4B23A

Unprecedented sculpting of dna at abasic sites by dna glycosylase homolog mag2
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
206
structure length
206
Chain Sequence
KDSDYKRAEKHLSSIDNKWSSLVKKVGPCTLTPHPEHAPYEGIIRAITSQKLSDAATNSIINKFCTQCSDNDEFPTPKQIMETDVETLHECGFSKLKSQEIHIVAEAALNKQIPSKSEIEKMSEEELMESLSKIKGVKRWTIEMYSIFTLGRLDIMPADDSTLKNEAKEFFGLSSKPQTEEVEKLTKPCKPYRTIAAWYLWQIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sculpting of DNA at Abasic Sites by DNA Glycosylase Homolog Mag2.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase/dna
molecule keywords MAG2, DNA-3-METHYLADENINE GLYCOSYLASE 2
total genus 75
structure length 206
sequence length 206
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2012-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4b23A02
1.10.1670.40 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 4b23A01
4AIAA 1NKUA 3IH7A 1VRLA 4DK9A 4EW0A 1DIZA 3CW7A 4YPRA 1KG5A 1MPGA 1KO9A 2ABKA 4E9GA 2NOBA 4UOBA 1PU6A 3D4VA 1MUDA 1KEAA 3I0XA 4EA5A 4EJYA 1HU0A 5AN4A 3I0WA 1ORPA 2NOHA 3CWUA 1XG7A 2H56A 4B24A 1KG7A 3N0UA 1M3QA 3CWAA 4AI4A 5KN8A 5CHZA 1LWYA 3OH9A 4UNFA 4E9EA 1EBMA 4B23A 4E9HA 4E9FA 1MUYA 1N3CA 1PVSA 3CWTA 1WEFA 1RRSA 2NOIA 1P7MA 5KN9A 3CVSA 3FHFA 1N39A 3IHOA 4HSBA 3KNTA 4EJZA 1WEIA 4PIIA 3OGDA 2NOEA 1KG6A 1LMZA 1P59A 1YQKA 1YQMA 4YPHA 1ORNA 2YG9A 2I5WA 2YG8A 2JHJA 1KG4A 5DPKA 1PU8A 4YOQA 4B22A 1LWWA 3CVTA 2NOLA 1N3AA 4EVVA 4AI5A 1XQOA 1XQPA 2XHIA 3FHGA 2JG6A 3G0QA 1MUNA 1KG2A 3OH6A 4EA4A 1YQRA 4EW4A 2JHNA 2NOFA 1KG3A 1M3HA 2NOZA 1WEGA 3N5NX 3KTUA 4OFAA 3S6IA 2OFIA 3F10A 1KQJA 1LWVA 3FSPA 4OFHA 1FN7A 4OFEA 3CWSA 2OFKA 4B21A 1YQLA 3F0ZA 1RRQA 1NGNA 1PU7A
chains in the Genus database with same CATH superfamily
3OYKA 4AIAA 1NKUA 3IH7A 1VRLA 4DK9A 4EW0A 1DIZA 3CW7A 4YPRA 1KG5A 1MPGA 4IKFA 4BE0A 1KO9A 3S3OA 4ZTFA 2ABKA 4E9GA 2NOBA 2JPSA 4UOBA 3L2VA 1PU6A 3D4VA 1MUDA 1KEAA 3I0XA 4EA5A 4BDYA 4EJYA 3OYDA 5FROA 1HU0A 5AN4A 3I0WA 1ORPA 2NOHA 3CWUA 2V75A 1XG7A 5FRMA 2H56A 4B24A 1KG7A 3N0UA 4BDZA 1M3QA 3CWAA 4AI4A 5KN8A 5CHZA 1LWYA 3OH9A 3OYHA 4UNFA 4E9EA 4E7JA 1EBMA 4B23A 4E9HA 4E9FA 3OS2A 1MUYA 1N3CA 1PVSA 3CWTA 3S3NA 1WEFA 1RRSA 2NOIA 3L2WA 1P7MA 5KN9A 3OYNA 3CVSA 3FHFA 4BACA 1N39A 3IHOA 2W03A 3R2XC 4HSBA 3KNTA 4EJZA 1WEIA 4PIIA 3OGDA 2NOEA 3OYCA 1KG6A 1LMZA 3L2RA 1YQKA 1YQMA 3L2UA 1P59A 4YPHA 1ORNA 2YG9A 2I5WA 1U84A 2YG8A 2JHJA 3OS0A 1KG4A 3OS1A 2W04A 5DPKA 3OYJA 4E7IA 1PU8A 3OYIA 3OYAA 3S3MA 4YOQA 4B22A 1LWWA 3CVTA 2NOLA 1N3AA 4EVVA 4AI5A 1XQOA 1XQPA 3L2QA 4NZGA 2XHIA 3FHGA 4E7LA 2JG6A 3G0QA 1MUNA 1KG2A 3VW4A 3OH6A 4BE2A 4EA4A 4ZTJA 1YQRA 4EW4A 2JHNA 3OYBA 2NOFA 1KG3A 1M3HA 2NOZA 1WEGA 3N5NX 3OYMA 3OYGA 3KTUA 4OFAA 5FRNA 3S6IA 2OFIA 3F10A 1KQJA 3OYLA 4BE1A 1LWVA 3FSPA 4OFHA 4E7KA 1FN7A 4OFEA 3CWSA 3OY9A 2OFKA 3LCNA 4E7HA 4B21A 1YQLA 3F0ZA 3OYEA 1RRQA 3OYFA 3NNQA 1NGNA 1PU7A
chains in the Genus database with same CATH topology
4AIAA 1NKUA 3IH7A 1VRLA 4DK9A 4EW0A 1DIZA 3CW7A 4YPRA 1KG5A 1MPGA 1KO9A 2ABKA 4E9GA 2NOBA 4UOBA 1PU6A 3D4VA 1MUDA 1KEAA 3I0XA 4EA5A 4EJYA 1HU0A 5AN4A 3I0WA 1ORPA 2NOHA 3CWUA 1XG7A 2H56A 4B24A 1KG7A 3N0UA 1M3QA 3CWAA 4AI4A 5KN8A 5CHZA 1LWYA 3OH9A 4UNFA 4E9EA 1EBMA 4B23A 4E9HA 4E9FA 1MUYA 1N3CA 1PVSA 3CWTA 1WEFA 1RRSA 2NOIA 1P7MA 5KN9A 3CVSA 3FHFA 1N39A 3IHOA 4HSBA 3KNTA 4EJZA 1WEIA 4PIIA 3OGDA 2NOEA 1KG6A 1LMZA 1P59A 1YQKA 1YQMA 4YPHA 1ORNA 2YG9A 2I5WA 2YG8A 2JHJA 1KG4A 5DPKA 1PU8A 4YOQA 4B22A 1LWWA 3CVTA 2NOLA 1N3AA 4EVVA 4AI5A 1XQOA 1XQPA 2XHIA 3FHGA 2JG6A 3G0QA 1MUNA 1KG2A 3OH6A 4EA4A 1YQRA 4EW4A 2JHNA 2NOFA 1KG3A 1M3HA 2NOZA 1WEGA 3N5NX 3KTUA 4OFAA 3S6IA 2OFIA 3F10A 1KQJA 1LWVA 3FSPA 4OFHA 1FN7A 4OFEA 3CWSA 2OFKA 4B21A 1YQLA 3F0ZA 1RRQA 1NGNA 1PU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AIA A;  1NKU A;  3IH7 A;  1VRL A;  4DK9 A;  4EW0 A;  1DIZ A;  3CW7 A;  4YPR A;  1KG5 A;  1MPG A;  1KO9 A;  2ABK A;  4E9G A;  2NOB A;  4UOB A;  1PU6 A;  3D4V A;  1MUD A;  1KEA A;  3I0X A;  4EA5 A;  4EJY A;  1HU0 A;  5AN4 A;  3I0W A;  1ORP A;  2NOH A;  3CWU A;  1XG7 A;  2H56 A;  4B24 A;  1KG7 A;  3N0U A;  1M3Q A;  3CWA A;  4AI4 A;  5KN8 A;  5CHZ A;  1LWY A;  3OH9 A;  4UNF A;  4E9E A;  1EBM A;  4B23 A;  4E9H A;  4E9F A;  1MUY A;  1N3C A;  1PVS A;  3CWT A;  1WEF A;  1RRS A;  2NOI A;  1P7M A;  5KN9 A;  3CVS A;  3FHF A;  1N39 A;  3IHO A;  4HSB A;  3KNT A;  4EJZ A;  1WEI A;  4PII A;  3OGD A;  2NOE A;  1KG6 A;  1LMZ A;  1P59 A;  1YQK A;  1YQM A;  4YPH A;  1ORN A;  2YG9 A;  2I5W A;  2YG8 A;  2JHJ A;  1KG4 A;  5DPK A;  1PU8 A;  4YOQ A;  4B22 A;  1LWW A;  3CVT A;  2NOL A;  1N3A A;  4EVV A;  4AI5 A;  1XQO A;  1XQP A;  2XHI A;  3FHG A;  2JG6 A;  3G0Q A;  1MUN A;  1KG2 A;  3OH6 A;  4EA4 A;  1YQR A;  4EW4 A;  2JHN A;  2NOF A;  1KG3 A;  1M3H A;  2NOZ A;  1WEG A;  3N5N X;  3KTU A;  4OFA A;  3S6I A;  2OFI A;  3F10 A;  1KQJ A;  1LWV A;  3FSP A;  4OFH A;  1FN7 A;  4OFE A;  3CWS A;  2OFK A;  4B21 A;  1YQL A;  3F0Z A;  1RRQ A;  1NGN A;  1PU7 A; 
#chains in the Genus database with same CATH topology
 3OYK A;  4AIA A;  1NKU A;  3IH7 A;  1VRL A;  4DK9 A;  4EW0 A;  1DIZ A;  3CW7 A;  4YPR A;  1KG5 A;  1MPG A;  4IKF A;  4BE0 A;  1KO9 A;  3S3O A;  4ZTF A;  2ABK A;  4E9G A;  2NOB A;  2JPS A;  4UOB A;  3L2V A;  1PU6 A;  3D4V A;  1MUD A;  1KEA A;  3I0X A;  4EA5 A;  4BDY A;  4EJY A;  3OYD A;  5FRO A;  1HU0 A;  5AN4 A;  3I0W A;  1ORP A;  2NOH A;  3CWU A;  2V75 A;  1XG7 A;  5FRM A;  2H56 A;  4B24 A;  1KG7 A;  3N0U A;  4BDZ A;  1M3Q A;  3CWA A;  4AI4 A;  5KN8 A;  5CHZ A;  1LWY A;  3OH9 A;  3OYH A;  4UNF A;  4E9E A;  4E7J A;  1EBM A;  4B23 A;  4E9H A;  4E9F A;  3OS2 A;  1MUY A;  1N3C A;  1PVS A;  3CWT A;  3S3N A;  1WEF A;  1RRS A;  2NOI A;  3L2W A;  1P7M A;  5KN9 A;  3OYN A;  3CVS A;  3FHF A;  4BAC A;  1N39 A;  3IHO A;  2W03 A;  3R2X C;  4HSB A;  3KNT A;  4EJZ A;  1WEI A;  4PII A;  3OGD A;  2NOE A;  3OYC A;  1KG6 A;  1LMZ A;  3L2R A;  1YQK A;  1YQM A;  3L2U A;  1P59 A;  4YPH A;  1ORN A;  2YG9 A;  2I5W A;  1U84 A;  2YG8 A;  2JHJ A;  3OS0 A;  1KG4 A;  3OS1 A;  2W04 A;  5DPK A;  3OYJ A;  4E7I A;  1PU8 A;  3OYI A;  3OYA A;  3S3M A;  4YOQ A;  4B22 A;  1LWW A;  3CVT A;  2NOL A;  1N3A A;  4EVV A;  4AI5 A;  1XQO A;  1XQP A;  3L2Q A;  4NZG A;  2XHI A;  3FHG A;  4E7L A;  2JG6 A;  3G0Q A;  1MUN A;  1KG2 A;  3VW4 A;  3OH6 A;  4BE2 A;  4EA4 A;  4ZTJ A;  1YQR A;  4EW4 A;  2JHN A;  3OYB A;  2NOF A;  1KG3 A;  1M3H A;  2NOZ A;  1WEG A;  3N5N X;  3OYM A;  3OYG A;  3KTU A;  4OFA A;  5FRN A;  3S6I A;  2OFI A;  3F10 A;  1KQJ A;  3OYL A;  4BE1 A;  1LWV A;  3FSP A;  4OFH A;  4E7K A;  1FN7 A;  4OFE A;  3CWS A;  3OY9 A;  2OFK A;  3LCN A;  4E7H A;  4B21 A;  1YQL A;  3F0Z A;  3OYE A;  1RRQ A;  3OYF A;  3NNQ A;  1NGN A;  1PU7 A; 
#chains in the Genus database with same CATH homology
 4AIA A;  1NKU A;  3IH7 A;  1VRL A;  4DK9 A;  4EW0 A;  1DIZ A;  3CW7 A;  4YPR A;  1KG5 A;  1MPG A;  1KO9 A;  2ABK A;  4E9G A;  2NOB A;  4UOB A;  1PU6 A;  3D4V A;  1MUD A;  1KEA A;  3I0X A;  4EA5 A;  4EJY A;  1HU0 A;  5AN4 A;  3I0W A;  1ORP A;  2NOH A;  3CWU A;  1XG7 A;  2H56 A;  4B24 A;  1KG7 A;  3N0U A;  1M3Q A;  3CWA A;  4AI4 A;  5KN8 A;  5CHZ A;  1LWY A;  3OH9 A;  4UNF A;  4E9E A;  1EBM A;  4B23 A;  4E9H A;  4E9F A;  1MUY A;  1N3C A;  1PVS A;  3CWT A;  1WEF A;  1RRS A;  2NOI A;  1P7M A;  5KN9 A;  3CVS A;  3FHF A;  1N39 A;  3IHO A;  4HSB A;  3KNT A;  4EJZ A;  1WEI A;  4PII A;  3OGD A;  2NOE A;  1KG6 A;  1LMZ A;  1P59 A;  1YQK A;  1YQM A;  4YPH A;  1ORN A;  2YG9 A;  2I5W A;  2YG8 A;  2JHJ A;  1KG4 A;  5DPK A;  1PU8 A;  4YOQ A;  4B22 A;  1LWW A;  3CVT A;  2NOL A;  1N3A A;  4EVV A;  4AI5 A;  1XQO A;  1XQP A;  2XHI A;  3FHG A;  2JG6 A;  3G0Q A;  1MUN A;  1KG2 A;  3OH6 A;  4EA4 A;  1YQR A;  4EW4 A;  2JHN A;  2NOF A;  1KG3 A;  1M3H A;  2NOZ A;  1WEG A;  3N5N X;  3KTU A;  4OFA A;  3S6I A;  2OFI A;  3F10 A;  1KQJ A;  1LWV A;  3FSP A;  4OFH A;  1FN7 A;  4OFE A;  3CWS A;  2OFK A;  4B21 A;  1YQL A;  3F0Z A;  1RRQ A;  1NGN A;  1PU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...