QTGA 3GVGA 1A5OC 3WH6A 1BXNA 1ZAJA 2OELA 3MJYA 5FSDC 4AZ6A 1KLZA 1R3RA 1XUUA 2J8FA 1KQYA 3RM9A 4HN4A 2F2KA 2VQTA 5TNVA 2PD5A 4C65A 3MTWA 1E1EA 3T05A 3ZXWA 2VGBA 3LPFA 4XV0A 3SUTA 1V5XA 3TH6A 3RCMA 5EKYA 3WF2A 4ZB5A 3KVKA 1R30A 4HA4A 2VD8A 1WDQA 3KVJA 2D0FA 1KFBA 1I9CB 1JDFA 2PP0A 2FPTA 2TRSA 4CCZA 3QR1A 2GJXA 3TN6A 4I5XA 1RVGA 3BICA 2QCEA 2FZBA 1E0XA 5REQB 3CUIA 1OSEA 1NWTA 5ABFB 1W3KA 3BC9A 4GO9A 4CN6A 3SCOA 1UA7A 3C2EA 4UQCA 1NU5A 4M3PA 3BOFA 4HNLA 4PUKA 1JZ3A 5PTDA 1EXBA 5G5IA 4BQ4A 3O1NA 4NI8A 3VIGA 1DJYA 2FH8A 1V3KA 1N2VA 1F73A 4M5PA 4EXQA 1CXFA 1PWMA 2FMNA 2VUNA 4CVUA 1WP6A 2VO5A 1E6SM 2F7FA 2TSYA 4AUBA 4EWJA 2RDTA 2E6FA 3DXIA 4GQRA 5AC7A 1RD6A 3EKGA 3NFUA 2E8ZA 1VBJA 4A2SA 3ORWA 3A4AA 4JD4A 4XZNX 3E0IA 1KGWA 2CESA 4TV6A 5IBXA 3JRKA 2PLKA 4U2YA 3W71A 1X7IA 4UTJA 4DWSA 3ZWTA 1SO6A 3L5MA 4L6HA 4HK5A 1J0YA 3C6CA 5LA1A 4O4VA 3ATYA 1Y65A 4O50A 3HJEA 5LIWX 1RXOB 1VEPA 3D46A 4OOZA 3TW6A 5G1TA 1VLWA 4D6CA 3CU2A 4Y2WA 1XYAA 3W9ZA 4GZEA 4ZVJA 3R8HA 2ACQA 1H41A 1DKWA 4RDYA 3RN6A 2QZRA 2WZHA 3QYQA 3MMWA 3AYSA 1UJPA 3SCVA 7PTDA 1MDLA 3LB0A 4OUEA 4RV8A 3CS2A 2WNNA 3K46A 2B0MA 2Z28A 1BGAA 4V1XA 2WPGA 4A8NA 5I3FA 2DW7A 1JAKA 1E9IA 4AIEA 3SN0A 4WHBA 3ZSSA 3M41A 2R9RA 1UR1A 5BXPA 1GQNA 1XG4A 3VIOA 1K8CA 3M0VA 2JFEX 1X8FA 5A6MA 4TOQA 5EMJA 4PR4A 2BHZA 3CQJA 1E72M 4HD5A 3MSRA 2FZDA 1XGEA 5AC8A 1V08A 3AALA 5JBDA 1KTBA 1LLWA 1P7TB 3M0IA 1SFJA 3GTNA 2XWDA 3CO4A 3NQ8A 5HJLA 4Y9AA 4U5KA 4ZSTA 2Y0FA 1D7KA 4B3LA 2PI6A 3DU0A 3ONCA 3CB3A 3KEHA 4UNKA 3QQWA 1I60A 1ONWA 2Q71A 2EPNA 1QPNA 1N8FA 3K8MA 1OCJA 1U1JA 3LMZA 3PSVA 5I7GA 4A3YA 1EP3A 3EWBX 1OIFA 1XG3A 4S3DA 2BNJA 1ZP3A 2ZE0A 3DC8A 5D9NA 4LAOA 2TYSA 1UMYA 4FK9A 4D6IA 3ZIZA 1B9BA 1QHOA 1YLVA 1EGVA 4D8LA 3VNYA 4XUGA 1U30A 4NX0A 4AIBA 4P7QA 2E5DA 1XDLA 3UR7A 5E0CA 3ZJKA 2V5DA 1OFQA 3PSWA 4NZ1A 3IUHA 5GNYA 4KRUA 4JFSA 3FS2A 4WGHA 1E4LA 3QMTA 4LS2A 2Y89A 1E3XA 1KGXA 3NR0A 2XN0A 3TQVA 4UOZA 3RX2A 3GXPA 1SJBA 1R38A 3RU8X 2YL6A 2O56A 2FDSA 5FL1A 4ZODA 2VYOA 4PULA 2C1IA 4PFHA 1H63A 3GG0A 4W7UA 3H7VA 1FA2A 1EP2A 2Z0IA 2QUUA 2PDMA 2HVNA 3WLSA 4IJBA 1ONXA 4C7FA 3CV7A 1Q6OA 3N6JA 4Q8QA 1FWAC 2OPJA 1LF1A 1TPUA 4DNHA 5C54A 2WOQA 1NWSA 1ENUA 2YOCA 1UUMA 2YW4A 1LBLA 1RPKA 3AIEA 5F2MA 3QTPA 2IW0A 2UY3A 4IPIA 1CX9A 3RRXA 1KFLA 2XIMA 3ZVHA 4IXHA 1OHLA 2DIEA 4IMCA 4G6CA 3UU0A 4E3TA 3BCJA 5FI8A 5AYXA 2C79A 5G1MA 4MIMA 3RYSA 1TELA 1EOKA 5KETA 1T6MA 2CYGA 2ACSA 2NQ9A 2GUBA 1BKSA 5DEZA 2J7HA 2P10A 3VGEA 3IJ8A 3PB0A 4C7DA 3A3XA 1GK8A 3W29A 2X1UA 4GI4A 4DJFD 1GOMA 3DG6A 4YYCA 1NDZA 3RM4A 1ME8A 3I6TA 2V5BA 3W84A 2NV1A 4WIWA 2BXZA