4B16A

Crystal structure of tamarind chitinase like lectin (tcll) complexed with n-acetyl glucosamine (glcnac)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
266
structure length
266
Chain Sequence
GGNIVVYWGQGGSDNSEGSLKEACKSGHYNMIVLEELITYDNGRDPDLNLGAHCVNCTSLQQEIKYCQLKLIKILLQIGQVTPTKEDTKDTTKDLSQYLDSNFFSGKSGPLGEVYLDGIDIASVPEGLNLKFDELVQALNDSATSRRIYLSASPNCVYPDYYLDKAIQTQKLDFLFVQFFYALPCIYTQGLPEDLFQAMKTWTSNVPESKIFMALPATPDLNGYIPPRVLNKEILPAVTQASNFAGVMIFDRYFDRFRKYSSKIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITINASE LIKE LECTIN
publication title Structural Investigation of a Novel N-Acetyl Glucosamine Binding Chi-Lectin which Reveals Evolutionary Relationship with Class III Chitinases.
pubmed doi rcsb
molecule tags Hydrolase
total genus 92
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4b16A00
4BQ3A 5AC5A 1CECA 3AHXA 1KB3A 2W91A 2XGIA 4D1JA 2JIEA 1JG9A 2WCSA 1E3XA 3TTQA 3SCQA 1J01A 4HA4A 2VR5A 2GJXB 1B3XA 1JZ2A 1NARA 3ARYA 3SCNA 5GQBA 3RJYA 2CXGA 3WEZA 1ODUA 1UWRA 1ODZA 1E0XA 1W9UA 1OSEA 4OIFA 4WKFA 5GPRA 3CUIA 1HF6A 1W3LA 2PBOA 4GIAA 5E6YA 4AD3A 1MQRA 2CIPA 4TOQA 2C8NA 3RM4A 1K6AA 3O2LA 1NWUA 1TR1A 2WVSA 1X6NA 3PZUA 2AAAA 2BHYA 1E73M 1JYXA 2DSZA 3KZSA 4UR9A 3WUGA 4U2YA 1HJXA 3GNPA 3WDHA 5HBFA 1PBGA 2ZE0A 1A3HA 5I24A 5A2AA 1JF6A 2YOCA 5ECUA 1BQCA 5DEZA 1QHZA 5BYWA 3VD9A 4GQQA 4HTYA 3AHTA 4PMUA 2VUYA 2JIWA 1EGZA 2WHJA 2QF8A 4D6DA 3HN3A 1DHKA 4YN5A 3BSGA 1Q4NX 3WMCA 1KWGA 3AS1A 1W2PA 3FHAA 1SFSA 3MU7A 3BAYA 4NRSA 3WNOA 1Q6CA 3BGAA 3IAQA 4Y7EA 1YHTA 2J74A 2E9LA 3CZEA 3AIVA 3JUGA 1QNPA 4F9DA 3VM7A 3ALFA 4TTUA 1M03A 1JAKA 1JZ7A 4LYQA 1BYAA 1V0LA 3HU7A 1RP8A 4BZYA 3W81A 1GVYA 3E1F1 1W9PA 4HZ6A 4DWSB 5D8WA 4CCCA 5JIWA 1L8NA 1LL4A 2WB5A 2BHZA 3KEHA 3CUJA 1OGSA 4W8LA 5IHSA 2WNWA 4W7VA 3WH7A 4E8CA 3OG2A 1H0IA 5HNNA 4URIA 1TCMA 2OSWA 3VIGA 1V6YA 2J7GA 1MW1A 5A8PA 1Q6DA 4HU0A 1CDGA 1DWHM 1TG7A 4UZSA 2Y24A 1ITXA 2FH6A 1C8YA 5A6KA 4H8HA 3SCOA 1CNVA 1BG9A 1NOUA 3OLGA 5IHRA 4C7DA 1TA3A 3W6LA 1K9FA 3HMCA 2B31A 3CZGA 3PTQA 4W87A 4W86A 2GFTA 5F7UA 2A3CA 3ZJ7A 1WZMA 1LWHA 3RMEA 1ZS2A 2PBGA 1GJUA 1WDQA 3S2CA 3T2QA 2VZOA 3II1A 1GOQA 1CGXA 3AHZA 1XH0A 5LA0A 2VX7A 2XVPA 3APGA 2YDRA 3AI0A 3CMGA 3A6OA 5BWFA 1HVQA 3VKKA 4V27A 1PPIA 1VFFA 4FLOA 1XH1A 5HPOA 4ZEPA 3VTRA 1ZJAA 4TVCA 3VGBA 1QNSA 2UWFA 1I75A 4B3LA 1KFWA 3T0DA 4IUGA 3RM9A 1BF2A 1HX0A 1OGBA 1GVIA 1MXGA 1VFOA 1UWUA 4D1IA 1C7TA 3WDJA 1X6LA 3ZSSA 2PWEA 3VIKA 3BCFA 1E72M 1U33A 1HJSA 4HOZA 4M56A 5ABFB 4N0RA 4M81A 4XUYA 4CD7A 1UD4A 3MUIA 1CGWA 1H41A 3B9AA 1BAGA 1ECEA 3AOFA 4D6CA 1Y7VA 4QLJA 4WSKA 1C8XA 4L4OA 3VMPA 1JYWA 1EHNA 1MYRA 5BXPA 3VD3A 4MNJA 3ZR5A 2CNCA 1MWOA 1E3ZA 3WQ5A 4H8VA 2W63A 4MB4A 3PZNA 2VX5A 3W26A 3AMGA 3OLEA 3VGEA 3WH9A 3MSGA 2FHBA 3L4VA 4GZEA 2WW5A 3EYPA 2VX6A 3CLWA 3CZ8A 2XFYA 1JAEA 3BAIA 2E3ZA 1C91A 4QDMA 2OWXA 4UTFA 1M7XA 4CU7A 2IXUA 1I1XA 3FN9A 3WUEA 3VGDA 1HIZA 1TVNA 2GJPA 5DT7A 1GQLA 5D9MA 3NUKA 4CCEA 1E6NA 3T08A 2ZUVA 4M24A 3AYRA 2VJXA 4HPHA 3ARTA 2A3EA 3VD4A 1E5NA 1CXEA 1JNEA 4P8VA 4UFHA 3VPLA 1XV8A 1UWSA 4PUDA 2GDVA 1LLOA 2AMGA 3K4DA 3T2OA 2YJQA 1BFNA 1NH6A 1JI1A 1H4PA 2E8YA 3NDZA 3AZSA 1EA9C 1E71M 1UKTA 3CGTA 6A3HA 3U5YA 3NIYA 3WNPA 1GOIA 1V0KA 4WK9A 1GNXA 2CBJA 2NT0A 1KGXA 2YIHA 2WXDM 3VM5A 5M3WA 3U57A 1OGGA 3KL3A 1HT6A 4E8DA 2Z1KA 2ZXAA 2UY3A 1QI0A 3OIHA 3J7HA 2E40A 4XX6A 4PMYA 4FLSA 2XIBA 2F8QA 1IZKA 1CTNA 4MTVA 1R87A 4HA3A 1G9HA 3CZLA 5I2UA 5I5RA 3D5HA 5HPCA 1DWAM 5KZ6A 4AZCB 4AD5A 3WQVA 5A6LA 1Q6EA 3DHUA 4JFTA 4EE9A 1ISWA 3OLIA 4J3VA 4RE2A 5AC4A 1EO7A 1WZAA 5BROA 4ATDA 4KH2A 1KBKA 4UCFA 1HJUA 5TD4A 4U33A 1UD6A 4X0VA 4P7OA 2XWDA 4J3WA 3PZ9A 2WVTA 2AOSA 4CUCA 4X0NA 3TOPA 3WFZA 5ABGA 1UD5A 1US3A 3EDDA 2UY2A 2WAGA 1RPKA 2EQDA 4W84A 4MAZA 3IANA 2XM1A 4U5IA 3WL0A 4JKMA 2CHOA 3PN8A 5CJ5A 2YL6A 2W66A 2CHNA 4CCDA 3VO0A 1B9ZA 4KRUA 5A8QA 3FNDA 4D6JA 1V3KA 2ZUTA 5E0FA 4A4AA 4LYRA 2D3NA 3N13A 2PWHA 5ABHA 3FW6A 3UR7A 1HNYA 2XFFA 4ACZA 3O6AA 1V0MA 2D20A 3GTNA 4QCFA 2ESCA 3GZAA 4UFIA 3CHCA 1B30A 2Z1SA 2QMJA 1ZB5A 3VDHA 4OKDA 4F9JA 3K46A 4Z2LA 2XSBA 1G5AA 5D9OA 1W32A 4OBSA 3ZMRA 3AMCA 1E4MM 1J18A 1W9DM 1HJWA 4TTGA 4P7NA 1UUQA 3NDYA 4CN1A 3ARVA 1AVAA 5JUVA 3UG5A 2E8ZA 1G0CA 4AZHA 3LMYA 1VIWA 3SCPA 1UH4A 1JGIA 3NSMA 2WC3A 1J0IA 4PYSA 2WLYA 4HP5A 5CPQA 1LQ0A 3GYCA 1NOFA 1UR0A 5C8BB 4GZIA 3GBDA 5A94A 1W2VA 3N11A 4AW7A 3IJ7A 4UZUA 2PF0A 2PWDA 3ARWA 3MMWA 1F4AA 1QNQA 2X1IA 5D9PA 5IDIA 3OZOA 3RDKA 2BY0A 1KXVA 1WCGA 1BGAA 1ZBCA 5CSUA 3OLDA 2EPKX 3L4XA 3W38A 1BHGA 3GH7A 1H2JA 4MB5A 4GKLA 3N17A 1HL9A 1VJZA 3VD5A 1ZBWA 1QBBA 4GI6A 5A3HA 1UZ1A 5M5DA 3AIUA 3BMWA 3AMDA 4MNKA 4ZXOA 4EAMA 2WM0A 2YL8A 1NP2A 1P6WA 4ZFMA 1J11A 2WMIA 4NF7A 3OZPA 1QI3A 5M17A 5FL0A 4JFSA 3BH4A 1V0NA 4D6EA 3M07A 3ZSTA 4WJXA 1WDSA 2ZXQA 1WDRA 2V3GA 1O6IA 4NI3A 2PB1A 4QLLA 1RP9A 3RIKA 3ZT7A 1CYGA 1QNRA 1E0WA 2EEXA 3ZR6A 1V02E 2VZVA 3VUPA 1CXFA 5E0CA 1CXKA 2OWCA 2VRKA 3WF2A 4FMVA 4N42A 3WQ4A 4DWSC 3ZT5A 1QI2A 4Z2HA 4BCEA 4W8AA 1TMQA 3KE0A 1H3GA 3OB8A 4J28A 4AZ7A 4UQDA 2FH8A 2YLLA 1V3JA 1US2A 3K8LA 4U5KA 1WP6A 1PEZA 1H09A 1CEOA 3AMLA 3OGSA 1BYDA 2DDXA 1VEPA 4DM2A 2XVGA 5BXTA 3GXFA 3ZT6A 4U31A 1J0YA 4AD0A 3B9DA 2J79A 3CPUA 4DUVA 4HA1A 2HVMA 1KCLA 4UQBA 3TP4A 1E15A 3ARQA 2WMFA 3VGGA 4AY1A 5A6MA 2J7FA 3WD2A 2BY2A 2OSYA 5CLWA 2BY1A 1W9VA 2YA2A 1G94A 2PI6A 3VNZA 4PRWA 1RD6A 2C7FA 3OGRA 2VO5A 2VI0A 2TAAA 2W62A 4D72A 1VBRA 3PZTA 3MV11 1W1YA 2V5CA 2VR4A 1EOKA 1BPLB 1MFVA 4RL3A 4XV0A 1CGVA 1ZBKA 5D9NA 4S3JA 3AXHA 3WNKA 1CLVA 3NYDA 2WLZA 1N82A 2WPGA 2XWEA 4W89A 3EBVA 3ARZA 3CBWA 4M8UA 1VRXA 1IZJA 2XHYA 2WMKA 2ZUMA 2DSUA 2GSJA 3G6LA 4LPCA 4U2ZA 2W61A 4D71A 4NZCA 1CLXA 2ZX7A 2VVSA 1SMDA 3WD1A 3W24A 3THDA 5JBEA 2W4XA 3TTSA 3QHNA 4PMRA 4W85A 4LXFA 1FH9A 2JF6A 4GQRA 3AIRA 3D3AA 1E9LA 3CUHA 3PZIA 4HOXA 1KXTA 3K1DA 3WY1A 2A3BA 3LPGA 3IK2A 4DWSA 1E4NA 4D6GA 3BC9A 2OLHA 2V3EA 1SMAA 1NOWA 4J3SA 4MDPA 1OBAA 1XCXA 6CGTA 3VGFA 1G1YA 4EKJA 2ZX8A 2X0HA 4U3AA 3W0KA 2VQUA 1FP9A 5E6ZA 1E6QM 3VGHA 4AIEA 4WKHA 1QHPA 1ESWA 1GOOA 5KEZA 1W1TA 2YKKA 3EDFA 2VL4A 2G41A 2VVNA 1EO5A 4WLCA 1UR2A 5LYRA 4MJ2A 3K8MA 1V6XA 2BS9A 4AC1X 3ZJ6A 2W5FA 4UQAA 1OT1A 2J25A 4ATLA 4CN6A 3WQ6A 5E09A 1FA2A 2J7BA 3WUFA 2FGLA 4JL2A 3W82A 4PCTA 2ZX5A 1UWQA 4H7VA 1PAMA 4PMXA 1TUXA 1JI2A 1OWQA 1ISXA 4BS0A 1FP8A 3U7VA 1C8QA 4YHEA 5EFFA 2WVUA 3IJ8A 1FOBA 2FHCA 1B1YA 1XYFA 3VIOA 4GO8A 1VJSA 3SUWA 1JD9A 4TXEA 4U3CA 3W4RA 1TA3B 3A3HA 1V08A 1VF8A 2D1ZA 1UZ4A 2WBKA 1B0IA 2ZXBA 4MAVA 1NWRA 3CTTA 4Z2IA 1M04A 2VRJA 1GQKA 1HN1A 3NCOA 2VQTA 2WCGA 1KGUA 5A6SA 4P8XA 5CGMA 1J12A 3GH5A 2WZHA 1IT0A 4OOUA 3WNMA 4AYSA 4OUEA 2JALA 4KGLA 3DYMA 5IFPA 1B2YA 4UOQA 2UY4A 1KR1A 2VZUA 1MFUA 3AISA 1VFMA 9CGTA 2GK1A 3GH4A 4GI8A 3WH8A 1C93A 4J3XA 1W3HA 2PWFA 3GNOA 2YA1A 3WH5A 3TTOA 2YBTA 2EPNA 4EANA 1WO2A 3WF1A 4UQCA 3AYSA 4C7GA 3K4AA 3SUSA 1NWSA 4K68A 4C7FA 1QOXA 3CZKA 3M6DA 5DMYA 3QR3A 1J10A 1UD3A 2QPSA 5A95A 1S46A 3CZJA 1OCQA 1KXHA 2F61A 3T0BA 2BVTA 2GUYA 3BXWA 4BQ2A 2WVVB 2J75A 2X05A 3AXXA 2CERA 3MUZ1 3UESA 4P8UA 1B3YA 5A69A 4UNIA 2XM2A 1V3HA 4B9YA 4E4PA 5CPTA 5A2CA 1JYNA 5EFDA 4W7WA 1GQJA 2WKGA 2ZUWA 4UOJA 3T09A 2BXZA 1V3IA 2NW0A 3WD0A 4PCSA 1EXPA 1XD0A 4QAWA 5I77A 4W5UA 1W3JA 1KCKA 5BXSA 2CKSA 3BLPX 1Z32X 3GNRA 3S6TA 4IISA 2WKLA 3B9EA 3GXDA 1AQ0A 3WH6A 3KWXA 4B15A 1GOMA 4UFMA 1C7SA 2OYMA 3IAPA 3AIEA 1CBGA 2DH3A 2YA0A 1WDPA 3SCWA 1E4LA 1UOKA 4MB3A 3WF0A 1CXHA 2YDQA 3WQ8A 4F8XA 2G3NA 2YDSA 5C70A 4AZCA 3WUBA 2GJRA 5CXPA 2WZIA 3ARRA 3AXIA 3ARUA 2CBVA 3OA5A 2CKRA 2WMGA 2WYSA 1GORA 3DHPA 1C3FA 3ARPA 3VDAA 3CHFA 1W91A 2DSKA 1JDCA 3WKZA 5BXRA 1DWJM 1EQCA 1SYTA 1UA7A 5FCZA 1QBAA 1CXLA 3NSXA 1PIFA 1ISVA 1K9EA 1GZJA 3VIFA 1MVYA 3PZGA 4BA0A 3RO8A 1BLIA 1KGWA 2DSWA 3PZVA 3AIBA 4AZIA 3FAWA 3QHMA 1VEOA 2PWGA 2O9OA 2WC4A 4PTVA 3UERA 1B90A 1XH2A 3SCUA 1EDTA 3AROA 3VMOA 5A6JA 1PX3A 2E9BA 3L4YA 2D0HA 3WDRA 1UR1A 1TZ7A 1E40A 4M29A 1BYBA 2WZEA 2Y8KA 4V28A 1HP4A 3WN6A 4J3UA 1ISYA 1GOWA 2ZUSA 3F4VA 3UEQA 5DO8A 3W53A 2VX4A 3L2MA 1SR0A 3EDKA 3KL5A 3TTYA 1YQ2A 3LPFA 1WKYA 2WHLA 3O9NA 2DIEA 1F4HA 1GONA 1HJVA 2C0HA 1JZ6A 1C90A 2OWWA 3PZMA 2YLAA 4OOZA 1JD7A 2XYLA 1BVZA 3VDBA 5FOOA 4ML4A 2UY5A 3SCRA 5IFTA 2WANA 4RE3A 1JIBA 2DSVA 4AD4A 2Y2WA 5AYIA 3PHAA 2BVYA 1UKSA 2ZX6A 2YL5A 3BMVA 4UQ9A 3MO4A 3QGVA 4OZOA 4JIEA 4ACZB 4HMCA 1UR8A 2EPMX 4TX8A 1QW8A 3TA9A 3VIHA 3AHYA 1J0HA 3AQUA 1BGGA 4P7LA 4Q7NA 2CYGA 2DEPA 1BTCA 2D2OA 3ZIZA 2XJ7A 3MUAA 4W7UA 2ZICA 1UKPA 4MJ4A 1V6VA 4AZ6A 3PZOA 1W3KA 2VCAA 1OD8A 1HKIA 1JXJA 1DEDA 3N12A 4KGJA 1JZ8A 3N9KA 4PTXA 1V3LA 4UOZA 1HJQA 4A3HA 1UH3A 3CO4A 3LPPA 1UH2A 2WC7A 1J0KA 3WDQA 4BQ5A 3AZRA 1E6XM 3FHQA 2ZOXA 4W93A 1B3WA 1HKKA 3QHOA 3CUFA 1EOMA 1UKOA 2PC8A 1MW0A 1CGUA 1DP0A 4DM1A 1HKMA 3RJXA 1A47A 4CGTA 1HL8A 4WSJA 2WBGA 2V38A 3DECA 1XGZA 4NRRA 1B31A 4CVWA 3CH9A 4J7RA 4DWSD 3ALGA 3LPOA 3AHVA 1E43A 1TE1A 2BHUA 2MANA 3K8KA 2EO7A 1UA3A 1W1PA 1MQPA 1UWIA 4AZGA 1VEMA 4ZE5A 1CWYA 3I3EA 4GZJA 5CLTA 4D6IA 1QI4A 3F5LA 2XFRA 1XD1A 1UYQA 2Y5EA 2WK2A 1BYCA 2DGAA 3WMBA 2WSKA 3VVGA 2JE8A 1DTUA 4JFUA 4QFUA 4AEFA 1V02A 1W1VA 2V5DA 1OIFA 4AD1A 1KWKA 3VIJA 3HJEA 2WWDA 2DPEA 4AEEA 1ZBVA 2WMIB 4GO9A 3VDCA 3BAJA 3OGVA 5A6BD 4J27A 4B16A 2D22A 2F2HA 4PMQA 2VURA 5I78A 3RCNA 3WF4A 1QHOA 2GJXA 1X1NA 3M7SA 5FL1A 1H5VA 3L4TA 1MW3A 3GXIA 4GPNA 4UFLA 5CPSA 4XZBA 3MUY1 1PIGA 3MMDA 1E70M 2CETA 1QVBA 3N18A 1WPCA 4GXPA 3UG3A 2BVDA 1UQZA 1LWJA 3W28A 4JL1A 2X0YA 4PEEA 4DUXA 3SCVA 2D0GA 1W9XA 4A3YA 1MQQA 3BSHA 3AICA 3BLKA 3CMJA 1KQYA 4OBRA 4CD6A 2O9RA 2DT2A 1LJYA 2VZSA 1U30A 1GPFA 4AMCA 3M46A 5C71A 3RPMA 1L0PA 1K9DA 3VOCA 2CPUA 4KMQA 1E55A 1OINA 4CD8A 1JZ3A 3T2PA 1W9BM 2WSPA 1E4IA 5I79A 1HVXA 4ATWA 2XIIA 1JYVA 3N15A 1D2KA 1E6PA 1PZ3A 4BF7A 1FFRA 4W5ZA 2OYLA 3ZQ9A 5M03A 4H04A 4L4PA 4Z2JA 5LA2A 1CENA 5GNYA 5GNZA 4JZ5A 3FXYA 3SUTA 4D6FA 4MNMA 3WBEA 1TVPA 4M1RA 2RGLA 4FF5A 1EHAA 1EQPA 1V6WA 4HOWA 4PUEA 4JHOA 3WNLA 1J9YA 4YHGA 1XCWA 1DWGM 3CHEA 3POHA 4BQ4A 1HP5A 4HZ8A 1PX4A 1RH9A 3NSNA 2Q8XA 4WF7A 3WIJA 1LG1A 2E0PA 2DT0A 3A4WA 3UG4A 3CIVA 1U2YA 2D0FA 1UQYA 2A3HA 4JCMA 4Q22A 4GI9A 6TAAA 2GVYA 5CG0A 1R7OA 4AXNA 4S3KA 4ZXLA 3EDEA 2XUCA 1XSIA 4LX4A 4NSBA 1EDQA 5I3DA 4JKLA 1UD8A 1ZL1A 3FAXA 2VRQA 3BAXA 3MSDA 3AFBA 1J0JA 4W88A 3ARXA 1CZ1A 2ZIDA 2W67A 3B8SA 2XVNA 2D24A 3GBEA 3VU2A 1Q6FA 2BY3A 5A6BA 2VCCA 3W29A 4PMDA 4MPKA 5IXEA 4W8BA 3SEPA 1H49A 1GCYA 2DT1A 3AIWA 4PSPA 5BRPA 4JKKA 1FHDA 4H2CA 1BSIA 5JIPA 1AQHA 1KBBA 2ZWZA 3ZJ8A 4TX6A 2FDMA 3BAWA 1WAWA 2RGMA 1D7FA 5DFAA 3QOMA 1NM9A 2E9MA 2QHAA 2ZWYA 1B3VA 4E2OA 5DT5A 1XYZA 2J7CA 4HZ7A 3AIQA 5E70A 5I6SA 1E5JA 5ABFA 2CITA 2E4TA 3N1AA 1BG4A 1XC6A 1JZ4A 2WCAA 3EMZA 4HPGA 4R27A 5EMYA 3SUVA 4CKQA 3MANA 1AQMA 4B9ZA 2BXYA 1BVNP 4HU8A 1E1FA 1EDGA 2G3JA 2VZTA 2NSXA 4AZBA 2J4GA 8CGTA 1JDDA 3VX1A 2Y4SA 5D8ZA 2WWCA 1WZKA 3EMQA 1JFXA 2WVVA 1UWTA 2JF7A 4P7QA 2J78A 4D6HA 1CGTA 2J77A 4JFVA 3PBGA 1MW2A 3AJ7A 1FH8A 2J62A 2GK1B 1LF1A 1OD0A 5JBFA 4AIOA 2NT1A 3W27A 3SCSA 3WBAA 4PTMA 2VCBA 1B3ZA 1UHVA 2OSXA 2FGZA 2WHKA 5A6AA 2X8RA 2A3AA 1K9TA 2IXVA 3I3DA 2Y8VA 3WDPP 3UR8A 3AS2A 3VMNA 2YL9A 4LQ1A 1OM0A 2ZUNA 3SUUA 3VD7A 4LGXA 2X09A 4M82A 3AS3A 4PMZA 4HMEA 3VX0A 1GQIA 3ECQA 7TAAA 4PBGA 2J8FA 1XSKA 5FKYA 1E1EA 4H8UA 3EDJA 1FFQA 4Z2KA 1UR4A 4JCLA 4PTWA 4LYPA 1R8LA 2XTKA 3POCA 3ZM8A 2JEQA 2EBNA 1GJWA 4J3TA 1ISZA 3WD3A 4UQEA 1V03A 4CU8A 5ABEA 2J7EA 1R86A 3PZQA 4QP0A 1UG6A 1VENA 4CD4A 1H0GA 3WEMA 3CHDA 4FLQA 3WDIA 2QMKA 3DC0A 1QI5A 3DYPA 2J8GA 1NP0A 1TFVA 5A8MA 2JEPA 1PX8A 1VBUA 3IJ9A 4MDOA 5HXMA 5A2BA 2FHFA 5AY7A 3WEOA 5HOSA 3WENA 3BCDA 1WB0A 4F66A 4JHZA 4R5EA 2VNCA 3PTKA 1CIUA 2EXOA 5BRQA 3A4XA 1GW1A 4JFWA 4PMVA 1E6RA 3F5KA 1E56A 1WE5A 3WD4A 4AWEA 5I23A 4P8WA 4IM4A 4WIWA 3U7BA 1FHLA 1M53A 4Z2GA 4CU6A 2W92A 4PN2A 1LL7A 3TONA 3NJ3A 2XG9A 3RM8A 3WSUA 3FY1A 3G6MA 1V6UA 2VMFA 2ZXDA 2VC9A 3MV01 2CCRA 4M80A 1JZ5A 3L2LA 5FD0A 4PMNA 1VB9A 1OT2A 1V3MA 1VFUA 3W6MA 2GDUA 5FIPA 1FH7A 2G3IA 5BCAA 3VIPA 3GM8A 3I3BA 1H11A 4QCEA 2EPLX 5CGTA 3MKKA 4MADA 2OYKA 3U5UA 1HXJA 4F79A 1ZJBA 5HDRA 3DYOA 2DT3A 4AD2A 1O7AA 1R7AA 3W25A 2O9TA 3VINA 2HISA 4DUWA 1UKQA 5JBDA 3VNYA 5E9AA 1JXKA 2XPKA 3MMUA 5A8OA 4ZE4A 4V2XA 1EIBA 4WKAA 4XZWA 4IPNB 5GNXA 5EBAA 2G4FA 2CEQA 2WMJA 5LA1A 3THCA 2BNJA 1DWIM 4UFKA 4ZENA 1JL8A 4KRTA 2J7DA 4FK9A 3SIMA 1D3CA 4IPLA 1OIMA 1CPUA 3WF3A 3L4WA 2JFEX 1E0VA 3ZO9A 1KR0A 4X9YA 1M01A 5CSYA 7A3HA 1J0ZA 2WMHA 3WL1A 2G3MA 1GUVA 4TVUA 2XVKA 4TUFA 1Q6GA 4HMDA 2X2YA 1H1NA 1XSJA 2YBUA 3UCQA 4B3KA 1C92A 3QOKA 2D3LA 1NQ6A 4JAWA 3ARSA 1OB0A 1LL6A 3VILA 1GHSA 4PMOA 2XVLA 8A3HA 5D4YA 4MB1A 3VIMA 2VTFA 1HKJA 1VAHA 1CGYA 3WFLA 2EJ1A 1JNDA 3AS0A 4QLKA 2G8ZA 1E6ZA 2QPUA 5EB8A 1UR9A 4OJYA 4PSRA 2VOTA 2ZX9A 2O92A 5A1AA 2ZUUA 2CBIA 4ACYA 3AMKA 4AZ5A 3KL0A 1PJ9A 2DQXA 2DIJA 3MS8A 3WQWA 3F5JA 4KWUA 4P7RA 1NWTA 5AYBA 1JDAA 3BAKA 7CGTA 2VT0A 2J47A 3UETA 1G01A 3GXMA 2BV9A 3A47A 1EH9A 1GOKA 2V3DA 1JFHA 1QW9A 1XHGA 3WELA 3ZJKA 1ZU8A 3W37A 4H41A 1I1WA 5I0DA 1WNOA 2IUZA 1AMYA 1GHRA 3L4UA 4RE4A 4UFJA 2QV4A 3WMSA 1WZLA 3GDBA 4TVDA 1PZ2A 3EMCA 1DWFM 1MXDA 3AZTA 1UD2A 2EPOA 4XB3A 3RILA 5A8NA 1R85A 4MNLA 2J7HA 4EK7A 5DF0A 3L4ZA 1CXIA 2QLYA 1KQZA 3WNNA 5CZKA 1QPKA 3PTMA 4CD5A 3N04A 2CBUA 4CN4A 2D23A 1ITCA 1IV8A 1XRVA 3SURA 1KXQA 1JF5A 4CVUA 1E6SM 4AISA 3A4AA 4FLRA 5CQ1A 2V3FA 4GINA 2XSAA 2CESA 4YPJA 3SCTA 1QNOA 3VIIA 1LG2A 2BFGA 3T0AA 2WHMA 2XGBA 4AIUA 2O9PA 2DH2A 3ZOAA 3CUGA 3OBAA
chains in the Genus database with same CATH superfamily
4BQ3A 1OADA 4MSSA 3AHXA 2W91A 4BR1A 1JG9A 3CAWA 4ES4A 4M6QA 3TTQA 2WNNA 3PF3A 3SSZA 2YPIA 5KZDA 5LGZA 3ARYA 3EAUA 3G8RA 3PPCA 4H9MA 4D8AA 2CXGA 3UQNA 2EG7A 1UWRA 1IR2A 2PAJA 3E9AA 1RUSA 1KKOA 3CUIA 2PBOA 2OZ0A 4HN4A 2J24A 3QMTA 5E6YA 4UMCA 4AD3A 3GTIA 3R94A 2ZC1A 4TOQA 3RM4A 2G5WA 4EWJA 5PTDA 1Q3NA 2GUUA 3NQDA 2PCQA 1JYXA 4GWEA 1T40A 4Z0JA 4ZA0A 3KZSA 4S3BA 3RUBL 3W83A 1XGEA 5HBFA 3W7HA 2V67A 4YVVA 3C3NA 1PUDA 1KM1A 1RV8A 5ECUA 4C6MA 1QWKA 1AH4A 2PA6A 4GQQA 4W9TA 2XN2A 2VUYA 2AL1A 3FDKA 3LUTA 3NZRA 2W27A 4RZBA 2QT3A 3WQFA 3ZWSA 1J6OA 4L5ZA 5FF0A 2QV5A 1K7EA 4ICNA 4NZ5A 4D2JA 2J74A 3W75A 4YTQA 4F9DA 3VM7A 2E1WA 2YYUA 1EF2A 3TDFA 2QCGA 1QK2A 3HU7A 1EBHA 4RK8A 1I60A 4AU0A 1RA5A 4HZ6A 1L8NA 5DCDA 2BOGX 1LL4A 1NDWA 2OJPA 1W8GA 4WGHA 3KEHA 3CYJA 3BZGA 1OGSA 3KVMA 2WNWA 5SWUA 3MDUA 2CLIA 4NY2A 1V6YA 4J4KA 1MW1A 2ADAA 1H50A 1XUZA 4HU0A 3NDOA 4GI4A 1ITXA 2WQPA 3FVMA 1QASA 3TH6A 1NOUA 1KM6A 5IHRA 3WLOA 3W6LA 2B31A 2VEFA 4HA0A 3UJRA 4W86A 2GFTA 2OMAA 5D32A 4QE5A 4NAEB 2QZRA 3B0PA 1WDQA 4OTKA 1CGXA 4Q8QA 4KESA 1VS1A 4BK9A 4HSHA 3FV9A 5BWFA 1QUMA 3DFPA 1VFFA 3RFAA 4FLOA 4M19A 3VTRA 1T96A 4TVCA 3VGBA 1TR9A 4OBTA 4B3LA 2Y63A 2OZ8A 4FA3A 3OVRA 2XIJA 1SFTA 3QVQA 4NT0A 3TA6A 2CLMA 1VFOA 4IMFA 3LCHA 3W7EA 4JTKA 4DHGA 3LHYA 3P0WA 3S46A 2ANUA 3SQSA 3VIKA 3M9YA 2WKJA 4UXDA 1U33A 1UD4A 4EXBA 1Y5WA 2DZXA 3QZEA 1KM2A 3REQB 4WSKA 3O15A 3VMPA 4C5ZA 4GNVA 3B04A 3T8LA 3VD3A 1L2UA 4IUOA 4MNJA 4F0LA 4B5XA 3MP4A 2CNCA 4H8VA 3OYZA 4MB4A 3PZNA 2VX5A 1K6WA 3WZ0E 3WH9A 2OGJA 1R38A 2FHBA 5FSEC 4GZEA 2WW5A 3HGRA 3HPSA 3STEA 1JAEA 3HA1A 4QDWA 3F1QA 4HNTA 1C91A 4E5TA 1LROA 2OWXA 5DQPA 4NASA 5F4SA 1TPVA 2R14A 3WUEA 3VGDA 5DT7A 1TVNA 3LRLA 3EEGA 2VR2A 1GQLA 5D9MA 3RR1A 1ZPTA 3NUKA 3R0KA 1E6NA 4N6EA 2VJXA 3M5ZA 1E5NA 5FAJA 4UFHA 5DXXA 5D2YA 1UWSA 4H9TA 3MUXA 3K4DA 1EZWA 3Q94A 2QS8A 5EKYA 1NH6A 3SI9A 4P61A 1H4PA 2E8YA 4H6KA 3ORWA 1P0BA 1RZMA 3CGTA 3U5YA 3NIYA 4GLEA 1V0KA 4MYXA 2ZZ2A 1GNXA 1F76A 4L6DA 2Z1KA 3TAOA 2I1OA 3DXIA 3V5CA 1OFPA 4S2BA 3T7VA 1QI0A 2VYOA 2E40A 4XX6A 3HFYA 1Z48A 2X41A 1TV5A 2XIBA 3I7QA 4K1WA 2P0OA 5CZ0A 4O15A 1B3OA 1PKLA 3E74A 2QGHA 5HPCA 1YDYA 2Z1WA 4AZCB 1PB0A 2Z29A 2YFNA 3B9OA 1ZY9A 1IGWA 3DHUA 3LCXA 2ZZ1A 3S0CA 4JFTA 4EE9A 4RE2A 5AC4A 1WZAA 3S1VA 1Y5XA 2WSYA 3NZQA 4IIDA 2G96A 4GUFA 5TD4A 4EXAA 2GSEA 3M16A 3EWYA 3OOQA 1VBJA 3TOPA 3LBCA 3EDDA 3CQ0A 4WSHA 2EQDA 4YCPA 3HG5A 4G7EB 2DZAA 4U5IA 3WL0A 4QE1A 4LC6A 1HO4A 5H8MA 3EXRA 4KRUA 3TC6A 5A8QA 3FNDA 4D6JA 5KMYA 4A4AA 3PJXA 3LXAA 3C0QA 3DERA 3FW6A 3UZZA 2TODA 4HSNA 1QK0A 3UR7A 4NKCA 4FX7A 1HNYA 2XFFA 3A24A 2V82A 2I16A 4MF4A 2D20A 3GTNA 4QCFA 4V1XA 1HO1A 2ESCA 2QNEA 3SY8A 2ZZ3A 3E5BA 1SZRA 1GZ1A 3PG9A 1QRQA 1Z44A 3K46A 2XSBA 1EL3A 2PF8A 3TN6A 1PKYA 2QDDA 1J2BA 4OBSA 1XKJA 3AMCA 1E4MM 1J18A 2R91A 4TTGA 2W6RA 4CNNA 4IMCA 5DRCA 4KEMA 4CN1A 1AVAA 2NVDA 3I10A 1PHQA 1VIWA 4O52A 1OCJA 2WC3A 3WLPA 5FF3A 2DZWA 1D3HA 4HP5A 5HQMA 1JRCA 3RRXA 4V33A 3GYCA 5D38A 4GZIA 3GBDA 3DGBA 4QNWA 3IJ7A 3T0TA 4UZUA 4N4QA 2Y8UA 1EP2A 4ML9A 2JGQA 3RPDA 2O0TA 2DUAA 3APYA 5G4WA 2OT1A 3CH0A 4HCLA 5CSUA 2EPKX 3NQ7A 3DUGA 2AQVA 1DOSA 4OT7A 1ZBWA 5CZSA 5AKQA 1VBHA 4S2CA 4HVXA 5A3HA 2VGBA 3NPWA 4REQA 2TMDA 4EAMA 4M7TA 4H19A 3TSBA 4ZFMA 3T0CA 4JY8A 3B8UA 3G1DA 1AUSL 1WDSA 2ZRYA 4QLLA 4Y9NA 3ZT7A 5CPOA 1LOLA 2OX4A 3VUPA 3ZVHA 3A12A 3QFWA 1ADSA 4DWSC 1KNWA 4ZBCA 4WDXA 4LB3A 1FWNA 4LNYA 3GR4A 1IQ8A 3ITLA 4KERA 3F2BA 3BLFA 4K39A 4O14A 1PEZA 1CEOA 1KLZA 3EEZA 2VFFA 4IF2A 3GXFA 4NJJA 4RNHA 4AD0A 4HA1A 3EA1A 1MRQA 3TP4A 4X63A 1NSJA 3G77A 3LTYA 2QUUA 1TO3A 4L56A 4KCTA 4IQEA 4K38A 4HPNA 3FDGA 3CT7A 1W9VA 3HQ1A 1ZTVA 2J9XA 2VI0A 2TAAA 3SSJA 3QV7A 2V5KA 1A3XA 1KFBA 2V5CA 2GGHA 4K7YA 3HG3A 2GQAA 1LBFA 4PE8A 5D9NA 1EFZA 1FCBA 3WNKA 1YIXA 3M1ZA 3NYDA 2WLZA 4W89A 1KTNA 1HUVA 2JKPA 4HNUA 2Y5SA 2QCNA 3CEPA 3H4XA 1YE6A 3PSWA 2DSUA 5BMWA 2B7OA 2XH2A 4HYVA 1KC7A 2W61A 2ZX7A 1I4NA 4LS2A 4C6BA 3A3WA 3WD1A 3W24A 4QJ4B 2W4XA 3HGOA 3QHNA 4W85A 1PIIA 2JF6A 3DOPA 6TIMA 5I3HA 3RN6A 4ZL1A 1E9LA 4CQCA 1XR2A 8XIAA 3OZYA 3H26A 2C3ZA 3IK2A 1E4NA 2G95A 2ZQ0A 1VPYA 2NXGA 2O4MA 4NX5A 2IPJA 4IX0A 2V3EA 2FZ9A 3FEMA 4ZCWA 2X0HA 4PMJA 1E6QM 4IL0A 3L5AA 4AIBA 4WKHA 4JEQA 1ESWA 4ZFCA 1GOOA 2WJDA 2ICSA 4KKXA 3UY8A 4IOTA 4DO4A 1TMLA 4F2BA 3SW6A 3U4FA 3EDFA 3R25A 3GYEA 4I8YA 5LYRA 1FXPA 1UR2A 2XINA 2E6YA 5TNVA 3K8MA 1YPIA 1FWIC 3V16A 3ZLFA 3MVIA 2BS9A 4AC1X 3LRMA 3ZJ6A 2J25A 1K8ZA 4ATLA 2FTWA 1FA2A 5CH9A 5C0QA 5K4XA 3TROA 1E51A 4XZMX 2Q8LA 1FVPA 1IIHA 1OWQA 4BS0A 1XGDA 2NX1A 1LP6A 4C6KA 1Y65A 2HJPA 1IWPA 2HBVA 3HPXA 3TJ4A 3IJ8A 3QSTA 1FWSA 4TXEA 1OYAA 2D1ZA 3OIXA 1I2PA 4MAVA 5D03A 3PPFA 3PAOA 2H3DA 4LS1A 1WV2A 3KRZA 3F4DA 4X2PA 3TC3A 2VQTA 1A80A 1BEUA 1WA3A 1J12A 1IXPA 3O7UA 2WZHA 2CFFA 4LUTB 4C1KA 1B2YA 1MFUA 5LNUA 3G2GA 1ZAIA 3H22A 1OX6A 4J3XA 2Q09A 1W3HA 3GNOA 1QAPA 3ELFA 3KDNA 3LMZA 3TQVA 1E1CA 1TVLA 2C18A 1TV2A 1O12A 2YBTA 5CJMA 4EANA 4MJZA 3SUSA 4PL2A 2FJKA 4BFAA 3CZKA 1XF0A 1ZHAA 3BXWA 3W7KA 2J75A 6REQA 2X05A 3MUZ1 3PBMA 1B3YA 4UNIA 2XM2A 1V3HA 3CWOX 3P2VA 3GE7A 1KTCA 2YCIX 1Y0EA 4N6FA 3SQLA 1L6FA 3ZS4A 2Q01A 6XIMA 4XZ9A 3T09A 5AFDA 2QJMA 3KVKA 1X8FA 3A22A 4Y9MA 3NL2A 1XD0A 4RXFA 1GQNA 1J6PA 1W3JA 4MZ8A 5BXSA 1EX5A 1Z32X 3S6TA 4IISA 3NZGA 1QMLA 2CLHA 3W7NA 1GOMA 3KRSA 2YYTA 3L23A 2DH3A 4DF2A 1KBIA 3RYSA 4MB3A 1KM3A 3NQGA 3WQ8A 2G3NA 3SGZA 4IT1A 1ELSA 2HMCA 1OZMA 3K13A 2WYSA 3UYCA 1PTGA 3FA3A 3WK0A 3PY2A 1W91A 4GIRA 1AJ2A 3WKZA 1MDRA 2FIQA 1EQCA 5FCZA 1WKFA 3MA8A 3HJZA 1QBAA 1RBAA 1UWAA 1PIFA 3PC0A 3B05A 4WUIA 3G1SA 1MVYA 3PZGA 4M7SA 1S2TA 3NEVA 3DGRA 4GUHA 1S2UA 2HBXA 1P0KA 2DSWA 3QHMA 3EKGA 3LLFA 4DJFA 3OJGA 2V0TA 3IARA 1I9CB 3AROA 4JNYA 1PX3A 2E9BA 1EC9A 3N6HA 4XKMA 3WDRA 1E40A 2HQAA 1BYBA 1DJXA 2WZEA 4S3FA 3C2YA 3OBKA 3P82A 1Q45A 5EMKA 3O63A 1GOWA 2ZUSA 3F4VA 5D2VA 6ENLA 5DANA 5DCEA 5DO8A 4UB9A 3T07A 3EDKA 2INEA 3LPFA 3RF9A 2C0HA 1UIPA 4QR6A 4H9UA 1MSSA 1C90A 3PZMA 5AVNA 3B3DA 2IPGA 3CB8A 3T6CA 2VP8A 4MLRA 5FEWA 1BVZA 4ML4A 2UY5A 1A49A 4KCWA 3TQ0A 4WXYA 4DO7A 2Y2WA 4JTCA 2VWTA 3PHAA 4KIEA 4LV9A 2ZX6A 3F2DA 1KM4A 4OZOA 3HIJA 1NDZA 3BJTA 4GY1A 1B57A 1F3WA 1XFCA 1K7FA 4GABA 2CYGA 3MUAA 3CEUA 2ALRA 3PZOA 3JVAA 4KFOA 3M5XA 3GTHA 1YNQA 5T9CE 4S39A 4KWSA 4LY4A 4WEVX 1HKIA 3RHGA 1EGVA 1VCFA 3A23A 3N9KA 3SQMA 2Z7KA 3KOWA 3T05A 3LHZA 4L1WA 4LALA 4A3HA 3CO4A 2BBFA 3P5ZA 2WC7A 4PUUA 3FVDA 1B5TA 3FHQA 5I3FA 4FS9A 4YYFA 2PC8A 4JIHA 3QPEA 4H00A 5K3VA 3LCLA 1MRAA 3M5VA 3DECA 1RA0A 1B31A 1JDFA 3TEVA 4HN8A 4TIMA 4LBRA 3K8KA 2ZZ7A 2CZFA 1SO4A 3MC5A 4MUPA 1BKHA 1PYFA 1UA3A 3GRIA 2FPTA 3PNUA 2BGSA 3PBVA 4ZE5A 3NZPA 4LVAA 1U1JA 4GZJA 5CLTA 1VH7A 3F5LA 1EJ7L 1XD1A 3WMBA 3VVGA 2OVLA 4REQB 1FWAC 1W1VA 3DI0A 3UY7A 1OIFA 3NQFA 3HJEA 3M6YA 1UC5A 3S5SA 3TJXA 2BASA 4GO9A 1SJAA 2INFA 4CQBA 3C2EA 4O0QA 3OGVA 3SB0A 3IJ6A 4RW3A 4PMQA 4D9PA 1BWKA 1C8VA 5BRBA 3LCFA 4KWWA 5LXEA 4C6NA 1W1ZA 2Y7GA 5LIWX 1MW3A 4L64A 3R11A 3MUY1 4DJED 2E68A 1EZ2A 5LIXX 5C55A 3MUCA 3GZ3A 1N8IA 1WPCA 2FMNA 4GXPA 1UQZA 4FNQA 4X2RA 1PDZA 1PDYA 4MWAA 2C16A 1W9XA 1F74A 3GU1A 3SJ3A 1MQQA 5FJUA 3AICA 3EX6A 1JEZA 2VEGA 2DT2A 5CSRA 2VZSA 1U30A 5G4HC 5C71A 1A5LC 1M7JA 2CPUA 3KTSA 4HGXA 4LH8A 1E55A 1OINA 3QLLA 4PODA 5AHIA 3B9NA 3DAQA 1JZ3A 1RLDA 3URAA 3T78A 4UNKA 4Z0SA 4JTFA 1FWJC 3WLKX 1E6PA 4BF7A 4K6AA 3LS9A 2POTA 4CEUC 1TYGA 5DX7A 3GR7A 5M03A 1LT8A 5G5IA 5GNZA 2FB3A 4UTLA 1XP3A 4QAIA 4GFSA 3W1UA 3TYBA 2RGLA 1W5MA 3VDGA 4LOCA 1V6WA 1G4TA 3VKDA 2QVNA 3PBUA 4LB4A 1TQXA 4YHGA 4HZ8A 1JQXA 2XH0A 3C2OA 2BLEA 1DXIA 4Q6JA 4CNOA 2E0PA 3KVJA 4IPIA 3CIVA 1U2YA 4KF1A 4GI9A 6TAAA 4Y9OA 4JQ3A 3V0TA 4RLIA 3GVWA 3DFHA 1XLGA 1TQJA 5FEPA 1AFSA 2VHLA 4IFKA 3IVTA 3FAXA 5A5WA 3MSDA 4W88A 2ZIDA 1X98A 1EKOA 2W67A 4AAJA 3B8SA 3H7VA 3GBEA 2BY3A 5A6BA 3UZJA 1P4CA 4PMDA 1JCMP 4W8BA 7TIMA 3TYEA 3SEPA 4YXGA 4OU1A 4PSPA 1FHDA 1VFLA 2J9ZA 5JIPA 4YTRA 3BLOA 4ZB2A 3BAWA 3N14A 3M64A 2RGMA 4CQ9A 1M3UA 3XIMA 3WCZA 1NM9A 4UR7A 4DXXA 4J2MA 3GHUA 5HWJA 5EMLA 5DT5A 1XYZA 5CJNA 4JPGA 1TELA 1PSCA 5I6SA 4HMNA 5ABFA 3STPA 3MHFA 1H7XA 3GC5A 4WQ6A 5U4NA 4DN1A 5EMYA 3SUVA 1VCVA 1XINA 3MANA 2BXYA 1BVNP 4GJJA 3I65A 1XJBA 4K7VA 1E1FA 1IT7A 1JDDA 3CTLA 2Y4SA 3RGTA 1UBPC 3TR2A 4WHBA 3EMQA 2IKGA 2BG5A 1Q2RA 2J77A 4JFVA 4Y8FA 3WBYA 1FWWA 2J62A 2GGEA 1FY6A 2VFHA 5K4ZA 3GC2A 2OSXA 4GQBA 4Q4KA 2FGZA 2WHKA 4NZ1A 1LTDA 4IIEA 4JS3A 2IXVA 1E1CB 3ANVA 4FALA 3WDPP 3UR8A 5HANA 4LQ1A 3G24A 1OM0A 4AHOA 4ZVJA 4LGXA 2X09A 4M82A 1FHUA 4HMEA 4UTWC 1GQIA 3ECQA 3ICJA 7TAAA 1TJPA 1W8SA 1XSKA 3EDJA 1UR4A 4JCLA 1PHWA 2LLEA 3I4KA 1HKWA 3R6IA 3VOHA 4A8IA 2EBNA 3L2IA 4OWGA 2H8ZA 1XLFA 3CASA 2HTMA 3FEQA 4A05A 3MP5A 3LM7A 3NQCA 3SO7A 1K1DA 3CHDA 1QO2A 3P8IA 2NWSA 1NP0A 2ZTJA 5A8MA 3W84A 4JICA 1E9IA 2HSAA 5A2BA 3WENA 4HU4A 2VWSA 4F66A 3PM6A 4NX0A 1K4HA 3PTKA 2C1GA 3P7YA 2EXOA 5BRQA 3PFMA 3A4XA 1IR1A 3G0SA 1R3SA 1A0EA 1E6RA 3O1NA 3W2LA 3C2FA 4AWEA 4CNPA 4AX6A 3NVDA 1K8YA 1W17A 1M53A 1IWAA 2AKMA 4CU6A 4PN2A 4RZ5A 1LL7A 3TONA 3NJ3A 6ALDA 4FEZA 2GVEA 3V0UA 1KFKA 3H2EA 1ZSXA 3WSUA 4Y9AA 3G6MA 1V6UA 2XH7A 2ZXDA 4UWMA 3MV01 2CCRA 4M6VA 4C65A 2AQOA 3GTFA 1EA0A 2AAMA 4PMNA 3U2ZA 4J1OA 2WQDA 2GDUA 3S1UA 2VD9A 5FIPA 5BCAA 3IWPA 3VIPA 3GM8A 2BOFX 2TRSA 2X40A 4IL2A 1H11A 4L65A 5GJMA 2YB4A 3P60A 5IOBA 2PTDA 2OYKA 3TW9A 5HDRA 1SFLA 1IWBA 3Q2DA 2PDNA 2PUZA 1LOSA 3VINA 1F8MA 2XIQA 3M0IA 3S4TA 1RPXA 4QHRA 3VNYA 3QV8A 1UP2A 4QQUA 5A8OA 4V2XA 4MZYA 2BVWA 2ASHA 3W74A 4DBWA 2C91A 2G4FA 5LNWA 4M3PA 4RDYA 1W5OA 3ANUA 2PZ0A 3K2GA 4ZENA 3UA4A 3DFTA 4O4VA 4KRTA 4QIUA 4YWIA 3LD5A 4FNRA 3WF3A 5DBUA 1E0VA 3BGJA 3UPBA 4J9JA 3GDTA 3UJSA 1OFOA 3VCCA 1M01A 1S1PA 1OQFA 4A22A 2Z00A 5FJOA 3WL1A 4TVUA 4XAYA 3CAVA 3UCQA 3QOKA 4JAWA 1DJGA 3CPRA 1RALA 2DJXA 4IHCA 2XVLA 1DQUA 2C6QA 2YXGA 8A3HA 4QG8A 1EXBA 2F6UA 1A5CA 2IMRA 2OFJA 3O05A 3TIMA 4B4HA 1HKJA 4PL1A 1R6WA 1CGYA 1H61A 1KBJA 4QLKA 1YX1A 5EB8A 3OPSA 3OTRA 1OFQA 4KBXA 4O1BA 3CU2A 3DHFA 5CC7A 1TTPA 3HURA 5A1AA 4C6CA 2R1MA 3KL0A 4PULA 1F07A 5D2TA 2IS7A 2IKIA 1G01A 3IJIA 3GXMA 2C19A 5HAOA 1EH9A 1JFHA 1XHGA 2FZ8A 3MVTA 1ZU8A 3W37A 1H7OA 2I5IA 5I0DA 1VP5A 1KA9F 3GHTA 2PRHA 1F8IA 4FXSA 3LHWA 3L4UA 4RE4A 3HOJA 3WMSA 2X7VA 4JYFA 1DWFM 1MXDA 2Z28A 4PEKA 2EPOA 4JR5A 3AXMA 1JPHA 5ABTA 2Q71A 2Q8ZA 1UUOA 4JQ1A 1XG4A 4IH3A 1KFJA 3JR2A 1HGYA 2IQ0A 1IV8A 1XRVA 3V75A 1NF7A 4GISA 3A4AA 3NL3A 3PR2A 4FLRA 5CQ1A 1ZCCA 2CESA 3NQAA 3SY5A 3VXGA 2AGKA 2V63A 2BFGA 4Z17A 1YBQB 3VAVA 3QR1A 4AIUA 2O9PA 2DH2A 1UUMA 1DJWA 1OFAA 2CW6A 5AC5A 3VA8A 2XGIA 4D1JA 2JIEA 3R58A 2WCSA 2XZ9A 1J01A 4H6RA 1DJNA 4ZZ9A 4ICMA 3BSMA 3U48A 1NARA 3W2NA 3SCNA 2DV0A 4XZIA 4HTBA 5GQBA 3FJLA 1CB2A 1ODZA 1E0XA 1OSEA 4OIFA 5GPRA 3ZYZA 3E0LA 1HF6A 4UTJA 3FCPA 1D3GA 1S38A 1RK5A 4B2DD 2C8NA 4MWAB 3O2LA 5K9XA 2ACQA 3NO3A 1X6NA 5J5DA 2UZ9A 2VC7A 3PZUA 3MO7A 3PJUA 1H7NA 4O8AA 1E73M 4QRNA 3WUGA 3GNPA 1I2QA 3WDHA 1CCWB 2OKOA 4EOUA 3ERPA 5I24A 2OKTA 3B8VA 1QCWA 3NOYA 5K7JA 1YW1A 2YOCA 4Q3MA 4E8GA 1S39A 5BYWA 4PMUA 2ZDSA 1H7PA 2WHJA 1EGZA 4JTIA 2C13A 2BGNE 4TMCA 4XD5A 3FX4A 1DHKA 4HPXA 1MNSA 5F1UA 4B5VA 1BWLA 3QTPA 3AS1A 3BZJA 4L4LA 3FHAA 1GVOA 3VCRA 5TQLA 2J88A 4GX9A 3EOOA 1US0A 3BGAA 4KRZA 3W00A 1DL3A 3AIVA 3ALFA 1JAKA 1JZ7A 3THQA 4GCXA 3B0VC 3WK1A 1EBGA 8RUCA 4ROQA 3B8IA 5EMUA 4M0XA 3GFZA 3GG7A 3QLDA 2SFPA 3W81A 1GVYA 3NXLA 5HULA 3BJFA 3VCNA 3NGJA 4RPQA 2DQWA 1OCBA 5FJTA 3UJEA 4FR6A 2BHZA 3CUJA 4H9YA 5CPLA 4ZQCA 5IHSA 5AHLA 3T40A 4E8CA 1H0IA 3QYQA 1GVQA 1TCMA 3VIGA 4NILA 1AW1A 5B80A 1ZLPA 1Q6DA 2R8WA 1ZP3A 4GQ0A 4FOJA 4IG2B 3OLGA 2F38A 3AYVA 4C7DA 1TA3A 3HMCA 3KOXA 2RJHA 3W2MA 3GTXA 5HATA 3VOGA 1AL8A 1LWHA 2PDPA 2Y7DA 1MEHA 4A3QA 3S2CA 2VZOA 3II1A 5LGXA 5D09A 1S5WA 3HPZA 1GOQA 3AHZA 5LA0A 3APGA 3AI0A 3P0XA 3A6OA 3CQHA 4V27A 2A7RA 4O54A 2GOUA 5HPOA 4KFNA 4OV4A 4GXMA 4PRRA 4AFYA 4KFPA 1VD6A 5CCZA 4RNIA 1OGBA 1MXGA 1TV3A 2OEKA 2E5BA 3M4HA 3KBSA 3WDJA 2JKAA 3S5NA 1TIWA 1AH0A 3ZSSA 4HJWA 1A53A 4NZFA 2PWEA 3NQBA 3BCFA 1E72M 4HOZA 5ABFB 4N0RA 4CD7A 3NVTA 3MW7A 1P6BA 1H41A 4WY0A 1LLWA 3B9AA 2ZCGA 1EX1A 1DJQA 3QGKC 1DXEA 1WXJA 4L4OA 4GKTA 3UXDA 3UWQA 1JYWA 1L8PA 2VFDA 1MWOA 2HPIA 2XN0A 2W63A 1VFHA 2PDGA 3AMGA 3VGEA 1B9BA 4IMDA 3L4VA 4A35A 1K70A 4PUWA 3CLWA 4FP1A 5JVLA 2XFYA 3ABOA 4EWND 3HF3A 2I17A 2GJPA 2ISVA 3W6YA 1XUUA 1GZGA 4LANA 4CCEA 3M0MA 2OZTA 3T08A 2ZUVA 3AYRA 3ITCA 4HPHA 1CXEA 2P53A 1JNEA 2FDSA 2YZRA 4AHPA 1LUCB 4PUDA 2GDVA 3T2OA 4JGDA 4LEQA 4YLWA 1XQLA 2I14A 3EWXA 1UKTA 1GOXA 3TX9A 2OLAA 3GW3A 1K8XA 5AYZA 6A3HA 4WK9A 2P0IA 5EYWA 1KGXA 3IVUA 3FIGA 1OGGA 4E8DA 3U2CA 2UY3A 4IJCA 3OIHA 4TX9A 1IXNA 3J7HA 4I5UA 1IT8A 3OVGA 4IPPA 1Z9AA 1NIUA 5E9XA 1NEYA 2EG6A 4G1KA 1IZKA 3W1TA 1CTNA 2QUNA 2NUXA 4HA3A 1G9HA 3TYZA 5I2UA 5I5RA 5DCBA 3D5HA 1DWAM 5KZ6A 3WQVA 4TO8A 5A6LA 3UZYA 4DY1A 3AAMA 2FZBA 4MLJA 5FI8A 1XIDA 2DU2A 2RDTA 4C6IA 3KLLA 3OHMB 1EO7A 2R82A 3K30A 4KH2A 4K3ZA 2PWUA 3BW2A 2XWDA 4GQGA 4X0NA 2QDHA 2Z6JA 5ABGA 1UD5A 1US3A 3MHGA 5F1VA 3U8GA 2UY2A 4W84A 4MAZA 4K2SA 2Z2BA 3Q65A 4JKMA 3PN8A 2CHNA 4DVOA 1XBYA 5HUPA 3V18A 3M41A 1DIOA 4LYRA 3IGXA 4F3HA 3PWIA 2C1IA 2GGJA 3T9PA 4QDPA 1TE6A 2V5JA 3WQOA 1YDNA 1K4GA 2Y89A 4ACZA 3O6AA 3MB9A 4ADUA 3PUOA 3ITGA 3CHCA 4DZ5A 3EB4A 2H6RA 2Z1SA 2QAFA 3SM0A 4YU1A 1ZB5A 3VDHA 4FOUA 5D9OA 2FPYA 3B8DA 1PWMA 2CLFA 2GJLA 4XWUA 1T8QA 2RUSA 5MKGA 4RDWA 3NDYA 2OCZA 3ARVA 3I4EA 3EWZA 5JUVA 3UG5A 4AZHA 4WRHA 1CB7B 3GHRA 6PTDA 4PYSA 3L65A 3H12A 4GCAA 1LQ0A 1NOFA 4JHMA 5C8BB 5HINA 1TWSA 3N11A 3CPGA 2NLYA 4AW7A 3T1GA 2FZNA 5CC5A 3TN4A 1ME7A 2X1IA 3R89A 3ZLHA 1SW3A 3OZOA 1KXVA 1WCGA 2HDJA 2OT0A 1BGAA 3E49A 3BICA 5DMMA 1R2SA 3KP1A 1H2JA 1IGSA 3W1LA 3TC7A 1EP1A 1HL9A 1VJZA 3VD5A 4GI6A 2FGBA 1OY0A 3DESA 1HL2A 5M5DA 3AIUA 3K1GA 4QSHA 3AMDA 4FXFA 4JTEA 3ABZA 4ZXOA 5LSMA 4DX3A 1NP2A 3RLHA 4ZQMA 1XRFA 1ZUAX 4F0HA 4NF7A 3OZPA 1QI3A 3BH4A 1V0NA 4D6EA 3M07A 4JNZA 2VEMA 1SVDA 4ROPA 2C71A 2V3GA 1F5ZA 4US5A 2R1LA 1QNRA 3LBMA 4MOZA 3R2GA 1P0EA 3ITVA 1CXFA 5E0CA 3TNBA 3LV5A 4EF9A 3KBMA 4HJFA 3ZT5A 1QI2A 4W8AA 1H3GA 3OB8A 3T42A 4AZ7A 2FH8A 3K8LA 1WP6A 4YYCA 1H09A 1W5NA 2V69A 3AMLA 1JR1A 1VEPA 3B9DA 3CPUA 4DJDD 1RJQA 2CLOA 1HGWA 1E15A 3VGGA 1DJYA 1NFPA 2J7FA 4R7OA 3ZFHA 4IP5A 3DEQA 4XSMA 3BE7A 5FF2A 4MWAE 2YA2A 3Q45A 2PI6A 4YTTA 3UNTA 4PRWA 1DJZA 1RD6A 3W7MA 3R43A 3OGRA 4NYYA 3TOYA 3ABQA 3CWNA 5C7VA 3PZTA 3W85A 3R8HA 1SPQA 4HD5A 2VEPA 1W1YA 2VR4A 4LCSA 4M1BA 3MWAA 4Q8MA 5CBIA 1EOKA 1GJPA 1R3WA 1MFVA 4JX5A 3DBPA 3PWGA 3ISIX 4E2VA 3EXTA 1CLVA 1N82A 4GYKA 2XWEA 1DIDA 3ARZA 1ITQA 1X1ZA 3IJQA 3E2VA 3RU6A 3V36A 3H2OA 1VRXA 1ICSA 5F2MA 3EZ4A 4ORMA 2ZVIA 4JN8A 3PJTA 4HHPA 2ON3A 2P1FA 1AD1A 3WQGA 3CV7A 5DMLA 3DFOA 4NJHA 1XCFA 3G6LA 4LPCA 4Y96A 4U2ZA 2A79A 4HYRA 2QKFA 5EL1A 3UGRA 4HK7A 3THDA 1MNZA 3CIWA 4PMRA 2RHGA 1XPGA 3GXTA 4GQRA 3AIRA 3NL5A 4F4RA 1W3TA 1EYEA 3CUHA 3T55A 1KXTA 3UWVA 1KCZA 3K1DA 2QPXA 3WY1A 2QF7A 2CZEA 4MY9A 3GKFA 2OLHA 2E09A 4B5WA 2EGZA 4IMGA 1OBAA 1JCNA 6CGTA 2GWGA 1UMLA 4U3AA 3VKBA 4H3DA 3W0KA 2VQUA 4B5TA 1IXOA 1LQ2A 3LSBA 4I90A 4Y6GA 2X1TA 3KTCA 3F4CA 4KCVA 5KEZA 2YKKA 2VL4A 3FSTA 2VVNA 3RNDA 4WLCA 4WD0A 1C9DA 3TZNA 1XKYA 4UQAA 4HPJA 3E02A 4CN6A 3BANA 3N2BA 4LVGA 5E09A 1JVNA 2J7BA 3GAKA 2FGLA 4Z1CA 4C6LA 2ZX5A 1UWQA 4H6EA 4PMXA 3LENA 2QQ6A 1TUXA 1JI2A 1ISXA 5K2ZA 1FP8A 3GDRA 1ALDA 4Q4MA 4F40A 1GVRA 3NFUA 3R7MA 4DJEA 1FOBA 1R0MA 4GO8A 4O12A 3W4RA 1F61A 1TA3B 1MUCA 2WBKA 3C0JA 1UZ4A 4DLFA 2OEMA 2ZXBA 3QY6A 3BCJA 1NWRA 1OFBA 2QCHA 3NCOA 3MYOA 1S2VA 5CGMA 2HV5A 1FCQA 3TN3A 3S6OA 3GH5A 3F4NA 5FA5A 5HA7A 4DIAA 4IIHA 5H1WA 4OUEA 5IFPA 2VZUA 3REQA 1VFMA 4GUGA 4F0KA 9CGTA 4GI8A 3JW7A 3KHJA 2WM1A 3URQA 2BB0A 3UNDA 1QPOA 2PWFA 3QPYA 5RUBA 2EPNA 1WO2A 1B54A 1Q7ZA 3AYSA 4UQCA 1JJKA 3ZXWA 1QOXA 4FR1A 1TPEA 1XIFA 3M6DA 3MWCA 1SO6A 1UC4A 4GC4A 1J10A 1UD3A 5FACA 3G1AA 3LBOA 1OCQA 1G4SA 2BVTA 1A0CA 2Z7GA 3LB0A 3G3MA 4WY0B 4DJFC 1TX0A 3UESA 4JOMA 5A69A 1GTEA 7REQA 1GPWA 4B9YA 4C6OA 4AVNA 4E4PA 3HZ3A 1TPDA 2Z1VA 2QJGA 2OU4A 5A2CA 3QKEA 3H2MA 3TE9A 2V6AA 4W7WA 4US6A 2WKGA 4UTMA 3DC8A 2BXZA 4ZO9A 4MM1A 4GACA 3PB0A 4AG0A 2NW0A 1EXPA 3H70A 1NAL1 3FJNA 2FTYA 4EPEC 2WNZA 4EPDC 3LCGA 3NPUA 2WKLA 1OC5A 1NY1A 1O1ZA 2QVHA 1AQ0A 3VZXA 3RCMA 2PU1A 3BO9A 1IIGA 2OYMA 3QBUA 1ZP4A 5ECVA 2HRWA 4DQWA 4YS1A 1SW0A 1FUYA 1TJRA 1VJIA 2YA0A 1AG1O 1S3HA 1WDPA 3SCWA 3CMFA 4Y2WA 4F8XA 5C54A 4AZCA 2GJRA 3W86A 4EXQA 3BOFA 3ARRA 4XG1A 3LERA 1TKKA 5CGQA 3AXIA 5DN1A 5HWNA 3OA5A 2HK1A 2E5CA 4Q6XA 2Z2AA 4DZHA 2WMGA 1RLCL 1GORA 3TQKA 2GVGA 3ARPA 3ITTA 3CHFA 1RD5A 2YCLB 2XN1A 1JDCA 1XLIA 5BXRA 3M0ZA 1DWJM 2DZVA 5I3KA 1EC8A 5C2CA 1BXNA 1SSDA 1QO5A 1RCXB 3OP2A 4R7JA 3OW1A 3TW7A 3ZLGA 3GB6A 4BA0A 3WLIA 4YCOA 4NAFA 1X39A 3W1AA 1KGWA 1W0MA 2B7NA 3PZVA 3TJIA 1J5SA 2PWGA 4ZQRA 2DUZA 1MEWA 1B90A 4ZO8A 1XH2A 4DUOA 4Y8EA 1R2RA 3IGHX 5A6JA 1VGAA 3ID7A 1G69A 3RO6A 5I3JA 2QCLA 3DH7A 4V28A 9XIAA 4J3UA 4XZNX 3THUA 2VFEA 3G1XA 3UWWA 3UEQA 2TSYA 1ENUA 3L2MA 5AOUA 4R85A 3KL5A 2FQIA 4JTQA 1F4HA 3C3UA 1JZ6A 5H91A 3W07A 2YLAA 4XTDA 3SR7A 4LUIA 3L0KA 3UXAA 4FX6M 4GG9A 9XIMA 4AVFA 3SCRA 2NUYA 5IFTA 1F3XA 2DSVA 2E67A 2VUNA 3CJPA 3A5FA 4MWAD 1UKSA 3BMVA 4RKAA 1RVKA 4ACZB 4HMCA 3VIHA 2R6OA 3WJYA 3AHYA 2ZRZA 3RXZA 1L6SA 2DEPA 3ZIZA 2XJ7A 1UKPA 3SN0A 2Z2UA 4K36A 4MJ4A 1V6VA 4AZ6A 4XSLA 3DG7A 1XLAA 1F7BA 3PVFA 4C6JA 1A5AA 3N12A 4KGJA 2QXWA 4RPPA 2PU0A 1JZ8A 3VUSA 1HJQA 3UW6A 3IIXA 4MWAC 1UH2A 1J0KA 3WDQA 3WLQA 1D9EA 5LIUX 1B3WA 1YTEA 3CUZA 1VCGA 4LBUA 1A0DA 1DP0A 3GKAA 3SY1A 1HKMA 1HL8A 4NRRA 3TFXA 4D8ZA 3KVLA 4G56A 2E77A 1TWIA 3QV6A 2MANA 2QUVA 2EO7A 2PURA 3STFA 4LW7A 1W1PA 3MKCA 4H7ZA 3MI2A 1MQPA 1E9YB 2F9RA 4AZGA 3O16A 1I0BA 1UMYA 3L12A 2XFRA 1UYQA 3RR4A 4IXXA 5C2GA 2WK2A 1BYCA 3KRUA 2WSKA 3M7WA 1CLKA 4QFUA 3QW4B 4L6OA 3VIJA 3P74A 2DPEA 4L9YA 2ABAA 3SFWA 1EIXA 5KZEA 1DE5A 5A6BD 3H2CA 4AY8A 2D22A 3CL7A 2VURA 3APTA 5F2IA 3WF4A 1QHOA 4AB4A 1J2WA 1EEXA 5H8UA 4GPNA 2QCEA 5CPSA 5IBXA 1UR3M 2GSHA 2VGIA 2Z26A 3QMRA 3BPWA 2O56A 3GDLA 4EAYA 2GQ9A 4IGHA 1GW9A 3UG3A 2BVDA 4JIPA 1V8EA 2V68A 4JL1A 4PEEA 3SCVA 4O16A 3GVQA 4B5SA 3KM8A 3AALA 4KEZA 3CMJA 1KQYA 4LU0A 1XI3A 4H1ZA 1LJYA 3W22A 1EB3A 4AMCA 1GPFA 1AODA 5KSWA 1K9DA 3B8WA 1XDLA 4KMQA 4I6VA 3P8JA 4KWVA 4CD8A 4J5NA 1UZDA 5FAGA 4GY0A 3EX4A 1U1HA 2PDFA 2GVLA 4ATWA 2ZVRA 1D2KA 1VYRA 3G3DA 2NQ9A 1FFRA 2PDIA 2YX0A 3KW3A 1GKQA 4L4PA 4LAUA 1Q4WA 4S38A 1ONRA 3VC6A 4B4FA 4JZ5A 3W87A 3TW6A 3BG9A 4X60A 3GVVA 4A2RA 1TVPA 2RH9A 4JTAA 4LRTA 4HKPA 1T7LA 3O8AA 5D37A 3B97A 4PUEA 3WNLA 1J9YA 1WKDA 3LSCA 1M1BA 1HP5A 3UF9A 5H6HA 1RH9A 3W02A 1DJHA 4IP7A 2Q8XA 1TWWA 2FVKA 3WIJA 3EWCA 3TSMA 1BVWA 4ECLA 4IFOA 2A3HA 3P62A 4LSBA 4S3KA 3EDEA 1GVEA 3O6YX 1XSIA 2E28A 4UTUA 4LX4A 3R0UA 3W01A 1VLWA 3NQ8A 2ZA3A 4JKLA 4QX4A 5KETA 1ZL1A 5LNRA 3BAXA 1V79A 4FPSA 1TJ2A 1J0JA 2E1DA 3ARXA 1QT1A 4KPLA 4XZHA 3SJNA 3EX3A 1TWDA 2D24A 3AC0A 3Q67A 2I9EA 2VCCA 3W29A 4KEVA 1FWEC 2BOEX 4HHLA 3QR0A 1AA1B 4IP4A 1GCYA 3NXFA 2DT1A 3G1FA 3AIWA 4EPKA 3HG2A 4JKKA 4H2CA 1AQHA 1UJQA 3ZJ8A 4TX6A 4CQAA 5F2LA 2FZMA 1D7FA 3ES8A 3AYTA 4O0KA 1YPFA 2QHAA 2Y6ZA 3S1XA 1L9WA 1WOAA 4LUTA 4XD6A 4JQ4A 1OYCA 3QM3A 1L6GA 2CITA 2E4TA 1BG4A 2NX3A 5AYXA 4DELA 1JZ4A 1O4UA 1R3VA 1AL7A 4BWLA 4HPGA 4LBSA 4YNGA 1Q7QA 4Q4QA 3EA2A 4PCNA 4B9ZA 2HEJA 4HU8A 2VFGA 4JTTA 1X7FA 1XFBA 2NSXA 2J4GA 3VX1A 1HFBA 5D8ZA 3UVIA 4B2DA 4NZ4A 4E2BA 2V5BA 2NXHA 2HCVA 1UWTA 3UA3A 4P7QA 4D6HA 2HS6A 2RFGA 3PBGA 2BP1A 4E4UA 2QIIA 2DZPA 4FNTA 3V5FA 4AIOA 4PTMA 2VCBA 1B3ZA 3V0SA 1X8CA 3I3DA 2QEZA 2Y8VA 4DF0A 3AS2A 2PP3A 2YL9A 2YCJA 2BXVA 3EKLA 3SAZA 8XIMA 3TNOA 1MUWA 3DIPA 3C52A 2J8FA 2Q02A 4H8UA 4Z2KA 3POCA 3GXNA 7REQB 2JEQA 1PVNA 3CC1A 5HQLA 3PJWA 5GJPA 1ISZA 2Y70A 2Y61A 4XO7A 1Q6OA 4IQDA 1V03A 5DMNA 4WDUA 2J7EA 1R86A 3GIYA 4Z08A 3RPTA 1UG6A 3CYVA 2E7FA 3WEMA 3WDIA 2QMKA 3DC0A 3DYPA 1W31A 2J8GA 2MUCA 1PX8A 2EKCA 1P0NA 2FHFA 5AVHA 3WEOA 4JX6A 3QQ0A 4XAZA 1WB0A 1TPB1 4JHZA 1S5VA 3IV8A 3WQPA 4JFWA 2QCFA 1TPWA 5AC6A 1KBLA 3W7QA 1E56A 3E3HA 3DI1A 5I23A 4IM4A 3QC3A 5DXYA 3UFYA 4FF7A 4WIWA 1A5NC 1TCDA 3KCJA 4M80A 5CZTA 1Q6QA 1ZRQA 3RLUA 1JZ5A 3LRKA 3G0UA 5CPNA 3GNNA 4FIRA 4JBRA 2Z27A 3S2MA 2EPLX 3MKKA 1QWGA 1ZJBA 4NAFB 3HB9A 4WDTA 3FGCA 1O7AA 4AD2A 4HNNA 3TQPA 3NYZA 3W25A 2GGIA 3LI1A 2Y85A 1VR6A 4H01A 1UKQA 5T9BG 5JBDA 3EWUA 5CEWA 1JXKA 1O5RA 3I6EA 1DVJA 4WKAA 1FXQA 3UWEA 3MQTA 3CQKA 4XZWA 4IPNB 2WMJA 5D33A 1VRDA 5LA1A 3THCA 5FF4A 4M6UA 1DV7A 2RDUA 4FK9A 4GNKB 1A4LA 3W7CA 2JFEX 1POJA 3MKVA 1ZENA 5AYYA 2QJIA 3ZO9A 1UP0A 5CSYA 7A3HA 4DNHA 1KV5A 3LA4A 2QCCA 4HMDA 1H1NA 4POCA 2YBUA 2X2GA 2ZRWA 2D3LA 2Z1BA 1NQ6A 1OABA 1U5HA 3TLQA 1LL6A 1GHSA 4N7QA 3O0FA 5H8PA 3C8FA 3VZYA 1J8VA 1AZ2A 1F9CA 3R12A 5D04C 1DORA 1JNDA 3M0XA 3QGAC 5E0KA 4JDBA 3HG4A 3AO0A 3CXOA 2VOTA 1TV8A 2CBIA 3AMKA 4AZ5A 3UCDA 5CBJA 2DQXA 3WQWA 1ADOA 2IQDA 1UROA 1JDAA 1KFLA 2VT0A 2J47A 2VGFA 3UETA 2Y7EA 3UGVA 2P3EA 2BX7A 1DPMA 2BV9A 2HE5A 3WELA 4H41A 1I1WA 4QJ5B 1W3IA 1WNOA 3S5ZA 3S6DA 1G6CA 2XIMA 3IV3A 4XAGA 4IIBA 4I9JA 2YFOA 5CC3A 2NLIA 3AZTA 3C0LA 3KOFA 1K77A 3H54A 2J7HA 3CK5A 4DF1A 2D69A 4EK7A 3L4ZA 2HVOA 1EP3A 4GVHA 4JTDA 4GGBA 4AWUA 2QUTA 3WNNA 1PWLA 2GJNA 5CZKA 1XW8A 1UASA 1XRSA 4RJEA 5I3GA 1TIMA 3GLCA 4Q4OA 2CBUA 2C1HA 3W7IA 3DFYA 2H90A 3E2SA 3SURA 1KXQA 3N4EA 3AJXA 4NQ1A 1E6SM 1T41A 2J8TA 4GINA 3UWUA 1NU5A 3VIIA 1LG2A 1FX6A 3T0AA 2WHMA 2XGBA 2NVAA 5U7SA 1KCXA 2DY3A 3NGFA 5LKYA 4Q8OA 2VR5A 3H6OA 4C6QA 4GC3A 1GG1A 1XLHA 3AXKA 3OVQA 3U2EA 4EF8A 2PGEA 3FA5A 3EWWA 1W9UA 4GFIA 3A3XA 3UCCA 4UTHA 3C5QA 2DZBA 1H1YA 1MQRA 2CIPA 1ZAJA 3NR0A 3MSYA 3OEXA 4H6QA 4DI8A 1NWUA 1TR1A 2WVSA 2AAAA 3IIZA 3SRDA 2RDXA 3EB3A 3G1HA 1HJXA 1RBOB 3D0CA 4Q8VA 1PBGA 3CUXA 3R8GA 2ZE0A 1A3HA 4KQNA 1P0DA 1BQCA 5DEZA 3I6TA 3VD9A 2AMXA 4HTYA 9RUBA 4ZQPA 4A8RA 4D6DA 3HN3A 1F2JA 2C79A 4YN5A 3WLRA 3WMCA 3PTDA 2PDUA 5HR6A 4NRSA 3WFAA 1Q6CA 4Y7EA 1YHTA 5AHMA 2VD8A 2WJEA 3BLEA 1QNPA 3GIPA 1M03A 4LNCA 3PBWA 3UXKA 1BYAA 3PG8A 4R34A 3V5OA 1RP8A 5GVJA 2X30A 4N9BA 3E1F1 1W9PA 5KZMA 4DWSB 5D8WA 5JIWA 3NA8A 3N73A 1RBLA 1SUXA 3QKZA 3WH7A 4O57A 5HNNA 5CBBA 1VPXA 4JNMA 2OSWA 5C9WA 3FSUA 5A8PA 1CDGA 1DWHM 1L6WA 4C1LA 4UZSA 3PBYA 2FH6A 1C8YA 5A6KA 3U3HA 1X7IA 3LEPA 3R13A 3W7RA 2A1YA 4I7WA 5LIKX 3QC0A 4UTIA 4MVAA 3M0KA 2A3CA 3ZJ7A 3S2NA 1WZMA 4QS6A 2X0SA 1ZS2A 2PBGA 3URBA 1GJUA 2QDEA 3T2QA 2NZLA 1OC7A 1XH0A 1UOZA 1ZGDA 4DJDA 1IZCA 2XVPA 4C6FA 4MKVA 3CMGA 3VKKA 2BODX 2B7QA 1PPIA 1IXQA 3UZXA 2WZMA 4ZEPA 3PK7A 4LTSA 3ABXA 1I75A 1KFWA 1SJCA 4IUGA 3W1XA 3RM9A 4JIRA 1EJRC 3NL6A 3AWNA 1GVIA 3ZR4A 1A5OC 3FS2A 4Z1DA 4AYGA 1J93A 3CL8A 4MJMA 3W76A 2V81A 2ZRVA 4ZB0A 3P81A 1M7OA 2R94A 3FYYA 3MCOA 4XUYA 2ISWA 4JTRA 1CGWA 4V15A 3AOFA 1BXBA 4D6CA 4ZO7A 1Y7VA 1EJWC 3W7OA 4XBSA 1Q13A 3IUIA 4XD4A 1EHNA 1A5MC 4QQ3A 5DLCA 1E3ZA 1E9ZB 4BEQA 3OLEA 3UYIA 3B03A 2YZ5A 4I3GA 1IYXA 1RXOB 1D7KA 3HPAA 5AC7A 2DZTA 4O8RA 4ADSA 3LN3A 4NZ3A 3BURA 3FLUA 4ZTYA 4K8HA 1BKSA 2E5DA 2E3ZA 3D47A 4QDMA 4UTFA 4I9AA 4CU7A 1TPC1 2IXUA 1I1XA 3FN9A 1FWDC 4H2HA 3H7RA 4O11A 4JTJA 2PDCA 2OO6A 4MPQA 4QS5A 4R7WA 3DENA 3INPA 2A3EA 3S2LA 1X97A 3PULA 3VPLA 1XV8A 1LLOA 2Q3RA 2YJQA 1MDLA 5BU6A 3P14A 3H21A 3AZSA 3TWBA 5J5RA 1OHLA 4RZ4A 3A21A 2QGYA 4UUIA 4JTHA 1XC4A 2CBJA 2YIHA 4LVFA 3VM5A 3WLHA 4IZGA 4CNUA 3R0DA 5M1TA 5M3WA 3U57A 3T81A 4DBDA 3KL3A 2WZTA 4GH1A 4Q8WA 3C56A 4U4MA 4HNCA 3DG6A 3GUGA 2F8QA 1R87A 1GG0A 2PTZA 2Q6ZA 4MKSA 1SO3A 3BQ6A 1GK8A 1SZEA 3ONBA 3MYPA 4XZLX 2HK0A 1ISWA 4J3VA 1G7VA 2FKPA 2D2JA 5BROA 3MSRA 4LUSA 2FVMA 1Z41A 1KBKA 4UCFA 3E5PA 1EPXA 3BL3A 1UD6A 1L2QA 4P7OA 2AOSA 3IIVA 5KINA 3GG8A 3WFZA 5FESA 2WAGA 1RPKA 1XQKA 4DYJA 4US5D 2XM1A 5CJ5A 1UZHA 3WLTA 1FWHC 1YNYA 3VO0A 1B9ZA 2YCEA 4XVDA 1AW5A 1V3KA 2EKGA 2PDMA 3N25A 2X1UA 4GUJA 1R47A 2D3NA 3N13A 2PWHA 2TYSA 5ABHA 1YEYA 3TMQA 2VXNA 5TBOA 5K9DA 3GR8A 3EOEA 4GX8A 3BWWA 4NU7A 5C9ZA 2NQHA 4NYUA 1LYXA 2XIOA 3NAVA 3FGCB 4F0RA 1ADDA 2QMJA 3ZWTA 1H63A 4F9JA 5HQEA 1G5AA 2Y62A 3UPMA 2OR2A 1W32A 1ONWA 3ZMRA 4DEFA 2WPBA 3UXLA 2HROA 1W9DM 3F03K 1C9WA 4FI4A 5D30A 1HJWA 1UBSA 4P7NA 1YTKA 1UUQA 1T6MA 3WLMA 2V2CA 3EPMA 1U1UA 3LMYA 3IRDA 1S2AA 1K02A 1UW9A 1PCWA 1PL9A 4NHVA 4LV4A 5A94A 1W2VA 2H9AB 2OOGA 3P93A 5HJLA 4GYFA 3BK0A 3V1PA 1B4KA 3LX9A 3MDWA 3RDKA 2NVCA 1NF0A 4RZ6A 1ZBCA 3WQDA 3OLDA 4GA8A 4AF0A 3L4XA 3W38A 1BHGA 4L1GA 2FZDA 1TPH1 3GH7A 5EBUA 3CM4A 4MB5A 4GKLA 4ZSTA 3N17A 4FAMA 3KHDA 1AK5A 4KCUA 2X42A 2PDJA 5HK4A 1RVGA 4H9VA 4GGHA 1UZ1A 5F2GA 3BMWA 3NQ2A 4WJ8A 4MNKA 2WM0A 2YL8A 2FJUB 4G6CA 4WOZA 3U4AA 1J11A 1EYWA 3S1GA 5FJIA 1H1ZA 1QPQA 4PB4A 1P5BA 3IUHA 5M17A 4JFSA 3T8QA 3GIQA 3GG1A 2ZXQA 1WDRA 4HYWA 3FK4A 3S5OA 2YBVA 5GJNA 1O6IA 4NI3A 4AH7A 1RP9A 3RIKA 1CYGA 1E0WA 2EEXA 3ZR6A 3E2QA 1FDZA 1YBQA 1SM9A 1TREA 2Y5JA 1XLLA 3KBNA 3RRAA 3WF2A 4O18A 3TUUA 4N42A 3WQ4A 7ENLA 1TMQA 4UQDA 2YLLA 4WVXA 1ONXA 1VHNA 4U5KA 4S3GA 2BMBA 3STGA 3KTXA 3SBFA 1BYDA 2DDXA 4V1YA 4DM2A 4AVOA 3ZT6A 4U31A 1J0YA 1FBAA 4LWWA 2HVMA 4HK6A 4QSFA 1TZ9A 3WD2A 2BY2A 4S23A 4OHQA 4EIVA 2BY1A 2CLPA 2HNHA 1OEPA 1G94A 3OQ8A 3VNZA 2I57A 2C7FA 2OO0A 1REQB 2W62A 3VFCA 1QPRA 3NNTA 3UR5A 3LG3A 3BLLA 1BPLB 4LEFA 4RL3A 4XV0A 1SZFA 1ZBKA 1OYBA 4S3JA 4UCGA 4M6PA 5BU9A 2EF9A 3W23A 3HV8A 2P8CA 2X16A 2WPGA 2PCEA 2Z6IA 3EBVA 1UP3A 4DJEC 3JZUA 3PB2A 3CBWA 1ITUA 4M8UA 3AUOA 4ZO6A 2WMKA 2ZUMA 4G2DA 1SFJA 2ZKMX 2GSJA 1I2OA 1OF8A 1V7AA 3SN1A 3UPWA 4D71A 4NZCA 2VVSA 1VPQA 1XDJA 4IWWA 4WR3A 5JBEA 2DJLA 1BRLA 4CQDA 3AU6A 3FXGA 3D3AA 1Q5MA 3WQEA 4C5YA 4K8EA 3PZIA 2OB3A 1R3YA 1EJTC 2FB2A 4LFYA 2W3ZA 4D6GA 1VBGA 1SMAA 4J3SA 1OK6A 4MDPA 1XCXA 2GVJA 3VGFA 1G1YA 3BLDA 3IPWA 5G1TA 2ZX8A 1FP9A 1S5TA 3S3GA 4PA8A 4GYPA 3VGHA 1JPIA 3GDMA 4AIEA 1J5TA 4O28A 2H3BA 3M43A 1QHPA 4GYJA 3H24A 1Z42A 4I7UA 1W3NA 4IG2A 3N19B 1W1TA 2OZ3A 4AY7A 2QCDB 2G41A 1VYSX 4X3ZA 3CV1A 1XM3A 3NQ6A 1OT1A 3WQ6A 1JPDX 4S3CA 3A64A 3WUFA 4JL2A 3W82A 4CQ8A 4PCTA 1PAMA 2G4JA 1W6TA 2PDKA 4PUJA 3N2OA 1YTDA 5EFFA 3S9IA 2WVUA 2A7NA 1Z89A 3WX7A 5HJYA 1W37A 1XYFA 2ISDA 3VIOA 2C15A 2PZNA 3SUWA 1JD9A 1F3EA 1VZWA 3B06A 1V08A 1FCUA 3A3HA 3ME3A 3HV9A 2HE8A 4ASTA 2W79A 1HN1A 5A6SA 2DVXA 3B4UA 3OO2A 4IXHA 4AYSA 4KGLA 3DYMA 3N34A 4UOQA 2F6KA 2GQ8A 2D2HA 4WY0F 2GK1A 1PV8A 4UIOA 3H23A 1MI3A 1D8CA 3WH5A 3KOZA 1BQGA 3WF1A 4C7GA 2KZHA 1TMHA 1MXSA 5A8GA 4K68A 3LK6A 4B90A 2J66A 2QPSA 3TN5A 4EP8C 1S46A 2IPFA 3CZJA 4Q33A 1KXHA 3KX6A 2GUYA 4BQ2A 2I7GA 2WVVB 4O1DA 4MHBA 2C14A 3W7LA 3GO2A 4ZTXA 1TRIA 4IGSA 3LHVA 1VLIA 4G8TA 4GK8A 2MNRA 1LRTA 1EUAA 2G97A 3L9CA 2GGGA 5AZ1A 5CPTA 1JYNA 1LUCA 1QOPA 1DBTA 2ZUWA 4UOJA 2J6XA 4ENLA 1V3IA 4J35A 2QULA 3WD0A 3NTYA 1DKWA 2F2KA 1BWVA 3SRKA 4QAWA 2DVTA 5I77A 4JYDA 4W5UA 5EY5A 2AL2A 1KCKA 5DY3A 3GNRA 2GYIA 5C9UA 4QM1A 1YXYA 3B9EA 3GXDA 3EGJA 3WH6A 3KWXA 1MO0A 4GMEA 1X6UA 3BV4A 1I6NA 3WJSA 3IAPA 4EACA 4B91A 1CBGA 1UCWA 1DYSA 4CCZA 4E2DA 3ZZ1A 3A4JA 2ZZ4A 1UOKA 1TPUA 1GYMA 3HGJA 1TV4A 4ZQNA 1CXHA 1S2CA 2YDSA 5C70A 3WUBA 5CXPA 1XLCA 4O4WA 1LRNA 1DXFA 4DZIA 2CKRA 1YE4A 1W1B1 2XSXA 3GU9A 1C29A 4AC7C 4IQJA 3H55A 3VDAA 3LTPA 4JIIX 4OFCA 2V5LA 1GTHA 3OYXA 1O1HA 2F7FA 1SYTA 1UA7A 5C6MA 3UZ5A 1CXLA 1TTJA 2OODA 3STCA 2KAUC 5CG7A 1GEHA 1O60A 3A13A 4Q7IA 1OFDA 4QG9A 3MBDA 1WYIA 3AIBA 3FAWA 1VEOA 3GFXA 4A2SA 4PC8A 2Z24A 4PTVA 2WC4A 2ACSA 4PB3A 3SCUA 4JQAA 3WK3A 3H4GA 3VMOA 2L5HA 3M47A 4LUSB 2PGWA 5JH1A 3L4YA 1GYNA 4PTDA 1DTNA 3RAOA 1UR1A 1AH3A 3K5XA 3CHVA 4M29A 5XINA 2YXXA 3DU0A 3FYOA 1HP4A 3WN6A 1ISYA 5J04A 4EPBC 3VE9A 3R1ZA 3W53A 2VX4A 1SR0A 1KM5A 2I5QA 3TTYA 1WKYA 4HIBA 1GGOA 1HJVA 1LWIA 4FIQA 2PPGA 2OWWA 4OOZA 3WJZA 2E6AA 1JD7A 2XYLA 5HMSA 2RJGA 3G5EA 3MBFA 3U9IA 4IJRA 1AQFA 1Q6RA 1XBXA 2WANA 4RE3A 1JIBA 4PGLA 2PWVA 2ZTKA 2BVYA 2OQHA 4UQ9A 3VZZA 3MO4A 3QGVA 3ENLA 4C90A