4B17A

Crystal structure of c2498 2'-o-ribose methyltransferase rlmm from escherichia coli in complex with s-adenosylmethionine
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
357
structure length
356
Chain Sequence
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Rlmm, the 2'O-Ribose Methyltransferase for C2498 of Escherichia Coli 23S Rrna.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE M
total genus 118
structure length 356
sequence length 357
ec nomenclature ec 2.1.1.186: 23S rRNA (cytidine(2498)-2'-O)-methyltransferase.
pdb deposition date 2012-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
A PF18125 RlmM_FDX RlmM ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b17A01
3.30.2300.20 Alpha Beta 2-Layer Sandwich THUMP fold THUMP fold 4b17A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4b17A03
2G8NA 3KQMA 3LCCA 3G5TA 4CXMA 4QVKA 2P3QA 3P2EA 4EMSA 5HFJA 3C3PA 3BWCA 3GRYA 3MCZA 1BKYA 4EVIA 5HIKA 3V97A 4F85A 3UJDA 1YFLA 2BM8A 3A26A 4C07A 1YUBA 2ZULA 1M6EX 2FPOA 3DXZA 3AXSA 4LWPA 1NKVA 3THSA 4V0RA 5F2NA 5HOQA 4M7RA 2G1PA 1VE3A 1VPTA 4DMGA 5EQJB 4PYJA 5LSAA 5IH3A 2NXNA 2DULA 3DLCA 3EPPA 3GDHA 5T64A 3RW9A 1G55A 3UJBA 3LHDA 3ID6C 2OB1A 4EKIA 4MHTA 5KQSA 2ZFUA 3P9CA 4GBED 4E2XA 4ZTBA 5IKMA 2UYCA 1DCTA 2YXLA 4E2YA 1FPQA 5FTWA 4E70A 3TMAA 3PTAA 4QPNA 2IGTA 4B17A 2VDUE 4KDCA 4JXJA 2HR1A 1N7JA 2JHAA 3GRRA 4GQBA 3EGIA 4V0QA 3G2MA 5E2AA 1OR8A 4PYQA 5U4XA 2AOXA 4QQNA 2O57A 3TM4A 1JTEA 1Y8CA 4KWCA 3VSEA 2IPXA 3TM5A 1DL5A 4GEKA 4QPPA 1NV8A 5BW5A 3P2IA 1AQIA 2VDVE 4E2ZA 2P40A 3GJYA 4M37A 4PYLA 1SUSA 1ZKDA 4PCLA 3KHKA 4DZRA 3GRUA 3IYLW 3DMHA 3MTEA 2AOTA 4HGYA 2P8JA 3KPJA 4IV0A 4Z2YA 4DF3A 5DLYA 3GO4A 2ZIGA 2Y1WA 2CWWA 2AR0A 2FHPA 3DOUA 3PB3A 5BXYA 3DMFA 3O4FA 3HCEA 1L3IA 3MHTA 2AVDA 3HEMA 1JG2A 2GH1A 3EMBA 5EIFA 3DXYA 1RI4A 4E33A 3FRHA 3PX2A 2ZBQA 3B7PA 2UYQA 3GU3A 5LQUA 2QRVB 5FCDA 1ORIA 2PBFA 1KYWA 5DRYA 1VP3A 2ONYA 3EVAA 3G2PA 4O29A 4LWOA 4YV2A 4ER3A 5EIWA 1KXZA 4PYKA 3KR0A 1WZNA 5EEGA 2IH4A 2WK1A 3A25A 1IY9A 2IIPA 2NXEA 3HCBA 4KIGA 5EMJA 3P9NA 3LDGA 3SR4A 2ZSUA 3T7SA 2B25A 2FCAA 3CJTA 1KP9A 1ZGJA 3KR1A 4K6MA 2P7HA 2OB2A 5ICCA 2JHPA 4AZTA 3G5LA 3VYWA 2I62A 3E8SA 3G2OA 2E5WA 1ZGAA 3CKKA 3LBFA 1L9KA 3FYCA 5EMMA 3A27A 5T67A 5LQNA 1X1BA 3P71T 1B42A 5HILA 3SGLA 3OZSA 2ESRA 2BR3A 4C08A 3LL7A 1P39A 3QV2A 4KDRA 2ZLBA 3SMQA 4E2WA 3HP7A 3M6VA 2EG5A 4KRGA 1RJDA 2B3TA 4GUAA 1R00A 4C03A 3UFBA 1XXLA 4AZVA 3GIWA 2B9EA 4DCGA 1SG9A 2HMYB 4BLVA 1NW6A 1RJGA 1X1DA 2H11A 1QAMA 4PGGA 2WA2A 5C1IA 5GIPE 5FHRA 5K0GA 5DX8A 3GRVA 5ERGB 5K0CA 2AOUA 5E2BA 3HCDA 4GC5A 3VC2A 5LQAA 1RI5A 4OA8A 1R8XA 4PYIA 2P7IA 2PSSA 4RTRA 2PV0A 3I58A 3P2KA 5DM4A 4ISCA 4BLWA 2YR0A 5FHQA 5P8WA 1QANA 4XCXA 4Y30A 4QTTB 3ME5A 2YX1A 3KR2A 3GXOA 3NTVA 3EEYA 3MERA 4E31A 3LECA 5D1HA 1TW2A 3LSTA 2I9KA 5EZQA 3OE5A 3OU7A 5EZSA 3LDFA 4GOLD 3QOWA 7MHTA 4PWYA 1YF3A 5CD1A 2K4MA 2H00A 4G56A 5BW4A 5EKXA 1V39A 3LCVB 4HG2A 4RWZA 3OZTA 4BP1A 4PYMA 2CMGA 2ORED 4YUYA 2Z6UA 3I64A 3L8DA 3OFJA 5DM1A 1XDZA 3ELWA 3CVOA 3KQWA 3KPUA 4GOND 3FPJA 5K03A 4DM3A 4RSRA 3IHTA 4ATNA 3DP7A 3FTFA 5E8RA 5E1DA 2IDJA 1F38A 1M0EA 3GNLA 5KYGA 1L3CA 3UBTA 3JWGA 1MHTA 3A7DA 3HA7A 5C0OE 2XYRA 3GGDA 5ICEA 1YB2A 1YFJA 2CKDA 1I1NA 3JWHA 2O06A 2WA1A 3DMGA 3EVGA 4ER6A 5K0JA 4RTKA 2N47A 3E7PA 3BGIA 4AX8A 1XCLA 3NVKI 1F3LA 3B3FA 1QAQA 3PFHA 1N7IA 2JG3A 4EQZA 3FRIA 1NT2A 4UOEA 3EEOA 2LD4A 2XYQA 2ZBPA 2ZW9A 4X60A 3AXTA 3OE4A 4QVGA 5DT2A 2ZTHA 3KQYA 1EAMA 2I6GA 4L7VA 3PT9A 5LQJA 1WXWA 1R8YA 1YZHA 3G2QA 5E1OA 1KPHA 5K09A 3KQQA 1X1CA 3HVKA 4FSXA 3EVCA 5T6BA 5ICGA 3EVBA 3OU6A 4OBXA 5F2OA 2EJUA 3I5UA 1KHHA 3CJQA 5EMKA 8MHTA 3A4TA 2CMHA 1WS6A 4LECA 3FUVA 5CCBA 2C7PA 3ERCA 3WSTA 1H1DA 3FZGA 5E9WA 1SKMA 3BKXA 2IH5A 1P91A 5GOZA 4RX1A 1QYRA 5K0NA 2NYUA 4R8SA 3UJ8A 4FS8A 3BGVA 5K0BA 1AQJA 2QM3A 5CVJA 2YUIA 3HNRA 3DR5A 5EHIA 3F4KA 5HZMA 5FADA 3GRZA 4A6DA 3HVIA 3UJ6A 2JJQA 4PYNA 1DUSA 2OZVA 3FPHA 3R3HA 1NW3A 2Z6AA 3SSNA 3I53A 2P3OA 3FYDA 3M70A 3UZUA 3G7UA 2UYHA 1RJFA 3G8AA 1BC5A 3IV6A 3NVMB 1KYZA 3P8ZA 4RVHA 3TOSA 3UA4A 4YUZA 3UJ7A 2ZWVA 2EJTA 2ZBRA 4RTLA 1EG2A 4QTUB 1JQ3A 1ORHA 1IXKA 2PX4A 3FPEA 4OBWA 3Q7EA 3R0QA 2FK7A 1NBHA 3ELYA 1G8SA 3NWEA 3OCJA 2GPYA 4RYLA 1FJXA 2PT9A 2QE6A 4GC9A 4RTPA 3ER8A 1G6Q1 3EGVA 4CTKA 2G70A 3PLAE 1JSZA 2A14A 1IM8A 1TW3A 2XYVA 4Y2HA 3SSMA 3KPYA 5FWDA 5CUQA 3V8VA 3JWIA 4H0NA 4X61A 1FP2A 3KR9A 1MJFA 1X19A 2P35A 3SXJA 5HEKA 2PX2A 3EVDA 1SQFA 4CKBA 2PX5A 1AF7A 3FPGA 3C6MA 3BZBA 5HIJA 3HVJA 4E30A 2AOUB 4C04A 2HTEA 4HTFB 5C9ZA 3OU2A 3HA5A 3BT7A 2IDKA 1R6AA 1XDUA 4YUVA 1JG4A 5LQKA 3FUUA 3KQTA 2YXDA 3P9KA 2ONZA 2EX4A 4IKPA 1XDSA 3HCCA 5EG5A 1I4WA 4EKGA 2ZWAA 5HIIA 3Q87B 2QY6A 1AV6A 5CIYA 4HTFA 3THRA 3KPWA 4GOMD 4R8RA 1VQ1A 4RVGA 2VP3A 3MB5A 4R05A 5EPEA 9MHTA 1Z3CA 4M36A 3G88A 2EFJA 5DXAA 3ANXA 3DXXA 1T43A 2FK8A 5FA5A 4AZSA 3EVEA 5DTQA 5GP1A 1U2ZA 2NXJA 4FGZA 3NW9A 3TQSA 4YUXA 4CTJA 3LDUA 3FTCA 5K0EA 5GINE 1R18A 3IEIA 4KIFA 5FULA 3BKWA 5EC8A 4E32A 3BUSA 3FTDA 5G02A 5DXJA 3BWYA 5JR3A 1BOOA 4AUKA 1TPYA 2OPBA 2P1DA 3B5IA 5H02A 2AVNA 3SM3A 3T7RA 2P3LA 3ER9A 2R3SA 2ZZNA 3DH0A 3UA3A 3BGDA 5K01A 2G72A 4DQ0A 2I7CA 4KW7A 5EEHA 3KQOA 4YV1A 5GM2A 2VDWA 5DWQA 1QZZA 4C06A 2HWKA 2XVAA 2PY6A 3R6TA 1WY7A 1VBFA 2V7EA 3B89A 3KQPA 3LKDA 2IBTA 2CL5A 4HRAA 3M4XA 3M33A 3E05A 3TLJA 2B78A 3JWJA 1VP9A 4FP9A 1XCJA 4MTLA 5CVUA 4RTSA 2HNKA 2O0LA 3OPNA 5E8JA 3HTXA 4FR0A 2GB4A 4X41A 4RVDA 3VC1A 4HH4A 4AZWA 5KS2A 1EJ0A 3OFKA 3C3YA 3GCZA 4DCMA 3OZRA 3CBGA 4FT4A 5LQRA 1UFKA 2BH2A 5K8VA 2GA9A 1JG1A 4MWZA 2G71A 1KR5A 2AOVA 2C7RA 2ADMA 5DTRA 5CCXA 1Q0TA 3B3JA 2PXAA 3B3GA 1JQEA 2YXEA 2Q41A 3CGGA 1VIDA 3DUWA 4PIPA 2C7OA 5GWXA 3MGGA 1G8AA 1G60A 1EJ6A 3AJDA 4OX9Y 5CVVA 3DLIA 4EK9A 2UZ4A 3U81A 1L3BA 4C4AA 2PT6A 3BWBA 1P1CA 2OKCA 3KPVA 1KIAA 1WG8A 3S68A 4P7KA 1SVUA 3EMDA 1XVAA 4R6WA 4WVLA 5DSXA 3TR6A 1N2XA 3RODA 2B2CA 3A7EA 4GOOD 4OQDA 1RI1A 2JH9A 1RI2A 1KPIA 2BR5A 2F8LA 2ZIFA 4PONA 4YMHA 4PNEA 3EVFA 2PVCA 10MHA 3PS9A 4X63A 3C0KA 1VL5A 2ZZKA 4DA4A 4MIKA 4FZVA 2FYTA 4QDJA 3ELUA 2ZZMA 2IBSA 2OYRA 2PGXA 3GWZA 2AN4A 4ER7A 2ZCJA 3BWMA 1NBIA 1NV9A 3TKAA 4MQ4A 1PRYA 1JTFA 3BXOA 2YQZA 4HSGA 4LG1A 1UWVA 2IH2A 1NE2A 4A6EA 4C05A 1ZQ9A 4KVZA 3DTNA 3EGEA 5LR6A 3R9XB 2PWPA 3PFGA 1HMYA 3MCTA 1FP1D 3UJ9A 5E1BA 2H1RA 2OBFA 1JG3A 2JH8A 4GF5A 2O07A 5FA8A 3O31A 3FTEA 4P58A 3D2LA 4P7JA 3E23A 1UIRA 4IV8A 4BY9E 3LCUA 3LGAA 1D2GA 2AZTA 3KQVA 4HGZA 3CJRA 4OQEA 4R6XA 4F86A 4BP3A 5M5BA 5GIOE 5CVDA 2XBMA 5KVAA 1FBNA 4HC4A 1QAOA 5B1SA 3PVCA 1EIZA 3ORHA 3KQSA 3FUXA 5DTMA 5KQRA 2UYOA 2P41A 2Y1XA 3X0DA 3CC8A 3NMUF 2PLWA 3P97A 1R74A 3K0BA 4CWAA 3LX6A 1L1EA 2NNWB 1XJ5A 2AN3A 1SQGA 3LBYA 4XUCA 1O9GA 5DM0A 5F2KA 1NW5A 1D2CA 3NDJA 5D1NA 4F84A 1I9GA 5FWAA 3LPMA 4U7PB 4XUEA 5EKUA 4RTJA 4QQKA 4P7FA 5DM2A 2DPMA 2VS1A 3FPFA 4XUDA 3TPZA 1JQDA 2IFTA 3C6KA 5EHGA 3MQ2A 3T0IA 1SUIA 3HCFA 2FRXA 3REOA 2BR4A 4RVFA 4DKJA 2AOTB 5E9JA 5HIMA 5DSTA 2QRVA 4X1OA 1ZG3A 2XVMA 2JHCA 2NXCA 3TFWA 4CKCA 3MTIA 3RIEA 3AY0A 4FSDA 5FQNA 4IWNA 3UWPA 5FUBA 4POOA 5DX0A 3SVZA 5MHTA 2NP7A 2Z6QA 3T7TA 4WXHA 4RV9A 5EMLA 4OA5A 1HNNA 3O7WA 3LKZA 3FUWA 2ERCA 2BM9A 2YVLA 5CVEA 4CKEA 4RTNA 4PIMA 1KPGA 3UJCA 5JUWA 2KW5A 2GS9A 4RTMA 1JSXA 5DRTA 2QYOA 5K0FA 1G38A 3AWIA 2AOWA 3ELDA 4PINA 4FT2A 2OO3A 4BLUA 2PJDA 4ER0A 3CCFA 2HV9A 2OY0A 5DX1A 4YV0A 2PX8A 3I9FA 2C7QA 2IP2A 2PXXA 4YMGA 2O05A 5GM1A 3FUTA 3KKZA 3HM2A 1P1BA 2PKWA 4PGHA 1RJEA 3DULA 1X1AA 5CM2Z 4PYOA 3HVHA 3M6UA 1EQAA 3QOXA 3NWBA 5ICFA 2OXTA 1WXXA 1VLMA 2PXCA 5K05A 1D2HA 5DPMA 3PX3A 5BP7A 2ZIEA 3G89A 5EVJA 1XTPA 3NDIA 5EGSA 3M6XA 3HA3A 4QDKA 3UJAA 5K0LA 1NW7A 3SSOA 4U7TB 3TRKA 1NW8A 3HCAA 3K6RA 1INLA 3EVZA 3R24A 2R6ZA 3NJRA 3M6WA 2BZGA 3MAGA 1BHJA 3P9IA 4P7GA 3H2BA 5LQCA 1PJZA 1ZHFA 1YZ3A 4PCAA 1M6YA 1O54A 2AN5A 2AS0A 4YUWA 5FQOA 2GLUA 1O9HA 2YTZA 3KU1A 2PWYA 3G8BA 5EOVA 5E9QA 3TKYA 2VZ9A 1Q0SA 4ER5A 4RTQA 2GAFA 1JR4A 4M38A 4RTOA 2V74B 2ZVJA 4NECA 1RI3A 5E1MA 2NP6A 3SX0A
chains in the Genus database with same CATH superfamily
4GC6A 3P2EA 1YA6A 2ZB2A 1Z4NA 2HSJA 4WXOA 5JVDB 4C0LA 3E27A 5C5EA 1OROA 4PYJA 5BUSA 1RBYA 2ZD1B 4QG7A 1P6QA 3ZZMA 4JR1A 5IYZF 3ZHCA 1VJTA 4FF1A 1SJ3P 3FKSD 1DQPA 4PNHA 3SC2A 1X80A 4L27A 4BGIA 5HKAA 3RYHA 1C1XA 3D5EA 4HJXA 5ALJA 2GT1A 3LAWA 2DCUB 4RHXA 5AOCA 3PXCX 1CUHA 3BKUA 2C28A 4NXNJ 1W5EA 3OBBA 4ESHA 5G4KA 3VAYA 5C35A 1VQLS 2JHFA 1GRVA 1T0JB 4ZA2A 5ILGA 1P77A 2JAQA 5D6GA 3C16C 3IMFA 4UE3S 5JWRA 4HXEB 4QTYA 1WXQA 1D5CA 1QR6A 3FCWA 2PU7A 2C2KB 4U2FA 3EQ6A 2PR2A 4RULA 2XMGA 1JAZA 3LPAA 4QREA 3UXHA 5C1IA 3MWEB 3FVWA 1R8XA 1YS7A 3D2AA 4YR2A 4HV4A 3LSTA 3AEKB 2MU1A 2RHJA 2D69A 1B23P 2FPKA 3IPRA 1JLMA 5LMUF 1RBLA 1UC9A 3RASA 3FG9A 2QL9A 5ALMA 4OK3A 1ID8A 4CR8A 1YIAA 1IG0A 1VHFA 1DE0A 2DGUA 4PPGA 2O3TA 1TK0A 4WFJA 1T0TV 1T9ZA 2OHXA 2JFOA 4KH1B 1WSRA 1EPUA 3TTTA 3MFYA 5T4FA 3LXMA 3NC0C 2UUCB 5CVJA 1OBCA 4JI4J 1Q1GA 2XNJA 3THWA 3WK4A 2UVQA 2M2IA 4DSEA 3PO5A 4QKQA 4CV3A 5B6IA 2HK2A 2IEZA 4RGQA 4YRNA 3LQRA 2A14A 4YV7A 1P2FA 4HEJA 5ICSA 4F1KA 1L5KA 5THKA 2D5IA 5L4SA 4MYHA 1FP2A 5ETTA 2IY5B 3Q9UA 4GSLA 4EB0A 4PVDA 5G41A 4CKBA 1WO8A 3GPIA 4L50A 5ALHA 2XBLA 3PO4A 2BI8A 4CM5A 1H6DA 1FSPA 3OCUA 1VQOS 3DHNA 5FI1B 3KYCB 2Q4RA 1N34J 1SBHA 5KFOA 4OKIA 5B37A 2W4MA 1N0IA 2HOQA 2CNOA 4MLPA 1U0HA 2OSVA 2XZTA 4QPJC 4YREA 4G4GA 3KEOA 3IWLA 4OHCA 4UZFA 1LUAA 3EVOA 3REGA 2XYPB 4Z9BA 2XYHB 2SKEA 5I51A 1Q0QA 4OQPA 3L4EA 2NAPA 5A9SA 3A13A 3O8LA 3QPIA 4B45A 4NZ6A 1JDBB 1JLQA 3TLJA 2C5FA 2XMVA 2CQBA 5B5SA 3HKZD 2ZJ6A 2FJDB 4YRBA 1KFKB 2DNHA 2GCEA 1FUKA 1FT8A 2DNOA 1JZQA 1M8FA 2Y27A 2E1PA 5JS6A 5IWAF 3CMES 3UC5A 4QAJA 1WD5A 4DX7A 2XB2D 4MQ6A 4PLGA 4P86A 4U6NA 3ETMA 4A6XA 4WK3A 1AE1A 3F1KA 4F6RB 2ZCJA 5CP8A 4YT4A 2WICA 3H5AA 1QYVA 2Y8WA 2BQUA 5J1EA 2YQZA 4OX9B 3ZCUA 3TQ1A 1TZ0A 1T0BA 4PVCA 1TQ6A 1NMXA 3OE7A 4Y0NA 4MAAA 2GPTA 1V3RA 3AODA 1ICEB 1W35A 1GY8A 4POAA 2PGAA 2P5SA 1B93A 5KFZA 2KSQA 3R4VA 3N2YA 2ZJ1A 4JP2A 1KAMA 1OLSA 2ZSHA 3CZQA 3GT3A 4XFJA 2SHKA 1IUNA 1YL6A 3N59A 4A6PA 5AE1A 1SN7A 3RFVA 2CAJA 3GLHE 2YHBA 4Z7NB 4NG5A 1B2RA 5E7JA 3PC8C 4MS1B 2IYUA 4TRRA 3KMSA 3OHAA 2HHWA 4ALJA 1LH0A 4GP9A 1XMSA 2MYPA 4P6QA 2ZTSA 4M0PA 1RWPB 1LDEA 2OM2A 3K6SB 3G96A 3QZUA 4X7BA 1E96A 4GIBA 3KSRA 1E2UA 4M0LA 4DDHA 3DXBA 1XTPA 4KHRA 3N0XA 1R2QA 4O3SA 3RVPA 5BRAA 3WLRA 1KJIA 3MWKA 1TMKA 1UFRA 3H2BA 4PR3A 2R66A 2Q7OE 2Y4NA 2ATXA 9ATCB 2UV8G 4M0CA 1A9RA 1LVHA 3WIUA 4CRJA 1MOQA 1X0XA 4RQTA 5K3FA 1RTKA 3CR7A 1M6EX 1FDNA 3VR4H 4P71A 2KZMA 5IH3A 5TRTA 5I7EA 2D1QA 4TTJA 2XGJA 4Y2TA 4CIOA 4NLYA 1H2HA 2GBLA 4DSIA 1Z0SA 2B1GA 3K73O 4HB4A 5LYJF 1BE8A 3BH7B 1A4XA 2OBLA 1C1DB 3FYSA 4DL9A 5ADZA 3ZC3A 4MGHA 2I33A 1F51E 3QUQA 1TYDE 4KI0A 3FLMA 2ZNYA 4KR7A 3IUNA 3N3BC 1W9MA 1N5LA 1QIEA 3NGKA 1P60A 2HJWA 1Q19A 4A8YA 3VTIA 1L1QA 4DDMA 2WZDA 2HSWA 1K44A 4ES2A 4R8UB 5IANA 5ALYA 2CJQA 5G3YA 4D3DA 4QRHA 4LJSA 2C99A 2WHEA 1XZEA 5BSHA 3PR5B 2F55A 4B3HA 5KX5B 3T1YB 3ZHBA 2VBXA 4OVKA 4QM7A 1RCOB 4BCDA 5HVFA 3W5JA 2CZ9A 3DF9A 1XVLA 2HU8A 3O8DA 2V4RA 4MQ5A 5FBZA 4YB6A 1EFDN 3CTPA 3LAKA 1JBEA 1EBUA 2Y0BB 3AEYA 3I4PA 2J1LA 5HS4A 3QOWA 1IXRC 3WNBA 2BX6A 2PFKA 2YNFA 3VDNB 2AH5A 1QTNA 2H3HA 2X23A 2XJ9A 5CNIA 1J0BA 2Z95A 3UB4A 1REVA 2H48B 3B3FA 5D51S 1ZM2A 4R41A 2HMSA 1J8QA 3PQ6A 2NUPA 1KPHA 4P3PA 1Z0KA 5DWVA 3P94A 2WF5A 2HDWA 1V7CA 3BR9A 5EMKA 4QM6A 2C7GA 1J0EA 3GOHA 2FHSA 4OUDB 1E1RA 2Y3YA 3W05A 3FCHA 4E94A 3VO2A 1E60A 3Q7SA 2DEUA 4WZMA 2XS5A 4C8YA 3OTOJ 1RBMA 4K81B 4C3MA 2CVHA 4WYLA 1LQTA 3PLAE 421PA 1HA1A 1UJMA 4IUCS 2Q3BA 4J94A 3AJEA 4EJSA 2VBGA 4XIFA 3T8YA 1EVZA 2K5UA 4WCEQ 3T5HA 5TR9A 1X7WB 1JHXA 2OXEA 4WADA 1DPFA 3F6BX 3MECB 3UGJA 1T8SA 4F60A 1BQMB 1CUIA 4MKZA 3DGPB 3KKNA 3F67A 1NM5C 4JH0A 3MQ4A 2IYZA 2MTLA 4FD2A 3EX7C 3VBEA 1LQUA 1S8OA 4IIJF 2FU5C 1ZR4A 5FFMA 5A8RB 2DPHA 1VL0A 4KW7A 3TLXA 1VGRA 5IP5A 2EWMA 4KN8A 5ALOA 4YJDA 2PRJA 4E46A 2TECE 4TTTS 1QS0B 1JJ7A 5EE3A 5A4KA 1RW4A 2IV3A 3DOCA 3G79A 4AM8A 2ZVPX 4H4OB 4KXLA 4QO7A 2Z2YA 2ZUEA 2FG6C 2G88A 3KJZA 1LLDA 5LLTA 1JL3A 4FGLA 2BJVA 1UINA 1ESNA 1QM9A 4DCPA 4KQ9A 3HHPA 2ZT8A 3K5OA 3RTAA 2Y0CA 3ZO7A 1YZVA 5TMBA 3EMKA 1WSWA 4FKMA 1WQ3A 3BJIC 4LRTB 1QOPB 4H4DA 3HQ4O 1Z22A 2XMQA 3TOXA 5JQGA 2QN8A 1NONA 2G9QA 3MM8A 3BDEA 1TTPB 2DERA 2Q4TA 2DBZA 2KDOA 1SC4A 4D4LA 1MGOA 3AFGA 1FWPA 2VDIA 4M5JA 1O9GA 3BKFA 2QDKA 2NZCA 3VAKA 1P5FA 1ZAYA 5AJWA 3VU9A 1I7NA 2ZH2A 7AT1B 4L6V3 5A6SB 1ETUA 3D6TB 3TEJA 3TKLA 4CIWA 2ZS8A 3QIPB 5CVEA 1EDDA 4H4MB 4ENUA 4HDMA 3WGKA 4WASA 1Y8QA 5BNZA 4WLUA 3LI2A 4W1PA 4I4CA 4URYR 3DWEX 1KDYA 2IMOA 4U6QA 3DQZA 4KQWA 5G0WA 1NXQA 3KKZA 4H7FA 1G5TA 1JXEA 5JXWA 1W8IA 1QK3A 3CURA 3V2GA 1R12A 2OV3A 5KZMB 3TA2A 4KOAA 4ZV4A 4ZRMA 1U90A 1NRKA 5FQOA 2QYCA 2FFBA 3G85A 3I0MA 4Y6OA 4Q18A 4AJ9A 4ZYZA 2FVPA 1DG1G 2H2IA 4I6AA 4ZITA 1Z74A 5TLSA 4M7RA 4ARCA 5TNXA 4MHTA 1O95D 1B7GO 3E22A 3OL9A 1SBIA 13PKA 3MJVA 3UXMA 3M4NA 3PTAA 2IGTA 4K03A 2WSFC 4PAOA 2HR1A 1TM7E 5K2OA 1HKAA 2DUMA 3ZLTA 4LOHA 1HBMB 3OOEA 2F3TA 5B08A 2H65B 3MEDB 4HDQB 4QBHA 4J03A 4NEYA 3ENZA 1ZKDA 3MTEA 5GMOA 4ZREA 4P98A 3C6TB 3C5WP 3QPVA 2H51B 2CWWA 4CN8A 4LR7A 1V47A 3UM9A 3WZLA 2YX7A 2LQ8A 1GZUA 3QY9A 5HW0A 1F3VA 1QPGA 4F7VA 4MVJA 1N6LA 2IPLA 4NY1A 2GR9A 3HCRA 4DARA 121PA 1IUPA 4E15A 5K0ZA 4HWKA 4TKUB 1GFSA 5A0VA 3ZOKA 4R1NA 2DFLA 1ISMA 1R4NA 2VQ6A 1GTHA 5AK5A 2VUTA 5JVHQ 4DN6A 2Y8YA 3ZI0A 3KFXA 5IH7A 3GWCA 2ABWA 4IXNA 4QUKA 3W5UA 1DEXA 3I45A 1R37A 2IYSA 5H68A 2Z6VA 4BO4A 1VBKA 2OPQB 1WVGA 2GEDA 1JZTA 3EZNA 2DGVA 1BX3A 2JCYA 2W7PA 4DR2J 3NGLA 4KR9A 3MYYA 1R88A 4BB5A 2KB2A 1OIAA 3ZGOA 2FR1A 2B0JA 2YKMB 8LDHA 4G8CA 2REOA 1TUIA 2H7CA 2HA0A 4WIQA 4E14A 2OTCA 4DAOA 4AJNA 1PGZA 5AW5A 3A31A 3G6YA 2H5LA 2Z9BA 3F1LA 4O2BB 1WDMA 1H38A 3RV4A 4EHAA 2RB4A 3TFQA 4JBCA 1F8FA 1LNQA 5LJ5Y 1E79A 4DCSA 3KTDA 4RY0A 4HPWA 2WVCA 2HNYB 3NEKA 1A9ZA 2E5JA 4ZT5A 3RS9A 5EIHA 5HEKA 2PUBA 5BSRA 2AOUB 3C14A 1V2GA 1FJGF 2GJKA 5D87A 2IYLD 2Q79A 3BD8A 1Y4SA 5EE0A 1O5JA 1KXJA 2DXFA 2ZRHA 1GVHA 2JARA 4COKA 4M8LA 2ECOA 2XGOA 2VYVD 2O8EA 1KEEA 2W11A 4N7BA 2PL5A 1FDSA 4Z51A 3ZE1B 2CG8A 3SCIE 4NU5A 4LCJA 2NX2A 2DYAA 2QY9A 2PY6A 4WLVA 2B9YA 1QFYA 3CLRD 3IM9A 4DV7F 2A5YB 4G0QA 1HR0F 2HNBA 2X5NA 5K99A 2ZKUA 4QARA 2B5OA 3CVJA 2D7CA 4U39A 4F5WA 4P0QB 3GJRB 2ZR0A 3EDOA 1Y8RB 4NLDA 1K4MA 1GQYA 4EHLA 1WKKA 1J5EJ 5JUMA 4GMFA 2ZI3A 1GPBA 1WG8A 1XMIA 1I3KA 5FTLA 4YMHA 1GFZA 1K8XB 1QVRA 2XLJA 4FZVA 3O38A 3IALA 1TZ2A 2VEOA 4ZYTA 4WD3A 3LLSA 3FDSA 4ES3A 1JT2A 4O08A 5CYQA 3L6EA 4DLKA 4OYOA 1YAJA 1JQJC 3ISJA 2PKXA 1XWFA 3RUBL 3QO9B 1DBIA 4Q3LA 3NMUF 1CK4A 4HB0A 3BEGB 2O3DA 4M76B 3T7JA 4NABA 3W5SA 2D54A 3DQPA 2HLDA 3CKMA 1Y34E 2IYWA 2YHIB 2PV7A 4BATA 3T99A 3HEBA 3SOPA 4W90B 5H5JA 2DLNA 5ANRB 4FXOA 4MXDA 3DOKA 5T41A 1R50A 1V71A 4XSGA 4F3MA 2XNCA 3R0ZA 3GIRA 5C4GB 2PYIA 1W581 4YV0A 3AB4B 2YN4A 4LBWA 2IP2A 4C7OB 1PJ6A 2R8HA 1JSCA 3SYMA 1YUNA 2QI9C 1L4EA 3AOGA 4M88A 2YXNA 3NDIA 2PUHA 4RSHA 1ADFA 5IG2A 3ISZA 1U3FA 3IWXA 3M9NB 3QYJA 4IDDA 4JQCA 5KEIA 4YUWA 3IODA 4RZ2A 2J41A 3DKRA 4ZCRA 1KJ9A 2WM8A 3UMBA 1OWLA 3SE7A 4EGLA 2LA6A 3KJVA 1KO8A 2FFHA 2W8BA 2FJPA 3ODGA 2ZH9A 4WFNQ 1MN9A 5L40A 1M54A 1L6RA 1ZD3A 4E2XA 4WZBA 1N6PA 4HHEA 2V97A 3HKBB 3V2UC 5SYMA 4KBIA 1W9HA 4QQNA 5CIQA 3SZUA 1X7ZA 3TSYA 1ONBA 1AKTA 3N1UA 3L9XA 2EG2A 4TYWA 1VG1A 3GVIA 3QOYA 3DMHA 3FR7A 3MTGA 1QRSA 2QRMA 4R8LA 1YNOA 2IZ6A 5AT1A 5KMGA 3EZYA 3A6EA 3HRIA 1FSZA 2G1DA 1HBNA 2DFDA 5EP4A 1V37A 4CFSA 4JSYA 3PGLA 1CY4A 4JQOA 3U4QA 2XB6A 4NL4H 3PUWA 4GWLA 3C15B 2Q1YA 4JI4F 4D9KA 2WSSD 4DPOA 1CQJB 3MJ4A 3FOAA 4K6MA 2GNKA 2I2CA 3EA5A 3PJFA 2CYCA 3N2NA 3NTRA 4MUGA 5KNLA 4NS4A 2IXTA 4Y2JA 3VI3B 4UHKA 3IAHA 2WD9A 4F4HA 4ZN6A 3NBQA 1Y7LA 2I2DA 2KFZA 4E22A 2CD9A 1TVRA 1GUBA 3OZUA 3DE0X 1D1PA 1QHXA 1GNLA 4WUVA 3L7JA 2X6RA 3P4XA 1X8KA 1OLUA 3PHLA 4ID5B 4NMMA 2BJ1A 4BBAA 5K3AA 5KC8A 2NIPA 4HWPA 4JIMA 1QTNB 4OZJA 5LM3A 1NMQA 3NT4A 5B0DA 1VE6A 1P1JA 1E6KA 1Z6ZA 1R0BA 3RNLA 1JZSA 1TL7C 1S9DA 1E0AA 4ED7A 4YCJA 4QXQA 2HB6A 2ZBCA 2B6HA 4B9SA 3ONFA 2B98A 4BWJA 1P74A 5CD4A 3O74A 2P68A 3MDFA 1KY3A 3JD4A 3D7SB 1XLWA 1BQ3A 3OJOA 1K92A 1KOOA 2ZWVA 4QTUB 3HN6A 4DV3B 4DMKA 2FK7A 2XUKA 4CO1A 3SWWA 2D6FA 4DQXA 1ZP6A 4LTDA 2CQ0A 3OECA 3AJAA 2FB9A 2YIVX 1WF0A 5FP0A 2QMZA 3BAZA 5EUHA 3RANA 3W9SA 5FPSA 4TWZA 3JPWA 4W8GA 3E0XA 1WTFA 4LSGA 4NZNA 5J2UA 2PRIA 1VOMA 4R5PA 1FK9A 1RKBA 5JVDA 3TARA 1WNEA 3ASYA 2ZJBA 5REQB 1AK2A 1DRWA 1NX6A 1FO1A 5LP1A 2I6WA 4EEKA 3WLMA 4RK0A 1WELA 1T6YA 3IP9A 1XBTA 1PEKE 4QDZA 2Q6OA 1GTZA 2HWKA 2XVAA 8AT1B 1CETA 1AKMA 3LK7A 3AVTA 2XWXA 2BH2A 3H1GA 4LMZA 1S4MA 1E61A 1HTWA 4LWZA 3PV0A 3QEMA 4ZMBA 5FLYA 3ZQJA 2GYVA 5JYEA 3H5OA 5EUCA 4UEWA 4Q4HB 2QZ8A 2HJGA 4JJ4A 5EZ6B 3BPSA 4PABA 5BR4A 2JSXA 5EWEA 3TW8A 1ESCA 1PJ3A 2JKVA 1YRXA 3U0BA 4Y6GB 3OPKA 3RRNA 3EC2A 1QDEA 4JENA 3KLOA 3IIMA 2IKSA 4XR9A 3ROMA 1TPZA 1YCDA 4LREA 1ZPWX 4MRPA 1YDLA 4LG1A 4TQUS 2HEKA 3T7AA 1KI8A 1RA7A 4D57A 3QT8A 3NMAA 3NGSA 2UU9F 4IQMA 4HXFB 4DFKA 2P27A 5HZHA 5H59A 5J59A 3ZTSA 3NPAA 2I29A 3FUXA 4C3ZA 2DXEA 1NZJA 4HS4A 4NL5A 4EP1A 3U4IA 3B6BA 1WHTB 1P1RA 1B1AA 4ZQIA 1QH1B 2XHWA 4OHBA 1Q92A 5D3KA 5KC9A 3KJFB 5C5IA 2EFEB 2CRLA 3TEHB 3UWPA 3SVZA 1YONA 3O5TB 2CXPA 3HXLA 2UXCF 4PTZA 4A1OA 2X58A 4YJFB 2U1AA 5AE3A 2HV9A 1XTBA 4NRTA 2J5QA 3VR2D 3WMXA 1QHGA 3BCRA 4RCVA 3ZUPA 3IHWA 1F2TB 1PE0A 3I87A 4YRKA 2P11A 2GF2A 1YRAA 4QGFA 1XCPA 4QBFA 3AFNA 4NRDA 2V2ZA 3W3AD 1OZFA 3HP4A 1E2HA 2CJAA 4G86A 3IQHX 2WVBA 4NR0A 5IASA 2OWDA 3ZHYA 5KIAA 1NGSA 4MYCA 5LYYA 4H31A 4C8ZA 4TTVA 3T9EA 4K9QA 5HCIA 1QGYA 2XPCA 3U0VA 4H16A 1VRQC 4KWIA 1BXRB 5I7FA 3KJNA 2VFSA 5C51B 1MOZA 3GJSA 2ZTUA 4WA7A 3PEUA 3LK6A 1S4QA 4OIMA 4LXXA 3LY7A 2BFBB 4ITVA 2F9FA 3UHFA 2QVZX 3U5ZB 3E81A 3HR8A 3PX7A 1Z5UA 2KI2A 4IRKA 4PKDB 2CE7A 3ZYZA 3DBVO 4QXRA 2J9RA 2WZ1A 1X1EA 3PVZA 1L5FA 2QSZA 3DUFA 3OC0A 3K71B 1MROA 4LBPA 4ZC1A 5ETRA 1P0CA 3IMKA 2VHYA 5JZ9A 3K70C 5TMDA 4O4RA 3T6KA 3QQPA 4JBGA 1YO6A 2F5GA 3TECE 1M5RA 1RBAA 1EQ0A 4S2EA 1BD6A 4AE5A 1ES9A 2CMKA 3WICA 4LXUA 1VB5A 4ZAXA 4L0QA 3C4VA 5LBTA 2QD5A 4EG6A 4K86A 3PNLA 2R8IA 2QAIA 3WR5A 4F4ZA 2PKQO 4NESA 1NW6A 2WUFA 2H11A 3UHOA 2WA2A 5GIPE 3VKVA 4BNUA 3QAUA 4ED9A 1H2FA 4PPZA 2IEYA 2NO4A 1GZ6A 4BNTA 4DPUA 4ZOCA 4PY2A 1H8ED 4IGFA 5EHNA 5CD1A 1K0FA 3JATA 5HFNA 3WYNA 4LF8B 4U0JA 2QD2A 4LQ9A 5ILOA 5IFLA 2YW9A 2D59A 2OD6A 4O4HB 4V0ME 3FSIA 1ABEA 4GMXA 3VNAA 2KRRA 2O3SA 2AMLA 1TL5A 1J7KA 3BFKA 3VM6A 1JHMA 2OC9A 3RYFA 1IK6A 1ZN8A 2VCEA 4M6WB 1N36F 5K8UA 3E7FA 4B8YA 3MMJA 1QIMA 3RHZA 5DYTA 4ZVTA 2EVWX 3WQHA 4UD6A 4MH8A 5DCWA 4R31A 2D1TA 3BFPA 1JT9A 4BJ6A 1EHWA 1LTKA 2HMTA 3IV6A 4NP6A 2ZJ8A 5COAA 1E4YA 2R65A 3RSSA 4ZDWA 4GPAA 2MEWA 4C1NA 2BTEA 3KDOA 1JSZA 3JSYA 3STVA 3DCIA 1UZDA 3A3PB 1X19A 2O2CA 4O4LB 1T1JA 5K8IA 2FGCA 2D06A 2HN9A 1Z26A 1M83A 2Z57B 3OT5A 1RA6A 4OL9A 5C53B 3UY4A 2DVIA 1XEWX 2VG6A 5L1IA 2Y9HA 4BEWA 1PTKA 4B9VA 1GPWB 3PFEA 3VHXA 4W5QA 1YRBA 1ZGHA 4H1TA 3GB0A 5DOZA 4WPGA 1X8JA 1GIAA 3U7IA 1QBGA 2QTLA 2CJPA 3JSMA 1QIIA 3TQSA 1QIJA 2PKQP 4J9NA 1GMWA 1YZNA 1YLXA 5AMXA 1EXNA 5EJAA 1USWA 4FXDA 1I51A 1CPZA 4QWWA 1CV2A 2WE8A 4RGVA 2HPVA 4U63A 4AY4A 2DPIA 1FJHA 4WOJA 1T5OA 3MTDA 5KYYB 2A18A 3OZRA 3T94A 4OI4A 2G5PA 4IIHA 5BSFA 5D0RA 2X1VA 5B55A 4YJKA 1REGX 4ZQFA 4M1WA 3TMYA 4CR7A 1EJ6A 3V2HA 2X0DA 3RU0A 1R8HA 5ALXA 4L16A 3UWDA 1KAQA 2E4WA 1V3TA 1TKZB 5JXSA 2YOFA 1CIPA 2AYBA 3FRJA 2BFCA 2Q3FA 2Y1LA 4LDRA 4GPD1 3ELUA 4D8TA 2VG8A 4XB1A 3RYLA 4A6EA 1B15A 2A5LA 5NULA 1KK2A 3INTA 3HL0A 1U1PA 3R5GA 3PNPA 4BUZA 2J5BA 1EIZA 1TLLA 3EZ2A 3X0DA 5CHEA 1CQMA 4IIUA 1BG6A 3T4UA 2HLUA 5JDCC 3IR5B 1SHLA 2A86A 3V4IB 1GQEA 2ISSD 3QVTA 2GCOA 2V9PA 1F0PA 1QH8B 2REQA 1MDBA 6PFKA 4BMPB 1P3DA 3AQ4A 3UV7A 1FRLA 4FBTA 3B82A 4ZYLA 2XY7A 2GK6A 3NWOA 3SIPA 1VSBA 3S2EA 4JU8A 2AOWA 4DG1A 4Q19A 4QU6A 1YE3A 3BCHA 5JJBA 2BBWA 5KYYA 2WAQD 1OV4A 3CGWA 4QECA 4AUNA 2YWJA 4MDEA 2G2OA 3SYKA 1G8GA 1CY8A 2W2PP 3UI3A 3IDFA 5FUVA 3L7UA 5EOVA 3CYFA 3R5AA 1G17A 2WTUA 1F6DA 3N2LA 3D66A 4MEJA 3K0EA 3OOHA 4KJXA 1WHVA 3I0RA 2YFKA 1AZSA 1XV5A 3NASA 4L3KA 2P8SA 2IYOA 3SV4A 3ITNA 3L1IA 1WDTA 1YRUA 3F8TA 2R11A 1ZMBA 1FUUA 2MMGA 5KQSA 2C5SA 3IBWA 3ROEA 2J8ZA 4OQMA 4L28A 3TMAA 2ZJ4A 3ESBA 1BE1A 2Y8EA 1MNAA 1CJVC 4ARSA 3LMKA 4KGXB 1DT5A 4ND1A 1HR0J 2W6QA 3EZ9A 4K1XA 3V4LA 4ZAFA 5HIAA 3GL9A 2C2MB 2UUWA 5YASA 2I6UA 1ZXLA 4F4YA 3OHBA 3GEDA 3FDJA 2GH1A 1A8UA 4HVLA 4I1IA 3ETGA 3OCWA 5CGZA 5AOVA 2VJOA 4Y2CA 1LD3A 3RRXA 4MR7A 4DVJA 3H97A 4RF4A 4CF4A 4QR0A 2OCXA 5F41A 5CLQA 3HKEB 2R1VB 2RQ4A 5D5PA 1MT0A 4D4MA 3SFGA 2P9GA 5KNDD 2UXBF 2E9TA 3ZLUA 1L3VA 1R10A 4W9RA 1M5UA 1SD1A 5LQAA 1EFCA 3I58A 1C4AA 2DCLA 1M5KC 5D7NA 3B6EA 2PBZA 1G4AE 3ILIA 1E6YB 1UQUA 2HSDA 5LQSA 4GOND 2GZOA 2EG1A 5HRCA 3VKGA 4AG6A 4DPWA 1DHMA 5K3OA 2PMFA 2JRCA 4RORA 2RUSA 4I9UA 4WCFB 1QGUA 4CF7A 1U80A 1KE1A 3S29A 3Q6MA 1RRPA 2JJ8A 1ZITA 4USHA 2ISCA 1EUCA 4WDQA 5DG8A 1M8GA 4UHCA 3CJQA 1JFFA 2Y4OA 5SZKB 3M4ZA 2G0NA 5K0NA 3UJ8A 1XWLA 1RQGA 4KHMA 2O6LA 1XQWA 2E4ZA 1I24A 1GTL1 1APSA 1WKCA 1BN6A 1LBEA 2CIMA 1TZKA 2I87A 2X0EA 2ZBRA 4AXIA 4U2KA 3FPEA 3G1WA 3IH5A 2QE6A 4RTPA 1OC4A 3QVGB 3HGQA 3TVTA 1M2OA 5IMBA 3RGWS 5HL7Q 4PLPA 3OUUA 4C04A 5D6OA 1MVNA 5DDPC 1ZHOA 4RKEA 2QSJA 4NNPA 1U8WA 2V8BA 2UUAB 2GHRA 2RH8A 3QXJA 4N5DA 2ZWAA 4Y9UA 2GAOA 3CNQS 2G63A 3SYRA 3F9RA 4URHA 1ZAVA 2ASYA 1P6XA 2RH9B 4DMHA 3U80A 1A1SA 4CLTA 2W6CX 1B41A 5ESRA 3UMYA 1PGPA 4DR7B 4HRVA 4B4KA 1NMYA 3AY6A 4Y2GA 5HQ3B 3OFGA 2W9AA 1LWXA 4DR3B 4JGGA 5G0TA 1FFEA 4EU0A 3MXTA 1VGYA 1HTTA 1BAPA 3LS2A 3LOUA 1I3OB 4ZPTR 5J3JA 3COVA 4AD8A 5AT1B 5B58C 4ANEA 5K8VA 2V6FA 3R8YA 2Z8YA 4E7PA 1ZH4A 3SYNA 4I56A 3W60A 1RXWA 3T5KA 3A36A 1ZONA 4R2MA 4HH1A 5CW2A 4ZT7A 4MV3A 2J6SA 3T7DA 1NB2A 3DAGA 3BWDD 3VYTB 1X4AA 4EI2A 4BO1A 1JWWA 4ZVPB 4WH0A 2M9MA 4L8GA 2PYZA 5C7OO 4UW9A 3EE3A 1PBNA 4PG7A 3G0OA 2AMFA 3SBEA 3OPVA 2G0TA 1Q1ZA 4RH1A 1PSWA 1SZCA 3A4YA 2FZKA 2CUZA 1U63A 1KQFA 1JFTA 1DBPA 4YQWA 2G83A 4BNDB 4NMHA 4PHCA 1BMTA 4B7ZA 1ODFA 3BB4A 4DX6A 4JVMA 2J59A 3ORHA 1XQIA 1S9EB 3I32A 4QD3A 1ZK0A 1NUPA 4ZZ3A 2R9LA 3SEOA 2UZ1A 2JFKA 1CW2B 3TR0A 2BJWA 4MVJH 2W2TA 1XAHA 1JLCA 1V26A 3Q7RA 1UPMB 3QWHA 3D8TA 3RC9A 5JJKA 2DHEA 1PJ5A 2WNSA 3WRXA 1SCUB 3E5HA 5I9MA 3DOKB 3NM6B 3T7TA 5EMLA 2WOOA 1T0HB 2ROPA 2BFEA 4E0DA 3FBWA 1JG7A 1NEEA 3ZNUA 4F5ZA 3SQXA 3IOBA 5D6NA 3TPFA 4N47A 5K3SA 1RKXA 3MCWA 1BDIA 2R8PA 5KSYA 2ZHBA 5CH5A 2EYUA 5ERYA 4EFDA 4K5SA 4FILA 1KTQA 1KORA 3SCZA 2VPXA 4MRNA 5B36A 5IM4A 4LF7J 4K4TA 4LHXA 2QV7A 3CG0A 3IEKA 4OGWA 3F96A 1AT1A 4PXBA 4ZVPA 3AETB 4L07A 4TSFD 3SIXA 1YRWA 3K0AB 2VNAA 4FD3A 4LWPA 2LE0A 1V11A 3OQBA 1DNPA 1ZZFA 1FZTA 1PR0A 4MGKR 3BBFA 1X1RA 1FRMA 3ZTPA 5ES3A 2ODBA 4FEGA 2VSOA 4K9NA 3QXGA 4KK4A 3BYZA 4PG6A 3LVFO 1ML4A 2FHKA 1S7HA 2WUVA 3LIIA 3E82A 3PFBA 4PQRA 4DQRA 2ALYB 3X3UA 2R7LA 3OUYA 4TXNA 5AXAA 1R27B 5DGXA 3ZD8A 3IC1A 1L3SA 3VC7A 1VLZA 3UMCA 4DYDA 2B56A 3A1UA 1RHRB 2AG5A 1PFKA 2I91A 1NLMA 4ML3A 1R0LA 2F1RA 4YPFA 4E4YA 5AOAA 4LSLB 4QU8A 4IDKA 5T57A 3JTMA 2WB1D 3MCOA 4F36A 3VYUB 4HH0A 4I1YA 2R2RA 1KD1T 3FYCA 1ISGA 5B0GA 4G5OA 1PBAA 3C3WA 1RCTE 2QSFA 2XQIA 3GW8A 1NBMD 2FQQA 1WHYA 5BOSA 1VBZA 1SFRA 1C1CB 3PFOA 2V5VA 3BVPA 1OREA 4UOGA 5HMMA 1US8B 3H65A 3WJ7A 1ZM3A 2ZG6A 2J3HA 3EHDA 1GAXA 4Q4HA 1BS9A 2WWWA 2FSPA 4GKAA 1X60A 2XXJA 2PCJA 4ANFA 3PA8A 3HPRA 2ZBPA 4JHLA 2OPPA 2QW1A 3VISA 3FD8A 2Z2XA 1FBTA 2RGYA 4H60A 3T5JA 3QXHA 3U7JA 4A8SA 3UR3C 1JAIA 2AFRA 4L9RA 4DCVA 3UR0A 2V8HA 5C3MA 3HJRA 3PCRB 2NYUA 5K0BA 4WCFA 2G2YA 4YQZA 1KQGA 1ZD8A 1H6BA 4NBUA 2IE0A 3ESAA 4QFDA 2E6UX 4UUBA 2X3UA 1XU7A 4RLFA 3GEEA 3B5JA 3ITHB 3RYIB 4XYLA 3VA7A 2DAPA 4EECA 4QHYA 1ST2A 2B7BB 1WEHA 1V2HE 4B8WA 1FFDA 1F5NA 5JV5A 2XMJA 2MGZB 1FKOB 1PZMA 4AUEA 1R6AA 1JG4A 5L3SA 1ZRHA 4XX0B 3LKBA 2C42A 3HK2A 4DSOA 4HS9A 3I61A 4A8TA 2IEIA 4B3TB 4TTIA 4CQMD 5EUMA 2Q6IA 1BS2A 2I0FA 3SHFA 4HNGA 2ZK7A 2VDWB 3IC5A 3Q7QA 3R5XA 1MLDA 2E4XA 1YOVB 1HQUB 2E85A 3TCKA 1OIVA 3ZD6A 1GGMA 1TUBA 3RJMA 2E5IA 2G71A 2FPXA 1GILA 4OGGA 4EJSC 2MHNA 1WCV1 2ADBA 3MAAA 3DZFA 1EBFA 2QZ9A 3OR1A 4JI0J 4ZOLF 5BPFA 2HRYA 4ZJQA 4K1LA 2ZDHA 3MK31 3OPXA 3N6MA 1S59A 2CQ3A 1TTQB 3L0BA 3NEAA 2WWGA 3MCUA 3HMKA 2RFLA 2IXAA 2Y9PB 2W6NA 2ZATA 2J9CA 1TMGE 1URRA 4C76A 3PFGA 3UJ9A 4XWYA 2G5TA 4N12A 3T54A 4INZA 1TIKA 4OZLA 1J90A 5A8RA 3DLGB 4L2IB 3M2TA 3VZSA 2IXDA 3QAEA 1Z5WA 1HQ2A 3VKFA 2JDID 3STWA 1SQGA 2Q3JA 1YQQA 2FN3A 1MN7A 1OPXA 4O8CA 4XUEA 2GMJA 2CNDA 3BULA 1XTJA 2AG6A 5KT4A 5BR8B 4HBZA 4A8JA 2MSSA 1XOIA 1QH8A 3AF0A 2VOEA 5DYYA 1I01A 3LM8A 3MR6A 1H0KA 1N5YB 4WK0B 4N9QA 5LWQA 1XU4A 1BCSA 2YNMD 1NJ2A 4V0NA 3PR3A 3ITDA 1VYHA 3CUUA 2NW6A 3RYIA 3ITHA 4PGHA 2AG8A 1CDEA 4RPGA 3NHKA 1EQAA 3D0GE 3OPQA 5FOXA 1VBMA 1T11A 5IC4A 1T05A 5HF9A 4X6UA 5DDQC 4HVAA 4Y18A 4ZHSA 2IOFA 3I23A 5E4FA 4D0GA 4PRYA 5D4NA 3CCLS 4KMOA 4I2QB 3EWSA 1ZOIA 5CYMB 2X4IA 3AXKA 2P9JA 4XYMA 4C89A 5GVRA 1OXSC 2VQFB 1DEAA 5EQJB 4MB0A 3H2JA 4ZEMA 4NU6A 5KFNA 2E7WA 4AB1A 4E70A 2RILA 3R40A 4CLRA 1RR6A 4HH3C 3MT7A 3KJXA 4CHGA 2BKOA 2PWZA 1U1QA 1T24A 1MW8X 3TM4A 4KWCA 4KNVA 3B4DA 3RUDA 4RPHA 4DZRA 2Q5JA 1EA5A 1AC5A 5HG0A 5LPNA 2F8HA 3IIEA 3UNYA 4F0HA 2V67A 4P74A 2BBTA 1Y3AA 5B4VA 4J2HA 4B3OB 4O33A 1RFLA 1XJCA 1IZZA 1PJTA 2NG1A 4KI7A 2JVRA 3BE6A 3HD1A 5HILA 1ULZA 1Y11A 4KPYA 5DBGA 5BYQA 1YZTA 5F12A 2ZI5A 3TUJC 5L39A 4BNDA 1G1MA 1QAMA 2I1RA 3OJFA 2FX5A 2GJ2A 5BUCA 1N34B 1CY6A 3J7AC 2J4FA 2YKNB 1GXSA 3A3PA 5AJUA 1DGQA 1U6IA 5CABA 1ISSA 1NPYA 3NVAA 2XHZA 1G4UR 3ROZA 5CFQA 1L4NA 2IDMA 4U7CA 3IGVA 3KYCA 1MHTA 2HNZB 3NBKA 2FVXA 3SEQA 5KTRA 2EDCA 4KMMA 1BVRA 3WDLA 4KNYA 1BX1A 4QVGA 5LQJA 1YZHA 4PC2A 1MAHA 3EFEA 3CVXA 4C29A 2O48X 5BSVA 4ABTA 5C8XA 3VGUA 1VK3A 3R09A 2QO3A 5KDLA 1JDTA 3GD7A 3W7AA 1SVWA 1QYXA 2WVJA 3T5DA 3WGIA 4Q34A 2IZOA 2DQYA 3U7EB 4M9QA 4AP9A 1OYDA 2C58A 4EMDA 3NOCA 4AJPA 1NVAA 3OLVA 3G7UA 4U2GA 4C98A 1FNCA 1GU7A 3KSUA 4HMQA 1RISA 4ZCPA 1WXHA 3G87A 2JLZA 2KN4A 3WNVA 4QOJA 1QZUA 3IP0A 4W9MC 3A3YA 1DWUA 1XKQA 4X90A 4EMUA 4KE7A 1XDUA 3CONA 4S35A 4I69A 2QBYB 1FFWA 5A62A 4MKYA 1K3TA 2Q3EA 3F7MA 3BMXA 5CZVA 1GGVA 1E0SA 2W9BB 2PK3A 2VPTA 5HMLA 1Z2LA 2WU3A 3D02A 2NZ4A 4A0SA 3I6BA 3OD1A 4TQ9A 3OLWA 1TCBA 5JNRA 1HLFA 4G0VA 3P5BA 1QKKA 1Z3IX 3K0CC 5H02A 3U7QB 4RNOA 2H5EA 4JLBA 1H2BA 3UA3A 1R6BX 5M2UA 1SBNE 5KJFA 2L42A 3THVA 1FP7A 3WNZA 4C0BA 3LTNC 3EXEB 5DK6A 5HMYA 1UBFA 1ZIPA 1A8IA 2HMAA 1G8FA 4W6ZA 4MAKA 1OI2A 4JYAF 1N33J 1Z7BA 2QW8A 1UP4A 1CBUA 1ZAXA 1UL3A 4FZ3A 3EXG1 3M05A 4CDIA 3OR2A 4IDAA 1KMMA 2B69A 2QTGA 2G1AA 3KKFA 4MMOA 4NCNA 4KLRA 1TO6A 3OI7A 4JEUA 2X51A 1M73E 5K0SA 5J63A 1U0JA 4B35A 2WZCA 2FZ5A 5EUBA 3GGJA 4QIWD 3A58B 5FR2A 1ATIA 1Y5IA 2PX6A 2GWHA 3DCNA 1OXUA 1QOZA 3TRDA 4CKWA 3EOAI 4P5PA 1QFMA 4QBGB 4Q16A 1TZBA 4BMDA 1CLFA 4ZWNA 3FCOA 5E4JA 2ZH5A 1NC3A 4RNDB 5KSZA 3OQ1A 3CA8A 4LRDA 2UYOA 2XMAA 4EYGA 2PFGA 1L1EA 1MG0A 2OFFA 5JT1A 1C9DB 3G1TA 5EKUA 2NU7B 4NZMA 2H8GA 2HZ7A 1T9AA 5HGJA 1UANA 1WHXA 2ZVSA 3MTIA 4GE3A 5FQNA 1J27A 1KDOA 5LNK1 1WZUA 4WBSA 3SHQA 1O6ZA 3VI4B 3NNCA 2LW7A 3CZ5A 1G3RA 4UHEA 2Z2IA 2A5FA 3D3BJ 1FP4B 4TU8A 2R6CA 4M55A 4USUA 1KOJA 2DGTA 2YN2A 3QVLA 3BAFA 2QV6A 2FR0A 4DLAA 3KMQA 5FIIA 1FKPA 1HNIA 3G8BA 1M67A 7MDHA 2M2BA 2HVZA 2Y1JA 2C83A 1XTZA 4K8RA 1GPKA 4B3TF 2K2QB 3I0RB 4G07A 4YXWA 1T1GA 1V3VA 3LGSA 2DHHA 3OJEA 3HLUA 2CLKB 1UTAA 4J43A 1KBZA 4OJQA 4B81A 4BTEA 2BKAA 2WKQA 5LUAA 1N32J 5FBKA 5JNWA 3UJBA 3M1IA 1ZC4A 4OKNA 3BO3A 3Q5DA 1CY2A 2JLQA 2AUNA 3TD9A 4N3NA 1GH8A 1M75A 1TQDA 2X1BA 1RWNB 4JGIA 4CIBA 3KLEB 4PYQA 2C4VA 4RXMA 4XR4A 2LWIA 2WJJA 4ZO9A 2XE4A 5FH9A 3M9OB 4AQYJ 4B7XA 3CB2A 3TLBA 2FC8A 3C5HA 1L3IA 1D04A 4DG5A 4OQJA 3WTBA 3BGLA 1FDIA 1EIWA 4M1KA 4ZMMA 4AG3A 4LBIA 4O5AA 4H4EA 1SC4B 3ZTQA 4MUEA 3CMQA 4TLBA 9ATCA 4IXMA 3R9WA 2R8YA 3C87A 4X00A 3RTEA 4ILEA 3GFPA 3C8YA 3H9BA 4DV3F 2QTVA 5CDGA 4BLVA 4BMXA 1OF1A 3M1VA 2WSMA 1ZUD1 1Y8QB 2Q5IA 1LJUA 4I50A 2X13A 4B4UA 1RRMA 3VR4D 1GQRA 4R1UA 5HGXA 2HCBA 4FE7A 2HQ3A 3L7AA 4C8KA 3IO3A 3KT6A 3FBGA 4IOLA 4IIVA 4CUZA 3GA5A 3VR6A 2ZS9A 2NACA 1S0UA 4U7UD 4BXOB 5LKAA 5JMOA 2ZBEA 3CX3A 1XT6A 2BF7A 3D4NA 2J0UA 3NALA 3T12A 1R1DA 2BLLA 5HKKD 3QSYA 2YVUA 4OB8A 5EXDA 4L6IA 1G8HA 3L8CA 3BQ0A 1ORTA 5LXTB 4CT0A 2O8DA 3ZFVA 1UPTA 1CUWA 3UA4A 5ALGA 1N2EA 3TVYA 1UC5B 3OMXA 1FE0A 1TJYA 1K7SN 3NBAA 2Q50A 1UBCA 1A5BB 2XLCA 1HFEL 3H5XA 2JGDB 4DFMA 1HBUA 5FO0A 4EO4A 1E20A 1ZUNA 3QG5A 5K8LA 4L74A 2VP0A 1Z2AA 1YNSA 1O5IA 2P8IA 1AIPA 3P52A 3L0SA 4RX6A 3QTTA 2VT7A 1V6CA 2REQB 3MR3A 4F3NA 4CODB 1E89A 1XAJA 5FNVF 5CK5A 4C5BA 3O84A 3C15A 1IDOA 1VHIA 4EBDA 2I55A 3FTCA 5EZYB 1AW0A 1F6BA 3AKYA 3KE8A 3RS2A 1DUVG 1OYYA 2PWBA 1DELA 3H42A 1ZCAA 4EUKA 4CLUA 2H5IA 4EPXA 3L49A 4XXHA 5J47A 4C7QA 5G1NA 4TLAA 2QD4A 3K1ZA 2GB4A 4MUHA 4JBWA 4D3FA 2VU5A 2B4AA 1JU4A 1OBVA 3COWA 3ZK7A 4QULA 1NU8A 1ZOPA 3DNCA 2CSUA 4GNKA 4GR9A 2IYRA 5EMNA 2QT9A 3IDSA 2DKOA 2ZIFA 3II6X 4J9LA 2O5DA 1F8YA 1P5HA 4J7AA 3BWMA 1DDGA 2JZCA 5DLQC 1JWLA 3IEMA 1VJ0A 2ZSDA 3OCYA 3N28A 1VQ9S 4KDEA 4L02A 2PWPA 2XDYA 2DISA 1NC1A 2VQDA 5G1PA 4LOJA 2XCSB 3TXXA 2W9BA 1VQMS 1PS8A 3R0JA 1NATA 4YOEA 3LP2A 4U0KA 1X15A 4Y67A 4GWGA 3KOAA 2XY6A 1SOWA 3NS6A 4ND7A 1P80A 2N7YA 3M1AA 3AV0B 3AF2A 5I9IA 3DBRA 1OFVA 3IBTA 4ZVSB 2AFIE 3DVLA 5M04A 3OM8A 1YVEI 1T9YA 1B6RA 4FOPA 1JLGA 3KEFA 3HXQA 1S4FA 4FQ7A 1ZXXA 2D2XA 1KFBB 4WBXC 4W1SA 1JXQA 4GD3Q 3RS4A 2PXCA 1RT3B 2P9HA 2JI9A 4OJNA 2PSHA 3N87A 2B9XA 1AO3A 2RVJA 5KT6A 3BREA 1RE1A 4LR9A 3UKJA 2ZNZA 2Z4TA 1GT6A 1GNVA 4R83A 2F8MA 4BVKA 5B0FA 3QE3A 3EXCX 2V4UA 3PEFA 3V97A 1EB8A 5CTAA 3BZQA 4LIPD 3CPHA 3F3KA 3NGMA 1XMOJ 1ADBA 2WT4A 1X4CA 1Y8RA 2CJKA 1XQXA 4OAOA 3IVGA 5AKJA 2BABA 3UG7A 3GRRA 3Q6NA 4PRFA 3LUYA 1S97A 1WDKA 3PG5A 1ISHA 3IR6B 5HTKA 2QU7A 2CNBA 1VL6A 4UY8T 2Z30A 4G8JA 4KN6A 2ZIGA 3LLVA 5BWCA 3H5WA 3ADAC 3L8YA 3M3HA 2C9MA 1HNZB 3KC2A 3R3SA 5IDWA 2UYQA 2LUOA 4JI6F 2K1RB 5LQDA 1DRKA 2QJOA 3KUEA 3UXEA 2ES4A 4FW8A 3WMRA 2RD5C 3IL2A 1D0VA 2GPWA 5IVPA 2VYVA 2IM3A 5I3UA 1M2VA 3NAMA 2XDAA 3KKOA 3E70C 5B58T 4DV0F 2GBCA 3SFUA 1ZVJA 4ZCLA 2NQ8A 1D9FA 2H1SA 3KLNA 3QLVC 2MSCB 3VNSA 4IYRA 2EFVA 4EEYA 3QSYB 1NQ5A 2AOUA 2R47A 4MPPA 5CLGA 1Z4QA 1E94E 1EG7A 4CKEB 4Y30A 5LP6A 1A7AA 3MMXA 3B9PA 1Y3JA 1P9RA 2HWWA 3NONA 2QZPA 4ZAYA 4X91A 2XUAA 3PDIB 3AINA 2WW8A 5UKDA 1KVKA 2QRPA 1J42A 2EF1A 2VPWA 4KGMA 3BICA 3RLIA 4G5XA 4ZK7M 1S2IA 2CDBA 2VJPA 1KAHA 2WWTA 2YVSA 2NPOA 2O06A 3FFTA 4ER6A 5J5VA 4CI9A 3DP9A 4DZZA 1RTHB 4D7AA 2X9VA 1TAUA 3V1YA 5JJIA 3Q98A 3RAJA 2Y0SD 3DDOA 2RD2A 3VJRA 1HQEA 1ZICA 3UQZA 1QDLB 4NENA 2DJWA 2DWQA 3VAFA 2VC2B 1XMXA 2DR6A 4EUFA 1EH5A 3SHTA 2GA8A 2ZU6A 2WC1A 4EZ6A 4J0FA 1XK6A 3SJUA 3IEXA 3TW4A 3BKTA 2PUTA 2O2SA 2HRZA 1N7HA 3GJTB 1BE6A 3DI6A 3ZX4A 2P5YA 2DBVO 2P6MA 4D3SA 2PX2A 2E4UA 4UXIA 1L4UA 4PWDB 3LYLA 4RVUA 4I7FB 1C0PA 4DANA 1F12A 2VV5A 4DR5F 1T6ZA 1T4DA 2QLLA 3WNCA 3UMGA 4LY6A 2P6RA 1KFCB 3MEEA 4F46A 4ZPWR 4MV8A 1AT1B 1L5YA 4MKAA 5DRKA 1YQWA 1T43A 1S1TA 2IBOA 3G6ES 2QPAA 1JUDA 4WZZA 2GHWA 1Z34A 2GQ2A 4NQZA 1R0YA 2E5LB 3RS0A 2OPBA 2IFXA 1RWWA 4OQYA 3NNDA 3NWPA 3NXZA 2I6SA 4XQCA 4AU1A 3B89A 4ARBA 3OJUA 4ND6A 4B73A 1L7NA 5GGXA 4QGBA 4YIKA 4Q0BA 3VC1A 3QU7A 2VZ8A 5SZIA 1HQEB 1DJMA 2Z8QA 2QTNA 1S9HA 3RRYA 2FV8A 3AP2A 5JMNA 4ARAA 5CAAA 2WP8J 3VR6D 2ZYIA 2DHQA 2ZB3A 2ZKLA 4REQB 3DFEA 2XB8A 2AQKA 1WPQA 3OQPA 1E1KA 2QX7A 3F5QA 4IGIA 1VL5A 2F8SA 2WSBA 4P5EA 3IE0A 4OJ1A 4BBYA 3EDRB 1UEVA 1JE1A 2WBMA 4PM4A 3GX1A 1ULUA 2H59A 3KUXA 3MHYA 2KI5A 4Z1OA 2PZBA 1UA0A 4DCCA 1LLUA 2OGTA 2VYQA 2HTFA 4C22A 3SDEB 1DCMA 1NSYA 1UIRA 3LGAA 3U56A 1QIGA 3CCJS 3IN5A 2J6CA 4MICA 3WK9A 2OORC 5U9CA 2IU4A 1U24A 3PVCA 3DMPA 1PJAA 5EX0A 3MUNA 4EHIA 2B1QA 3KKMA 2CLDX 4GLOA 4MQEA 1TEXA 4XVRA 5CB0A 1I13A 5M2PA 3DHWC 4YDSA 3ICVA 5K1ZA 1P2TA 4AL5A 4HDSA 2QR5A 5KOXA 3B51X 5CNMA 2XUZA 1QBKC 3NFYA 4TU7A 4UDOA 2JIBA 2B61A 1IIBA 3HZZA 2CVQA 4BN0A 4DA0A 2C7QA 5EIBC 3MWJA 2JJ2A 5EP2A 1ISIA 2VYCA 3UT6A 1MQAA 4D43A 3FMWA 5FIUA 2IA0A 4UBKA 1KFEB 3VR2A 2EFPA 1II8A 2GHTA 3NTUA 2RGXA 2EKPA 3FNQA 3TPCA 4CXMA 1ULAA 2QA4G 4JDUA 5HVNA 1X13A 2GS8A 3UJDA 1X5TA 1M2VB 4KXXA 1BDMA 3DXZA 1NKVA 2WTXA 1K0UA 4UCQA 3T4EA 1FDVA 2R48A 2Y1OA 5AVVA 1N33B 5JZMA 1V45E 4MMZB 2PGCA 1NZDA 2EWHA 1NIPA 3HDHA 1SL0A 3ZK8A 4AJ1A 5KG1A 4HLUC 1NW9B 4OX9F 1I5RA 1Z36A 4LQLA 3ZWPA 5AJVB 3DV2A 3LX5A 3HZGA 1N5MA 4OZ2A 3KPJA 1AGRA 3EMTA 4FFVA 2ZU0C 3F71A 4L1KA 4K2HA 4Q93A 2CB9A 2X7IA 1OBHA 4EB6B 2TMGA 1AXGA 3WY9A 5KG7A 5T14A 5C18A 1H2EA 3IBCA 2QMEA 3ZBTA 1F60A 2HO4A 4LF9F 3AESB 2KX7A 1NXXA 1U45A 2POQX 4O59O 2GRAA 4IOKA 1EQ2A 5AK0A 3SMQA 1WB6A 1WJ9A 2QRGA 2YWCA 1RE0A 5AHWA 4C6AA 3U61B 2P4HX 3ISTA 4JI0F 3JQGA 4TWAA 3JSAA 5CT9A 2DD8S 2A0KA 2LCFA 4ENSA 2UUBJ 1IR0A 2ERXA 5C1DA 3TJ9A 1FD8A 4P7BA 3UK1A 3I1FA 5HYVA 2N1MA 4RW6B 2HNAA 3JATB 1TUGB 3FDXA 3GNLA 1PUXA 4L4XA 4U2BA 2HWXA 3PFNA 1L7RA 3SYLA 5K5MA 1U0OC 1Z56C 1PR1A 3OQJA 2O23A 2PO4A 4MWDA 3NL0A 2XBPA 4JT9A 4B3MF 2IEDA 3A4TA 3G13A 3F0NA 1MHPA 2JAUA 1QQTA 4Y2SA 2VJVA 1AQJA 1PGQA 2YMLA 3DR5A 4EGSA 2H48A 4PPNA 3K9BA 1ONPA 4XX1A 2J6HA 1U2EA 3C3MA 3PHJA 4HUQB 2P5UA 1FMFA 1Y81A 4I1VA 1FDRA 3GMTA 1DG9A 3TD6A 1OY6A 1JIUA 3WISA 2LGJA 1YK9A 4B3XA 1XQ6A 3PJWA 4YHBA 3HCWA 1SQFA 2PX5A 1C9KA 1BVUA 4WXYB 4YMSA 2QR3A 1CR2A 1F2HA 4MK7A 3HO1A 4OYXA 4Q7JB 4A0FA 4YR9A 3RRHA 1RACB 2D7SA 4HN2A 4MA0A 5IJWA 4Q15A 3UWKA 1WRBA 3IO1A 2QT7A 4D25A 1ZIDA 2YQ3A 2W6MA 3EVEA 1U2ZA 3HV2A 2QSYA 1NDPA 3PCOB 2V59A 2GVZA 2GMWA 5F5LA 5JBIA 3RRZA 3ZGLA 4NZ0A 1Z12A 5FORA 4Z4EA 3BSCA 3R6TA 5C8DA 2RHSB 4UZEA 4LZAA 4KYZA 1ESZA 2HS3A 2LMIA 4IS3A 1BFUA 1QSGA 4FR0A 4ZYXA 3DWIA 3UJ3X 3N05A 1MROB 1SIUA 2DF8A 5I4CA 2PGDA 2P6UA 2X5JO 3KK3A 3KYIB 2YMQA 4DG8A 1MG5A 3T7KA 1VFPA 2X7JA 4K4UA 2MY7A 2VRCD 1BMDA 4NX2A 4HRYA 3T19A 4DV2J 10MHA 1U1DA 1KWMA 5DXFA 2WYVA 2HADA 1IQ0A 4EKYA 1EE1A 3D9BA 2F43B 5CX4A 1VKZA 4UXJA 1JMTA 2JLGA 2D3WA 1M0TA 2XXBA 5IW8A 2M6SA 1T25A 1FCAA 5M5BA 4GMHA 4FFDA 3VH1A 4CYUA 1F2UA 4B3MJ 2NOAA 2WG1A 4WLFA 3RFFA 5BUQA 2C03A 3WLJA 3QJ5A 4IJUA 3IP5A 4D79A 2M9KA 2CCJA 2CJBA 1HL6A 2MPUA 5FT9A 4PHTA 3ZS8A 2WF8A 2J7UA 3N2GA 4FFMA 5BYAA 4IZHA 1NJ5A 1Z18A 4L4UA 4CKEA 4MRMB 3GDGA 2HPZA 2NU8B 4BRWA 3BWEA 1ZPDA 1M5PC 1UK8A 3LH2S 3R7BB 1FOEB 2BGTA 1W4RA 1VCHA 1GPJA 3BK7A 2P2YA 2PJUA 4D3XA 5EI5A 1Y3BE 4U3JA 3AZPA 4EA9A 3V4FA 1PWZA 3B1XA 5FDFA 2DWPA 4MULA 1AA1B 2O1SA 1H9CA 2RCNA 4NBTA 1QTQA 2B4PA 1DOZA 3W9UA 2NP6A 1IY8A 3UJNA 3LNTA 3BWCA 1RU2A 4DIFA 2WKRA 4F85A 1XZFA 1CR1A 1OLOA 1ZI6A 1KKHA 1DG3A 1S8AA 2Z57A 5CTJA 2YVAA 1N5IA 3BMOB 1OXXK 1LB1B 1K8ZB 5D3MA 4UZCA 5T8KA 2EBFX 1DDIA 1NN3A 4TMXA 4KPUB 4V0QA 1OR8A 4BLSA 1TK5A 3R27A 3TEGA 3NV7A 3W4JA 2FLOA 2QN1A 3LY9A 5K14A 4RD4A 1EXWA 3DL0A 3GQBB 2XXAB 3BSWA 1NPTO 4KC0A 4MHSA 1NMSA 1E7MA 4EYHB 3I1IA 1BX0A 1L1FA 3HPQA 4E33A 3GIMA 3CLSD 1TVRB 3PICA 1N8SA 4IAOA 2W2OA 2OELA 2BKUA 1HUQA 2B82A 4MH0R 3WB0A 3S1TA 4DLNA 2WKWA 3I73A 1J8FA 2ZRDA 4AZTA 5L53A 1X7HA 1DBQA 4OG2A 3NIDB 1BWPA 2FF5A 2VUIB 1UKEA 1B4SA 4E2WA 4ESOA 4LQCA 1D9AA 2HHXA 1M1XB 2XZOA 2NSJA 5B09A 5IM5A 3PWTA 5K0CA 1KI9A 4CDNA 1UPCA 1I2ZA 2E9RX 2C9ZA 3LW5C 4HACA 1P0FA 3QBJA 2A5DA 1OQ3A 4PEOA 1RP1A 4X4TA 2FUNB 4RBTA 2B99A 3HSYA 1XRJA 1KHVA 3BPSP 3OFJA 3W64A 3DT6A 3L79A 2XMPA 3PXEA 3S1LA 1K6XA 2ZWIA 2IDJA 3FMIA 3NYIA 2VF2A 4G1UC 1RT4B 4XLTA 1SKYE 3CZMA 1I1NA 1V35A 4KR0B 4CLKA 3PFHA 4CP5A 2B4KA 4YMEA 4N7RA 3BBPA 3RUIA 2XUJA 3G7SA 3TZ6A 3WYDA 2YFYA 2QLBA 3KXDA 5KOYA 4UAJA 4P33A 1J2UA 3HUTA 4BFWA 3HNRA 1PGOA 1J2VA 3HN2A 2RDMA 3CX4A 4GI2A 2G17A 5B1YA 4DFDA 3V81B 4JI5J 3IS3A 4BNHA 2PGLA 1KZ1A 4G9BA 1YHQS 1XHLA 2G0AA 3DUFB 5IUKC 2GEUA 1U25A 1QJCA 2AJ2A 4LE2A 4Q8FA 2WEKA 4BV2A 4B43A 2HHQA 1M1HA 3G7NA 3NR2A 4CLLA 1DHRA 1JPUA 1GL9B 4H4MA 4WN3A 1G9XA 4IDBA 4YUVA 1G2OA 1DTTA 2YKQA 1R27A 5SY4A 4X4NA 5K8JB 2MKYA 3HPOA 4CLWA 3I6PA 4XDGA 4FYHA 3N2IA 4GOMD 4RPFA 3H4IA 3VOTA 4YP7A 1N54B 1W5BA 2EFJA 2XSJA 1F5SA 3N6LA 4OSEA 4IKAA 3V6JA 2VWQA 2X0NA 1VC0A 2V58A 4M9UA 1KFJB 2C0PA 1CDZA 2RHLA 1JWBB 1NDHA 5AW6A 3K0AA 2UV8A 3PC6A 3AHCA 4JLOA 5FJIA 4MIBA 1GR1A 3NNHA 1JW9B 2DNYA 1IBLB 2CGEA 4B4WA 4I99A 3O7MA 3DUWA 3ND9A 3DDZX 4A8OA 4M9RA 5FRDA 1NVGA 3I9MA 3TYTA 4MYSA 3UJPA 1SVUA 3KL4A 5JS2A 3NG1A 4XDHA 2FWBA 1FFAA 3STHA 4DT1B 2EK1A 4DA4A 3H6HA 3NJ8A 3QGGA 4UUQA 2PGXA 3Q3CA 2H7XA 4G4JA 2D2FA 3ZZRA 3D2BA 1TYCA 3MRSA 3IUMA 5A8KB 1O4VA 1WEZA 2D7DA 4R51A 3I72A 2GD2A 1POXA 2XCAA 2CPHA 3REQA 5KFJA 4F67A 3MFHA 2X22A 5GIOE 3BHNA 2O8VA 3RVSA 4DEYA 4UZSA 1SBYA 5ELLA 5E38A 2PA0A 2VHTA 4YUAA 5CBKA 1LDNA 4CYMA 2AF4C 4E11A 5KNDA 2AA3A 1AA9A 1D2MA 3WYAA 4MQFB 1S2OA 4KVGA 2BMDA 3TRJA 4DUGD 4L0DA 5J2QB 4TWIA 4CKCA 3IR7B 3C66A 1CJUA 3O75A 3O7WA 1O7JA 2I4LA 1ZO8A 3E6AA 4C6SA 2CD7A 1Q1EA 3D54D 4DADA 1CPYA 3A10A 3M9LA 4G37A 1UMCB 5KAPA 1CIVA 3FSXA 4JD5A 5DF1A 1YMVA 2HRBA 1IHXA 4YJHB 2VG7A 1YRHA 4DRZA 3TLEA 4ZK6A 4ED8A 4HI0E 5L6LB 3M8QB 1OGYA 1QNFA 4HNRA 2PZAA 2E44A 1TVEA 1RE1B 4XYGA 3A05A 5DHFA 1KOLA 1WF2A 4RLSA 1VHQA 3H3XA 4X3CA 3PJ9A 3QX8A 1LW7A 3PLRA 1BKYA 1C8VB 1KY4A 4KU4A 4KLNA 4DAEA 4EI8A 4CM7A 4DV0B 3JZIA 2GEKA 1OGJA 4OV1A 4PC1A 2DHDA 3V8BA 2FKAA 4WERA 3Q8LA 3UIEA 3QFTA 3SK0A 4EW2A 4WP3A 2W7OA 2BN4A 2X77A 3I2GA 4EBBA 3BBCA 4M8IA 1AA6A 5C7PA 4C7VA 2ILYA 1OBFO 2N42A 2RB5A 2PIIA 5A0TA 2JGKA 3S8MA 2ZBQA 5GMKa 3CVVA 4KIGA 4HFMA 3W61A 5ICCA 2MHCA 1NJYA 5ALPA 3CLUD 5D5QA 3A27A 4LTMA 2CJXB 4R9VA 4FOLA 1IWOA 5F9LA 1IQTA 2B4UA 3KLHA 4FOOA 3O0TA 2IDLA 2CDNA 2JFFA 4I08A 1U9IC 4JI7B 1S1WA 3QJYA 1W7AA 2X8JA 5IJXA 4EUSA 2FP3A 4EL0A 3MERA 1GFWA 2JGNA 2AC7A 4NXNF 3KJQA 2VHGA 4G5YA 1J0AA 2E0IA 2PBRA 2CPJA 3SKXA 4DLRA 1RAIA 3B36A 4H1HA 3R5BA 2PAFA 2B8QA 5A4FS 3QHPA 1J5XA 1CJKA 2R2UA 1M2EA 1X2BA 1LX6A 3AO0B 3FWZA 3ISND 4BLGA 4TPKA 3GIKA 1TA0A 3KUDA 1IHYA 1Z28A 3KQQA 1YJRA 4BEJA 2LQJA 5F2OA 3C5CA 5H1YA 3JYQA 3GZJA 4EABA 2RONA 5KYTA 4Y1FA 2B4QA 4IPTA 3NEYA 2XA9A 4KO1S 2GHQA 3DLGA 1YQDA 3JCZA 2IL1A 3UJ6A 1NF2A 4QPXA 1LBHA 4NE9A 3IAUA 1QGED 1YOBA 4RZQA 3M0EA 2JBWA 3Q7EA 4D4KA 4ZGBA 3NWEA 4TMKA 4KUHA 2CKMA 4BKPA 2G9UA 2G70A 3UMFA 1XWWA 4CO3A 3IP3A 2OO4A 3GYNA 3IUYA 5L6MB 1WMSA 1EX1A 2CPZA 4M46A 3MOIA 1C80A 3BEDA 1ZUHA 2LTAA 1RWNA 2Y05A 2CHEA 4XARA 3OTGA 2OO5A 4F2RA 5CLFA 1JXMA 4G67A 4YECA 4M1MA 3NBPB 4LSLA 3L7DA 3ANLA 1CUXA 3LOQA 4NF2A 4DLLA 1QWSA 1DKQA 2P1DA 1MCZA 2QTAA 1UMDB 4X6XA 4DSNA 1IM5A 3RABA 1FB5A 2YWRA 2YZ7A 3I92A 4CLOB 1JHRA 1OVGA 1YB4A 4EAAA 3RW6A 2VQFF 1PC5A 1ZGBA 4DILA 4F2DA 2FGJA 1TKAA 4GKKB 5TJHA 1I6JA 3CRRA 4P4NA 1T3LA 3E5MA 5H80A 4L8WB 3AW9A 2EKZA 3V7NA 4RZHA 2OEJA 3GPLA 4XWGA 2ZHOA 3QFFA 2AB0A 5ISMA 4K9OA 3U44B 1I30A 2HIGA 3AG5A 1YB6A 3A8TA 3ZV5A 4AULA 2O54A 1GPH1 4L5IA 4MPRA 1U1RA 3PCXA 1R4NB 5K9ZA 4R71A 5JECA 3EPLA 4MVJG 4L4RA 3K70B 1XZJA 1OZHA 2BEJA 3O8OA 4K88A 4MK9A 3C1UA 2OKQA 4EMBA 3EDCA 3NKYA 1C3OA 4RMGA 4ZANA 3WLPA 1C1HA 4HL6A 3B1FA 5FDLA 4YEDA 2JCXA 2NNWB 4FBMA 1IKYA 1W8DA 1N5QA 4KGKA 5ECYA 3J81j 4NPCA 1IUKA 4E98A 4TV8A 2AP6A 3IPXA 2BRUA 5EWLB 4BX8A 1P2BA 3O3MB 1JLKA 5JTTA 5E2QA 1KVIA 1QYIA 5DSTA 1OPIA 2YFQA 4Y6QA 3GFGA 1NK8A 3T4PA 1RC0A 4LOIA 4G0NA 2R8OA 4MDFA 2V7XA 2ZVQX 4QU7A 2PJZA 3TXYA 4G85A 4FYYA 2RDIA 3ABSB 1XVVA 5DX1A 2WD8A 3ZWAA 4LHZA 3SR0A 4MK8A 3M6UA 3GARA 5CFOA 2NSHA 3IP8A 4L6AA 3KVYA 2VSNA 3E9QA 3BMCA 3NJRA 4EA8A 1NPDA 3D1OA 2DMRA 1ZNQO 3D68A 1EBBA 4XTRA 1RS0A 4UE6A 4J7CA 4L57A 2XSZD 2EX1A 3AK4A 3M7VA 4UASA 2X3FA 3DHEA 3DZJA 5JCOC 4R7ZA 3PYDA 5DS7A 4HDMB 1THMA 1OXBB 2PL3A 1QB8A 3EGIA 4CMAA 4XK8C 8ATCA 4ILLA 1W2IA 1E92A 5IFMA 1NHVA 5DNDA 4KHPB 3SQGB 4F3RA 4X0EA 1L5ZA 3KHKA 4YAGA 4DF3A 1H42A 1OUMA 4P3KA 3FCCA 5K3DA 5IF9A 4TKVA 2JIOA 4H4KC 1CUCA 3FW1A 2PBFA 5LZ7A 5KFWA 2ETXA 3H90A 3SZ2A 4NPOA 4JASB 4TVSA 3P71T 3U39A 2IHR1 4WF9Q 3GDFA 1N6QA 1ZEJA 1G2EA 2A0WA 3NXSA 4ZVTB 3V80A 3PEVA 3HCDA 3KD3A 2B4RO 2RF2B 2JRLA 1I6WA 3DLEA 1JS1X 1BWVA 4AI6A 2TMDA 3GFZA 4ZO7A 5BW4A 4L4SA 4IGKA 5LL6P 1L0BA 3DWFA 4MRVA 3EXG2 1O6GA 2VK1A 3JZMA 2IXFA 4X1KA 5DBFA 1Y7TA 3IERA 1YJ7A 3QFRA 1S1WB 2KTQA 1AQUA 3GEPA 3PW4A 4YJ3F 4BVGA 1GG9A 2ZBFA 4K4ZA 1DFIA 3Q1KA 4ZC8A 5BO5A 4KWEA 4WFBQ 2ZSIA 4UM5A 1HYSB 3O6QA 2HUNA 4QLAA 1QVGR 3ESYA 4I81A 4P2SA 5DTJA 2ZC4A 2NO5A 5EHIA 1JK9B 5HZMA 3CRNA 2ZH3A 1RTJA 3T15A 2N3LA 2HG4A 2PUAA 2ZM5A 4YUZA 3K0HA 4Z9AA 2QYGA 1OGIA 1W46A 1W2HA 1SUWA 3OKPA 3L2OB 2K2PA 2AW0A 2MKJA 4H7HA 1YBUA 2IHYA 4LYGA 2ZJYA 2O2HA 3T9ZA 4NULA 2ZYVX 3NTXA 2LDXA 1LPAB 2XDWA 3H5RA 3NTOA 2DHSA 3OU2A 1NNLA 1QFSA 5TPWB 2Z8ZA 5LOQA 4R3NA 4JR2A 2YS7A 2X3DA 4XAKA 3V00A 4I36A 1JLBB 1QIDA 1J56A 2Z09A 1A2BA 2XNDD 3MGBA 2BKXA 2R6R1 1NKSA 1U7HA 4TS4A 4M9CA 2C9OA 5E5NA 2UZ1B 3BXPA 3EXIB 4LSZA 2XO6A 1HH4A 3CZ4A 5B1DA 2QIOA 5LA6A 2AEJA 2Y99A 2CNWA 1HZJA 2ENUA 4ZGWA 2DH7A 4UVHA 3BJYA 2IWHA 1UR5A 5GM2A 1VL8A 4PRLA 1K8YB 2CPEA 2IHBA 3CR8A 4DCOB 1AM4D 5I8WA 1FUEA 4JITA 2N75A 2FR8A 5KX5F 4LBYA 3CUWA 3M81A 2ACMA 4CG1A 2YYYA 3HP6A 4JCOA 3BMOA 2HHVA 2EQAA 1NDLA 2HHUA 2AV6A 4R2LA 1ZZEA 2KT5A 4DR4J 1TGVA 4QGSA 1N5YA 5L9AA 1PJ4A 4CM1A 2FSVA 1NJSA 2X41A 2VFUA 1MC1A 5FFFA 5IAJA 3K4QA 4O2AF 3R8CA 3A6HA 5A3QA 3T5BA 2FQXA 5CH8A 1ZPVA 1PRYA 2PZEA 2Q6LA 3CF4A 2JLEA 2C9DA 1HRKA 1R0SA 3CZRA 5BOVA 1I32A 1E0KA 4OD0A 1K5GA 2H85A 3TIGA 4ZGGA 3O31A 4LYHA 2DFVA 2WSCC 1RT7B 2R7TA </