4B23A

Unprecedented sculpting of dna at abasic sites by dna glycosylase homolog mag2
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
206
structure length
206
Chain Sequence
KDSDYKRAEKHLSSIDNKWSSLVKKVGPCTLTPHPEHAPYEGIIRAITSQKLSDAATNSIINKFCTQCSDNDEFPTPKQIMETDVETLHECGFSKLKSQEIHIVAEAALNKQIPSKSEIEKMSEEELMESLSKIKGVKRWTIEMYSIFTLGRLDIMPADDSTLKNEAKEFFGLSSKPQTEEVEKLTKPCKPYRTIAAWYLWQIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAG2, DNA-3-METHYLADENINE GLYCOSYLASE 2
publication title Sculpting of DNA at Abasic Sites by DNA Glycosylase Homolog Mag2.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase/dna
total genus 75
structure length 206
sequence length 206
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2012-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4b23A02
1.10.1670.40 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 4b23A01
3FHGA 2JG6A 2XHIA 3D4VA 3KTUA 1P7MA 4B23A 1XG7A 4EA5A 1YQMA 1WEFA 3FSPA 1LWYA 2JHNA 2NOLA 4EJZA 4EA4A 3FHFA 5KN8A 2NOHA 1KG7A 3OH6A 4DK9A 5DPKA 3F0ZA 1EBMA 2I5WA 1WEIA 1YQRA 2NOFA 1ORNA 4E9FA 1PVSA 4OFEA 1MUYA 2OFKA 1XQOA 1LMZA 1PU7A 2H56A 3CWUA 1WEGA 4B21A 1LWWA 3F10A 4AIAA 5KN9A 4E9GA 1KQJA 3CVSA 1YQKA 4HSBA 3N5NX 4OFHA 3OGDA 2NOBA 3S6IA 1KG6A 2JHJA 2NOZA 1YQLA 3IH7A 1P59A 3G0QA 1ORPA 3CWTA 1KG5A 4YPRA 3OH9A 1N39A 4OFAA 1LWVA 1MPGA 1KG4A 1N3AA 1VRLA 3KNTA 1PU8A 1KO9A 1MUNA 4EW0A 1KG3A 1MUDA 3CWSA 2ABKA 4E9HA 2NOIA 2OFIA 5AN4A 4YOQA 1FN7A 4UNFA 2YG8A 4EW4A 1RRSA 3IHOA 2NOEA 4UOBA 4PIIA 4E9EA 1NKUA 1KEAA 1RRQA 2YG9A 3CVTA 1M3QA 1HU0A 1DIZA 4B22A 4AI4A 4EVVA 1NGNA 1KG2A 3CWAA 1M3HA 1N3CA 1XQPA 3N0UA 3I0XA 4AI5A 1PU6A 4YPHA 4EJYA 3CW7A 3I0WA 4B24A 5CHZA
chains in the Genus database with same CATH superfamily
3L2QA 3FHGA 3OYEA 2JG6A 2XHIA 3S3OA 3OYKA 3NNQA 3OS1A 3D4VA 3L2VA 5FRMA 3OYAA 3KTUA 4E7IA 1P7MA 4B23A 4ZTJA 1XG7A 4EA5A 1YQMA 3OYGA 1WEFA 3FSPA 1LWYA 2JHNA 2NOLA 4EJZA 2V75A 3L2UA 4EA4A 3L2RA 3FHFA 5KN8A 2NOHA 1KG7A 3OH6A 5FRNA 3LCNA 4DK9A 5DPKA 3F0ZA 1EBMA 2I5WA 1WEIA 1YQRA 2NOFA 1ORNA 4ZTFA 4E9FA 1PVSA 4BDZA 4OFEA 1MUYA 2OFKA 1XQOA 1LMZA 1PU7A 2H56A 4BE2A 3CWUA 1WEGA 4B21A 1LWWA 3F10A 2JPSA 4AIAA 5KN9A 4E9GA 1KQJA 3CVSA 1YQKA 4HSBA 4E7HA 4BDYA 4IKFA 3N5NX 4OFHA 3OGDA 2NOBA 3S6IA 4BE1A 1KG6A 2JHJA 2NOZA 1YQLA 3IH7A 5FROA 4E7LA 3S3MA 3OYMA 1P59A 3OYHA 3G0QA 1ORPA 3CWTA 1KG5A 3OYCA 4YPRA 4NZGA 3OH9A 1N39A 3OS2A 4OFAA 1LWVA 1MPGA 3OYJA 1KG4A 1N3AA 1VRLA 3KNTA 1PU8A 1KO9A 1MUNA 1U84A 3R2XC 4EW0A 1KG3A 1MUDA 3CWSA 2ABKA 4E9HA 4BACA 2OFIA 5AN4A 2NOIA 3S3NA 4YOQA 4BE0A 1FN7A 4UNFA 3OYIA 2YG8A 4EW4A 1RRSA 3IHOA 2NOEA 4UOBA 2W04A 4PIIA 4E9EA 1NKUA 3OYNA 4E7KA 1KEAA 1RRQA 2YG9A 3OYDA 3OYLA 3CVTA 1M3QA 1HU0A 1DIZA 3L2WA 4B22A 4AI4A 4EVVA 1NGNA 1KG2A 3OYBA 3CWAA 1M3HA 1N3CA 1XQPA 3N0UA 3OY9A 3OS0A 4AI5A 3I0XA 3VW4A 1PU6A 4E7JA 4YPHA 4EJYA 3CW7A 2W03A 3OYFA 3I0WA 4B24A 5CHZA
chains in the Genus database with same CATH topology
3FHGA 2JG6A 2XHIA 3D4VA 3KTUA 1P7MA 4B23A 1XG7A 4EA5A 1YQMA 1WEFA 3FSPA 1LWYA 2JHNA 2NOLA 4EJZA 4EA4A 3FHFA 5KN8A 2NOHA 1KG7A 3OH6A 4DK9A 5DPKA 3F0ZA 1EBMA 2I5WA 1WEIA 1YQRA 2NOFA 1ORNA 4E9FA 1PVSA 4OFEA 1MUYA 2OFKA 1XQOA 1LMZA 1PU7A 2H56A 3CWUA 1WEGA 4B21A 1LWWA 3F10A 4AIAA 5KN9A 4E9GA 1KQJA 3CVSA 1YQKA 4HSBA 3N5NX 4OFHA 3OGDA 2NOBA 3S6IA 1KG6A 2JHJA 2NOZA 1YQLA 3IH7A 1P59A 3G0QA 1ORPA 3CWTA 1KG5A 4YPRA 3OH9A 1N39A 4OFAA 1LWVA 1MPGA 1KG4A 1N3AA 1VRLA 3KNTA 1PU8A 1KO9A 1MUNA 4EW0A 1KG3A 1MUDA 3CWSA 2ABKA 4E9HA 2NOIA 2OFIA 5AN4A 4YOQA 1FN7A 4UNFA 2YG8A 4EW4A 1RRSA 3IHOA 2NOEA 4UOBA 4PIIA 4E9EA 1NKUA 1KEAA 1RRQA 2YG9A 3CVTA 1M3QA 1HU0A 1DIZA 4B22A 4AI4A 4EVVA 1NGNA 1KG2A 3CWAA 1M3HA 1N3CA 1XQPA 3N0UA 3I0XA 4AI5A 1PU6A 4YPHA 4EJYA 3CW7A 3I0WA 4B24A 5CHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FHG A;  2JG6 A;  2XHI A;  3D4V A;  3KTU A;  1P7M A;  4B23 A;  1XG7 A;  4EA5 A;  1YQM A;  1WEF A;  3FSP A;  1LWY A;  2JHN A;  2NOL A;  4EJZ A;  4EA4 A;  3FHF A;  5KN8 A;  2NOH A;  1KG7 A;  3OH6 A;  4DK9 A;  5DPK A;  3F0Z A;  1EBM A;  2I5W A;  1WEI A;  1YQR A;  2NOF A;  1ORN A;  4E9F A;  1PVS A;  4OFE A;  1MUY A;  2OFK A;  1XQO A;  1LMZ A;  1PU7 A;  2H56 A;  3CWU A;  1WEG A;  4B21 A;  1LWW A;  3F10 A;  4AIA A;  5KN9 A;  4E9G A;  1KQJ A;  3CVS A;  1YQK A;  4HSB A;  3N5N X;  4OFH A;  3OGD A;  2NOB A;  3S6I A;  1KG6 A;  2JHJ A;  2NOZ A;  1YQL A;  3IH7 A;  1P59 A;  3G0Q A;  1ORP A;  3CWT A;  1KG5 A;  4YPR A;  3OH9 A;  1N39 A;  4OFA A;  1LWV A;  1MPG A;  1KG4 A;  1N3A A;  1VRL A;  3KNT A;  1PU8 A;  1KO9 A;  1MUN A;  4EW0 A;  1KG3 A;  1MUD A;  3CWS A;  2ABK A;  4E9H A;  2NOI A;  2OFI A;  5AN4 A;  4YOQ A;  1FN7 A;  4UNF A;  2YG8 A;  4EW4 A;  1RRS A;  3IHO A;  2NOE A;  4UOB A;  4PII A;  4E9E A;  1NKU A;  1KEA A;  1RRQ A;  2YG9 A;  3CVT A;  1M3Q A;  1HU0 A;  1DIZ A;  4B22 A;  4AI4 A;  4EVV A;  1NGN A;  1KG2 A;  3CWA A;  1M3H A;  1N3C A;  1XQP A;  3N0U A;  3I0X A;  4AI5 A;  1PU6 A;  4YPH A;  4EJY A;  3CW7 A;  3I0W A;  4B24 A;  5CHZ A; 
#chains in the Genus database with same CATH topology
 3L2Q A;  3FHG A;  3OYE A;  2JG6 A;  2XHI A;  3S3O A;  3OYK A;  3NNQ A;  3OS1 A;  3D4V A;  3L2V A;  5FRM A;  3OYA A;  3KTU A;  4E7I A;  1P7M A;  4B23 A;  4ZTJ A;  1XG7 A;  4EA5 A;  1YQM A;  3OYG A;  1WEF A;  3FSP A;  1LWY A;  2JHN A;  2NOL A;  4EJZ A;  2V75 A;  3L2U A;  4EA4 A;  3L2R A;  3FHF A;  5KN8 A;  2NOH A;  1KG7 A;  3OH6 A;  5FRN A;  3LCN A;  4DK9 A;  5DPK A;  3F0Z A;  1EBM A;  2I5W A;  1WEI A;  1YQR A;  2NOF A;  1ORN A;  4ZTF A;  4E9F A;  1PVS A;  4BDZ A;  4OFE A;  1MUY A;  2OFK A;  1XQO A;  1LMZ A;  1PU7 A;  2H56 A;  4BE2 A;  3CWU A;  1WEG A;  4B21 A;  1LWW A;  3F10 A;  2JPS A;  4AIA A;  5KN9 A;  4E9G A;  1KQJ A;  3CVS A;  1YQK A;  4HSB A;  4E7H A;  4BDY A;  4IKF A;  3N5N X;  4OFH A;  3OGD A;  2NOB A;  3S6I A;  4BE1 A;  1KG6 A;  2JHJ A;  2NOZ A;  1YQL A;  3IH7 A;  5FRO A;  4E7L A;  3S3M A;  3OYM A;  1P59 A;  3OYH A;  3G0Q A;  1ORP A;  3CWT A;  1KG5 A;  3OYC A;  4YPR A;  4NZG A;  3OH9 A;  1N39 A;  3OS2 A;  4OFA A;  1LWV A;  1MPG A;  3OYJ A;  1KG4 A;  1N3A A;  1VRL A;  3KNT A;  1PU8 A;  1KO9 A;  1MUN A;  1U84 A;  3R2X C;  4EW0 A;  1KG3 A;  1MUD A;  3CWS A;  2ABK A;  4E9H A;  4BAC A;  2OFI A;  5AN4 A;  2NOI A;  3S3N A;  4YOQ A;  4BE0 A;  1FN7 A;  4UNF A;  3OYI A;  2YG8 A;  4EW4 A;  1RRS A;  3IHO A;  2NOE A;  4UOB A;  2W04 A;  4PII A;  4E9E A;  1NKU A;  3OYN A;  4E7K A;  1KEA A;  1RRQ A;  2YG9 A;  3OYD A;  3OYL A;  3CVT A;  1M3Q A;  1HU0 A;  1DIZ A;  3L2W A;  4B22 A;  4AI4 A;  4EVV A;  1NGN A;  1KG2 A;  3OYB A;  3CWA A;  1M3H A;  1N3C A;  1XQP A;  3N0U A;  3OY9 A;  3OS0 A;  4AI5 A;  3I0X A;  3VW4 A;  1PU6 A;  4E7J A;  4YPH A;  4EJY A;  3CW7 A;  2W03 A;  3OYF A;  3I0W A;  4B24 A;  5CHZ A; 
#chains in the Genus database with same CATH homology
 3FHG A;  2JG6 A;  2XHI A;  3D4V A;  3KTU A;  1P7M A;  4B23 A;  1XG7 A;  4EA5 A;  1YQM A;  1WEF A;  3FSP A;  1LWY A;  2JHN A;  2NOL A;  4EJZ A;  4EA4 A;  3FHF A;  5KN8 A;  2NOH A;  1KG7 A;  3OH6 A;  4DK9 A;  5DPK A;  3F0Z A;  1EBM A;  2I5W A;  1WEI A;  1YQR A;  2NOF A;  1ORN A;  4E9F A;  1PVS A;  4OFE A;  1MUY A;  2OFK A;  1XQO A;  1LMZ A;  1PU7 A;  2H56 A;  3CWU A;  1WEG A;  4B21 A;  1LWW A;  3F10 A;  4AIA A;  5KN9 A;  4E9G A;  1KQJ A;  3CVS A;  1YQK A;  4HSB A;  3N5N X;  4OFH A;  3OGD A;  2NOB A;  3S6I A;  1KG6 A;  2JHJ A;  2NOZ A;  1YQL A;  3IH7 A;  1P59 A;  3G0Q A;  1ORP A;  3CWT A;  1KG5 A;  4YPR A;  3OH9 A;  1N39 A;  4OFA A;  1LWV A;  1MPG A;  1KG4 A;  1N3A A;  1VRL A;  3KNT A;  1PU8 A;  1KO9 A;  1MUN A;  4EW0 A;  1KG3 A;  1MUD A;  3CWS A;  2ABK A;  4E9H A;  2NOI A;  2OFI A;  5AN4 A;  4YOQ A;  1FN7 A;  4UNF A;  2YG8 A;  4EW4 A;  1RRS A;  3IHO A;  2NOE A;  4UOB A;  4PII A;  4E9E A;  1NKU A;  1KEA A;  1RRQ A;  2YG9 A;  3CVT A;  1M3Q A;  1HU0 A;  1DIZ A;  4B22 A;  4AI4 A;  4EVV A;  1NGN A;  1KG2 A;  3CWA A;  1M3H A;  1N3C A;  1XQP A;  3N0U A;  3I0X A;  4AI5 A;  1PU6 A;  4YPH A;  4EJY A;  3CW7 A;  3I0W A;  4B24 A;  5CHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...