4B24A

Unprecedented sculpting of dna at abasic sites by dna glycosylase homolog mag2
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
206
structure length
206
Chain Sequence
KDSDYKRAEKHLSSIDNKWSSLVKKVGPCTLTPHPEHAPYEGIIRAITSQKLSDAATNSIINKFCTQCSDNDEFPTPKQIMETDVETLHECGFSKLKSQEIHIVAEAALNKQIPSKSEIEKMSEEELMESLSKIKGVKRWTIEMYSIFTLGRLDIMPADDSTLKNEAKEFFGLSSKPQTEEVEKLTKPCKPYRTIAAWYLWQIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE DNA-3-METHYLADENINE GLYCOSYLASE 2
publication title Sculpting of DNA at Abasic Sites by DNA Glycosylase Homolog Mag2.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase/dna
total genus 72
structure length 206
sequence length 206
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2012-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4b24A02
1.10.1670.40 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 4b24A01
1RRSA 4EW0A 1M3HA 3IH7A 3CVSA 5AN4A 3CWUA 1YQMA 4YOQA 1PU6A 3FSPA 2NOEA 1XQOA 2NOLA 1KG6A 3OH6A 2YG9A 2I5WA 1NGNA 4DK9A 2OFIA 4AIAA 4EA5A 1KG4A 4B21A 1EBMA 2NOZA 1KEAA 5KN9A 4OFEA 5CHZA 3I0WA 2OFKA 1N39A 4EVVA 1XQPA 4OFAA 1YQKA 4EJZA 3G0QA 3CWTA 4E9GA 1M3QA 1P59A 4UOBA 4B24A 1PU8A 4EJYA 2JHNA 3OH9A 1KG5A 1KG2A 4AI4A 1LMZA 1P7MA 1KQJA 2YG8A 1NKUA 1PVSA 2ABKA 3FHGA 1YQLA 2XHIA 3KTUA 4E9EA 1WEFA 4EA4A 1MUYA 5KN8A 1LWVA 3N0UA 1HU0A 4HSBA 3CW7A 2NOIA 4YPHA 4PIIA 5DPKA 1N3AA 4YPRA 4EW4A 1LWWA 3CWSA 4E9FA 4AI5A 1ORPA 1VRLA 1ORNA 2NOBA 2NOFA 1RRQA 4B22A 1YQRA 1PU7A 3D4VA 3OGDA 2JG6A 3IHOA 4OFHA 4UNFA 1LWYA 1WEGA 1WEIA 1N3CA 1MUNA 3CVTA 1MPGA 3KNTA 4B23A 1KO9A 1KG7A 2JHJA 3S6IA 1XG7A 1DIZA 3F10A 1MUDA 3I0XA 3F0ZA 3CWAA 3N5NX 1FN7A 3FHFA 2NOHA 1KG3A 2H56A 4E9HA
chains in the Genus database with same CATH superfamily
1RRSA 4EW0A 1M3HA 3IH7A 3CVSA 3OYNA 4ZTFA 5AN4A 3CWUA 1YQMA 4YOQA 1PU6A 3FSPA 2NOEA 3L2RA 1XQOA 2NOLA 1KG6A 3OH6A 2YG9A 2JPSA 2I5WA 1NGNA 2V75A 4DK9A 2OFIA 4AIAA 4EA5A 1KG4A 4B21A 5FRMA 3VW4A 1EBMA 2NOZA 1KEAA 5KN9A 3OYMA 4E7HA 4ZTJA 4OFEA 5CHZA 3I0WA 3OYDA 2OFKA 4BE0A 3OS0A 1N39A 4EVVA 1XQPA 4OFAA 1YQKA 1U84A 4E7IA 4EJZA 4BE1A 3G0QA 3CWTA 4E9GA 1M3QA 5FRNA 1P59A 4UOBA 4B24A 1PU8A 4EJYA 3OYEA 3OY9A 2JHNA 3OH9A 1KG5A 3S3NA 1KG2A 4AI4A 4E7KA 1LMZA 1P7MA 3L2QA 3NNQA 1KQJA 2YG8A 1NKUA 1PVSA 2ABKA 3FHGA 1YQLA 2XHIA 3KTUA 3L2UA 4E9EA 1WEFA 4EA4A 1MUYA 5KN8A 1LWVA 3L2VA 3N0UA 3OYKA 4BDYA 1HU0A 4HSBA 3CW7A 2NOIA 4YPHA 4PIIA 3OYJA 4BDZA 4E7JA 5DPKA 1N3AA 4YPRA 3OYHA 4EW4A 1LWWA 3CWSA 3OYBA 2W03A 4E9FA 3S3OA 3OYAA 4AI5A 3OYGA 1ORPA 3LCNA 3OYCA 4NZGA 1VRLA 1ORNA 2NOBA 2NOFA 1RRQA 4BACA 4B22A 1YQRA 1PU7A 3D4VA 3OGDA 2JG6A 3OS1A 3IHOA 4OFHA 4UNFA 1LWYA 4IKFA 3OYIA 1WEGA 3OYFA 1WEIA 1N3CA 3OS2A 1MUNA 3CVTA 1MPGA 3KNTA 4B23A 1KO9A 5FROA 4BE2A 1KG7A 3OYLA 3L2WA 2JHJA 3S3MA 3S6IA 1XG7A 1DIZA 3F10A 1MUDA 3I0XA 3F0ZA 3CWAA 3N5NX 1FN7A 3FHFA 2NOHA 1KG3A 2W04A 2H56A 4E9HA 4E7LA 3R2XC
chains in the Genus database with same CATH topology
1RRSA 4EW0A 1M3HA 3IH7A 3CVSA 5AN4A 3CWUA 1YQMA 4YOQA 1PU6A 3FSPA 2NOEA 1XQOA 2NOLA 1KG6A 3OH6A 2YG9A 2I5WA 1NGNA 4DK9A 2OFIA 4AIAA 4EA5A 1KG4A 4B21A 1EBMA 2NOZA 1KEAA 5KN9A 4OFEA 5CHZA 3I0WA 2OFKA 1N39A 4EVVA 1XQPA 4OFAA 1YQKA 4EJZA 3G0QA 3CWTA 4E9GA 1M3QA 1P59A 4UOBA 4B24A 1PU8A 4EJYA 2JHNA 3OH9A 1KG5A 1KG2A 4AI4A 1LMZA 1P7MA 1KQJA 2YG8A 1NKUA 1PVSA 2ABKA 3FHGA 1YQLA 2XHIA 3KTUA 4E9EA 1WEFA 4EA4A 1MUYA 5KN8A 1LWVA 3N0UA 1HU0A 4HSBA 3CW7A 2NOIA 4YPHA 4PIIA 5DPKA 1N3AA 4YPRA 4EW4A 1LWWA 3CWSA 4E9FA 4AI5A 1ORPA 1VRLA 1ORNA 2NOBA 2NOFA 1RRQA 4B22A 1YQRA 1PU7A 3D4VA 3OGDA 2JG6A 3IHOA 4OFHA 4UNFA 1LWYA 1WEGA 1WEIA 1N3CA 1MUNA 3CVTA 1MPGA 3KNTA 4B23A 1KO9A 1KG7A 2JHJA 3S6IA 1XG7A 1DIZA 3F10A 1MUDA 3I0XA 3F0ZA 3CWAA 3N5NX 1FN7A 3FHFA 2NOHA 1KG3A 2H56A 4E9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RRS A;  4EW0 A;  1M3H A;  3IH7 A;  3CVS A;  5AN4 A;  3CWU A;  1YQM A;  4YOQ A;  1PU6 A;  3FSP A;  2NOE A;  1XQO A;  2NOL A;  1KG6 A;  3OH6 A;  2YG9 A;  2I5W A;  1NGN A;  4DK9 A;  2OFI A;  4AIA A;  4EA5 A;  1KG4 A;  4B21 A;  1EBM A;  2NOZ A;  1KEA A;  5KN9 A;  4OFE A;  5CHZ A;  3I0W A;  2OFK A;  1N39 A;  4EVV A;  1XQP A;  4OFA A;  1YQK A;  4EJZ A;  3G0Q A;  3CWT A;  4E9G A;  1M3Q A;  1P59 A;  4UOB A;  4B24 A;  1PU8 A;  4EJY A;  2JHN A;  3OH9 A;  1KG5 A;  1KG2 A;  4AI4 A;  1LMZ A;  1P7M A;  1KQJ A;  2YG8 A;  1NKU A;  1PVS A;  2ABK A;  3FHG A;  1YQL A;  2XHI A;  3KTU A;  4E9E A;  1WEF A;  4EA4 A;  1MUY A;  5KN8 A;  1LWV A;  3N0U A;  1HU0 A;  4HSB A;  3CW7 A;  2NOI A;  4YPH A;  4PII A;  5DPK A;  1N3A A;  4YPR A;  4EW4 A;  1LWW A;  3CWS A;  4E9F A;  4AI5 A;  1ORP A;  1VRL A;  1ORN A;  2NOB A;  2NOF A;  1RRQ A;  4B22 A;  1YQR A;  1PU7 A;  3D4V A;  3OGD A;  2JG6 A;  3IHO A;  4OFH A;  4UNF A;  1LWY A;  1WEG A;  1WEI A;  1N3C A;  1MUN A;  3CVT A;  1MPG A;  3KNT A;  4B23 A;  1KO9 A;  1KG7 A;  2JHJ A;  3S6I A;  1XG7 A;  1DIZ A;  3F10 A;  1MUD A;  3I0X A;  3F0Z A;  3CWA A;  3N5N X;  1FN7 A;  3FHF A;  2NOH A;  1KG3 A;  2H56 A;  4E9H A; 
#chains in the Genus database with same CATH topology
 1RRS A;  4EW0 A;  1M3H A;  3IH7 A;  3CVS A;  3OYN A;  4ZTF A;  5AN4 A;  3CWU A;  1YQM A;  4YOQ A;  1PU6 A;  3FSP A;  2NOE A;  3L2R A;  1XQO A;  2NOL A;  1KG6 A;  3OH6 A;  2YG9 A;  2JPS A;  2I5W A;  1NGN A;  2V75 A;  4DK9 A;  2OFI A;  4AIA A;  4EA5 A;  1KG4 A;  4B21 A;  5FRM A;  3VW4 A;  1EBM A;  2NOZ A;  1KEA A;  5KN9 A;  3OYM A;  4E7H A;  4ZTJ A;  4OFE A;  5CHZ A;  3I0W A;  3OYD A;  2OFK A;  4BE0 A;  3OS0 A;  1N39 A;  4EVV A;  1XQP A;  4OFA A;  1YQK A;  1U84 A;  4E7I A;  4EJZ A;  4BE1 A;  3G0Q A;  3CWT A;  4E9G A;  1M3Q A;  5FRN A;  1P59 A;  4UOB A;  4B24 A;  1PU8 A;  4EJY A;  3OYE A;  3OY9 A;  2JHN A;  3OH9 A;  1KG5 A;  3S3N A;  1KG2 A;  4AI4 A;  4E7K A;  1LMZ A;  1P7M A;  3L2Q A;  3NNQ A;  1KQJ A;  2YG8 A;  1NKU A;  1PVS A;  2ABK A;  3FHG A;  1YQL A;  2XHI A;  3KTU A;  3L2U A;  4E9E A;  1WEF A;  4EA4 A;  1MUY A;  5KN8 A;  1LWV A;  3L2V A;  3N0U A;  3OYK A;  4BDY A;  1HU0 A;  4HSB A;  3CW7 A;  2NOI A;  4YPH A;  4PII A;  3OYJ A;  4BDZ A;  4E7J A;  5DPK A;  1N3A A;  4YPR A;  3OYH A;  4EW4 A;  1LWW A;  3CWS A;  3OYB A;  2W03 A;  4E9F A;  3S3O A;  3OYA A;  4AI5 A;  3OYG A;  1ORP A;  3LCN A;  3OYC A;  4NZG A;  1VRL A;  1ORN A;  2NOB A;  2NOF A;  1RRQ A;  4BAC A;  4B22 A;  1YQR A;  1PU7 A;  3D4V A;  3OGD A;  2JG6 A;  3OS1 A;  3IHO A;  4OFH A;  4UNF A;  1LWY A;  4IKF A;  3OYI A;  1WEG A;  3OYF A;  1WEI A;  1N3C A;  3OS2 A;  1MUN A;  3CVT A;  1MPG A;  3KNT A;  4B23 A;  1KO9 A;  5FRO A;  4BE2 A;  1KG7 A;  3OYL A;  3L2W A;  2JHJ A;  3S3M A;  3S6I A;  1XG7 A;  1DIZ A;  3F10 A;  1MUD A;  3I0X A;  3F0Z A;  3CWA A;  3N5N X;  1FN7 A;  3FHF A;  2NOH A;  1KG3 A;  2W04 A;  2H56 A;  4E9H A;  4E7L A;  3R2X C; 
#chains in the Genus database with same CATH homology
 1RRS A;  4EW0 A;  1M3H A;  3IH7 A;  3CVS A;  5AN4 A;  3CWU A;  1YQM A;  4YOQ A;  1PU6 A;  3FSP A;  2NOE A;  1XQO A;  2NOL A;  1KG6 A;  3OH6 A;  2YG9 A;  2I5W A;  1NGN A;  4DK9 A;  2OFI A;  4AIA A;  4EA5 A;  1KG4 A;  4B21 A;  1EBM A;  2NOZ A;  1KEA A;  5KN9 A;  4OFE A;  5CHZ A;  3I0W A;  2OFK A;  1N39 A;  4EVV A;  1XQP A;  4OFA A;  1YQK A;  4EJZ A;  3G0Q A;  3CWT A;  4E9G A;  1M3Q A;  1P59 A;  4UOB A;  4B24 A;  1PU8 A;  4EJY A;  2JHN A;  3OH9 A;  1KG5 A;  1KG2 A;  4AI4 A;  1LMZ A;  1P7M A;  1KQJ A;  2YG8 A;  1NKU A;  1PVS A;  2ABK A;  3FHG A;  1YQL A;  2XHI A;  3KTU A;  4E9E A;  1WEF A;  4EA4 A;  1MUY A;  5KN8 A;  1LWV A;  3N0U A;  1HU0 A;  4HSB A;  3CW7 A;  2NOI A;  4YPH A;  4PII A;  5DPK A;  1N3A A;  4YPR A;  4EW4 A;  1LWW A;  3CWS A;  4E9F A;  4AI5 A;  1ORP A;  1VRL A;  1ORN A;  2NOB A;  2NOF A;  1RRQ A;  4B22 A;  1YQR A;  1PU7 A;  3D4V A;  3OGD A;  2JG6 A;  3IHO A;  4OFH A;  4UNF A;  1LWY A;  1WEG A;  1WEI A;  1N3C A;  1MUN A;  3CVT A;  1MPG A;  3KNT A;  4B23 A;  1KO9 A;  1KG7 A;  2JHJ A;  3S6I A;  1XG7 A;  1DIZ A;  3F10 A;  1MUD A;  3I0X A;  3F0Z A;  3CWA A;  3N5N X;  1FN7 A;  3FHF A;  2NOH A;  1KG3 A;  2H56 A;  4E9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...