4B23A

Unprecedented sculpting of dna at abasic sites by dna glycosylase homolog mag2
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
206
structure length
206
Chain Sequence
b'KDSDYKRAEKHLSSIDNKWSSLVKKVGPCTLTPHPEHAPYEGIIRAITSQKLSDAATNSIINKFCTQCSDNDEFPTPKQIMETDVETLHECGFSKLKSQEIHIVAEAALNKQIPSKSEIEKMSEEELMESLSKIKGVKRWTIEMYSIFTLGRLDIMPADDSTLKNEAKEFFGLSSKPQTEEVEKLTKPCKPYRTIAAWYLWQIPKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAG2, DNA-3-METHYLADENINE GLYCOSYLASE 2
publication title Sculpting of DNA at Abasic Sites by DNA Glycosylase Homolog Mag2.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase/dna
total genus 75
structure length 206
sequence length 206
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2012-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4b23A02
1.10.1670.40 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 4b23A01
4YPHA 1KG2A 3KNTA 1M3QA 1LWVA 1RRSA 1MUYA 1ORNA 1ORPA 1FN7A 1PU7A 4E9FA 4PIIA 1MUDA 1VRLA 2YG8A 4EJYA 3CVTA 2ABKA 1XQPA 1KG6A 1KG3A 2NOFA 2OFKA 4B21A 4B24A 1P59A 4DK9A 1YQMA 1YQLA 2NOEA 2JHNA 3CWTA 4B23A 3FHFA 1KO9A 4AIAA 1WEIA 4HSBA 3OH6A 1YQRA 3G0QA 3N0UA 2NOLA 3F10A 1WEGA 4YPRA 1KG7A 3CW7A 2XHIA 1LWYA 4B22A 1KG5A 2OFIA 4YOQA 3IHOA 2NOIA 1KEAA 1P7MA 4OFEA 1KQJA 1KG4A 5CHZA 1N3CA 4UOBA 4EW0A 1NGNA 3I0WA 4E9GA 1PVSA 2JG6A 1PU6A 3CWUA 2NOBA 4E9HA 3S6IA 2NOHA 5DPKA 3D4VA 3KTUA 1N3AA 5AN4A 3CWAA 1LWWA 4EA4A 1M3HA 4OFAA 3IH7A 4OFHA 5KN9A 4AI4A 1EBMA 1XQOA 4AI5A 2H56A 3OH9A 4EA5A 1DIZA 1PU8A 3FSPA 3OGDA 4EW4A 2NOZA 1YQKA 4UNFA 2JHJA 3I0XA 1NKUA 1XG7A 1HU0A 3FHGA 3N5NX 2I5WA 1LMZA 3F0ZA 1N39A 1RRQA 2YG9A 1MPGA 4EJZA 4E9EA 5KN8A 3CVSA 4EVVA 1WEFA 3CWSA 1MUNA
chains in the Genus database with same CATH superfamily
4YPHA 1KG2A 3KNTA 1M3QA 1LWVA 3OYMA 1RRSA 1MUYA 1ORNA 2W03A 4BDZA 1ORPA 1FN7A 1PU7A 4E9FA 4PIIA 1MUDA 5FROA 4BE2A 2YG8A 4BE0A 1VRLA 4EJYA 3CVTA 2ABKA 4BE1A 1XQPA 1KG6A 1KG3A 2NOFA 2OFKA 4B21A 4B24A 1P59A 3L2UA 4DK9A 1YQMA 1YQLA 2NOEA 2JHNA 4E7IA 3CWTA 2W04A 4B23A 3FHFA 3OS2A 1KO9A 1U84A 4AIAA 1WEIA 4HSBA 3OH6A 3OYEA 1YQRA 3G0QA 3N0UA 4BDYA 2NOLA 3F10A 2JPSA 1WEGA 3L2RA 4YPRA 1KG7A 4ZTFA 3CW7A 2XHIA 4E7JA 1LWYA 4B22A 1KG5A 3OYLA 3L2VA 3NNQA 2OFIA 4YOQA 4ZTJA 3IHOA 2NOIA 1KEAA 3OYAA 2V75A 1P7MA 4OFEA 1KQJA 1KG4A 5CHZA 1N3CA 4IKFA 4UOBA 4EW0A 3VW4A 1NGNA 3L2WA 3S3NA 5FRMA 3I0WA 4E9GA 3LCNA 1PVSA 3OYCA 3OS0A 3OYNA 4E7LA 2JG6A 3R2XC 3S3OA 1PU6A 3CWUA 2NOBA 4E9HA 4E7HA 3OYBA 3S6IA 2NOHA 5DPKA 3D4VA 3KTUA 1N3AA 3OYDA 4E7KA 5AN4A 3OYHA 3CWAA 4NZGA 4BACA 4EA4A 1M3HA 1LWWA 3L2QA 3OYJA 4OFAA 3IH7A 4OFHA 5FRNA 5KN9A 4AI4A 1EBMA 1XQOA 4AI5A 2H56A 3OH9A 4EA5A 1DIZA 1PU8A 3FSPA 3OGDA 4EW4A 2NOZA 1YQKA 3S3MA 3OYGA 4UNFA 2JHJA 3I0XA 1NKUA 1XG7A 3OY9A 3OYIA 1HU0A 3FHGA 3N5NX 3OYKA 2I5WA 1LMZA 3F0ZA 1N39A 1RRQA 2YG9A 1MPGA 4EJZA 4E9EA 5KN8A 3CVSA 4EVVA 1WEFA 3OS1A 3OYFA 3CWSA 1MUNA
chains in the Genus database with same CATH topology
4YPHA 1KG2A 3KNTA 1M3QA 1LWVA 1RRSA 1MUYA 1ORNA 1ORPA 1FN7A 1PU7A 4E9FA 4PIIA 1MUDA 1VRLA 2YG8A 4EJYA 3CVTA 2ABKA 1XQPA 1KG6A 1KG3A 2NOFA 2OFKA 4B21A 4B24A 1P59A 4DK9A 1YQMA 1YQLA 2NOEA 2JHNA 3CWTA 4B23A 3FHFA 1KO9A 4AIAA 1WEIA 4HSBA 3OH6A 1YQRA 3G0QA 3N0UA 2NOLA 3F10A 1WEGA 4YPRA 1KG7A 3CW7A 2XHIA 1LWYA 4B22A 1KG5A 2OFIA 4YOQA 3IHOA 2NOIA 1KEAA 1P7MA 4OFEA 1KQJA 1KG4A 5CHZA 1N3CA 4UOBA 4EW0A 1NGNA 3I0WA 4E9GA 1PVSA 2JG6A 1PU6A 3CWUA 2NOBA 4E9HA 3S6IA 2NOHA 5DPKA 3D4VA 3KTUA 1N3AA 5AN4A 3CWAA 1LWWA 4EA4A 1M3HA 4OFAA 3IH7A 4OFHA 5KN9A 4AI4A 1EBMA 1XQOA 4AI5A 2H56A 3OH9A 4EA5A 1DIZA 1PU8A 3FSPA 3OGDA 4EW4A 2NOZA 1YQKA 4UNFA 2JHJA 3I0XA 1NKUA 1XG7A 1HU0A 3FHGA 3N5NX 2I5WA 1LMZA 3F0ZA 1N39A 1RRQA 2YG9A 1MPGA 4EJZA 4E9EA 5KN8A 3CVSA 4EVVA 1WEFA 3CWSA 1MUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YPH A;  1KG2 A;  3KNT A;  1M3Q A;  1LWV A;  1RRS A;  1MUY A;  1ORN A;  1ORP A;  1FN7 A;  1PU7 A;  4E9F A;  4PII A;  1MUD A;  1VRL A;  2YG8 A;  4EJY A;  3CVT A;  2ABK A;  1XQP A;  1KG6 A;  1KG3 A;  2NOF A;  2OFK A;  4B21 A;  4B24 A;  1P59 A;  4DK9 A;  1YQM A;  1YQL A;  2NOE A;  2JHN A;  3CWT A;  4B23 A;  3FHF A;  1KO9 A;  4AIA A;  1WEI A;  4HSB A;  3OH6 A;  1YQR A;  3G0Q A;  3N0U A;  2NOL A;  3F10 A;  1WEG A;  4YPR A;  1KG7 A;  3CW7 A;  2XHI A;  1LWY A;  4B22 A;  1KG5 A;  2OFI A;  4YOQ A;  3IHO A;  2NOI A;  1KEA A;  1P7M A;  4OFE A;  1KQJ A;  1KG4 A;  5CHZ A;  1N3C A;  4UOB A;  4EW0 A;  1NGN A;  3I0W A;  4E9G A;  1PVS A;  2JG6 A;  1PU6 A;  3CWU A;  2NOB A;  4E9H A;  3S6I A;  2NOH A;  5DPK A;  3D4V A;  3KTU A;  1N3A A;  5AN4 A;  3CWA A;  1LWW A;  4EA4 A;  1M3H A;  4OFA A;  3IH7 A;  4OFH A;  5KN9 A;  4AI4 A;  1EBM A;  1XQO A;  4AI5 A;  2H56 A;  3OH9 A;  4EA5 A;  1DIZ A;  1PU8 A;  3FSP A;  3OGD A;  4EW4 A;  2NOZ A;  1YQK A;  4UNF A;  2JHJ A;  3I0X A;  1NKU A;  1XG7 A;  1HU0 A;  3FHG A;  3N5N X;  2I5W A;  1LMZ A;  3F0Z A;  1N39 A;  1RRQ A;  2YG9 A;  1MPG A;  4EJZ A;  4E9E A;  5KN8 A;  3CVS A;  4EVV A;  1WEF A;  3CWS A;  1MUN A; 
#chains in the Genus database with same CATH topology
 4YPH A;  1KG2 A;  3KNT A;  1M3Q A;  1LWV A;  3OYM A;  1RRS A;  1MUY A;  1ORN A;  2W03 A;  4BDZ A;  1ORP A;  1FN7 A;  1PU7 A;  4E9F A;  4PII A;  1MUD A;  5FRO A;  4BE2 A;  2YG8 A;  4BE0 A;  1VRL A;  4EJY A;  3CVT A;  2ABK A;  4BE1 A;  1XQP A;  1KG6 A;  1KG3 A;  2NOF A;  2OFK A;  4B21 A;  4B24 A;  1P59 A;  3L2U A;  4DK9 A;  1YQM A;  1YQL A;  2NOE A;  2JHN A;  4E7I A;  3CWT A;  2W04 A;  4B23 A;  3FHF A;  3OS2 A;  1KO9 A;  1U84 A;  4AIA A;  1WEI A;  4HSB A;  3OH6 A;  3OYE A;  1YQR A;  3G0Q A;  3N0U A;  4BDY A;  2NOL A;  3F10 A;  2JPS A;  1WEG A;  3L2R A;  4YPR A;  1KG7 A;  4ZTF A;  3CW7 A;  2XHI A;  4E7J A;  1LWY A;  4B22 A;  1KG5 A;  3OYL A;  3L2V A;  3NNQ A;  2OFI A;  4YOQ A;  4ZTJ A;  3IHO A;  2NOI A;  1KEA A;  3OYA A;  2V75 A;  1P7M A;  4OFE A;  1KQJ A;  1KG4 A;  5CHZ A;  1N3C A;  4IKF A;  4UOB A;  4EW0 A;  3VW4 A;  1NGN A;  3L2W A;  3S3N A;  5FRM A;  3I0W A;  4E9G A;  3LCN A;  1PVS A;  3OYC A;  3OS0 A;  3OYN A;  4E7L A;  2JG6 A;  3R2X C;  3S3O A;  1PU6 A;  3CWU A;  2NOB A;  4E9H A;  4E7H A;  3OYB A;  3S6I A;  2NOH A;  5DPK A;  3D4V A;  3KTU A;  1N3A A;  3OYD A;  4E7K A;  5AN4 A;  3OYH A;  3CWA A;  4NZG A;  4BAC A;  4EA4 A;  1M3H A;  1LWW A;  3L2Q A;  3OYJ A;  4OFA A;  3IH7 A;  4OFH A;  5FRN A;  5KN9 A;  4AI4 A;  1EBM A;  1XQO A;  4AI5 A;  2H56 A;  3OH9 A;  4EA5 A;  1DIZ A;  1PU8 A;  3FSP A;  3OGD A;  4EW4 A;  2NOZ A;  1YQK A;  3S3M A;  3OYG A;  4UNF A;  2JHJ A;  3I0X A;  1NKU A;  1XG7 A;  3OY9 A;  3OYI A;  1HU0 A;  3FHG A;  3N5N X;  3OYK A;  2I5W A;  1LMZ A;  3F0Z A;  1N39 A;  1RRQ A;  2YG9 A;  1MPG A;  4EJZ A;  4E9E A;  5KN8 A;  3CVS A;  4EVV A;  1WEF A;  3OS1 A;  3OYF A;  3CWS A;  1MUN A; 
#chains in the Genus database with same CATH homology
 4YPH A;  1KG2 A;  3KNT A;  1M3Q A;  1LWV A;  1RRS A;  1MUY A;  1ORN A;  1ORP A;  1FN7 A;  1PU7 A;  4E9F A;  4PII A;  1MUD A;  1VRL A;  2YG8 A;  4EJY A;  3CVT A;  2ABK A;  1XQP A;  1KG6 A;  1KG3 A;  2NOF A;  2OFK A;  4B21 A;  4B24 A;  1P59 A;  4DK9 A;  1YQM A;  1YQL A;  2NOE A;  2JHN A;  3CWT A;  4B23 A;  3FHF A;  1KO9 A;  4AIA A;  1WEI A;  4HSB A;  3OH6 A;  1YQR A;  3G0Q A;  3N0U A;  2NOL A;  3F10 A;  1WEG A;  4YPR A;  1KG7 A;  3CW7 A;  2XHI A;  1LWY A;  4B22 A;  1KG5 A;  2OFI A;  4YOQ A;  3IHO A;  2NOI A;  1KEA A;  1P7M A;  4OFE A;  1KQJ A;  1KG4 A;  5CHZ A;  1N3C A;  4UOB A;  4EW0 A;  1NGN A;  3I0W A;  4E9G A;  1PVS A;  2JG6 A;  1PU6 A;  3CWU A;  2NOB A;  4E9H A;  3S6I A;  2NOH A;  5DPK A;  3D4V A;  3KTU A;  1N3A A;  5AN4 A;  3CWA A;  1LWW A;  4EA4 A;  1M3H A;  4OFA A;  3IH7 A;  4OFH A;  5KN9 A;  4AI4 A;  1EBM A;  1XQO A;  4AI5 A;  2H56 A;  3OH9 A;  4EA5 A;  1DIZ A;  1PU8 A;  3FSP A;  3OGD A;  4EW4 A;  2NOZ A;  1YQK A;  4UNF A;  2JHJ A;  3I0X A;  1NKU A;  1XG7 A;  1HU0 A;  3FHG A;  3N5N X;  2I5W A;  1LMZ A;  3F0Z A;  1N39 A;  1RRQ A;  2YG9 A;  1MPG A;  4EJZ A;  4E9E A;  5KN8 A;  3CVS A;  4EVV A;  1WEF A;  3CWS A;  1MUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...