4B23A

Unprecedented sculpting of dna at abasic sites by dna glycosylase homolog mag2
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
206
structure length
206
Chain Sequence
KDSDYKRAEKHLSSIDNKWSSLVKKVGPCTLTPHPEHAPYEGIIRAITSQKLSDAATNSIINKFCTQCSDNDEFPTPKQIMETDVETLHECGFSKLKSQEIHIVAEAALNKQIPSKSEIEKMSEEELMESLSKIKGVKRWTIEMYSIFTLGRLDIMPADDSTLKNEAKEFFGLSSKPQTEEVEKLTKPCKPYRTIAAWYLWQIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAG2, DNA-3-METHYLADENINE GLYCOSYLASE 2
publication title Sculpting of DNA at Abasic Sites by DNA Glycosylase Homolog Mag2.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase/dna
total genus 75
structure length 206
sequence length 206
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2012-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4b23A02
1.10.1670.40 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 4b23A01
1YQRA 3I0XA 1KG7A 1MUNA 2NOBA 1PU7A 4E9HA 5CHZA 1FN7A 3I0WA 2ABKA 1RRSA 3G0QA 1YQLA 3OH9A 4YPHA 1KEAA 1LWYA 2I5WA 3S6IA 5KN9A 4AI5A 1HU0A 4EJYA 3OH6A 1N39A 1KG6A 2NOIA 1XQPA 4YOQA 1M3HA 1LWVA 3FHFA 1NGNA 5AN4A 1PU6A 2OFKA 4B23A 1XG7A 2JG6A 1LMZA 3FSPA 3F0ZA 1LWWA 1YQKA 1N3CA 2H56A 4YPRA 1PVSA 3F10A 2YG9A 3CWUA 1KO9A 4AIAA 3CWSA 1KG3A 4AI4A 1KG5A 1RRQA 2NOLA 3N0UA 3D4VA 1XQOA 4OFEA 3FHGA 4PIIA 4E9EA 5KN8A 3CVSA 1YQMA 1KG4A 1EBMA 2NOFA 4EW0A 3CWAA 4DK9A 3KTUA 4OFHA 3CVTA 4E9GA 4B24A 1WEFA 3OGDA 4EJZA 1MPGA 4B22A 1NKUA 1PU8A 2OFIA 1WEGA 1P7MA 5DPKA 1KG2A 1KQJA 2JHNA 2NOZA 1ORPA 1MUYA 1WEIA 3IHOA 2NOHA 2YG8A 4UOBA 2JHJA 1M3QA 1N3AA 4EA4A 2XHIA 1MUDA 4B21A 1ORNA 1DIZA 1P59A 4UNFA 4EA5A 4HSBA 4OFAA 4EW4A 4E9FA 3N5NX 3CW7A 3CWTA 1VRLA 3KNTA 3IH7A 2NOEA 4EVVA
chains in the Genus database with same CATH superfamily
1YQRA 5FROA 3I0XA 1KG7A 1MUNA 2W03A 2NOBA 1PU7A 4E9HA 5CHZA 4BE0A 3OYAA 1FN7A 3I0WA 2ABKA 1RRSA 4BDYA 4NZGA 3G0QA 1YQLA 3OH9A 4E7IA 3L2UA 4YPHA 1KEAA 1LWYA 2I5WA 5FRNA 3OYKA 5KN9A 3S6IA 4AI5A 4BE2A 1HU0A 4EJYA 3OH6A 3OYGA 3OYIA 4E7KA 3S3NA 1KG6A 1N39A 2NOIA 1XQPA 4YOQA 1M3HA 1LWVA 3NNQA 3L2VA 3OYDA 5FRMA 3FHFA 3OYMA 1NGNA 3OYNA 3OYHA 5AN4A 1PU6A 4ZTFA 2OFKA 4B23A 1XG7A 2JG6A 3S3MA 1LMZA 3LCNA 3FSPA 3F0ZA 2W04A 1LWWA 1YQKA 1N3CA 2H56A 4YPRA 4BE1A 1PVSA 3F10A 2YG9A 4BDZA 3CWUA 1KO9A 4AIAA 3CWSA 1KG3A 4AI4A 1KG5A 1RRQA 2NOLA 3VW4A 3OS0A 3N0UA 3D4VA 3OYEA 1XQOA 4OFEA 3FHGA 4PIIA 4E9EA 5KN8A 3CVSA 1YQMA 1KG4A 3OYLA 1EBMA 2NOFA 4EW0A 3CWAA 4DK9A 3L2RA 3KTUA 4OFHA 3CVTA 4E9GA 4BACA 4B24A 1WEFA 4ZTJA 3OYJA 3OGDA 4EJZA 1U84A 1MPGA 4E7LA 4B22A 3OYFA 4E7HA 1NKUA 1PU8A 2OFIA 3OS2A 1WEGA 1P7MA 5DPKA 1KG2A 1KQJA 2JHNA 2NOZA 1ORPA 1MUYA 2V75A 1WEIA 3IHOA 2NOHA 2YG8A 3R2XC 4UOBA 2JHJA 3L2QA 3OS1A 1M3QA 1N3AA 4EA4A 2XHIA 3OYCA 1MUDA 3OY9A 4B21A 2JPSA 1ORNA 1DIZA 1P59A 3OYBA 4UNFA 4EA5A 4HSBA 4OFAA 4EW4A 4E9FA 3N5NX 3CW7A 3CWTA 1VRLA 3S3OA 3KNTA 4E7JA 3IH7A 3L2WA 2NOEA 4IKFA 4EVVA
chains in the Genus database with same CATH topology
1YQRA 3I0XA 1KG7A 1MUNA 2NOBA 1PU7A 4E9HA 5CHZA 1FN7A 3I0WA 2ABKA 1RRSA 3G0QA 1YQLA 3OH9A 4YPHA 1KEAA 1LWYA 2I5WA 3S6IA 5KN9A 4AI5A 1HU0A 4EJYA 3OH6A 1N39A 1KG6A 2NOIA 1XQPA 4YOQA 1M3HA 1LWVA 3FHFA 1NGNA 5AN4A 1PU6A 2OFKA 4B23A 1XG7A 2JG6A 1LMZA 3FSPA 3F0ZA 1LWWA 1YQKA 1N3CA 2H56A 4YPRA 1PVSA 3F10A 2YG9A 3CWUA 1KO9A 4AIAA 3CWSA 1KG3A 4AI4A 1KG5A 1RRQA 2NOLA 3N0UA 3D4VA 1XQOA 4OFEA 3FHGA 4PIIA 4E9EA 5KN8A 3CVSA 1YQMA 1KG4A 1EBMA 2NOFA 4EW0A 3CWAA 4DK9A 3KTUA 4OFHA 3CVTA 4E9GA 4B24A 1WEFA 3OGDA 4EJZA 1MPGA 4B22A 1NKUA 1PU8A 2OFIA 1WEGA 1P7MA 5DPKA 1KG2A 1KQJA 2JHNA 2NOZA 1ORPA 1MUYA 1WEIA 3IHOA 2NOHA 2YG8A 4UOBA 2JHJA 1M3QA 1N3AA 4EA4A 2XHIA 1MUDA 4B21A 1ORNA 1DIZA 1P59A 4UNFA 4EA5A 4HSBA 4OFAA 4EW4A 4E9FA 3N5NX 3CW7A 3CWTA 1VRLA 3KNTA 3IH7A 2NOEA 4EVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQR A;  3I0X A;  1KG7 A;  1MUN A;  2NOB A;  1PU7 A;  4E9H A;  5CHZ A;  1FN7 A;  3I0W A;  2ABK A;  1RRS A;  3G0Q A;  1YQL A;  3OH9 A;  4YPH A;  1KEA A;  1LWY A;  2I5W A;  3S6I A;  5KN9 A;  4AI5 A;  1HU0 A;  4EJY A;  3OH6 A;  1N39 A;  1KG6 A;  2NOI A;  1XQP A;  4YOQ A;  1M3H A;  1LWV A;  3FHF A;  1NGN A;  5AN4 A;  1PU6 A;  2OFK A;  4B23 A;  1XG7 A;  2JG6 A;  1LMZ A;  3FSP A;  3F0Z A;  1LWW A;  1YQK A;  1N3C A;  2H56 A;  4YPR A;  1PVS A;  3F10 A;  2YG9 A;  3CWU A;  1KO9 A;  4AIA A;  3CWS A;  1KG3 A;  4AI4 A;  1KG5 A;  1RRQ A;  2NOL A;  3N0U A;  3D4V A;  1XQO A;  4OFE A;  3FHG A;  4PII A;  4E9E A;  5KN8 A;  3CVS A;  1YQM A;  1KG4 A;  1EBM A;  2NOF A;  4EW0 A;  3CWA A;  4DK9 A;  3KTU A;  4OFH A;  3CVT A;  4E9G A;  4B24 A;  1WEF A;  3OGD A;  4EJZ A;  1MPG A;  4B22 A;  1NKU A;  1PU8 A;  2OFI A;  1WEG A;  1P7M A;  5DPK A;  1KG2 A;  1KQJ A;  2JHN A;  2NOZ A;  1ORP A;  1MUY A;  1WEI A;  3IHO A;  2NOH A;  2YG8 A;  4UOB A;  2JHJ A;  1M3Q A;  1N3A A;  4EA4 A;  2XHI A;  1MUD A;  4B21 A;  1ORN A;  1DIZ A;  1P59 A;  4UNF A;  4EA5 A;  4HSB A;  4OFA A;  4EW4 A;  4E9F A;  3N5N X;  3CW7 A;  3CWT A;  1VRL A;  3KNT A;  3IH7 A;  2NOE A;  4EVV A; 
#chains in the Genus database with same CATH topology
 1YQR A;  5FRO A;  3I0X A;  1KG7 A;  1MUN A;  2W03 A;  2NOB A;  1PU7 A;  4E9H A;  5CHZ A;  4BE0 A;  3OYA A;  1FN7 A;  3I0W A;  2ABK A;  1RRS A;  4BDY A;  4NZG A;  3G0Q A;  1YQL A;  3OH9 A;  4E7I A;  3L2U A;  4YPH A;  1KEA A;  1LWY A;  2I5W A;  5FRN A;  3OYK A;  5KN9 A;  3S6I A;  4AI5 A;  4BE2 A;  1HU0 A;  4EJY A;  3OH6 A;  3OYG A;  3OYI A;  4E7K A;  3S3N A;  1KG6 A;  1N39 A;  2NOI A;  1XQP A;  4YOQ A;  1M3H A;  1LWV A;  3NNQ A;  3L2V A;  3OYD A;  5FRM A;  3FHF A;  3OYM A;  1NGN A;  3OYN A;  3OYH A;  5AN4 A;  1PU6 A;  4ZTF A;  2OFK A;  4B23 A;  1XG7 A;  2JG6 A;  3S3M A;  1LMZ A;  3LCN A;  3FSP A;  3F0Z A;  2W04 A;  1LWW A;  1YQK A;  1N3C A;  2H56 A;  4YPR A;  4BE1 A;  1PVS A;  3F10 A;  2YG9 A;  4BDZ A;  3CWU A;  1KO9 A;  4AIA A;  3CWS A;  1KG3 A;  4AI4 A;  1KG5 A;  1RRQ A;  2NOL A;  3VW4 A;  3OS0 A;  3N0U A;  3D4V A;  3OYE A;  1XQO A;  4OFE A;  3FHG A;  4PII A;  4E9E A;  5KN8 A;  3CVS A;  1YQM A;  1KG4 A;  3OYL A;  1EBM A;  2NOF A;  4EW0 A;  3CWA A;  4DK9 A;  3L2R A;  3KTU A;  4OFH A;  3CVT A;  4E9G A;  4BAC A;  4B24 A;  1WEF A;  4ZTJ A;  3OYJ A;  3OGD A;  4EJZ A;  1U84 A;  1MPG A;  4E7L A;  4B22 A;  3OYF A;  4E7H A;  1NKU A;  1PU8 A;  2OFI A;  3OS2 A;  1WEG A;  1P7M A;  5DPK A;  1KG2 A;  1KQJ A;  2JHN A;  2NOZ A;  1ORP A;  1MUY A;  2V75 A;  1WEI A;  3IHO A;  2NOH A;  2YG8 A;  3R2X C;  4UOB A;  2JHJ A;  3L2Q A;  3OS1 A;  1M3Q A;  1N3A A;  4EA4 A;  2XHI A;  3OYC A;  1MUD A;  3OY9 A;  4B21 A;  2JPS A;  1ORN A;  1DIZ A;  1P59 A;  3OYB A;  4UNF A;  4EA5 A;  4HSB A;  4OFA A;  4EW4 A;  4E9F A;  3N5N X;  3CW7 A;  3CWT A;  1VRL A;  3S3O A;  3KNT A;  4E7J A;  3IH7 A;  3L2W A;  2NOE A;  4IKF A;  4EVV A; 
#chains in the Genus database with same CATH homology
 1YQR A;  3I0X A;  1KG7 A;  1MUN A;  2NOB A;  1PU7 A;  4E9H A;  5CHZ A;  1FN7 A;  3I0W A;  2ABK A;  1RRS A;  3G0Q A;  1YQL A;  3OH9 A;  4YPH A;  1KEA A;  1LWY A;  2I5W A;  3S6I A;  5KN9 A;  4AI5 A;  1HU0 A;  4EJY A;  3OH6 A;  1N39 A;  1KG6 A;  2NOI A;  1XQP A;  4YOQ A;  1M3H A;  1LWV A;  3FHF A;  1NGN A;  5AN4 A;  1PU6 A;  2OFK A;  4B23 A;  1XG7 A;  2JG6 A;  1LMZ A;  3FSP A;  3F0Z A;  1LWW A;  1YQK A;  1N3C A;  2H56 A;  4YPR A;  1PVS A;  3F10 A;  2YG9 A;  3CWU A;  1KO9 A;  4AIA A;  3CWS A;  1KG3 A;  4AI4 A;  1KG5 A;  1RRQ A;  2NOL A;  3N0U A;  3D4V A;  1XQO A;  4OFE A;  3FHG A;  4PII A;  4E9E A;  5KN8 A;  3CVS A;  1YQM A;  1KG4 A;  1EBM A;  2NOF A;  4EW0 A;  3CWA A;  4DK9 A;  3KTU A;  4OFH A;  3CVT A;  4E9G A;  4B24 A;  1WEF A;  3OGD A;  4EJZ A;  1MPG A;  4B22 A;  1NKU A;  1PU8 A;  2OFI A;  1WEG A;  1P7M A;  5DPK A;  1KG2 A;  1KQJ A;  2JHN A;  2NOZ A;  1ORP A;  1MUY A;  1WEI A;  3IHO A;  2NOH A;  2YG8 A;  4UOB A;  2JHJ A;  1M3Q A;  1N3A A;  4EA4 A;  2XHI A;  1MUD A;  4B21 A;  1ORN A;  1DIZ A;  1P59 A;  4UNF A;  4EA5 A;  4HSB A;  4OFA A;  4EW4 A;  4E9F A;  3N5N X;  3CW7 A;  3CWT A;  1VRL A;  3KNT A;  3IH7 A;  2NOE A;  4EVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...