4B17A

Crystal structure of c2498 2'-o-ribose methyltransferase rlmm from escherichia coli in complex with s-adenosylmethionine
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
357
structure length
356
Chain Sequence
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELPFSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFCRKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCYTGYSYSNNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVDNGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Rlmm, the 2'O-Ribose Methyltransferase for C2498 of Escherichia Coli 23S Rrna.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE M
total genus 118
structure length 356
sequence length 357
ec nomenclature ec 2.1.1.186: 23S rRNA (cytidine(2498)-2'-O)-methyltransferase.
pdb deposition date 2012-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
A PF18125 RlmM_FDX RlmM ferredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b17A01
3.30.2300.20 Alpha Beta 2-Layer Sandwich THUMP fold THUMP fold 4b17A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4b17A03
2ZIFA 1JR4A 2FK8A 3C6MA 1JG4A 3MERA 4QTTB 2P7IA 3EEYA 3EGEA 2IP2A 2XVMA 3B3JA 2OB2A 3DXYA 4QVKA 3GO4A 4RVGA 5EEGA 2ZZMA 3OE5A 1ZG3A 3NMUF 2YXLA 2H1RA 2HV9A 2QY6A 1B42A 2Y1XA 5KQRA 1WS6A 2WA2A 1AF7A 1SVUA 4HH4A 5KQSA 5LQJA 3G5LA 2YTZA 2KW5A 2LD4A 1L9KA 4DQ0A 3VC1A 4RTNA 2BM9A 4PYOA 1NBHA 3KQMA 2YR0A 5LSAA 2P35A 1AV6A 2K4MA 2O57A 3P8ZA 1RI4A 3LCUA 3KR9A 5HOQA 5CIYA 1P1BA 1G8AA 2XVAA 4GUAA 4M37A 3BWYA 2V7EA 2OKCA 1YUBA 4PYKA 3L8DA 4BP1A 2OPBA 3DMFA 1FPQA 3CCFA 1WZNA 4K6MA 2EG5A 4HG2A 5DT2A 1ZGAA 5EQJB 2G8NA 4FS8A 4RTSA 2Z6QA 2QYOA 3GDHA 4HTFA 4DMGA 3TRKA 2XYRA 2AOXA 4R8SA 3M6XA 1X1DA 4F86A 5GIOE 1XJ5A 2P3LA 3B3FA 1ZHFA 4LG1A 2OYRA 2GLUA 4GF5A 3KR1A 4YV2A 1NW5A 4RTLA 5M5BA 4RTMA 3BWBA 3SM3A 2PX4A 1TW3A 3DLIA 4G56A 5E8JA 2ZIEA 3NDIA 4RV9A 3LDGA 4CKCA 1JSZA 3CGGA 3G5TA 3LX6A 5ICFA 5CM2Z 2AOWA 3KQTA 4M36A 3HA7A 4GEKA 2NP6A 3DXZA 3KQVA 1JG1A 3MQ2A 3NJRA 2PWYA 4RYLA 5H02A 4C07A 5JR3A 1ORHA 3Q7EA 3BGDA 3OFKA 2PSSA 3SSMA 2ZFUA 3G2OA 3EVGA 1PJZA 3FRIA 3HM2A 1X1AA 4XCXA 2PVCA 2PX8A 3CVOA 3FTDA 3KQWA 4E2XA 3OE4A 4E2WA 3FPFA 4QTUB 1R8YA 3THRA 3NW9A 1EQAA 3OZRA 3C3YA 4OQEA 5CVJA 5DSXA 3KPJA 3VYWA 4DM3A 4GBED 3UJ7A 2AVDA 3HEMA 1NW6A 2ZULA 1HMYA 1UWVA 2PWPA 3GGDA 3OU6A 4A6DA 3R24A 4OX9Y 3DMGA 5GOZA 1Z3CA 1KR5A 1SQGA 3IHTA 3T7TA 5EG5A 3K6RA 3HTXA 3LKZA 5K05A 3QOXA 3BWCA 1KPHA 1QAMA 5HIIA 3E8SA 4XUCA 3UJ6A 1NV8A 5E8RA 4PCLA 3GNLA 5GM1A 4U7PB 1XTPA 3C3PA 5CUQA 4CTJA 3MTIA 2Z6AA 1XVAA 2Q41A 4EVIA 1INLA 3FRHA 5T64A 1M0EA 2C7RA 1P91A 1RI1A 5E9QA 3KQSA 3C0KA 3A4TA 4GC9A 5EEHA 2AN5A 3UJ8A 3UBTA 3GRUA 1UFKA 3GJYA 3TM5A 2P8JA 3T0IA 3FTFA 3A7DA 3LGAA 5FADA 3O31A 3RODA 3FPJA 3VSEA 2ORED 3AY0A 4X60A 2UYHA 2IH2A 1WG8A 2AOTA 3P71T 2GS9A 4PYIA 1R00A 5IH3A 4KW7A 3SGLA 3RIEA 3ORHA 5E1DA 3LCCA 3PTAA 3GRVA 2O06A 5BW4A 2R6ZA 4BLUA 1I4WA 4AZVA 2GH1A 1L1EA 1NBIA 4DCMA 3OU2A 2I9KA 7MHTA 5HEKA 4KDCA 2JH9A 2XYQA 3ID6C 5DLYA 2IGTA 5LQKA 1NT2A 3KQPA 2GPYA 4UOEA 3DULA 3ER8A 1KP9A 4KIFA 4E30A 4Y30A 2CKDA 3NWEA 4OQDA 3OZSA 4PINA 4R6WA 5EMMA 2VDUE 3TQSA 4KRGA 4MWZA 2CMHA 5IKMA 9MHTA 3R3HA 4PYMA 5GWXA 4KIGA 2PV0A 3KPWA 2EFJA 1Q0TA 4P7JA 5DM0A 5T67A 1PRYA 4FP9A 5CCBA 4PYNA 2A14A 3KPYA 4PIMA 3RW9A 1D2HA 4YUXA 2PKWA 3SXJA 3G2MA 2PJDA 5EZQA 1F38A 2G70A 3MCZA 3SSNA 1G38A 4E33A 4ER5A 2F8LA 2AS0A 3MB5A 4QVGA 3P9KA 3P2KA 5K03A 5FHRA 3SX0A 3T7SA 8MHTA 2VS1A 2B78A 2YXEA 3CKKA 3EVZA 3P2IA 1JQ3A 1YFLA 1EG2A 3BGIA 3UJCA 3CJTA 4RTJA 3ERCA 3JWJA 2VZ9A 2H11A 3LSTA 5FHQA 3I64A 3AXTA 2AVNA 1BKYA 3I5UA 4CKEA 1IM8A 2GA9A 3ELWA 2ZTHA 10MHA 2PBFA 1G60A 3LBYA 1RI5A 3LHDA 4PWYA 2JH8A 3V97A 4FR0A 1T43A 2WA1A 3REOA 3TFWA 2YXDA 4PIPA 5BP7A 4V0RA 2UZ4A 4B17A 4CWAA 1XCJA 5FULA 4GC5A 3GIWA 5JUWA 3EVBA 2HR1A 4YUZA 4EQZA 4QQKA 3FPHA 4HRAA 5CVEA 3G2QA 2EX4A 2BM8A 3T7RA 1QZZA 1P1CA 2PT9A 3EVCA 4IWNA 1YZ3A 5DRYA 5EOVA 3EMDA 4A6EA 4ER6A 4P7KA 1OR8A 2BZGA 5DXJA 5GP1A 3K0BA 2IDKA 4R8RA 1VIDA 1O54A 3BT7A 4P7GA 5K8VA 5K0NA 1RJDA 3M70A 3HNRA 5ERGB 2ZZNA 4YUVA 4X61A 2PLWA 3UJDA 1JSXA 4FGZA 3NTVA 1BHJA 1TPYA 4RSRA 3Q87B 4PGGA 5K0CA 3GRRA 1YFJA 4MHTA 4OBXA 2ZBQA 4WXHA 2B25A 5DX1A 2UYCA 4X41A 2JG3A 3X0DA 3HVKA 3R9XB 3I9FA 5E2BA 3QOWA 3KU1A 4GOOD 1KYZA 5DTQA 2OXTA 3LECA 2PXAA 3ELUA 2CWWA 4AUKA 5DX8A 1ZKDA 3DMHA 1O9GA 4C04A 4YV0A 3UJ9A 2JHPA 4DA4A 3DH0A 3IEIA 1NE2A 4FT2A 1G6Q1 1WY7A 1KYWA 1VQ1A 3LDFA 4HTFB 4KWCA 5F2OA 3M6VA 1U2ZA 4BLVA 3LL7A 1N7IA 3BWMA 1KHHA 1EJ0A 1D2CA 1MJFA 4RVDA 3TKAA 4AZWA 4WVLA 2FHPA 3HCCA 2R3SA 2QM3A 3CJRA 3GRYA 3LPMA 4OA8A 4P58A 5FTWA 5GIPE 3FTEA 2AZTA 4QPPA 3BUSA 5D1NA 4CKBA 4PNEA 3HP7A 2OZVA 1VBFA 3S68A 4GOLD 2P3OA 3PB3A 5G02A 3CJQA 3UA4A 3NVKI 3B3GA 3DR5A 3H2BA 5FWDA 5T6BA 1Q0SA 1EAMA 3P9NA 4AZTA 1QANA 3FTCA 3KPUA 1XDZA 4ER3A 3A7EA 3EMBA 4P7FA 3SR4A 1R74A 3OZTA 3F4KA 3DLCA 3EVDA 4YUWA 2NXCA 2PXCA 4BLWA 2NP7A 4OBWA 3BGVA 1EJ6A 2HNKA 2PX5A 2Y1WA 3JWHA 4R6XA 4PYLA 3ELYA 3B7PA 5FUBA 3SSOA 2I6GA 2YUIA 4ISCA 3O4FA 3MGGA 1XDSA 1DUSA 1HNNA 5EC8A 1ZQ9A 2H00A 1RJFA 1QAOA 4NECA 2NXJA 2XBMA 3LCVB 5DTMA 4KVZA 2WK1A 1KXZA 1M6YA 2PY6A 4HGZA 4M38A 4X63A 3U81A 4EMSA 1NW3A 3FYDA 1JQDA 5EZSA 2UYOA 4XUDA 4C06A 3V8VA 5HIMA 4QQNA 4H0NA 2GAFA 3TM4A 1XCLA 1AQJA 5HILA 2I7CA 1L3BA 4RTPA 4HSGA 4MIKA 3KQOA 2IBSA 5FQNA 1VLMA 3PLAE 5BW5A 4O29A 2B9EA 3FZGA 4GOMD 3DTNA 3AXSA 5EHGA 5FCDA 2P1DA 1SUSA 3GRZA 3NDJA 2IDJA 1VP3A 2ZSUA 3FYCA 4HGYA 1X1CA 1SKMA 1QAQA 4C08A 2NXNA 2G71A 4GOND 2EJUA 2ADMA 4X1OA 2QE6A 3EGVA 3GWZA 5C9ZA 2FK7A 4DF3A 2B3TA 2HWKA 2JHAA 2P40A 3PT9A 1EIZA 2BR5A 3ANXA 5DM1A 3GU3A 3IV6A 3WSTA 5LQNA 3ME5A 5HIJA 1DL5A 1R8XA 4QDKA 5EKXA 1YF3A 4RTQA 3A27A 5DSTA 2IBTA 2IFTA 2ZBPA 3G2PA 5DM4A 5K01A 3TR6A 2PGXA 5CVDA 2OB1A 3G7UA 2ZBRA 2PX2A 3GXOA 3TLJA 2ZWAA 3KQQA 1I9GA 5FA5A 5DWQA 3KQYA 4PYJA 3OPNA 5C0OE 4OA5A 1SQFA 5KYGA 1ORIA 2DULA 3TKYA 4E31A 3EPPA 5EVJA 4EKIA 1TW2A 3I53A 5EIFA 1IY9A 3SVZA 4C03A 4EKGA 3PS9A 3HVHA 5EMKA 4KDRA 3B89A 1VP9A 3M6UA 2O0LA 5GM2A 3TPZA 2GB4A 3OFJA 4ER7A 2VP3A 5EGSA 5E1OA 1G55A 4YV1A 5LQCA 5HZMA 3HCAA 1NW7A 2B2CA 4E32A 2I62A 4AZSA 3R6TA 4U7TB 3HVJA 4RTRA 4BP3A 3TMAA 3P9CA 1VL5A 4CXMA 3HCFA 4YMHA 1N7JA 2CL5A 5CD1A 2C7OA 2YX1A 4PCAA 2E5WA 4ZTBA 3ELDA 5K0LA 5DRTA 2CMGA 3OCJA 1FP2A 3AJDA 3P97A 5C1IA 4CTKA 3DUWA 3HCEA 3I58A 3PFGA 5K0GA 3HA3A 1X1BA 5FQOA 4FT4A 4LWOA 5F2NA 3BKWA 3HCDA 2EJTA 2PT6A 1I1NA 5CCXA 5GINE 2Z6UA 1KPIA 3UWPA 1JQEA 4DKJA 3HA5A 3P2EA 2NXEA 2AOUB 2AR0A 1N2XA 3LBFA 4RVHA 4PGHA 5K09A 2O07A 3BXOA 4M7RA 3KR0A 3DXXA 2VDWA 5EIWA 3C6KA 5EPEA 4C05A 3EEOA 4PYQA 5HIKA 2N47A 1O9HA 3OU7A 3FUWA 2ERCA 1JG2A 3FPEA 1R6AA 2DPMA 2HMYB 2BR3A 2C7PA 3PFHA 2NNWB 5EKUA 4LECA 1D2GA 1ZGJA 5ICGA 2JJQA 3GCZA 2OY0A 4MQ4A 1L3IA 3TOSA 3E05A 5E9JA 3KR2A 4RTKA 1NW8A 1NV9A 4RWZA 4V0QA 2PXXA 2AN4A 4E70A 5FA8A 2FRXA 3QV2A 1AQIA 4JXJA 4LWPA 4YMGA 4FSDA 4YUYA 5P8WA 4BY9E 2BH2A 2YQZA 1SUIA 1YZHA 3THSA 1YB2A 2FPOA 2UYQA 3KPVA 3LKDA 4L7VA 4QPNA 2P41A 3LDUA 2O05A 1P39A 2P7HA 4R05A 1WXXA 5KVAA 1XXLA 3EVEA 4FSXA 5BXYA 1DCTA 1UIRA 4DCGA 2IIPA 2ZVJA 2QRVA 3JWGA 1BOOA 3A25A 3UJAA 2G72A 4F84A 3G89A 3MTEA 1M6EX 4IV8A 3P9IA 1KIAA 3EGIA 3PX2A 4HC4A 1WXWA 5DTRA 5K0JA 1JG3A 1FP1D 2AOUA 4ATNA 2BR4A 2ONYA 3BZBA 3D2LA 2IH5A 1JTEA 5MHTA 3PX3A 2IPXA 3EVFA 4RX1A 3DOUA 5CVVA 3UZUA 2FYTA 3CBGA 5CVUA 4RTOA 1R18A 3SMQA 2ZZKA 5E1MA 3E7PA 3NVMB 2HTEA 3MAGA 3IYLW 5E2AA 3O7WA 5F2KA 5B1SA 4ER0A 1FJXA 3HVIA 2G1PA 3EVAA 3FPGA 5EHIA 3M33A 3UA3A 5DXAA 5E9WA 2ZIGA 5DX0A 1VE3A 2QRVB 3DP7A 1V39A 5K0EA 1F3LA 2ZWVA 5LQAA 2VDVE 3PVCA 2AOTB 1G8SA 1FBNA 5E1BA 4AX8A 5K0BA 1JTFA 4POOA 3NWBA 5ICEA 3M4XA 3BKXA 4PONA 4Y2HA 5FWAA 2C7QA 1RI3A 1RJGA 1NKVA 3HCBA 4E2ZA 2FCAA 2ZW9A 2ZCJA 1QYRA 3G88A 1MHTA 4IV0A 2XYVA 3FUXA 5D1HA 4RVFA 3FUTA 3UJBA 3M6WA 4GQBA 3KHKA 4F85A 5LQRA 5K0FA 2JHCA 5LQUA 4MTLA 3UFBA 5DM2A 2NYUA 2OBFA 4E2YA 3FUUA 3VC2A 1L3CA 3KKZA 4IKPA 3JWIA 2AN3A 1VPTA 1IXKA 5U4XA 1BC5A 2ONZA 2ZLBA 3E23A 5KS2A 1SG9A 2V74B 1X19A 2YVLA 5EMLA 5HFJA 3FUVA 5LR6A 1H1DA 3A26A 1KPGA 1RJEA 5DPMA 4FZVA 4EK9A 3B5IA 2IH4A 4Z2YA 2ESRA 1XDUA 4C4AA 2OO3A 3ER9A 4QDJA 4XUEA 1Y8CA 4DZRA 2P3QA 1RI2A 2AOVA 3G8AA 5EMJA 3MHTA 3MCTA 3AWIA 3G8BA 3CC8A 3R0QA 5ICCA
chains in the Genus database with same CATH superfamily
2CVHA 2J67A 4G67A 5G1PA 4HLUC 4Q44A 1GRVA 2WBRA 2WYUA 4WNIA 3RYFA 4M9ZA 5C8YB 5J1TB 1B42A 2BELA 3PR2B 1R0BA 1KMHB 3FVYA 3B1JA 3ROKA 5U1PA 5K1ZA 2Y1JA 4BB5A 3A4MA 4XZ3A 1J8FA 2XWQA 2XGGA 4BRZA 4D9IA 3ZLVA 1SJ3P 5TJHA 5DZ6A 1QNFA 2VXCA 5M5BA 4B7UA 4EMTA 1BQMA 5DBFA 2ZH5A 3KWMA 4A46A 1FTQA 4OKSA 2WWGA 3GYBA 3IHLA 1MABA 5EAIA 1X7WB 3I4FA 5J59A 2CFSA 1GNVA 3ZW9A 2NO9A 1JFFB 3X1XA 4L75A 4NWBA 1JJHA 2XMVA 4DR2J 5HQJA 5A1TA 3G0CA 5J5CA 4ETXA 5KG6A 1UWKA 5L8RC 3R7NB 4QOFA 4BQQA 3KCNA 2FZLA 3AESB 4K8RB 4A4DA 2V68A 4A0GA 1JFFA 1F2DA 4A36A 2IAJA 4O8CA 2IELA 3H2YA 1R6XA 1RPJA 2NU9A 4CG1A 1RXOB 2C98A 3D6NB 5F7ZA 2GS9A 3HZHA 3PTAA 2V96A 1EZ4A 2EKZA 5J2UB 4DCMA 1Y82A 2P91A 2EC2A 3KBBA 2UVPA 2XYQA 1PDWA 3U9LA 5CB6A 2XUJA 3GLHE 4IFVB 4G9GA 4EJMA 3LF1A 3FPSA 5KFHA 1O8BA 4KO4S 2UUBF 1YB5A 4P0PB 1CDOA 4ID5A 3HKDB 2JD0A 4CI9A 1BKYA 3CX4A 4JV0A 4BNKA 1RTTA 1OJ7A 3TBKA 3NANA 3IAM9 4GX0A 1LXJA 1T43A 2WA1A 4YAOA 3GNSA 2IYQA 4HZIA 1XLWA 5FULA 3ZX4A 3JSRA 2JGRA 2YOGA 1NHKL 2PT9A 1BHNA 4H18A 4QJVA 2N7YA 4FVTA 4P0QB 4WK3A 1KDZA 5HQTA 5IWAF 3GRRA 2HQ1A 4GI5A 2JG3A 5DHAA 4EVSA 3R9XB 1S3SA 2VBFA 1RHJB 4EDFA 1N77A 4DA9A 4HI0E 2YKAA 3ZDXB 3PCRB 3AHPA 1FMTA 5DGDA 1R4AA 3JYOA 3CG4A 5F5NA 2AT1B 4RS4A 2U1AA 1G18A 1WY7A 1XTRA 3RYTC 1CEEA 3CNQP 4O3NA 4GSKA 4JIGA 1N7IA 1WC0A 2OLJA 2YC2C 1QJCA 2CNLB 3CRZA 1XNQJ 2MSWA 1UJ4A 2V4MA 1Z6ZA 2BANB 1Y3CE 4CF3A 3Q5GA 2YIMA 2KT3A 3I1JA 2R8YA 3A12A 4CGYA 3DI6B 1W29A 3VV2B 2F65A 2J6IA 4E7PA 1N6HA 1WA5A 3QUBA 1DAKA 1D4ZA 2ZCUA 3PRYA 1GRCA 3KXKA 3CULA 1WXHA 5LJIA 1CUHA 3G6ES 4ZAZA 3VV2A 4L0CA 3TSWA 2N3ZA 1BMDA 3C4JA 1XN4A 1P75A 1ZD1A 1RHQA 4EDHA 2FK7A 3OM8A 1RWNB 1JK9B 1PKXA 1ZU4A 3GSIA 4BKRA 1V7CA 1ZM9A 4IH7A 621PA 3L0SA 1R6DA 5CLJA 3I53A 3GN1A 2RHGB 4ZVMA 2XUAA 5H9EJ 4BJHB 1G55A 1HA1A 2LV8A 3MRVA 1NMEB 2OMKA 2XUHA 2Y9HA 2E1PA 1XDDA 3JD1A 5L45A 3UWPA 5DNUA 4NH4A 3RJ9A 3CC7S 3S2UA 3TH5A 4B02A 2DRDA 3JQCA 2PS3A 3UGTA 3EZFA 2A5FA 1NW9B 2FAXA 3EC1A 2R66A 3C6UA 4CO1A 1DLIA 4N0EA 3E05A 1TLLA 3GCGA 3DOJA 1AA9A 1CJKC 1CTQA 3C14A 1E6YB 3SC3A 3OO1A 5FLYA 3ZW8A 5JYBA 1RYBA 1FRIA 3ESBA 3QLHA 2HA5A 2KXHA 4IV8A 4ZRMA 5A3JA 4NG4A 1H3EA 3GX1A 4KPUB 5HP1A 1SC1B 5GMDA 1FK9B 1RT5B 2J7UA 5I7EA 1HBJA 3VVMA 2E6UX 2CJAA 2HVHA 5TMPA 3QLHB 5FBHA 1RMYA 4M5JA 1J9EA 3CVJA 1EXMA 5K4AA 1BXRA 2XRYA 4R41A 4C4XA 2V8HA 1D8TA 3PJFA 2UXBB 1I32A 3WLQA 1XVIA 2V9CA 4USTA 2HJSA 3NJ8A 3OCUA 4N12A 1YTUA 2BMWA 2RNEA 2BUBA 2VJKA 2R5FA 4HBZA 4CKYA 2MMCA 3A1NA 4B6RA 2OHOA 3K5OA 3EXG1 3WGKA 2HNAA 5LQJA 2V97A 1S6PA 1V5IB 5DB4A 2O7RA 2XVMA 4QDTA 3PW7A 2OENG 2CLHB 3LTEA 1M74A 3A1UA 4ZP7A 4Q1EA 4X4SA 3I5BA 5H9EK 2ETXA 3BD8A 3PNPA 4EABA 4ZDJA 2W9BB 1UFLA 1NU6A 1USIA 2AI2A 4IF4A 1CQMA 3WGTA 2J5RA 1UDAA 1T10A 4I6WA 1F6TA 5CFLA 3I34X 2F8SA 5F3ZA 2B20A 3KK2B 4JI3J 7MDHA 1XKLA 3B2QA 4FN5A 2W6IA 2YXBA 5ICFA 5I7HA 2HRZA 4ZXFA 2AOWA 3MUFA 1ZD8A 1H72C 3QEOA 4KGXB 3K94A 4Y6LA 3EDCA 2QN6B 3L4KA 1AQUA 5CABA 1EGMB 4DYDA 2AYMA 4R71A 4TTSA 1EQMA 5ESDA 4R0MA 4ABYA 2BW7A 3NG8A 1IJFB 2CHFA 3C8HA 4MW1A 1FDRA 4Q1DA 4HP8A 5GJVC 2O20A 4QU8A 4KFTA 3AUYA 1VC2A 1EESA 3RIEA 1G1XA 4MB0A 1I4WA 2BE2B 1OBFO 1SC3B 5CIQA 4MRMA 1RWWA 1PO6A 3GZNA 1MGOA 4WN3A 3V81B 2ZNZA 4D45A 4CV3A 4BMPB 3NB0A 4J9PA 2VDNB 1U9JA 1TYAE 2ZRMA 1XWFA 3HDSA 3ZNUA 3WRXA 3KEMA 4C0BA 3X1WA 1FJ2A 2VPYA 4INAA 1Z36A 3HU2A 5EHQA 3TIGA 2DY0A 4YNBA 2GM3A 4ZZ3A 1MAUA 4XVHA 2WONB 1NF8A 4EEXA 4K6OA 3KE9A 4CU5A 3LBAA 2CWKA 4P7GA 1AT1A 3SZMA 5F23A 4WZAE 2J3DA 2VUHB 2Y3IA 4ANDA 3R2DJ 3NTRA 3G8TA 2OBBA 2NSJA 3FF4A 5AVYA 2QL5B 4D3SA 5CJJA 4I1VA 4V1CI 2WMYA 2RSQA 5KTKA 4TT3D 3OJCA 1ZM3A 2Y0CA 3SN6A 5H9FJ 4JJ6A 4ECSA 4BFWA 2VT3A 3OC6A 4L8WB 4YN3A 2YV1A 4LSNA 2GN4A 2JFWA 1NF9A 4P83A 4Q4HB 3E9YA 2VZEA 1TTHB 1C3VA 3FTQA 5FFNA 1I01A 3NNDA 2RI1A 2CHEA 1GSIA 3P96A 3UVJA 4IFYA 2PZJA 3PTZA 1XA3A 1RLIA 1K9VF 2NU6A 2YBEA 5B1EA 4HXEB 3CDWA 3NDJA 5CFRA 3GLFE 4NU0A 3WK5A 1VHJA 3BTSA 1LPPA 4QGHA 3RBAA 2UVDA 5HDBB 1EHCA 3IV6A 3BE6A 3W61A 1KFBB 5DHTA 4PZEA 3HBNA 1ECPA 3VU9A 3ZHXA 4DLXA 3OPYI 1GQ2A 5HAOA 2A5YB 2M6RA 1LVGA 3G2IA 3IOBA 4CMCA 3SEAA 2AJ4A 3HVJA 1Y81A 2CB0A 4A2PA 2RF2B 4DUTA 4FF2A 4JB8B 5CQGA 3QAEA 3V7NA 4HQOA 3D7SB 3ZJ4A 3PLRA 1XN9A 3DVSX 2VKQA 4WJZA 3BAZA 3MMCA 1ZLXA 2H1SA 4DREA 4DSTA 2BGUA 3GUUA 1S0OA 4ENTA 5EXDA 4YRTA 4PBTA 3DVAA 3W8FA 4YUDA 3ZWAA 4UF4A 4RY9A 2HIAA 1NW8A 4BNGA 2DNHA 2HRRA 4L08A 4QTZA 2DFLA 4M7PA 4ZDIA 1VE7A 3I4HX 3T7DA 3T5KA 5C7PA 2V94A 1DCTA 1TKCA 2PKYX 4I4LA 3E9EA 4RW7B 3VMMA 4DHVA 2MT9A 1MB4A 3RRNA 1UJNA 1UEXC 2HF7A 2Z8ZA 3I61A 3FYUB 5JAHA 5EX3A 1NY5A 3A9VA 3BGUA 3AB3A 4CR8A 4ERDA 4KRXA 4OBEA 3M4XA 1EDBA 2ASDA 3CXCR 2YRXA 3WBZA 2WM8A 3LU1A 4KIUA 1N2SA 3RIHA 3UB2A 5GGYA 2Y8YA 3DXBA 5A5GA 3CE6A 1VMAA 4LISA 2LEBA 4TXJA 4Y0FA 3SCJE 1FRVA 5HHTA 1FF9A 4EZ6A 1H0SA 2C5BA 2I0FA 1XNGA 4J37A 1H2XA 4H4CA 3OUYA 3T7EA 1RMTA 4AUMA 4ALIA 4AP9A 4WYWA 5HQ3B 3PBKA 1NQVA 1D9ZA 2K3IA 1E2PA 1P6XA 4Y6OA 1VJWA 4RL6A 3CNBA 2X1LA 2GBIA 3O8NA 2OPBA 1QD1A 3A9CA 1DJLA 4G63A 1IZ8A 2VP5A 1M1NB 3L6DA 2YS7A 3OZIA 2B98A 4F3TA 3N59A 2ASEA 2E2WA 4EHKA 1Z2EA 4ELUA 2NT3A 1I7DA 2ZVSA 3CWZA 3DD1A 1VMDA 3S8SA 1HNXB 3BVPA 3IAS6 3K1TA 3DGPB 2QAJA 3EEBA 4GKBA 5CXUA 3RYIB 5J2QB 4PHHA 3K58A 4G3IA 4M5DA 4DTIA 1AVTA 5BXIA 2HIHA 2VF5X 4JT4A 4DR4J 3UFCX 2SBTA 3TZEA 3L0YA 1VKOA 4QSMA 4ONEA 1Y3KA 2YNMA 3K9NA 5CEJA 4OAPA 4WFBQ 4IHJB 4U9IS 1CQJA 1GRQA 1ES9A 1BQNB 2QZJA 2OZKA 3QUTA 3MTBA 4POAA 1R3UA 2HYDA 4LSMA 2HT1A 1PDOA 4DCUA 2EF0A 2IJGX 1JIJA 2C3OA 1CQJB 3RHZA 3TW4A 1B14A 4LJLA 2HFUA 1E8MA 4GQIA 2R8KA 2P9GA 5EZQA 2BGLA 2F8LA 3WGLA 1GKKA 4CBVA 3HRIA 3BERA 1DO2A 4YT5A 5JFTA 3GEIA 3IAEA 2V8OA 4NR0A 4Y1GA 2NACA 4NBWA 5A8WB 2QSJA 3JRNA 2N46A 2RE8A 4X62J 2NTNA 2JEGA 1RJWA 5G3YA 2FFQA 3WL5A 4IWNA 2CNNB 2COLA 2CYYA 3ORFA 3SF0A 1LWFB 2VJDA 3IRXA 4W4MA 3H18A 4BBJA 2ZVIA 1S9FA 5C5JA 3LPDA 3AOEA 1GLGA 1H2UX 1U7TA 5JMTA 5EE5B 1LI5A 1F1BB 3B20A 3WLRA 3ONNA 2FOXA 3W2WB 4P58A 5GIPE 3FTEA 5IM0A 1LI4A 3S1LA 5AVVA 2RK4A 1KAHA 2JFNA 4E5PA 1AK1A 3ZVLA 3EIXA 3OZTA 3BBFA 3JAWA 2C9DA 2HNKA 3CNHA 4YLEA 3QY9A 4PYLA 5JUMA 4O44A 3FYDA 3RU9A 1YAHA 4ZQHA 1NHVA 1AH2A 2FJVA 1QS0A 1NURA 1M3SA 1K1SA 4LKOA 2G4CA 4C11B 1NK9A 2QE6A 3GJ4A 2E9SA 3S27A 1JZSA 2RVJA 3GG2A 2TSYB 1C3XA 1VSTA 3C2PA 5MFZA 4XX0A 4F6RA 3N01A 1D03A 2DVMA 4L5AA 3FPAA 1CXZA 3Q23A 2X0RA 3GEGA 2XMTA 4OSEA 4EZIA 1FRQA 3OMWA 1KO8A 2JC0A 4B34A 1LFPA 4IUDS 4DL7A 4XB1A 4QO7A 4B3OB 4OXRA 2CKWA 1C3JA 2ILYA 3K70C 3KSBC 1E1QA 2FPPB 1NRXA 3CN7A 1UVLA 3LY9A 2E1RA 2RFLA 2D62A 2FW8A 2OFHX 3L05A 1VRVA 3ESAA 2HJVA 2ZG6A 4L8FA 5AHWA 1V8DA 3D8NA 2FZVA 4KMSA 4KO0B 3REQA 3H5IA 2RU9A 2FPPA 2J31A 4AJKA 3A28A 3TL3A 2C2BA 3L0CA 3E1SA 1BW9A 1ZR2A 2Z2JA 3QVMA 2IIPA 4JT8A 5C5DA 3NNHA 2JOQA 1RW4A 3DAHA 1QVVA 3DLKA 3T3NA 2HCTA 5CM8B 4FKBA 5KOJB 1UM9B 1U3WA 2YVSA 1ZJJA 3QW4B 4E0DA 5A2QY 5HMYA 3C5HA 2X2FA 1OA1A 1OC2A 1FTWA 2ZRGA 2PPLA 1F51E 1MN6A 1GTJ1 3WLMA 1U5AA 3RVSA 5L6LB 1R3NA 1MN7A 1HBMA 1WW3A 2ZSKA 4DILA 4I50A 1OX5A 4UTPA 2CB9A 3MGJA 1KU0A 4NIMA 1Y37A 2J6UA 4D80A 2R2TA 4S0XA 3SV4A 1P2UA 2JFYA 1JJVA 1PG5B 1SWVA 5E6SA 3HSJA 1JLLA 4UDOA 3L84A 2ZE7A 4LRFA 2PL9A 2EJCA 1SOUA 3I5XA 2PMHA 3GLQA 3ZXSA 2H3HA 3FFAA 3T5HA 2ZBIA 4CP5A 1KKLA 2Y1XA 4DLTA 1DKUA 3TE7A 1WELA 1KZHA 4CH1A 3M2TA 1N2HA 1DJOA 3BJMA 1LSSA 1J06A 3IQDB 1WMDA 1E92A 3NHPA 4E12A 4DMGA 4NTZA 2H65B 1DQAA 3PPIA 1ID1A 2VLIA 5L8VA 1U0RA 2JWNA 3W1YC 1HHSA 1C29B 4NZYA 3T1YB 1SKUB 5F21A 2AD5A 1C0LA 1MAWA 4ZDWA 4RYLA 2H4WA 4C7XA 4HLUA 4G84A 4N4AA 5E4JA 1S79A 5AXMA 4DL9A 4UZSA 1U63A 1KK3A 2HCJB 3IQEA 3NGKA 2FPIA 1N0VC 4O4HB 4D6YA 3CJKA 1CRZA 3BDVA 3JR3A 2QRGA 4YMLA 1PZMA 2VD3A 1XVAA 1Y9OA 1UJ2A 5TY0A 1YTYA 2OECA 2C7RA 5B37A 4OLFA 4AYBD 1GZ7A 1VBYA 3ETGA 2W7PA 1ISJA 4ENSA 3MFYA 1K6MA 1K7XB 3OQVA 5CAAA 2AUTA 3LCCA 3MWGA 4MPRA 2JFVA 2VRCD 4YMSA 1L5ZA 2H5IB 5I3UA 2I8AA 5IT9U 2G5PA 4AKIA 4RETA 5AO9A 1GXSB 2F7SA 2BM1A 3IUJA 3CLSC 2H54B 1TT5A 1PZEA 1X9MA 3MSXA 4UBLA 2Q2WA 4UXJA 4PG8A 1PRYA 1DG1G 1LBTA 2YX4A 1BVHA 2F43B 2XLKA 4J0IA 3N6LA 2APJA 1V1JA 3KZ1E 4OQNA 4RJTA 3Q8LA 4G41A 3FHTA 7AT1A 3W9JA 2AC2A 3RVBA 1N2IA 4EFMA 4ZMSA 1FRLA 1PSDA 2ZR7A 4H1HA 5LP6F 1Q77A 4KR0A 2XUPA 3AY6A 4Q34A 1E2QA 2P9CA 3IXLA 3EXYA 5FH9A 4DPKA 3MOZA 4RD6A 3O0DA 4JQCA 3N3BC 1UMBA 3RKSA 4C4ZA 4YCJA 4B6EA 1XKXA 2VC0A 3CY6A 4USWA 5IC4B 2J48A 3NS5A 1TK0A 1RDFA 5ETSA 4BN4A 4MIEA 1VBFA 1UMBB 4R7TA 4DL6A 3LC2O 2IPAB 2U2FA 3NGUA 2SCUB 3JSMA 3FDIA 1F2TA 4ZI2A 2OUIA 4XO0A 3E7DA 2PX5A 2NLWA 2OBNA 3OVAA 5FNVF 4M0FA 2OWDA 2HPHA 2ILZA 5HZKA 4IQFA 4PZDA 1PK9A 3IVCA 1R4MB 1EVYA 2XYPA 3ESYA 2XB2D 3V8RA 3VDNB 5FTLA 2O2CA 1KSHA 3ZR4B 1IB6A 2BFOA 1TIBA 4EY7A 1E2IA 2YV5A 3FYSA 5EIOA 2YCBA 5JG7A 2I78A 2CLDX 4Z7NB 1LRLA 5EKDA 2WQ6A 3EWGA 1OXMA 3ZY5A 1ULHA 5LA6F 1LPSA 3FOEC 4F4HA 1WCIA 4CMBA 4ZPXA 1EJBA 3KEOA 3IAUA 1C81A 1E8DA 1C4WA 5LIRA 4AO7A 4CMEC 4M7OA 2QW1A 1NBAA 3HCFA 2HJGA 4DMKA 3WP1B 2B4RO 1NNLA 1E4YA 4D4MA 1X1BA 4ER8A 1NVGA 1S2MA 1AHNA 2I4TA 3R5JB 2X9NA 3F8SA 2DQSA 5BN3A 2D3ZA 3E8XA 5IVKA 1U26A 4BLGA 5BUSA 4AIRA 2HMYB 5DASA 4XPCA 4DSEA 4DV0B 4F7WA 2UUPA 4LS3A 3LC1O 5I7OA 1Q0HA 3OQ2A 1FLVA 4BLRA 4I14A 4GM4A 4AECA 4OK5A 3CIOA 1DC6A 4RX1A 2BTQA 3DOLA 2OZLB 4QEZA 5AQEA 2QLTA 2C28A 3HVIA 4YCCA 4D3DA 4MRRA 1VBXA 4MFBA 2CWXA 3PNOA 3OL9A 3CJ4A 1P7ZA 4QXPA 5JXWA 2QZZA 2BEFA 3P45B 3B2NA 3KHRA 1X9WA 4N54A 3PEFA 3UDEA 5D4LA 1F8YA 1YIJS 1G5TA 2J1LA 4EH1A 3HJVA 1ZVKA 2VRWA 3MRXA 5I7SA 1T6NA 5ETTA 2ZTSA 4BPRA 2TRSB 2OO3A 3NWOA 1S9GB 4ILEA 3RRKA 4F2RA 2PAFA 2B5VA 1CULB 3VVLA 3D54A 4BEBA 3AP3A 1EE9A 2IA0A 3X1KA 4HB0A 5JECA 2P9TA 5BNIA 2HX1A 3SCKE 1FFSA 1EP4A 1M2EA 1PW5A 2IP4A 4RD4A 1U2SA 5GIOE 2X42A 5F8GA 3FHLA 2HAEA 3BGRB 4WCFA 1NW5A 2J0WA 3C8YA 1GARA 2YMLA 1KQSR 1DCMA 3DDZX 5LMNF 1YT5A 2H1HA 1T5HX 1NAQA 2RHBA 5IQQA 1P1RA 2XMZA 2ZBEA 3FC9A 2NUTB 1N6OA 2ZDGA 4YRBA 2IS1A 3S8MA 5A5EA 3FJOA 1GO2A 1U48A 4WRRA 3UOGA 3I6MA 1TZ0A 5AVSA 2GHPA 3KG1A 5YASA 2QM8A 4OQ4A 3IT1A 3O2NA 1QFSA 2CEAA 1Z0UA 3S40A 1JQ5A 3GRUA 3ZY6A 1USGA 3TSCA 1L3SA 4GPIB 1H1LA 5ALDA 5BSVA 3D9BA 4D9KA 2C82A 3OESA 2QRJA 3EW9A 3LP1B 2WVBA 3Q72A 1CZUA 3O8RA 3REGA 5IAEA 4EQ6B 2JLFA 1H1LB 4JV5B 1S9DA 2V59A 2FKAA 3L6CA 4X6YA 2UXBJ 3C3EA 4L9SA 4MR7A 2MZQA 3P9KA 5I9BA 2YKMA 1FNOA 4DV6J 4ZIRB 3EAGA 4FFWA 1AZLA 2J9FB 1OYEA 3ZTQA 1R9JA 1XCJA 1NNUA 3T52A 2O8FB 2RHJA 3FDFA 3TSOA 5AVRA 4M9SA 4KNYA 3RC7A 1AKNA 4BN0A 2G07A 3H4TA 3WK9A 1GWNA 3RAEC 2PH5A 4ZIVA 3TNFA 4C3ZA 5SZJA 1YFJA 2BBWA 1IQZA 3SE7A 3L6BA 2Y1LB 1HUQA 2F9FA 3AYZB 1A97A 1APSA 3QYPA 1AXQA 2LNDA 5C4GB 3P7MA 2D3O1 3G1UA 1X8XA 4D02A 1N5SA 3FYUC 3REFA 1H5UA 2MKKA 3Q5EA 2QLNA 4WVLA 4LV8B 5F9MA 1MA0A 1ZN7A 3BULA 4DDUA 1OH5A 1HWJA 3PW4A 4ZCPA 2X5NA 4UTZA 3EGCA 2B9XA 4K4YA 4BUZA 2YKGA 4LF7F 1KHTA 4AYTA 5CYPA 2DHAA 2VT6A 3H4VA 1J8DA 2WTUA 5KOHB 2VTDA 3GBVA 4DMCA 1QM5A 1FF2A 4RA6B 4Q0BA 4M98A 4F3QA 5THQA 4L0DA 2J9ZB 4JKYA 2NVUB 1NMEA 4L3OA 4UHHA 1LTKA 5CB4A 4I9NA 3KOYA 1G5IA 1A04A 2GRJA 4RW4B 3IB3A 3FVWA 4RU1A 4E11A 4OA5A 1UFWA 2MSSA 4LWQA 4DQDA 4CQLB 4FBMA 3U17A 7ABPA 2BP7B 3IILA 1E7SA 2DUUA 3E3OA 4PPZA 4L7QA 1QCYA 4YACA 3RIXA 1KDTA 4X95A 2XOKA 3O75A 4EG0A 3VYTB 2AOUB 3L7NA 4URXR 2DHGA 2C3MA 2F8MA 3COWA 3LXUX 2DPMA 4GLOA 3OA2A 1TL1B 2WRMA 3I0RA 4EAAA 4Q6BA 2JL9A 4X91A 4D3GA 5IFLA 4ZN6A 2BF4A 3SDEA 2R7VA 5FA8A 4CDMA 2I9PA 3R7BA 4HKTA 3OFGA 4W1SA 5D3MA 5TARA 3OSZA 3OAAD 2ZSBA 3N0XA 4A6XA 3SZGA 5BR1A 3DZGA 4TWBA 1Z5OA 2VUUA 4ZICA 4LY3A 1NNI1 2XMWA 1DAHA 1YS6A 4ECQA 2O7QA 1Q84A 3F3SA 1SD2A 2C9YA 2Z56A 2J9YB 4OHFA 5DX0A 1JBKA 4MUNA 2Y1CA 1XQYA 1DKNA 1EU1A 2ILVA 3NHSA 5L1JA 4P84A 1VQMS 1TTTA 2ZW9A 3NNAA 1O6FA 2MU1A 5ILOA 4MQFB 1LWNA 3NT5A 4TXMA 4O44B 3ZI4A 5TRTA 5LT5A 2IYNA 1KA9H 2O19A 1U0EA 2G9UA 1W9MA 3BO2A 5CA1B 4R5HA 1P0CA 1QE5A 2IZOA 3NMUF 1C1DA 3G6XA 4TX1A 1R66A 1MH1A 5BOSB 1XLUA 2BOAA 2GF2A 1NRKA 2WDPA 3AW8A 3QA3E 2I6TA 4HYTA 2HJHA 3DDWA 3X44A 2WWTA 3GIMA 4RW8B 1VYUA 5COBA 4DEZA 2AZ4A 1ND6A 4U8VA 5AM0A 1U3VA 1BN7A 5LMNB 1O94C 2NQ8A 2GEVA 3JQQA 1Q95G 1T94A 1JR3A 1TW3A 1UEIA 1ST2A 4UDYX 3QRQA 3CR3C 3KQTA 2ZSHA 1ZM4A 3SHQA 1NUSA 5GADI 2H2DA 2Z04A 4DEXA 2BT4A 1L7QA 1G2EA 3H5OA 4BX0A 2XH8A 3IAXA 4YJGB 4QNMA 2B2NA 4UAGA 3TTYA 3UOWA 3W5JA 1VCMA 1Z2CA 2Z8YM 4L85A 3OU6A 1G3QA 5HX7A 5JW6A 3MCNA 2HBYB 4LJKA 5HNKA 1LDYA 1TL7B 5JMOA 5J2NB 4M6WB 3TQ1A 4XLTA 2BWJA 1U3TA 2I2XB 3UK1A 1SH7A 2XWJI 4RA9A 4DPTA 2VH7A 2GZ2A 2AMFA 3IS3A 2WM3A 4M0UA 2XMQA 3RS4A 1NTOA 1E6KA 1ZESA 2QVGA 1JLFB 1ZNYA 3UWSA 4OL8A 2CQCA 521PA 3L92A 4IRXA 4C29A 4LY0A 2WU4A 4GE0A 2EHDA 5KG7A 3MUTP 3UCZP 3DAGA 3KQPA 1VLJA 4Y30A 2Z09A 1PZNA 1JNRB 2Q5EA 2PMKA 2BPOA 2MSNA 4JLWA 3ZG6A 4A8XA 2FVSA 5CCBA 1Q7EA 1UMJA 2PR2A 1O96B 1EB8A 2GUWA 1IY1A 5CBPA 3MMAA 4MPTA 4X66F 3VYVA 4JGGA 5DGAA 1K6IA 3PYDA 1X4EA 4OI6A 5AXBA 2JLVA 1PD0A 1Y7HA 5SY9A 4YCLA 1F0XA 3T5MA 5JAMA 2H92A 3G2QA 3D6VA 3I5CA 1UL3A 2UVWA 1V8ZA 3ZGNA 2D06A 3DFKA 3K0BA 4HTJA 1SBRA 4WFAQ 3BT7A 4RQAA 4RELA 3UJDA 3I3OA 4N6GA 4CM6A 3BFPA 2ADOA 5JZMA 2Q5OA 1T1IA 2G7MC 2G6TA 2P2LA 1W93A 1L4UA 4YRLA 3UN3A 1Z6PA 1CY7A 3QO9A 2D9PA 4DDMA 3JQKA 4ZVKA 2R3SA 1D7OA 3GILA 1RM3A 1DQZA 1OILA 4YH1A 2H3EB 4NMMA 3QY0A 4D4LA 4X2BA 1BS1A 4WTOB 1NIPA 5KKNB 4CPDA 4OGFA 3DHYA 1M8KA 3NHUA 1L0BA 4XVUA 1HMPA 4G4GA 4C8ZA 1Z4QA 4MV9A 2NYVA 5ADHA 1H05A 3NBZC 2FFBA 1B41A 4GRSA 1J90A 8OHMA 3TE6A 1KMNA 3V8QA 1VLQA 2REQB 5DO2A 2OAP1 4CMEA 5D0HA 2NXNA 3IAM1 4OIXA 1K5DA 3Q5DA 1NZAA 5D4OA 2VPZB 1IK6A 4UARA 4CO3A 3BE4A 2MQMA 4TVKA 1WOSA 2IBTA 3GP8A 2DEUA 2PGXA 2XOXA 4KYIB 4TWJA 4TY9A 2FX5A 1KAQA 1S4QA 2VPZA 4P8RA 1EIYB 5EMKA 4ZQIA 4JBNA 1NW7A 4UUPA 5IEBA 1W1WA 2PLFA 1ADGA 3UMMA 4QZVA 1FU8A 3PKJA 1VHFA 3O84A 3IL2A 4DLVA 4JUZA 2ZXFA 5IJWA 4GPEA 4Q66C 2Z57B 1DKRA 2Y6VA 3AI1A 4DUYF 3CCRS 5DIFA 3RSLA 4MV5A 3Q7IA 1ZI8A 4WK0B 1II8A 2MHEA 1GH8A 4FGJA 2OY0A 3TVYA 4ENQA 3QF4A 3OIYA 2CXSA 3K4HA 2FRXA 4MXDA 1P3Y1 2CJWB 4TLEA 3GGJA 1AQLA 2JIOA 3FYHA 1YCGA 1FA9A 5G4KA 4LBWA 1SKYE 4KGZA 1RXIA 3K0FA 3JVIA 2JVKA 3HN7A 5F76A 2UDPA 4PXCA 4N6OA 4MHSA 3SXPA 4PN3A 3UI3A 2OXCA 4KPGA 1KZ7B 3GQBB 1RVDA 1EARA 1IVNA 1B70B 1VI7A 5IJ0A 1OY8A 2A2DA 4AB1A 3ILSA 4Y2PA 5BQOA 1NKVA 1JLBA 4FEYA 3ZCPA 4KFCA 1PL0A 3G6VA 4LREA 1IN8A 4LR8A 4TV8A 4M94A 4G85A 3CH4B 3L0PA 2W42A 4G9BA 5KNCD 2HK9A 2VJVA 4OFZA 5IYZF 4REMA 3ZJVA 3CSUA 2I7XA 1BDMA 2LUOA 4PPQA 2YWFA 4K9LA 2JAUA 1JUDA 3TR0A 4JI5B 2JNWA 4QOTA 4WIAA 4TL8A 3JQMA 1ML4A 3C16C 5JQGB 1VXOA 5EUBA 5KFSA 3N2GB 4FLFA 2ILTA 4BBAA 3H5SA 3GB9A 4HG2A 3CGWA 3GCWA 2Z3ZA 2E5JA 3NI2A 1CS4C 3LIIA 4TVBA 4E88A 5H8WA 5JJIA 3GIKA 1Y10A 3KLGA 4RHEA 3ZZUA 3Q40A 1P5RA 2VHEA 1XMOB 4ALNA 2FPRA 4AJ1A 2YRFA 3OHAA 4IILA 4J0HA 4NZOA 1EK0A 2VJLA 1J09A 4C0HA 4FILA 4JJFA 1YQEA 2YOFA 2HA4A 1C4OA 2WB2A 5FOVA 1EWVA 1RCOB 1DQ8A 3U4CA 3HR7A 1NSYA 1R0CA 1ECBA 2FPMA 1QYXA 1DPGA 5LXTF 1OI3A 5JAIA 4KBIA 3B70A 4YY3B 2PDAA 3CB4A 4G3XA 2WAXA 5MAOA 4G0VA 2I03A 1X4AA 3TEHB 1G3RA 1QCZA 2GPJA 5DETA 1P1JA 1U2GA 3RODA 3VSEA 1W19A 1I5OA 2C83A 3PY8A 1OS5A 1MDFA 1NSTA 1VPWA 2VYNA 2OZLA 3BAFA 2NSHA 3QT7A 1PFGA 5ITVA 2Y77A 4B46A 4W98A 1UKZA 4KLNA 1D2HA 2IUEA 5B36A 1UXOA 4UUQA 5GMEA 1VYTA 2JX2A 3A4YA 3UAOA 3VKHA 5IWAJ 3IDFA 3N8DA 3EGDA 4PTYA 3H7HB 1Z28A 4QOEA 3EMKA 2IMWP 4MVJF 2VUIB 4B76A 2GK6A 5D4PA 4GX2A 3BD6A 1YZ3A 1NUAA 2XQFA 1AB6A 1DRUA 1E2HA 2CNOA 1CJTB 3Q87B 4MHTA 4F2DA 2ECOA 1OZFA 3GCDA 4HDGA 5DVZA 3SX2A 3JYHA 2H1WA 4AUKA 5EUCA 2YJ3A 4UPDA 2Z30A 2IU4A 4PX5A 2RQCA 3LPMA 1PNRA 4K9SA 3EK2A 1DOZA 1MZPA 5JFGA 3PGJA 4XWYA 3Q15C 4LQ4A 2IPLA 4BLWA 2P8IA 1W73A 5E38A 3L9ZA 1NATA 1S3GA 2CUTA 3V33A 1KDNA 1YD7A 5AW8A 4MX8A 3HJRA 2WOMA 1ZIXA 3UMVA 3GJ8A 1VFJA 3UTCA 2EFCB 2VQ3A 3FZ2A 4EWTA 5KU1A 2XQIA 2GA8A 3AXSA 2AZ1A 3D3WA 2IM0A 3RVDA 1F4LA 2WB4A 2PMFA 1XFAA 5IMSA 3KOXA 4B81A 4D0NA 1BX3A 4P86A 4DG5A 1TUBA 1ICIA 1UBTS 2H51A 1TVMA 2Z8YA 4Y00A 2ZBRA 2XY7A 1OBOA 3O91A 3ESCA 1YACA 2MQQA 3ZH9B 4ARCA 5AKEA 5DZSA 1P2TA 4X20B 3MFHA 3ESQA 3K0KA 1NI3A 2FSFA 4G89A 3WGJA 3T34A 3HBFA 2QN7A 1N52B 1XL0A 2V7VA 3GV8B 3AOCA 3N2IA 4FT4A 3AQPA 4TUYB 5FTJA 1TJNA 1W581 2BIFA 3BG5A 3DLKB 5ETLA 3S2IA 4RL1A 1U8TA 5ALWA 1TFUA 1QH1B 3DN9A 3C1TA 1LX6A 3E3LA 4W8GA 1A76A 4KSBA 2QU7A 1K2VN 3KTFA 3KR2A 1Y0BA 1XMQF 5EWEA 1HBMB 3MG9A 3CCTA 1HLWA 1X7XA 1PJSA 5KQMA 1GQYA 5A8KA 2JLGA 2WZDA 1Z4PX 2EPIA 1ZN8A 5LXTA 4F84A 2A1BA 3ZNJ1 1VA5A 3AIIA 1DTQB 5K0JA 3UGJA 2VDPB 2Q7OE 3KTAB 1V2GA 3ROEA 2HDWA 5C37A 3OT1A 2DGTA 3EVAA 1E3SA 1OYYA 3ECCA 3OY2A 2J8AA 5HK8A 4FYVA 3UMSA 3M1VB 1XD8A 5DGBA 4KDEA 2LMIA 2EWMA 3HHDA 3QU2A 3PW5A 4B71A 2XSFA 3ND8A 1KK0A 1I24A 4XH9B 5AR1A 3D5EA 2B4AA 4BNNA 5CH5A 4K9QA 4JU8A 1SQ0A 4UM9B 3PC8C 4O5OA 5DNDA 4BCCA 5TJ9A 2ORYA 2XYHA 3K1JA 4IVPA 4F4UA 2VH2A 1FEHA 1DQNA 1TMGE 4XM0A 1J49A 2EBUA 4HXGA 2M9KA 1MQSA 4I8DA 5A06A 1P2GA 2DH5A 1FX4A 3ADKA 3P32A 1M2VB 4B40A 3KR9A 1Z13A 3QLVC 3E9NA 1ZMXA 2I1RA 5BR8J 1E66A 1LK7A 3H5YA 3CJKB 4MRAA 1EB0A 1Q1BA 3AM1A 4ZQCB 1WCWA 2VHVA 1XGKA 1A5SB 3KVOA 2W6NA 1BS2A 3WLSA 4FXDA 3GRCA 1WNTA 1JI0A 5BXQC 2VSXA 3AEYA 4I1PA 4W5NA 2ROEA 4U4AA 1GOTA 4A73A 1Y9JA 3PFIA 1RHRA 2IPOB 3CCJS 2WU0A 4LOHA 2O14A 1NI4A 3QVVA 3U3RA 5C7YA 4FJ2A 1P2FA 5K2OA 3ZD8A 1BX1A 4MDHA 5TE9A 3RSFA 1FTRA 4LQLA 4Y2QA 1ZJWA 1CUXA 1CV2A 5EUMA 2JRSA 4O08A 1W8DA 2H8KA 2Y9MB 1Y6RA 1S6QA 3VR2D 3DDSA 3DLLQ 3N2EA 1I5RA 1YQDA 3ZHYA 5C8YF 1TAQA 5HJ2A 3PPXA 4CQ1A 3BRSA 3BFKA 2IOFA 4IQ0A 1ZAYA 4KDFA 3G4SS 3MM5A 1VRUA 2LE0A 4BO6A 4FGWA 1JR3E 3C3BA 3U4MA 1GQRA 3KJQB 1CKEA 3LSTA 5LYJF 5DKFA 3D3CJ 2VRNA 2ZTHA 1FJCA 2W2LD 2JHEA 4BTEA 1JDBB 3CC4S 1XZBA 3CE9A 1CB7A 1RQPA 4FUTA 2CADA 4OLPA 2DKOA 1CVLA 1QP4A 4M8NE 3VFDA 5L3VA 1FYFA 4NJOA 5F4ZA 4UZCA 4B08A 2KM1A 4OBXA 3NP7A 1JXMA 5I51A 1NMQA 1NJYA 4CLOA 2J76E 1PILA 4ZEMA 2RC6A 4LSLA 5JATA 3O2QB 3L07A 1NONA 2R87A 4EA7A 3E18A 4EO6A 4IDPA 2NZ8A 2HUNA 4MK9A 5B57C 4TM8A 1TTQB 2W4IA 4QXAA 1YJUA 4DJ5X 1XI2A 1MO6A 4R68A 1KKUA 2FWPA 1RAIA 2DEIA 1YQTA 4YROA 4OKNA 2XDYA 2EXXA 1VMBA 3MJVA 3DL2A 3SSOA 4QEKA 1PT6A 5FJIA 3KJNA 2ORWA 3UH0A 1S12A 1Q20A 4WN9B 5BSUA 3U60B 1M6YA 1SN7A 3OL6A 2UYOA 3M2PA 3L1HA 3B82A 3ZCQA 4L5CA 2IBOA 5BWMA 4Q3NA 2E82A 1RKBA 5G0RB 3KKKA 2OFWA 1JSRA 3G0IA 5GZ1A 3UK2A 5FL7A 3AG5A 2FPLA 4XD7D 4HDRB 2XNSA 1VRQC 4P82A 1P2VA 3K92A 3KSZO 4P10A 4LSZA 3GAMA 5FL7D 1ORIA 4KH1B 3FRJA 1DKOA 1RT1A 3MOSA 4UE3S 5LZ8A 1QKKA 4C6HA 3I0SB 4EUVA 4ELTA 3L8GA 3AJDA 2MYPA 2I29A 1KO4A 1T9DA 1D4OA 4JSTA 2DO4A 3Q2SC 4XYEA 2QW0X 2HQ3A 1ZZEA 3FMPB 4KSCA 4K9PA 1BYIA 2GIRA 3UWMA 2DSNA 1OAOA 1KC1A 5EQFA 3PACA 4PLWA 1EUZA 4AY5A 1G1MA 4MEBA 2JW5A 1WZEA 1QU3A 4YRKA 4J0GA 4DU8A 1SUIA 3F5QA 3SS9X 4P3PA 2IEZA 3MEKA 2XI3A 4ZQGA 1EXWA 2LXUA 1XLTA 3MEEA 3EVFA 1G59A 4OX7A 1WV1A 4E51A 1JWLA 1Z34A 2DIRA 4AX8A 1G7CB 2BFDB 2XCSB 2GO8A 2PSZA 1M6WA 1C8LA 4J6FA 3CNEA 1A95A 2IYOA 3IBWA 3EZGA 4BFVA 5KYUB 5F64A 3CX6A 1UC8A 4Z3OA 1EVKA 1KNXA 3PDJA 1BDBA 3DLEA 3MS2A 1P80A 2W9AA 5KHAA 4RANA 3H1FA 1IPFA 3K6SB 4K50A 5FF9A 2O8EB 2NG1A 1IC6A 4X1KB 2K6GA 5AKKA 2HKIA 4TMFA 3DLEB 4ZC1A 2GF0A 1JEYA 3LQ4A 3M8PB 1HT0A 2YY6A 2XMCA 1YHNA 4JJGA 2GETA 3SNKA 1TC1A 3NS7B 1PJ3A 5HQLA 5JROA 1XXHA 4URZR 3KQMA 2IEYA 1HEIA 2HGZA 1P1BA 1W8IA 1SHZA 2OKCA 4OJTA 1XQ6A 3R4CA 4BP1A 2Y67A 1H6AA 1WC1A 2DK2A 4ESOA 3D4BA 5ILQA 1ZJ6A 3TO8A 4WZBB 4NENA 3OX2A 2OUGA 2I6XA 3KC2A 2G3YA 4ZAWA 5K9FA 5FFMA 4YB7A 4JI0F 1AO0A 2QLBB 4JVMA 3FKSA 3OQOA 2E5IA 3A4NA 2DHEA 2XZDB 4EPTA 2PX8A 3CVOA 4B43A 5JD6A 2PN1A 1TM7E 1R0KA 2J6SA 4RGBA 1DIOB 2PNJA 4WVFA 3COVA 1L7DA 1TYEB 3QF7A 3H2ZA 4DM3A 3L7CA 4N48A 4F9EA 3R24A 4OHMA 5T4HA 1Z3CA 3U16A 1H69A 4C88A 1AGXA 3T7TA 4AY4A 1HYQA 3H2UB 4I81A 2B8TA 1HEYA 4LI3X 2YQ3A 1Y5LA 1TA4A 2QI9F 1JWAB 3MLAA 1XK7A 3HZOA 2JIBA 2VTBB 3LP2A 2WMNB 2QWXA 1IZ9A 2YQ0A 4MB6A 2BMBA 4OP2A 1G7TA 4WEOA 5D5QA 2ZVQX 2VYVA 2EZTA 1ORVA 1E9RA 1EM8B 2JDID 3KTDA 5BORA 4HDMA 4N3GA 3M9WA 5A8RB 1V9CA 4E03A 3M4YA 2ODAA 3N6XA 1RT6A 2UU9B 1NJ1A 3HJFA 1EG2A 4B3IA 4EUKA 1UM8A 4W7HA 2E5GA 3BF4A 1YJ7A 2C8LA 1EFPA 2FV8A 4V0RA 4I4CA 1H6BA 4MVJP 5CVEA 5AI5A 1T2DA 3AHJA 5EL0A 1KMIY 4NASA 4GWLA 1FTYA 4DV2J 1AHPA 2JCVA 3PFNA 5KX5B 1S59A 3ESRA 2X5XA 1UBRS 3W2HA 2I2DA 4R16A 4LF5J 3RADC 2JFFA 4JZYA 4O5AA 4RHYA 3B1XA 4MK4A 4ECXA 8LDHA 4WNAB 4X71A 3IR6B 3MECA 1RHMB 3RYIA 2JH3A 5DCYA 4NAUA 2Q3HA 3UT6A 4PLTA 3VOBA 4WLUA 4RK7A 3MPUA 4BKQA 1QANA 4O4IA 1OGYA 2CV2A 4R9VA 3Q2KA 4HQRA 4EPXA 1P4GA 3L1KA 4A1OA 4CTAA 1N25A 5LSOA 2QOEA 4R84A 3A9RA 4WEQA 4NXNJ 3E9DA 2IEDA 3BXEA 3CX3A 1U1PA 3UGQA 4XDGA 2QDXA 1X1CA 2A0XA 4FIDA 1C1HA 3EPJA 1KGSA 3ULKA 4DFJA 3PIDA 2JAPA 4IQ8A 5JD5A 2QGFA 3FTNA 2XT9A 4B3SB 1TRHA 4X62F 3LZCA 1U9IA 1CDDA 4BGIA 1H0KA 3NVDA 4DDTA 3JYPA 1LJLA 4N9WA 4D9BA 4M22A 1IVSA 4BKMA 2VJNA 4LIWA 4DZZA 3U1TA 2XWPA 4PIVA 1ADYA 5CT8A 1RLUA 3IP7A 2JIZA 3HA3A 3T41A 3GD5A 2Z9BA 4JJ4A 1NU8A 2HA3A 2VDWA 1KRXA 4M1YA 5HRAA 5ICGA 1QFYA 5EHHA 1XP5A 3UMBA 1BC6A 3R3UA 2GQCA 3V46A 3FR8A 4OJYA 1A8IA 4L51A 2BISA 3QIDA 4FHFA 5H9VA 3HSYA 2AMLA 4MWTA 1XMJA 4PG5A 4QXQA 3ZNOA 2XHEA 4HAZA 1JNYA 1K6EA 4MTCA 3IULA 3O0TA 3B9RA 4NXMF 1Z0FA 4QJ3A 4KB5A 1IUJA 2PRIA 3D81A 3F5MA 3ICCA 3NC4A 5KT5A 1YI2S 3U3XA 3U7RA 4DZTA 2ZCJA 1RTDA 4C76A 2IHVA 4NMWA 1O51A 4ND8B 3IS9A 1B93A 1K08A 3CRRA 4OAQA 2OFOA 3H2LA 1U6BA 5JS7A 1MX3A 1I94B 3UK0A 3NALA 3NUQA 1TU0B 2V4QA 1RE0A 3JCZA 3MCVA 2WG2A 1RTDB 4G65A 4DQLA 1XU4A 3JQ9A 2R1ZA 1FUEA 4PQGA 1AK9A 1VLLA 1P33A 5AT1B 2W2OA 1JJBA 1U6FA 4ED5A 1D0SA 3E9QA 4IIEA 3LWBA 2LR0A 5KQSA 4CIXA 3D67A 2OD7A 5CXXA 3HKDA 3F78A 3MMZA 3AVUA 3G8CA 2ZRLA 4AUNA 2WB1D 4HY3A 1MO2A 4ODIA 1COWD 3K8ZA 3P49B 5ENVA 4G0YA 3TFOA 1ZCFA 1A5BB 1E9BA 5E8JA 1GUFA 4JB3A 5DI3A 1I2ZA 4KBYA 2XMGA 4PABA 1KO5A 2HS3A 4NCGB 3N53A 3UMFA 4YO7A 2A3RA 2YIJA 4CM1A 4L4SA 3KPJA 3DDIA 4YHHF 3TXXA 4JLPA 1JJ2R 2JAQA 2VQEB 5LMUB 2WHYA 3K6RA 4YEAA 5HIIA 4NJEA 3PNVA 1IKYA 2CVFA 1I33A 4RH3A 3G6KA 3OD1A 3CF4A 1L1FA 3L04A 2OYSA 1KI8A 3WRYC 3MMAB 3ENVA 3TW6A 3BN4A 2Z0MA 5IF9A 3W5XA 1S2GA 3CNLA 1ULAA 2HEGA 4RSHA 1H74A 1X4DA 4J9LA 1J1IA 4CNQA 3QI7A 3K0JA 1JJCB 2ROQA 3HB4X 2PKCA 1NDQA 3WZMA 1F9FA 3UFXA 4KQHA 5JD3A 1NLKL 4FGLA 4ZREA 5C32A 4Z8YA 5LFAA 4ER5A 2HGMA 4B6SA 2JK1A 4BX8A 3GUVA 1BOFA 1PBAA 1A50B 3U3JA 4DV2F 2H11A 1MNQA 3FROA 3ZGZA 4LF8F 1N54B 1Y3DE 3LRTA 4EQZA 1B6RA 3T1YF 1QZZA 4UJ3A 2YN4A 2PANA 1Z5WA 4IRUB 1WBJB 1K6JA 4JEUA 1DB3A 2R2UA 2RH8A 5TEVA 4EA6A 5AQ1A 3RASA 4ILRA 3M9OB 4LF6J 4NU8X 1IN4A 3RT7A 1M1UA 3UJ9A 1JLKA 3QBCA 4DV1J 3BB5A 2H4WB 4RO0A 3KOWA 3F46A 1Q74A 5D1NA 2OZVA 1GVHA 5TQ2B 4IRDA 4DNQA 4DG1A 1PR2A 1Z5GA 1FWKA 1XU9A 1IQUA 4O4LF 2FPIB 5K45A 2JI4A 4QYIB 2GJ2A 4KYTA 2BJ8A 3W9SA 1U31A 1Q0PA 3RQIA 3SJBA 1EFVB 3TIVA 3HYLA 1YS7A 3THWB 3FLBA 1AHIA 2BKXA 4OHCA 2NSCA 2Z1NA 4BMVA 5T8KA 2VHJA 4FKYA 1DBSA 2VBYA 4ZYYA 3PKMA 1N6QA 3WOHA 3RRZA 3ZIDA 5F9FA 4HSEA 1QTQA 2QRUA 1VMIA 4IJMA 2OESA 4CW7A 2Z98A 2PRSA 2VPWB 3EZLA 1UBUS 1PJLA 2XF8A 2FLOA 3GP3A 3H8WA 1JNXX 5EGSA 3QFHA 1QORA 5LL6d 1ZOTA 1Q16A 3ILLA 2C7OA 5GMKa 3O73A 5ETMA 5FQOA 5AW0A 1WF6A 1F0KA 3UC5A 2FHJD 2JIPA 3K17A 2O07A 5L9AA 3UR3C 1AS0A 4MUHA 3OU7A 3HBJA 3LPLA 5A6SB 1MQAA 1XZEA 3A6HA 3TCNA 2ID9A 1X9HA 5DCUA 3QX9A 3KD2A 5TR9A 4FMDF 3PC4A 3TTVA 1WM1A 3LKDA 4YJHB 4KGXA 4LCBA 3PR1A 1R0SA 1I3NA 1T9XA 1L5LA 4BZQA 2G72A 3TB6A 1RT9A 1A2BA 2QL6A 4JI2F 1FP1D 3H8JA 1IKVB 2GN6A 3PX3A 1FZQA 2AUMA 1Y11A 1CC8A 4BNFA 1B0PA 3TQEA 3JSMB 2B37A 4KYVA 4OX9F 2AOTB 2BKEA 4TNOA 2QTHA 1W88A 2V5AA 2FCAA 1VG9B 4ZKEA 4S1TA 5LQRA 3IKMB 1QUEA 2X76A 1W30A 3B9QA 2R6AA 4P5DA 3ZHTA 2P11A 2M7SA 3GB0A 4BO5A 3Q0IA 2ZUTA 1OV6A 3INRA 2X9QA 3PNYA 1SKRA 4TS3A 5KQLA 1UEKA 5AJXA 2P9BA 4HRYA 3OQHA 3M49A 3ZU4A 1BE8A 2G08A 1PC4A 4DB4A 1MT3A 1RKJA 2QYGA 3IFSA 2R8EA 2D1RA 1CJBA 1Q0QA 1OLSA 1JSZA 1E9VA 1MO5A 2AI1A 2XTNA 3VAAA 2VF8A 4MKYA 4J3FA 2B1JA 2C95A 1HDYA 2P65A 3KK1B 4C0JA 2BRUC 2EFYA 1GA1A 3F41A 1C1BA 1PVOA 4NOMA 4DXHA 4XFKA 1PP4A 3STHA 2DOKA 5ESXA 4AO8A 5E7OB 2VYQA 2ACMA 1IBKF 5DNYB 3LNTA 1SUDA 1QZUA 5AKHA 4Y2KA 2UUAJ 2QRQA 1RI1A 1MG0A 4IUBS 1H9BA 2GBLA 4IS3A 4LSNB 4QOIA 3IVRA 1J1UA 1T8TA 1TTHA 3FWZA 3G85A 3M8KA 4MGZR 3P6YC 4UHJA 1WSWA 3ELBA 2Q3JA 4IYJA 2YKQA 4BBPA 3ID6C 2GCOA 4B47A 2O2XA 3X1YA 2FR8A 4Q4AA 3ADAC 1B6GA 3A8IA 4C6AA 3RG8A 2CMHA 2XMUA 3EXEB 1VIOA 3RSGA 3V2UA 3LOPA 4MKRA 3SSNA 1E96A 4ZRNA 2RBKA 3H2IA 2HMWA 1V6HA 4CQMA 5J2MA 2ZKUA 4BWMA 3VU9B 2HK8A 3OX1A 3A6ZA 3KOMA 2W7AA 3VR4D 2XJ4A 3NEPX 2NYAA 2HR1A 3F9RA 2OCKA 3DV0B 3O3MB 1PR3A 4G1IA 4OL9A 1GYRA 4L22A 1QDUA 5C5CA 2NZYA 2PLNA 4ZVPB 5DXJA 3NKYA 5K0NA 3LDAA 5K3SA 4RDIA 3I2JA 3IUYA 4F4DA 3CUTA 2YXPX 1FNDA 1CLEA 2HMAA 4WLFA 4XJVA 1FFCA 3SDZA 1G20E 3CRW1 3CJ3A 1F7VA 4I1IA 3QPWA 3IEKA 2WHRA 4CYUB 2HVIA 3MRSA 5D5HA 2FJAB 3I73A 1FMFA 1B7YB 3S2EA 1D8YA 1TJ5A 4KPEC 4H1WA 4XVQA 4U63A 2KB2A 2TMYA 5ESRA 3MR7A 5E6UB 2FFAA 3WHPA 3DKPA 4A8HA 1Q5PA 3DDUA 4DS5A 2XB6A 1XTJA 4Z0HO 1C7IA 3E5RA 3EVTA 1E3MA 3NBKA 3LCVB 3AB2B 4DIMA 3S8YA 2ZJOA 3D02A 2GJ9A 4TS4A 3LUBA 2UZIR 4TVAB 3U9TA 4BNMA 1YOVB 5IG2A 1YR9A 1LBSA 4OJNA 1JIQA 1XV5A 3HBLA 1X14A 3V3KA 2DX7A 4K3VA 3WYEA 4OLHA 1RWXB 3SR0A 1GCOA 3IBCA 2PBRA 2G9RA 2EBHX 4O59O 2CG4A 3WKAA 4IGAA 2KLHA 3BMXA 4KQ2A 2WVEA 4B3MF 2ZWAA 4Z4CA 1OQ6A 4DCJB 4NYJQ 4L73A 3KJVA 3IT0A 3LIPA 2IY7A 3AETA 4A8YA 4M9CA 1ZUD1 4FW9A 1YKSA 3TOZA 1XMOF 4S0MA 4KRWA 5RUBA 5A8KB 4ZHRB 1RT6B 4Z4HA 2NTYC 1WZ2A 5AOAA 3UHFA 5HYVA 1Z68A 2KBEA 2AK3A 3LM8A 2FHKA 4UREA 2QZ8A 3KUDA 1LW2A 1NP7A 2C7PA 2OMLA 3P5SA 4FYVB 1N9ZA 2BEVA 5F1OA 3EXCX 4HQ6A 1Y98A 1T9UA 3FE2A 2QNRA 2MKSA 1JIXA 2DPIA 2WK4A 1GPWB 3P0JA 3SICE 3LX5A 2X1BA 1Q2XA 2DAPA 2XT6A 2IPXA 2WIKA 3DOUA 1FI4A 3TL2A 2HTEA 3HB1A 5IDWA 3IQFA 1N2EA 4AN4A 2OGSA 4GR4A 1CJKA 3FFIA 1QGUB 1MV8A 3OX4A 1UADA 1RUSA 2DNQA 4POOA 4ASUA 2C9OA 3C41J 1AMNA 4FYDA 1STOA 3FUTA 4YP1A 5EJMA 3RIGA 4CCSA 3NGTA 5G4DA 3IP8A 4DQPA 1H5QA 2CQ2A 4XPZA 4D8YA 3IUQA 3GG0A 3JWIA 4E1BA 1LOUA 4PWWA 5JALA 4ERNA 5K8PA 4RW6A 3E58A 3ENZA 3FWHA 1HG0A 1HE2A 1D1UA 4CH0S 1O5OA 1WU8A 4J1QA 5A7FA 1HNIB 3NWRA 5IK2D 3AFHA 4S1NA 2DWOA 4X65B 1EUYA 4FDTA 3EYAA 1Y5RA 1M73E 1G17A 3OSUA 4JWTA 4U7CA 1TA9A 1BJTA 1ZUHA 1URRA 2EKQA 1Q7CA 1EVZA 2E5LB 4C3MA 5EIBD 2Z6QA 3EULA 2LWIA 3GDGA 8ADHA 1X1DA 2G25A 3LAKA 4KNVA 4ZKDA 3N39C 3TB4A 3SE0A 3M05A 1B1AA 1JBEA 2QRRA 2FR1A 1YRTA 5HL7Q 5KVQA 5JCXA 1EGVB 3F7NA 1Y5NB 1C0IA 4QU9A 4GGOA 4KZPA 1LZLA 3EAFA 2LCQA 4EY8A 3H20A 1F14A 2BUNA 5HBGA 5AKZA 2MJLA 2HJ9A 4LMZA 2C5EA 3SXLA 4MR8B 4C0SA 1CS4B 2F3RA 3OR2A 4G0XA 3BWCA 3LKBA 4YP9A 1NK5A 1SZPA 3W2IA 3HWRA 1GT8A 4BJ1A 2ZSJA 4UAUA 2PFDA 1Y4ZB 3TLXA 2ZJAA 1P60A 1O77A 1GTL1 1CZRA 1S5ZA 3PG9A 3FCAA 3D1JA 1PJ6A 4OATA 3MNFA 3NTOA 2IF2A 1XRQA 2R751 4NE9C 4QLBA 4KQGA 1OXTA 3L95X 1T6ZA 3Q0EA 2HF8A 3DLTA 2IFXA 1C1XB 1PL8A 3DQZA 3TARA 3HT3A 4MQFA 1S77D 5D7BA 1DHMA 3PR3A 2WFAA 4I1UA 3S70A 4ZV7A 3CEAA 5ERYA 2CFOA 4HT3B 2BONA 2Y0BA 4QWCA 2QTZA 3AUTA 4IOLA 1V4NA 3KNAA 2C7VA 3GA5A 4KMMA 1JVSA 3N5FA 1YNOA 1U0HB 1TU0A 1TV6A 3H3JA 1KH3A 1A69A 1GUZA 1BJRE 3SXUA 2ZJ6A 1JPNA 4BEJA 3ECSA 3Q8WA 2HBQB 3OURA 3B60A 3ET6A 1JSXA 1RAIB 4BRWA 4UFOA 4ZA1A 1BHJA 3U61B 1GTMA 1BXGB 4OUDA 1PWHA 1SKWA 3VKWA 3CEPB 3D6JA 4EB8A 2RSLA 4M46A 3JQRA 3STVA 3HC7A 2JHPA 2AF6A 1PX2A 2CNDA 1BD4A 3AF0A 2VG8A 4NONA 5E95A 4BFXA 3LY5A 4UASA 1XPJA 5K8UA 3S68A 1R0YA 1BDJA 4HZUB 3H2BA 4J43A 1Q5VA 3G9UA 2G9QA 1NXWA 3GDFA 3QSYB 4R3UC 4WE3A 1OFUX 3P26A 2V1XA 1A4XA 1TIKA 3PM9A 5HRUA 3B4DA 4HQ0A 3NBFA 1YX2A 3CVXA 4GO7X 2CQDA 5KC8A 1AK2A 1VLMA 2L0XA 3V6LA 1H2BA 1B0AA 4UU1A 5BV0A 4X1OA 1YFZA 3PO4A 2GXSA 4GKKB 2XYGB 1QF9A 5H16A 2PWAA 3PXGa 5JC8A 5GVQA 1G3IA 4EELA 2GN9A 4WE1A 1T9BA 1TU4A 1B2RA 3PDIB 5CHYA 2JFPA 3FVTA 4ZVSB 2DULA 1W1UA 5CFNA 3KBOA 2I2WA 5FB3A 3CX8A 3MURP 1GAJA 5ETKA 1X9IA 4NA3A 1C9YA 3GRKA 1DQSA 1VL5A 1WAMA 4TLQA 2GVDA 4QJ4A 3OTHA 4CTKA 1KFKB 3HCEA 1UFRA 1SUBA 1IHPA 3QBEA 4BB6A 4KL8S 3RYCB 3RS5A 4BDTA 3K53A 1X60A 3KRTA 4MITA 2UUCF 1DMSA 1GUYA 2J0UA 2JJQA 1V43A 5ETVA 2ZHBA 5GVSA 1YE5A 2ZRPA 4GVBB 1JFLA 5DBOA 4OTZA 4LZWA 4ZT6A 3KT6A 4FYIA 3ZDYB 1QHFA 1UXJA 3SSAA 3SQLA 1FW8A 1BOOA 5GPBA 3LYLA 3OM9A 3AI3A 2GSDA 2FW7A 2CVQA 5CA0A 2IH5A 3T54A 3PUIA 2Q2VA 4H3VA 2J0XA 1ETHA 3HUEA 2FKNA 3CBGA 1RACB 3DOMA 3OTBA 2HH9A 2ZJ4A 2FI1A 5K5EA 2G1KA 4JOCA 4RU9A 3H2HA 3PA6A 3G82B 3C3DA 3INGA 4AKHA 2DGVA 3EPRA 4A7PA 1O94A 2HNYB 1QIMA 3AT1B 4GRDA 3C16A 4F85A 2GA7A 4TV9A 3V1UA 4IRCA 1FDNA 2REQA 4GI1A 1XR6A 3GZ7A 1RYFA 3USZA 3FUVA 4OLAA 1AUXA 1ECGA 3VNUA 4C2BA 4YQEA 1RI2A 4GI7A 3HSZA 4LFBF 3EUFA 2WSSD 5A3SA 3RF6A 1F2GA 3TX2A 4WX2B 4IV5A 3KMQA 5JYDA 2HHWA 2QMXA 1J00A 3JARA 3HKWA 3QXHA 3WWOA 1C0UB 3UMYA 3ZKWA 2VHWA 3FPLA 1D0VA 2GEFA 1Y6ZA 4LYJA 1NHUA 1LW6E 4J7UA 4RGQA 4R8UB 3R7LA 4ICLA 4JI1B 2YH0A 3Q7RA 3BWBA 1CJUA 1QWOA 2HDHA 2AJLI 1N32B 2PYDA 3CGGA 3EXHC 4LF6F 4GEKA 4G01B 1SEVA 1FDTA 1W4BA 1YQXA 1IBMB 3THRA 3ETJA 2XZTB 2VG5B 1BVYF 2ZOGA 4B3DA 1Y00A 2CSUA 2DJ5A 1VSUA 1XTUA 3R4VA 1NE7A 2BD0A 3A3NB 1U45A 2G06A 1ZUNB 1N32F 4G5QA 1IEXA 3ZBTA 4RLQA 1YDWA 2Z0GA 9LDTA 1E3WB 5LLTA 1XTSA 4RHXA 1SPXA 5F9LA 4YGYA 3JQGA 4BVAA 3O31A 2FGJA 2QL9B 1SQSA 1X7WA 2V6JA 3P9XA 4LVOA 1W36D 3H0CA 2VHUA 5JMWA 1DOHA 4E4RA 4U2BA 5EJIA 5CYOA 2V58A 2IPMA 1BQXA 4RCYA 5F8MA 3U7FB 3C6TB 4ZN1A 4RLHA 1R5BA 2F17A 3LBHA 1X0FA 4L4RA 3D4PA 3IC5A 1EAYA 4Y2GA 1J8QA 1EVJA 1NJZA 2ES4A 2O2JA 4R9UC 1S2NA 2DETA 5E4FA 5AD1A 5AUNB 3NDRA 1CUJA 4EG8A 2Q4DA 1GSOA 3Q7TA 1JHZA 4KFBA 1JYSA 1XZMA 4MV3A 1EFDN 4Q6WA 1OPZA 1NN1A 2OOKA 1NKBA 2PUFA 2PGNA 2FC8A 1ZTWA 2HIMA 2H9YA 3H25A 1LDGA 5TPZA 2UYCA 2J7PD 1KSGA 2FY1A 4ENUA 3FI0A 3PHBE 4I2VA 2B61A 2GBLC 3OPMA 1Z83A 4LNUA 1N9GA 1RBYA 3GWGA 1RRVA 2I71A 3HXLA 4PKDB 3GRYA 5D77A 4RF5A 5ALRA 1RBLA 1RRKA 3AUAA 3E3NA 4TU8A 4OF4A 1EZZB 3UJHA 4UMFA 3GMTA 5CPBA 4ZARA 3PQ6A 1F3OA 2RDMA 2XOEA 4WXPA 2D7CA 2GK3A 4L50A 2F1HA 3QLJA 1IN6A 3QVUA 4ZHQB 4N3CA 3WV5A 3GV7B 1NMYA 5DRKA 5M2RA 3DRXA 1VE9A 3QPBA 2C4NA 4RFVA 1KONA 3I6ZA 5EJEA 5H83A 5F33A 4K6KA 5D0RA 1T36A 5C1OA 3C6QA 4CO4A 3HSGA 3PXXA 4JYMA 4HGNA 4XQ0A 1XERA 4LF5B 5HSPA 2XCAA 4G97A 1GG2A 4CM2A 2KHZA 6Q21A 1KZGB 5EWJB 2A5DA 3O2JA 4YAFA 2HCRA 3EG9B 1U7UA 4KZKA 3TLAA 2LDBA 4MGIR 3OM1A 3A1VA 4ZTBA 5DDIP 1ZNZA 3OCJA 2AR9A 1IG0A 3P0FA 2B7BB 2C03A 4MROA 2Q7DA 3DRSA 3A6KA 3O21A 4PGHA 3BXOA 4AKEA 1C4CA 2R7AA 4PEVA 5SYAA 2X1MA 2K8GA 2J4CA 5JXJA 4QYWA 4FZ5A 2H57A 2ZRFA 4CEIA 3E15A 2VZ8A 2JZCA 5KFVA 2VOEA 4JXJA 1JMVA 1GL9B 3MILA 4IVRA 3WKCA 1B74A 5B58T 1TM5E 5BV7A 1U7ZA 5EX0A 1U2EA 1XR5A 2ZGVA 1P6QA 6REQB 3V7YA 4DG9A 4A27A 4GOXA 4INOA 3L79A 1R18A 2H1LA 4YFYA 3CZMA 1P7CA 3BDAA 3NGLA 4CUKA 3ZO7A 3RUIA 2PT7A 5AT1A 1VJ0A 3C74A 4JLNA 2OIHA 2CUKA 2GTIA 4XSGA 5AM4A 5AVJA 1UCFA 4B2LA 1KFEB 2QA1A 3UT5B 3AR2A 3KHSA 3JYLA 4YT8A 3SKYA 5D85A 4FYJA 4ED9A 2YVLA 2C8JA 3AF6A 4ZVLA 1TUBB 5C24A 1XCPA 3KHGA 3WWCA 2MHNA 1GQQA 1EJ2A 5KNBD 1OF1A 3EUWA 2Z58A 5DTJA 1KY3A 3CGIA 3UQSA 3R5BA 2RMLA 4BFZA 1T35A 5FBLB 2DGXA 3VC1A 1RLTA 4IINA 2O3UA 5IYZB 1L8QA 3QU9A 2WE7A 3EB9A 3B78A 2PIDA 1HYEA 4H2DA 3CCFA 1WZNA 2ZI3A 3TUIC 4NMHA 1SXQA 2E9RX 3F4BA 3M2RA 2JD2A 1ZP6A 3QPAA 2BHRA 5EJGA 4AM8A 2FN4A 1NXVA 3AETB 2DB3A 1Y80A 1PEKE 1AKWA 4JVNA 5FOSA 4B3MJ 1RIIA 5C8XA 1F12A 1QH1A 3IT3A 3FRIA 5AIBA 2NUHA 4JMLA 4ERXA 3WLPA 2G82A 4FDAA 4ENWA 5JMPA 3RRFA 2GM4A 1AZWA 3M3HA 4OX9Y 3KWFA 5KTPA 3EGXB 1JT2A 3RJ5A 3SFGA 2JATA 3Q8VA 4BU1A 5HVGA 3VR5D 3UFXB 4WFKA 2AB0A 3ENKA 2V7QD 1ZM2A 3JZFA 4RHTA 1P91A 2YV2A 4MV7A 3UBTA 3ZVNA 1SOMA 2XUIA 1Z7WA 2FB0A 2OJ3A 5EMNA 1UK8A 4A5SA 1EVEA 2WSSA 5FNVB 1DBIA 1YR3A 4E30A 2V98A 1RRPA 1O89A 2KHDA 3OIUA 4I1YA 2PKWA 3OWXA 2PFGA 2DHCA 2F2TA 4FJ0A 2ZRKA 4RE6A 3JS9A 2CQHA 2NQTA 3NAIA 4LOKA 1XNHA 5DHFA 1UQUA 3IR7B 4ACBA 1I7QB 3HKCB 5EWFA 5JD4A 3EZUA 2EWHA 3K3PA 1M83A 4P75A 2HBRB 2NSLA 3GIWA 1HE8B 5FXMA 4XWAA 1U6KA 3T8YA 4A8WA 2UZAA 3H87A 2BZGA 2DFPA 2IXFA 3PSAA 5KFBA 2X1AA 3PNKA 1BSVA 1F9HA 3TVKA 3W5ZA 2XUGA 3AR5A 5A0TA 4P74A 4FFDA 4NDAA 1PBUA 2D74A 3F5FA 3QOWA 4PZVA 5BWOA 1LC3A 1ZKDA 4G2NA 2WHEA 3LH2S 4CZCA 4OQXA 2P0AA 3Q3JB 4Y2JA 3FRYA 5HGXA 1IRXA 1U9CA 3THVA 4UJ5A 2DGSA 1MJFA 3EUAA 4UXHA 2IK8A 3GJRA 1YJAA 1SG0A 2OL4A 5COAA 4P2MA 1EBUA 3P9PA 1VQ8S 1YB1A 4WHMA 4IRMA 1ZL2A 2CJBA 1PSWA 3PJEA 3G6YA 4R2JA 4ISCA 1ORDA 3DWIA 3VPGA 1KAGA 2Q3EA 5I9NA 4ZEXA 4X8HA 3ZJYA 1ULSA 2QJFA 4A2CA 3KQOA 4HWPA 2NREA 2OELA 5CD9A 4XSVA 2XLIA 4WGFA 4YCMA 4DXAA 1U24A 3P4XA 3CRVA 3QG1A 5I8WA 5IJZA 2B43A 1OJ4A 5DEIA 4YDXA 3O8OA 1ZZGA 3PV8A 1HZZA 4NQZA 4HAYA 3PRKE 4XIYA 5I9MA 2QM0A 1YJCA 4B3SF 1HWIA 4UUAA 2HZCA 3SSRA 1Q15A 3NBAA 4KDRA 1U4SA 2AIRA 4CLKA 1PD1A 4BP3A 2QFIA 2Y1DA 1MV5A 4JI4J 4YJHA 4ALJA 1T8PA 2ZRAA 4TU7A 3HCDA 1AA1B 1PR9A 4YP3A 3P2EA 3ZV6A 1GPNA 1OYWA 3A3PB 4XVCA 4Q39A 4PY2A 4J2HA 1TELA 3HBMA 1ZD5A 1R6AA 4Q21A 3JASA 4UUMA 1KLNA 5ETRA 4LTNA 5AVQA 3ZIUA 2NU8A 5CYQB 3ONEA 2XCUA 5FOQA 5CTAA 2OSQA 2HIQA 2Q5JA 1UDBA 4ZLPA 2CFIA 2EWWA 1X7ZA 3L77A 3WGOA 2N1BA 2X5OA 2I2AA 3A1DA 2H5JB 3J80U 2H2WA 2QEXS 2RT3A 1YR8A 4B3SJ 5JCPA 3I39X 4YRMA 2Q79A 1K73T 2FW9A 1KVUA 5AUPB 1DCFA 2AX0A 4MIYA 3CB2A 4LF4F 1L7NA 1QG4A 2ATLA 3RSQA 1SA0B 5LQUA 2A10A 1KK2A 3TEGA 4X6LA 4JR2A 3FNIA 2JBAA 1HRKA 2WC1A 1PV2A 3WLIA 2UXBF 1DLOA 1C9EA 4XAKA 2I6SA 3VPCA 1AQYA 1B6SA 4UVIA 4Q0MA 3B3JA 4D98A 3C4VA 3RAGA 3F1KA 4GC7A 2APOA </