4B24A

Unprecedented sculpting of dna at abasic sites by dna glycosylase homolog mag2
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
206
structure length
206
Chain Sequence
KDSDYKRAEKHLSSIDNKWSSLVKKVGPCTLTPHPEHAPYEGIIRAITSQKLSDAATNSIINKFCTQCSDNDEFPTPKQIMETDVETLHECGFSKLKSQEIHIVAEAALNKQIPSKSEIEKMSEEELMESLSKIKGVKRWTIEMYSIFTLGRLDIMPADDSTLKNEAKEFFGLSSKPQTEEVEKLTKPCKPYRTIAAWYLWQIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE DNA-3-METHYLADENINE GLYCOSYLASE 2
publication title Sculpting of DNA at Abasic Sites by DNA Glycosylase Homolog Mag2.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase/dna
total genus 72
structure length 206
sequence length 206
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2012-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 4b24A02
1.10.1670.40 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Endonuclease Iii, domain 2 4b24A01
3S6IA 2NOIA 4UNFA 3FSPA 2NOZA 3N5NX 4E9GA 2NOBA 4EA4A 3OH6A 4B24A 3CWSA 3FHFA 1YQLA 4AI5A 4AI4A 1LWWA 5DPKA 3IHOA 1DIZA 1N3CA 2NOHA 4YPRA 3I0WA 1PU6A 4E9EA 5KN8A 3G0QA 3KTUA 1M3HA 1KG2A 1N3AA 1NGNA 2OFIA 1P7MA 4PIIA 1XG7A 4OFEA 2OFKA 1LWVA 2NOEA 1KO9A 1XQPA 3CWAA 2XHIA 4E9HA 1P59A 3CW7A 4EW4A 4B21A 1XQOA 1WEFA 4UOBA 1PVSA 5CHZA 1MUDA 3CVTA 1MUNA 1N39A 5AN4A 1PU7A 4EW0A 1RRSA 4EJZA 3I0XA 2I5WA 4E9FA 1ORNA 3FHGA 4DK9A 4AIAA 3CWTA 2JHJA 1M3QA 2ABKA 1YQRA 1PU8A 3OGDA 1YQMA 4HSBA 3F10A 1VRLA 5KN9A 4EJYA 4EVVA 1KG3A 3IH7A 2NOFA 2YG9A 1WEGA 2JHNA 4OFHA 1KG7A 4OFAA 3CWUA 1NKUA 1LWYA 1YQKA 3D4VA 2JG6A 4YOQA 2NOLA 1ORPA 1MUYA 3F0ZA 1KG4A 1HU0A 1LMZA 2YG8A 1KG6A 3CVSA 1WEIA 4B22A 3KNTA 4B23A 3OH9A 4EA5A 1MPGA 1KG5A 1RRQA 4YPHA 1EBMA 1FN7A 2H56A 1KEAA 3N0UA 1KQJA
chains in the Genus database with same CATH superfamily
3S6IA 2NOIA 4UNFA 3FSPA 2NOZA 3N5NX 4E9GA 2NOBA 4EA4A 3OYJA 3OYEA 3OH6A 4B24A 3CWSA 3FHFA 1YQLA 4AI5A 2W04A 4AI4A 5DPKA 3IHOA 3OS0A 1LWWA 1DIZA 1N3CA 2NOHA 4YPRA 4E7IA 4BE2A 3I0WA 1PU6A 4E9EA 5KN8A 3G0QA 3KTUA 1M3HA 1KG2A 1N3AA 1NGNA 2OFIA 1P7MA 4PIIA 4E7JA 1XG7A 3L2WA 4OFEA 4BE0A 3OYMA 3L2RA 3L2UA 2OFKA 1LWVA 2NOEA 1KO9A 1XQPA 3OYGA 4ZTJA 3CWAA 3L2VA 2XHIA 4E9HA 3OY9A 5FROA 1P59A 3CW7A 3OYDA 4EW4A 4B21A 1XQOA 1WEFA 2V75A 4UOBA 1PVSA 5FRNA 5CHZA 1MUDA 3CVTA 1MUNA 1N39A 3OYKA 5AN4A 1PU7A 4BDZA 4EW0A 1RRSA 3VW4A 4EJZA 3I0XA 2I5WA 3R2XC 3OS1A 4E9FA 3OYBA 1ORNA 3FHGA 4DK9A 4AIAA 4E7HA 3OYIA 3CWTA 4E7LA 4BE1A 2JHJA 3OYLA 1M3QA 2ABKA 4IKFA 1YQRA 3OYHA 1PU8A 3OYAA 3OGDA 1YQMA 4HSBA 3F10A 1VRLA 5KN9A 4EJYA 4NZGA 4EVVA 3S3MA 1KG3A 2W03A 3IH7A 2NOFA 2YG9A 1WEGA 2JHNA 4OFHA 3OYFA 3OYNA 1KG7A 4OFAA 3CWUA 1NKUA 2JPSA 3OYCA 1LWYA 4E7KA 1YQKA 3D4VA 2JG6A 5FRMA 4YOQA 2NOLA 1ORPA 1MUYA 3L2QA 1U84A 3F0ZA 1KG4A 3S3NA 1HU0A 1LMZA 2YG8A 3NNQA 1KG6A 3CVSA 1WEIA 4B22A 3OS2A 3KNTA 4B23A 3OH9A 3LCNA 1MPGA 1KG5A 4EA5A 1RRQA 4YPHA 3S3OA 1EBMA 1FN7A 4ZTFA 2H56A 1KEAA 4BDYA 3N0UA 4BACA 1KQJA
chains in the Genus database with same CATH topology
3S6IA 2NOIA 4UNFA 3FSPA 2NOZA 3N5NX 4E9GA 2NOBA 4EA4A 3OH6A 4B24A 3CWSA 3FHFA 1YQLA 4AI5A 4AI4A 1LWWA 5DPKA 3IHOA 1DIZA 1N3CA 2NOHA 4YPRA 3I0WA 1PU6A 4E9EA 5KN8A 3G0QA 3KTUA 1M3HA 1KG2A 1N3AA 1NGNA 2OFIA 1P7MA 4PIIA 1XG7A 4OFEA 2OFKA 1LWVA 2NOEA 1KO9A 1XQPA 3CWAA 2XHIA 4E9HA 1P59A 3CW7A 4EW4A 4B21A 1XQOA 1WEFA 4UOBA 1PVSA 5CHZA 1MUDA 3CVTA 1MUNA 1N39A 5AN4A 1PU7A 4EW0A 1RRSA 4EJZA 3I0XA 2I5WA 4E9FA 1ORNA 3FHGA 4DK9A 4AIAA 3CWTA 2JHJA 1M3QA 2ABKA 1YQRA 1PU8A 3OGDA 1YQMA 4HSBA 3F10A 1VRLA 5KN9A 4EJYA 4EVVA 1KG3A 3IH7A 2NOFA 2YG9A 1WEGA 2JHNA 4OFHA 1KG7A 4OFAA 3CWUA 1NKUA 1LWYA 1YQKA 3D4VA 2JG6A 4YOQA 2NOLA 1ORPA 1MUYA 3F0ZA 1KG4A 1HU0A 1LMZA 2YG8A 1KG6A 3CVSA 1WEIA 4B22A 3KNTA 4B23A 3OH9A 4EA5A 1MPGA 1KG5A 1RRQA 4YPHA 1EBMA 1FN7A 2H56A 1KEAA 3N0UA 1KQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6I A;  2NOI A;  4UNF A;  3FSP A;  2NOZ A;  3N5N X;  4E9G A;  2NOB A;  4EA4 A;  3OH6 A;  4B24 A;  3CWS A;  3FHF A;  1YQL A;  4AI5 A;  4AI4 A;  1LWW A;  5DPK A;  3IHO A;  1DIZ A;  1N3C A;  2NOH A;  4YPR A;  3I0W A;  1PU6 A;  4E9E A;  5KN8 A;  3G0Q A;  3KTU A;  1M3H A;  1KG2 A;  1N3A A;  1NGN A;  2OFI A;  1P7M A;  4PII A;  1XG7 A;  4OFE A;  2OFK A;  1LWV A;  2NOE A;  1KO9 A;  1XQP A;  3CWA A;  2XHI A;  4E9H A;  1P59 A;  3CW7 A;  4EW4 A;  4B21 A;  1XQO A;  1WEF A;  4UOB A;  1PVS A;  5CHZ A;  1MUD A;  3CVT A;  1MUN A;  1N39 A;  5AN4 A;  1PU7 A;  4EW0 A;  1RRS A;  4EJZ A;  3I0X A;  2I5W A;  4E9F A;  1ORN A;  3FHG A;  4DK9 A;  4AIA A;  3CWT A;  2JHJ A;  1M3Q A;  2ABK A;  1YQR A;  1PU8 A;  3OGD A;  1YQM A;  4HSB A;  3F10 A;  1VRL A;  5KN9 A;  4EJY A;  4EVV A;  1KG3 A;  3IH7 A;  2NOF A;  2YG9 A;  1WEG A;  2JHN A;  4OFH A;  1KG7 A;  4OFA A;  3CWU A;  1NKU A;  1LWY A;  1YQK A;  3D4V A;  2JG6 A;  4YOQ A;  2NOL A;  1ORP A;  1MUY A;  3F0Z A;  1KG4 A;  1HU0 A;  1LMZ A;  2YG8 A;  1KG6 A;  3CVS A;  1WEI A;  4B22 A;  3KNT A;  4B23 A;  3OH9 A;  4EA5 A;  1MPG A;  1KG5 A;  1RRQ A;  4YPH A;  1EBM A;  1FN7 A;  2H56 A;  1KEA A;  3N0U A;  1KQJ A; 
#chains in the Genus database with same CATH topology
 3S6I A;  2NOI A;  4UNF A;  3FSP A;  2NOZ A;  3N5N X;  4E9G A;  2NOB A;  4EA4 A;  3OYJ A;  3OYE A;  3OH6 A;  4B24 A;  3CWS A;  3FHF A;  1YQL A;  4AI5 A;  2W04 A;  4AI4 A;  5DPK A;  3IHO A;  3OS0 A;  1LWW A;  1DIZ A;  1N3C A;  2NOH A;  4YPR A;  4E7I A;  4BE2 A;  3I0W A;  1PU6 A;  4E9E A;  5KN8 A;  3G0Q A;  3KTU A;  1M3H A;  1KG2 A;  1N3A A;  1NGN A;  2OFI A;  1P7M A;  4PII A;  4E7J A;  1XG7 A;  3L2W A;  4OFE A;  4BE0 A;  3OYM A;  3L2R A;  3L2U A;  2OFK A;  1LWV A;  2NOE A;  1KO9 A;  1XQP A;  3OYG A;  4ZTJ A;  3CWA A;  3L2V A;  2XHI A;  4E9H A;  3OY9 A;  5FRO A;  1P59 A;  3CW7 A;  3OYD A;  4EW4 A;  4B21 A;  1XQO A;  1WEF A;  2V75 A;  4UOB A;  1PVS A;  5FRN A;  5CHZ A;  1MUD A;  3CVT A;  1MUN A;  1N39 A;  3OYK A;  5AN4 A;  1PU7 A;  4BDZ A;  4EW0 A;  1RRS A;  3VW4 A;  4EJZ A;  3I0X A;  2I5W A;  3R2X C;  3OS1 A;  4E9F A;  3OYB A;  1ORN A;  3FHG A;  4DK9 A;  4AIA A;  4E7H A;  3OYI A;  3CWT A;  4E7L A;  4BE1 A;  2JHJ A;  3OYL A;  1M3Q A;  2ABK A;  4IKF A;  1YQR A;  3OYH A;  1PU8 A;  3OYA A;  3OGD A;  1YQM A;  4HSB A;  3F10 A;  1VRL A;  5KN9 A;  4EJY A;  4NZG A;  4EVV A;  3S3M A;  1KG3 A;  2W03 A;  3IH7 A;  2NOF A;  2YG9 A;  1WEG A;  2JHN A;  4OFH A;  3OYF A;  3OYN A;  1KG7 A;  4OFA A;  3CWU A;  1NKU A;  2JPS A;  3OYC A;  1LWY A;  4E7K A;  1YQK A;  3D4V A;  2JG6 A;  5FRM A;  4YOQ A;  2NOL A;  1ORP A;  1MUY A;  3L2Q A;  1U84 A;  3F0Z A;  1KG4 A;  3S3N A;  1HU0 A;  1LMZ A;  2YG8 A;  3NNQ A;  1KG6 A;  3CVS A;  1WEI A;  4B22 A;  3OS2 A;  3KNT A;  4B23 A;  3OH9 A;  3LCN A;  1MPG A;  1KG5 A;  4EA5 A;  1RRQ A;  4YPH A;  3S3O A;  1EBM A;  1FN7 A;  4ZTF A;  2H56 A;  1KEA A;  4BDY A;  3N0U A;  4BAC A;  1KQJ A; 
#chains in the Genus database with same CATH homology
 3S6I A;  2NOI A;  4UNF A;  3FSP A;  2NOZ A;  3N5N X;  4E9G A;  2NOB A;  4EA4 A;  3OH6 A;  4B24 A;  3CWS A;  3FHF A;  1YQL A;  4AI5 A;  4AI4 A;  1LWW A;  5DPK A;  3IHO A;  1DIZ A;  1N3C A;  2NOH A;  4YPR A;  3I0W A;  1PU6 A;  4E9E A;  5KN8 A;  3G0Q A;  3KTU A;  1M3H A;  1KG2 A;  1N3A A;  1NGN A;  2OFI A;  1P7M A;  4PII A;  1XG7 A;  4OFE A;  2OFK A;  1LWV A;  2NOE A;  1KO9 A;  1XQP A;  3CWA A;  2XHI A;  4E9H A;  1P59 A;  3CW7 A;  4EW4 A;  4B21 A;  1XQO A;  1WEF A;  4UOB A;  1PVS A;  5CHZ A;  1MUD A;  3CVT A;  1MUN A;  1N39 A;  5AN4 A;  1PU7 A;  4EW0 A;  1RRS A;  4EJZ A;  3I0X A;  2I5W A;  4E9F A;  1ORN A;  3FHG A;  4DK9 A;  4AIA A;  3CWT A;  2JHJ A;  1M3Q A;  2ABK A;  1YQR A;  1PU8 A;  3OGD A;  1YQM A;  4HSB A;  3F10 A;  1VRL A;  5KN9 A;  4EJY A;  4EVV A;  1KG3 A;  3IH7 A;  2NOF A;  2YG9 A;  1WEG A;  2JHN A;  4OFH A;  1KG7 A;  4OFA A;  3CWU A;  1NKU A;  1LWY A;  1YQK A;  3D4V A;  2JG6 A;  4YOQ A;  2NOL A;  1ORP A;  1MUY A;  3F0Z A;  1KG4 A;  1HU0 A;  1LMZ A;  2YG8 A;  1KG6 A;  3CVS A;  1WEI A;  4B22 A;  3KNT A;  4B23 A;  3OH9 A;  4EA5 A;  1MPG A;  1KG5 A;  1RRQ A;  4YPH A;  1EBM A;  1FN7 A;  2H56 A;  1KEA A;  3N0U A;  1KQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...