4B2BA

Structure of the factor xa-like trypsin variant triple-ala (tgpa) in complex with eglin c
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDAGGPVVCSGKLQGIVSWGEGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title Thermodynamic signatures in macromolecular interactions involving conformational flexibility.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
chains with identical sequence C
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b2bA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b2bA02
2WYJA 5DGJA 1O2GH 3QO6A 1NM6A 2HALA 1EZQA 3RDZA 2J2UA 2GDEH 4CH8B 4E7RG 2HPPH 1L1NA 4K5ZA 3O8RA 1CA8B 1F0SA 1GCDA 1SGIB 2ZDMA 1S0RA 2BZAA 3UOPA 1AE8H 2EA3A 1SB1H 2P3TB 2BQ6B 3GOVB 1TBZH 1W12U 4TPIZ 2W7SA 3V7TA 3LGUA 1EATA 1PYTD 2BD5A 3BTEE 3M5LA 1QJ1B 3D49H 1PFXC 2FTLE 1WTHD 1PPGE 1TNLA 4X6OA 5F03A 1QGFA 2AIPA 2BD3A 4I8LA 4WH8A 2ODQA 7ESTE 4MPUA 4BTTB 2OCVB 3VGCB 4OS4A 2F83A 2GZ9A 5CE1A 5E8EH 3SNCA 1UCYE 2F9BH 4AFSA 3BF6H 1QRXA 3VEQB 1CE5A 3SZNA 4B74A 1HAZB 4K2YA 1W10U 1V2OT 3B9FH 1BJUA 1YPMH 1QQ4A 2HGTH 3LU9B 4ZH8A 4UD9H 1XVMA 1AQ7A 1TABE 2FP7B 2SNVA 4LK4A 1FPCH 7GCHG 1SLWB 2GCHG 1C2MA 1SHYA 4Y71A 1SSXA 4UFEH 2FOEA 1O2SA 2BB4A 2RDLA 1D9IA 1MQ6A 4FUBA 1J8AA 1BTXA 1SOTA 4X1NU 3A89A 1AVWA 3NCLA 3P17H 3SNBA 2JH6D 3BTQE 3O8DA 1DLKB 1O5EH 3SHCH 3P6ZB 1HAIH 2C8YB 4OS2A 5E2OA 1KLIH 2OC0A 4I8GA 1ESTA 1UHBB 3F6UH 1BTYA 1HJ9A 4RKJB 1VJAU 3STJA 1O2VA 5JPMH 3MO6A 1P01A 5F8TA 3GY6A 1AU8A 4NWLA 1CT2E 2Y7ZA 1BBRK 1YBWA 2IOTA 1ZPZA 3QTOH 4X2VA 1ORFA 2UUKB 1G3CA 4MLFB 1C1UH 3MO9A 3AASA 2VGCC 1Z8IB 5DP9A 2JKHA 2GZ8A 2VVCA 2TIOA 1DOJA 4ESTE 1LKAA 1FAXA 4AZ2B 4AFUA 3R3GB 1C5XB 3A8CA 3I29A 2P8OC 1BDAA 2XW9A 3VFEA 1GI7B 2BLWA 4X6NA 1TGCA 1P2KA 3P8OA 3ZZ5A 1AZ8A 2FOGA 2ZWLH 2BDYA 2ZQ1A 1KLTA 4TY6A 1A3EH 1C5QA 1XUKA 1IHTH 4TYDA 1O2QA 2IN2A 3H7TA 1QBOA 3T25A 1C1QA 1QFKH 3A86A 3MYWA 3A80A 2W3IA 1KXBA 4D7GA 1O2KA 1HAYB 3ZZCA 4NIWA 3SNAA 1KTTB 4K1TA 1CBWC 1RD3B 1CSOE 1MH0A 2ANKH 3CS7A 3RXAA 2KAIA 3G01A 3V3MA 1Y5UT 3GCOA 1C5TA 1SGFA 2Y5HA 4K8YA 2VIOA 2QY0B 3LC5A 3SU3A 3ZZ3A 1GHBG 4ABAA 1TMUH 3TGIE 5EXMA 1GBFA 1O3FA 1GJDB 3B23B 4JZDH 1SGCA 4Z6AH 4ZROA 3MU4A 4KTUA 1SLVB 2GV7A 3T2NA 1K22H 1FNIA 1OYTH 2G4UA 2WYGA 3QDZB 4UE7H 1H9LB 5GXPA 1OWKA 5A8XA 1O2HA 4CRGA 3JZ1B 1LHGH 1GBHA 4HTCH 2DE9A 1GBIA 1PPFE 1GBLA 1HBTH 2NU1E 3F9HA 1EZXC 1FY5A 4VGCB 1VITG 4MG3A 1V3XA 3BTFE 4I32A 3BSQA 3QLPH 1P03A 1NFUA 4I8HA 2BY9X 2ZHDA 4UDWH 5DP4A 1UVSH 4DOQA 1HUTH 1O31A 2VU8E 1CGIE 3KQDA 1GBEA 1O2TA 2C90B 1Z1IA 1WV7H 1ESBA 3NZIA 4NCYA 3SNEA 5JB9S 1BHXB 1O37A 1T32A 3RXJA 2VWMA 5DPAA 1PQ8A 1EOJA 5A0BA 2WPMS 4GCHF 4JZIA 1SFQB 3QGNB 3PMHB 1BJVA 1K1MA 1QB1A 1UK4A 4MDSA 1M9UA 3EE0B 3LT3A 2F9VA 3ZZ9A 2BHGA 2ZGXH 1C5MD 1JIRA 2BX3A 1MBMA 5H4IB 1NRSH 1RTKA 2B5TB 5C3NA 5EXLA 1V2MT 1FZZA 2XRCA 1MTUA 1BTWA 1GHZA 1AB9B 2SNWA 1JXPA 3GY7A 1SQTA 1ANBA 1GJ6A 3GY2A 4K1EA 3RXUA 4B71A 4B73A 1YKTA 3D23A 1T8LA 1KSNA 1KXCA 1AWFH 3NWUA 3KEEA 3PO1B 1DLEA 3RXDA 3UFAA 3DFJA 1D3PB 2FOCA 5TCCA 4D8NA 1MTVA 1D3DB 1Z7KA 2D1JA 3UQVA 2F9PA 1BTHH 3IG6B 4JK6A 3VB5A 2OQ5A 5FCKA 1UTKA 2SGEE 1V6DA 5L30H 2BYAX 2OUAA 4CR5A 2UUJB 1T7CA 3ATIA 3M37A 3PM3A 1SGQE 2ZI2H 5DP8A 2FO9A 4U01A 4X0WU 4XBBA 4YT7H 2V6NA 4CREA 3PB1E 1D6WA 1LVMA 1O5AB 1SGRE 3P8NA 1IQJA 3RXRA 1DANH 3D62A 2CGAA 3KQEA 3AAUA 2ZP0H 1E34B 4ZHLU 4F4OC 1G30B 5A8ZA 1SL3A 2Y81A 2VVVA 4XSKU 1OX1A 1YPHE 3T28A 1SGFG 3VB4A 3RXTA 1T8OA 1W0YH 1UMAH 1FN6A 5E0GA 2PUQH 3BTGE 3KNXA 1ELGA 1C2FA 2WPJS 1O2MA 4AORA 4I7YH 4ABJA 1DWEH 2PKAA 2AFQB 4E06H 3E0NB 3TPIZ 1VITH 3ATKA 1QRWA 2OINA 1S81A 1O3DA 1C2EA 1VCPA 2Y6TA 1VR1H 1ZGIA 1KXEA 4FUIA 4GHQA 2Z9JA 2VINA 1FN8A 2FZZA 2F9UA 3LC3A 2A45B 2AIQA 2ZU1A 2WPKS 3SJIA 1CT0E 1S5SA 2XC5A 3SUEA 1K21H 1HPGA 3A81A 1SGPE 5JBCS 1B5GH 2OLGA 4BTIB 1SR5C 1SGNE 5DK1A 1GJ8B 3GISB 1AGJA 3TK6A 7GCHF 4NWKA 5HM9A 1S6HA 2GCHF 1NRPH 1GHAG 4CBOA 4MNWA 2VH0A 2A7JA 1QBVH 2PKSC 1O34A 2AH4X 4KTCA 3S9BA 2G00A 2ZU5A 3MH4A 3FANA 4CRAA 2CN0H 1QR3E 1J17T 1ELTA 1V2PT 1WCZA 3QWCH 3MTYA 4DJZB 1LMWB 1G3EA 2GTBA 2ZGJA 4Y8YA 5EOKA 4IN2A 1CO7E 1P2NA 1UCYH 3GY4A 4K8BA 5FPYA 3U69H 3U98H 4VGCC 1N8OB 1GI1A 4Q7ZA 1LVYA 4U30A 9LPRA 1GMDG 1UVPA 1GMCG 4YLQH 1J16A 1LTOA 1TNKA 1P9UA 1O30A 3RU4D 2NU3E 1C5WB 1GI8B 2VIPA 1MD8A 1TMBH 1Q31A 1O2NA 4NG9H 3SV6A 3ODFA 3MU5A 1TGSZ 3S7KB 4B2CA 1A46H 1WBGB 4NA9H 2BXTH 5TCAA 2Z6BD 1MKWH 1CQQA 5J4SA 2EI8A 1G32B 1EZUC 4Q80A 3URDA 3UNQA 4O9VA 4YTAA 1C2LA 1A3BH 1C5SA 3M7QA 3EA7A 2WPLS 4XDEA 1YM0A 1C1NA 1DPOA 3BEIB 1LHCH 1W3CA 1GBBA 1ZRBA 1YCPM 3SHAH 3F1SB 1SLXB 2Y5GA 5I46H 1KYNA 2A5AA 2ZEBA 1WQVH 3RXEA 2QAAA 5DP3A 1C5RA 1O3IA 1EJMA 3RXMA 2FWWA 1ANCA 1LHEH 3GDVA 1AB9C 3U8TH 1G2LA 2O8LA 1BRUP 2ZO3H 2WPHS 1TQ7B 4H42U 2BOHB 5FPTA 2LNCA 1ESAA 1ELEE 3SU1A 3MU1A 2AEIH 2PFEA 2QYIA 2ZZUH 2ANYA 1GJBB 1SGTA 1SGDE 5GIBA 1NFYA 1EAXA 2ZFRH 3PO1C 1ELCA 3EAJA 1KLJH 2JH0D 6GCHG 4X1RU 3E6PH 2ZU3A 3SBKA 1O5DH 3E0PB 1RTLA 1P11E 3PWCA 1N6YA 3RMMH 1EJNA 3ODDA 2TPIZ 3S7HB 3RXPA 3TNSA 3SGAE 4D9QA 1P2JA 2BVSH 3NPSA 2QIQA 3RXVA 1O0DH 2BY8X 1GHBF 1BZXE 1C5PA 3SU6A 4ZKRU 3RM0H 8ESTE 1JBUH 4R0IA 3ZVFA 3ZV9A 3GYLB 1GBCA 4DVAU 3PROA 4B2AA 4FUFA 3P92A 1T4VH 1O3AA 3MI4A 4Y7BA 5EW1H 4SGAE 1S85A 2EI6A 5EGMA 3TLOA 4LZ1H 3RXKA 4DY7B 1MZAA 1YPJH 3TJUA 5JBBS 2QXGA 4MTBA 3VB7A 1ARCA 2ZG0H 1FPHH 5DJ7A 1OWDA 2RA0A 2GMTC 1VITF 4MPWA 1EAWA 1Z8RA 5LPEA 1KDQB 1NFWA 1CT4E 1V2ST 1L4DA 2YNAA 1AKSA 1ZHRA 3KHVA 3BTWE 2A31A 1GJCB 1ZHPA 1NFXA 1AFQC 1YLDA 2FPZA 2ZGBH 1ZSLA 2XCNA 5BRRE 3UNSA 1A1RA 2Y5FA 2W7UA 3RU4E 1UVOA 1CGHA 1BITA 1O3JA 4RN6A 4X8VH 2BMGB 4FU9A 1C4Y2 1TFXA 3A82A 1HLTH 6CHAC 1AMHA 4XFQA 2R3YA 4Y0YE 2BY7X 1P2IA 4FUEA 1O3NA 1HAVB 2GKVE 3TGKE 1YCPK 4JZFH 1VJ9U 4DIIH 2FLRH 1EB1H 3GDUA 1P12E 2ZGCA 2FX6A 1RTFB 2PWXA 2WINI 3QTVH 1EJAA 4JZ1A 1GL0E 2HLCA 1FUJA 1EPTB 1NT1A 2PSXA 3NXPA 4NIYA 2FXRA 3S0NA 2FESH 2UWPA 1JOUB 1DUAA 4NFFA 4X1SU 1YC0A 2J9NA 4ZKOU 2ZDAH 1E35B 1YPLH 3TK5A 3FP8E 3SOSA 5FX6A 2KAIB 2HWLB 1N8OC 2A0QB 4GLYA 4CRFA 1WSSH 3RUOA 2XYAA 5I25A 4MNYA 1LVBA 5FBIA 3DFLA 1ETSH 1V2UT 4LZ4B 5A0CA 1AI8H 4TWWA 1BBRH 2R0LA 1AO5A 1DX5M 3KF2A 1ANEA 5C2ZA 4UFFH 4FXGH 4Y7AA 2BLVA 1WYKA 1FONA 1C1WH 3U8RH 1OSSA 1O3OA 1NO9H 2ZECA 2A32A 4J2YB 1YYY1 2ZCHP 4ZXYH 4AGKA 3ZZ4A 5JBTA 1D3TB 3KL6A 3O8CA 1AY6H 2A5KA 2R9PA 2W26A 2XBVA 3M7UA 4ABHA 1XXDA 1A5IA 2V3HH 3LOXA 4BTUB 3RLYH 3SJOA 1C5VA 2NU4E 3MU0A 4DCDA 1OWEA 1LHDH 4O97A 4OGYA 2XBYA 2NWNA 3M35A 2G4TA 3ZVAA 1FI8A 4BAOB 3ENSB 5L2ZH 1EUFA 2FI3E 4Y6DA 1C5LH 1TX6A 1AIXH 1C5ZB 3DHKH 3EA9A 2HOBA 4YZUA 1E38B 2GX4A 4INHA 1ABJH 1FY8E 2Z9LA 3V13A 1H8IH 3A84A 4X1PU 5DG6A 1P09A 3L6PA 3EYDA 3BN9A 3PLKA 1O2ZA 2HNTC 4NSYA 2FOFA 5F6MA 1KXAA 1QB6A 4CHAB 1QNJA 4ZKSU 1HIAA 2HPQH 2PW8H 2F9OA 5ETXA 3M7TA 3QX5H 3UIRA 3A8DA 4QT8C 3U1JB 2WV4A 1MMJN 1GJ7B 1TPSA 3TH3H 3CENA 4ISNA 1TX8A 1GHAF 1K2I1 2IPHA 1Y3VA 3I77A 1SFIA 5GJ4B 2JH5D 1C1MA 4H6SB 3C1KA 1T31A 1S83A 1TPAE 1BMAA 1GMHG 3RXGA 3F68H 4JMYA 4X6MA 1XUIA 5EQSA 1TIOA 1TNHA 2ZU4A 2P59A 2JETB 1UTOA 2Z9GA 4WMFA 3BTKE 4KTSA 4A92A 2J34A 3ZVDA 4Y79A 4BXSA 3RXBA 1AD8H 1P9SA 1VGCC 3BV9B 1GCTB 1K1LA 1C1SA 2O8TA 1IHSH 1GMDF 2DUCA 1TONA 4GVUA 4D7FA 1PPBH 1GMCF 3VPKA 1L2EA 2R2WU 2AMPA 1FY4A 3M5MA 1GI9B 1HAXB 5C5OA 2CHAC 5A09A 2OBQA 3RMNH 1YGCH 2BM2A 3SI4H 2F9NA 1OXGA 2BQWB 1QHRB 3PLPA 3SJ9A 1DT2A 1UTPA 2BDHA 1UTQA 2ANMH 1THPB 1K1PA 1IQLA 1WTGH 5C20A 5FPSA 1CA0B 4FUJA 3SN8A 3RXOA 2Z3EA 1MBQA 1Z1JA 1GGDB 4FVBA 1ZZZA 2J94A 3F9EA 4ZMAH 5JBAS 2QXIA 1RFNA 2UUFB 3C27B 2FTMA 1EPTC 2ZTXA 1ID5H 1BMNH 1TALA 5EPYA 1ZRKA 4XE4A 2ZU2A 2FOBA 4YOIA 4A6LA 1A61H 3Q76A 1ZPBA 3LH3A 1GPZA 1ELDE 3E91A 3VGCC 2UWLA 1O2XA 3PWBA 2FM2A 1BRAA 9ESTA 1FMGA 2ZFQH 4DW2U 1UHBA 1MTWA 2H2ZA 1ZOMA 1DUEA 1DWDH 1O3KA 2FLBH 3QZQA 4SGBE 3M5OA 3RMLH 4JYTA 2ZHQH 2Z3CA 6GCHF 2Z94A 3ZZ8A 3M5NA 1BBRE 4MNXA 3D65E 1FV9A 1GBKA 3TNTA 1IQEA 1WUNH 1C9PA 1GJ9B 4AOQA 1J9CH 2H5CA 1O2IA 4K3JA 3U1IB 3A7ZA 8GCHG 1D6RA 3M3SA 4NGAH 1EP6A 4ZKNU 2AYWA 4JZEH 1BUIA 1KTSB 3AW1A 1N6XA 2ASUB 1BRBE 1O2YA 1Y3UA 2M5TA 3BEFB 1YPEH 2Q6DA 3HPTB 3LGIA 1OYQA 1BB0B 2BDGA 2AGIX 5JYIA 2H9EH 1C4V2 4NZLA 1O3LA 1ARBA 1PYTC 1XMNB 5EPNA 4E7NA 3KN2A 1ZTJA 1C2KA 1VCQA 1DDJA 4YESB 1RIWB 1CHOG 2A7HA 3ESTA 1OWIA 1INCA 1V2WT 3DUXH 2IJOB 2ZGHA 3GY5A 2FS8A 1BCUH 4X2YA 3UUZA 3MHWU 2A4GA 1BIOA 1HJAB 1T8NA 3OSYA 2B8OH 2HVXA 4B1TA 3NUMA 2VH6A 5FCRA 4IW4E 1G3DA 2TBSA 3A85A 4AFZA 3LGYA 3TITA 1O2WA 1Y3XA 2CJIA 1C1TA 1V2LT 5GPIB 1NU9A 3UOUA 1KY9A 2AMQA 2PHBA 2C93B 1GHYH 5E0HA 5F8ZA 1PPEE 3M36A 1XVOA 5AF9H 5IDKA 1TRMA 1NESE 3BTDE 4NZQA 2ZFSA 4WJG2 2PV9B 3HKJB 4AGJA 2BY6X 2AS9A 1V2NT 3MU8A 3R0FA 3SV2H 5DP5A 1TYNA 2D26C 2ZPQA 4CBNA 3OTJE 4YOJA 4KGAA 2Y80A 2G52A 3PLBA 1E0FD 2BX4A 4FU7A 3PV4A 1TRNA 2SGFE 4PROA 4AX9H 1TNJA 3DD2H 4DIHH 3KIDU 1W7XH 2VB0A 2Q6GA 4O3UA 1FIZA 4I8KA 3MH7A 2GCTB 1AUJA 5L6NH 5PTPA 3K6ZA 1GCTC 1P57B 3LGWA 2G5NA 4OS7A 4BAMB 1FLEE 1XUGA 1NC6A 2B0FA 2QGRA 4NA8A 5EU8A 2BD7A 1IOEA 1UK3A 1ZR0A 3GCHB 3ZVCA 5C1XA 3E8LA 3LPRA 3STIA 4LOYH 1MTNB 1AUTC 2XWAA 2GGVB 2EI7A 1FY3A 3IITA 2GP9B 3SW2B 1ETTH 1UTJA 2FYRA 4DGJA 1OWJA 1CA0C 3AVZA 5A0AE 1NROH 4FU8A 1G9IE 3LJJA 3HGPA 1DFPA 1O3BA 1DSTA 1ZPCA 2D2DA 3IWMA 5F8XA 1GGDC 1HXFH 3MOCA 3ZZAA 1F0RA 4B76A 2ZKSA 2CMYA 1NY22 3T5FH 4E05H 2ZQ2A 6LPRA 2RA3A 1GI6A 1H9IE 2ZFTA 4DG4A 3UR9A 3QZRA 2H9TH 4UFGH 3UWIA 5B6OA 4NIVA 1A7SA 1C1VH 1HYLA 1PPCE 2ODYB 3ZV8A 1HAHH 4XBCA 2O8MA 4IMQA 1HFDA 4NSVA 2FOMB 2R2MB 4FUCA 2SGAA 1W7GH 2H6MA 2A7CA 5K0HA 3MNXA 2DE8A 1TGTA 2J92A 3K65B 1RJXB 4ZHMU 3HK3B 5A2MH 2YOLA 3ZVBA 4X2WA 1GVZA 2QV1A 3BIVH 1C1OA 1F92A 3TIUA 1UJ1A 2VJ1A 1J15A 2XBXA 2Y7XA 1WU1A 3UNRA 5EQRA 2ZF0H 1FY1A 2STAE 2RCEA 1FAKH 3H7OA 3LKWA 3KQBA 1TGNA 1BTPA 3QUMP 3LDXH 4YOGA 2QXJA 1QA7A 2OTVA 5C5NA 3E3TA 1GI0A 4FUHA 5EQQA 1MD7A 2ZTZA 3H5CB 5CMXH 3O8BA 4MVNA 1GMHF 1W11U 2VWOA 2WUBA 4WXIA 3TH2H 1ACBE 2QXHA 3OX7U 2PGBB 4TWYA 1FQ3A 3RXIA 3EA8A 4AB9A 4TY7A 2PLXA 2PSYA 3MO3A 1NTPA 2BQ7B 1EXFA 1O2OA 3BEUA 3ITIA 3ATLA 4LXBH 3QN7A 3U8OH 1QIXB 1SOZA 4ISIH 1TQ0B 1LKBA 4B2BA 4ZAEA 1SI5H 1O3GA 5E2PA 1S6FA 2TGTA 1C5YB 4X8SH 3EGKH 1UVTH 4Q7XA 3LH1A 1OOKB 3V12A 1ELFA 1MAXA 5GDSH 4Q7YA 1FDPA 3UQOA 1HAGE 3T27A 1YCPH 1WOFA 1W0ZU 2OBOA 3DA9B 2Q6FA 1AWHB 2W5EA 3GYMA 4Y8XA 3W94A 1MKXK 2TGPZ 2F3CE 2ZFPH 2P16A 3UTUH 2BTCE 2FX4A 3L3TA 1DWBH 1BT7A 2GZ7A 3RXHA 3FFGA 3ZZ7A 5DKMA 2XCFA 4B75A 1A4WH 1EX3A 1TMTH 2ZHFH 1SPJA 4ABBA 2AGEX 4RKOB 3SV9A 1DWCH 1SGEE 1SHHB 2P93A 4WF8A 3RXSA 3UY9A 1CBWB 1MTSA 1MCTA 2B7DH 1GI2A 2FIRH 4YLUA 4IMZA 1GWAA 2OC1A 5EG4A 1WAYB 1BRCE 2OQUA 4IS5A 3RP2A 1CVWH 2VWLA 1B0FA 3SJ8A 4CRCA 3LJOA 1HIAB 4BXWA 1P0SH 3RC6A 1ZMJA 2ANWA 2HNTF 4Z0KA 1HCGA 2XTTB 3P8GA 3A7YA 2VNTA 1P2QA 5AFZH 2GT7A 4ISHH 1Y5BT 1GI5A 2O8UA 4UONA 2ALPA 5FHTA 1MTNC 1NPMA 3EQ0H 5JDUB 1O2UA 3MFJA 2HNTE 1QBNA 1B0EA 2BY5X 1DY9A 1O5CB 1AE5A 1Z6EA 8GCHF 1S84A 4IGDA 2P94A 4I31A 3ZYEA 4U2WA 3ZZ6A 2ZTYA 2AMDA 4GUXA 4ASHA 2VVUA 4THNH 4JYVH 4OS6A 1H8DH 1P3CA 2FDAA 2ULLA 3PYHA 3S9CA 3OY6U 1OP0A 1SMFE 1A2CH 3ATMA 1J14A 1CHOF 2ZDLA 3M3VA 2ZIQH 1C2DA 1A0JA 1OP2A 3U9AH 4Y0ZE 2GV6A 3Q00A 4FUDA 3KCGH 2STBE 3BTTE 1IQFA 1CGJE 1XUFA 3VB6A 5EODA 1C5NH 1LQEA 2EEKA 2A4RA 4NA7A 1EQ9A 3F9GA 3SGQE 1PPZA 1C4U2 1HXEH 1SVPA 2XNIA 3P70B 2WV5A 1QURH 2BD9A 1HJ8A 3UREA 1O2RA 4INLA 1TGBA 1QCPA 1DITH 1S82A 5G4BA 3UPEA 1UTMA 3S69A 2FOAA 3BG8A 1AZZA 3GY3A 3HGNA 5E0JA 4X1QU 2FOHA 3K9XB 3NK8A 5GCHG 3T29A 1GDQA 1GL1A 3KQCA 4IBLH 1MU8B 2ZDKA 4YT6H 1Z71A 2ZNKH 1RGQA 1THRH 1CU1A 2ZPSA 1EP5A 2VIQA 3ATWA 3ELAH 5CHAB 4KKDA 1WQSA 1LPKB 1OWHA 4BOHA 4F49A 3URCA 1XKAC 1TBRH 1IQGA 3GCTG 1F2SE 1TAWA 5C1YA 4AYVB 5HM2A 3E16B 1TNGA 2QCYA 1P2MA 4TPYA 2BD8A 4A1XA 5HGGA 4X6PA 4ABEA 2GT8A 2QA9E 1GVKB 4GAWA 1Y8TA 3BG4B 1KDQA 4IC5A 1HNEE 1ELAA 5DP7A 3TJVA 1F7ZA 2CV3A 4BAHB 2R3UA 1QRZA 2C4FH 1JIMA 1QY6A 1NZQH 2A2QH 1IQHA 4Y10E 3SUDA 2RG3A 2NU2E 4ISLA 2ZHWH 4JYUH 4WVPE 1ZHMA 2TRMA 5T6GA 1GBTA 4BANB 5L2YH 3RMOH 4AFQA 2SGQE 3SORA 1GBMA 3OY5U 4WXVA 3UR6A 3RXQA 5IYTA 1L0ZA 1HAVA 1IAUA 1GG6B 2VIWA 2BD2A 1LPZB 3LGTA 1YPGH 1LDTT 2C8ZB 1A0HB 1PJPA 3CP7A 3SV8A 1ZSKA 2P3FH 1IQKA 1SGYE 3A8BA 3AW0A 5FXLA 1HGTH 1JRTA 3AAVA 4ZHAA 4U32A 4KELA 3SI3H 1FXYA 1EKBB 1EPTA 1V2QT 3GY8A 4ZUHA 4HGCA 2QF0A 1QQUA 2VIVA 1QL7A 3GDSA 4BNRA 3GCNA 1C2IA 1YPKH 2OP9A 1H1BA 1PQ7A 2Z9IA 3LONA 5ESTE 2BDBA 5K7RA 1QL9A 1DE7H 5T6DA 5JB8S 1LVOA 3SU5A 5C67A 2J95A 3MNBA 2ZA5A 3SJKA 1Y59T 4D76A 4WWYA 3MWIU 3SV7A 1O3CA 2WPIS 1EASA 1SC8U 1UTLM 3VXFH 5GWZA 5BPEA 4XOJA 2CF8H 2OD3B 4ABIA 7LPRA 2G55A 2Z3DA 3LIWA 3QGJA 1T8MA 1TOMH 2I6QA 1IQMA 3RC5A 1P02A 2PKSB 4Y8ZA 3HKIB 1S0QA 4WY3A 1Z8JB 1BOQA 2ODPA 2SGPE 2GVFA 1DXPA 1C2JA 2ZPRA 1C2GA 5LPRA 1HAPH 3TVJB 3PTBA 4I8JA 4D9RA 5FBEA 2FODA 2PKAB 1X7AC 1QL8A 3E1XB 3KGPA 4FUGA 2FS9A 4J1YA 1FJSA 2O8WA 2BD4A 4AN7A 1T4UH 1OKXA 1QJ7B 3RM2H 3SU4A 4ABGA 1VZQH 1Z8GA 4H6TA 3Q3XA 4JCNA 1BA8B 2BVRH 2PTNA 1JMOH 2VIDA 3RXLA 1K9OE 4YM9A 4NFEA 3A8AA 1TPPA 3TU7H 2A4OA 1O38A 1K1NA 1TX7A 3OU0A 1DY8A 1K1JA 3SGBE 1GI3A 5ABWA 4R8TB 1ELBA 4KP0A 1KXFA 3ZZBA 2Q1JA 1W2KH 2XWBI 3M3TA 1XM1A 1PQAA 1Y3YA 1L1JA 5AHGH 1O32A 3A7TA 3P8FA 2V3OH 1NRNH 4HI3A 4O3TA 3Q3KA 1BQYA 2ILNA 3A7WA 3SU2A 1D3QB 1XUJA 1G3BA 1JWTA 1KIGH 1GVLA 2QC2A 4DT7B 1V2JT 4ABDA 5CHAC 4AG2A 1TA2A 3RXFA 2CXVA 4M7GA 2A4QA 2NU0E 5T3HA 5LPFA 3PMBB 1O3PB 1QB9A 3Q77A 2PR3A 3FP7E 5C1UA 1U6QA 8KME2 1BTUA 4A7IB 1RRKA 1GHXH 2A5IA 2V35A 4MQAA 3VXEH 2TGDA 1HRTH 1KXDA 5SGAE 4DURA 3RC4A 2OXSA 1Q2WA 3EDXB 1BHXF 3BG4C 2SFAA 4CHAC 1H4WA 1LPGB 3P95A 1LQDB 2ALVA 1QTFA 2A1DB 1NRQH 1ZMNA 1C1RA 1ZSJA 1ZYOA 2XBWA 2C3SA 1EB2A 1TPOA 1MUEB 2QN5T 3SQEE 1IQNA 4UFDH 5FAHA 2ZDVH 4AB8A 3FP6E 3TH4H 4YO9A 5AFYH 1O33A 2A2XH 1TRYA 3A7VA 3HATH 2THFB 1MZDA 1RS0A 1GHVH 1XXFA 1P10A 2BDIA 2FI5E 1SLUB 1TNIA 1NS3A 1GG6C 1TE0A 2P3UB 4MNVA 2G81E 1B7XB 2JETC 2Z7FE 3BIUH 2XC0A 4GSOA 5LGOA 1GJ5H 1MAYA 1BMLA 5FX5A 1NN6A 2AGGX 1D4PB 2ZC9H 4WMEA 7KMEH 3Q3YA 3SUFA 2C8XB 2GMTB 1AN1E 3TJNA 1NRRH 5ESBA 4A1TA 1L4ZA 4K69A 4OS5A 2WUCA 1A0LA 3B8JA 1Y3WA 1AVXA 3L33A 3RLWH 3ZYDA 4RSPA 2F91A 4A5TS 1YP9A 1CHGA 1AFQB 2YNBA 1O3HA 4ZXXH 1A5HA 1Q3XA 3TK9A 1XKBC 1H9HE 3I78A 2G5VA 1O5FH 1ETRH 1OS8A 1V2TT 4ISOA 4NIXA 4X8TH 1QJ6B 1DSUA 1UVUH 3WY8A 1C2HA 4O03A 2O9QA 6CHAB 3MH6A 1N1LA 2BLQA 1PQ5A 3QK1A 1W14U 3FZZA 1MQ5A 3ZVEA 2BZ6H 2V0BA 2BVXH 1E36B 3A87A 4OS1A 4HZHA 2Z9KA 1HB0B 4MPVA 1C5UA 2P95A 2R0KA 1LO6A 1NU7B 3SU0A 1F5RA 1P3EA 3DT0H 2GD4B 1DM4B 1OPHB 2SGDE 1TLDA 5EXNA 5T6FA 4K60A 5GCHF 1O2PA 4I33A 2BXUH 3PTNA 3V0XA 1QA0A 1GJAB 1C5OH 1O36A 4X2XA 1GJ4H 1DICA 1SBWA 3M61U 2C8WB 1AKSB 1E37B 2XC4A 5AVDA 1AFEH 3A83A 4Y11E 1ZGVA 1K1OA 1GBAA 1F5LA 2ZCKP 3GCTF 3RXCA 2ZDNA 1LHFH 3SNDA 4CRBA 3HK6B 2G51A 4XBDA 1ZTKA 4IN1A 1O3EA 4H4FA 2QF3A 1P04A 2J4IA 1V2VT 2ZFFH 3MNSA 4HFPB 1IQIA 1GBJA 1EZSC 2AERH 1C1PA 1ZMLA 3GICB 1XUHA 1ANDA 3JZ2B 1W8BH 4BAQB 1G36A 1TA6A 1EAIA 2W3KA 3NKKA 1SQAA 4FVDA 3OYPA 4WMDA 5DO4H 2B9LA 1F5KU 1ELVA 1TOCB 2PTCE 1THSH 2FMJA 3TJOA 1O2LA 1O2JA 2J38A 1YPHC 1C9TA 2TGAA 4GPGA 4CR9A 2BLOA 1MCVA 4X8UH 4CH2B 5HMAA 3E90B 3FAOA 1EOLA 1MKXH 5A8YA 3T26A 1P06A 1Z6JH 4INKA 3S9AA 4AYYB 1UCYK 3K2UA 1DS2E 1MU6B 1LCYA 1RIWC 1SQOA 1BTZA 4ABFA 3TGJE 1ABIH 1YF4A 2FYQA 3N7OA 3VB3A 3MH5A 2VWNA 1GI4A 1DVAH 1HJAC 1ZJDA 2OC7A 1V2KT 1ZLRA 1P8VC 1GBDA 1UO6A 1O5GH 2GDDA 1O35A 1UTNA 1HV7A 1V2RT 2I6SA 1MKWK 4OGXA 5EW2H 5J4QA 2H5DA 2VGCB 1GHWH 3FVFB 4GCHG 2XXLA 1F0UA 1GDUA 1SG8B 2D8WA 1A5GH 2Y82A 3PMJA 1AHTH 1G2MA 1G37A 2ZCLP 1O39A 3UWJH 2P8OB 2H1UA 1TBQH 3LGVA 1O3MA 2UWOA 2EC9H 1P05A 1EAUA 3RU4T 1W13U 1O5BB 1TWXB 2K1QA 1JRSA 4GHTA 2BDCA 1PPHE 1OP8A 2PGQB 3ZZDA 3PMAB 1TB6H 1Y5AT 8LPRA 1ZTLA 5LH8A 2BOKA 1ZJKA 2ESTE 4Y76A 1GDNA 3MNCA 4UEHH 3BTHE 1FIWA 1RXPA 1BMMH 1K1IA 3CS0A 4IC6A 2CF9H 2G8TA 5HYOA 1K28D 1UK2A 5HXFA 1DXWA 4BAKB 1HAOH 3SUGA 3T62A 3W95A 2PUXB 2OC8A 3A88A 2LPRA 4A1VA 4MPXA 3A7XA 2FI4E 3F9FA 3BTME 2GCTC 4JK5A 1XX9A 1VGCB 2H9HA 1YLCA 2FEQH 2HRVA 4WH6A 3MMGA 1HDTH 2UUYA 1L1GA 4AG1A 4CRDA 3SO3A 3K6YA 3FZDA 2CHAB 3GCHC 1VCWA 3ZVGA 4K1SA 5TJXA 6ESTA 1P2OA 1AVGH 2ZHEH 3SQHE 2BDAA 4Q2KA 1F0TA 5DP6A
chains in the Genus database with same CATH superfamily
2WYJA 5DGJA 1O2GH 3QO6A 1NM6A 2HALA 1EZQA 3RDZA 2J2UA 2GDEH 4CH8B 4E7RG 5EJ1A 2HPPH 1L1NA 4K5ZA 3O8RA 1CA8B 1F0SA 1GCDA 1SGIB 2ZDMA 1S0RA 2BZAA 3UOPA 1AE8H 2EA3A 1SB1H 2P3TB 2BQ6B 3GOVB 1TBZH 1W12U 4TPIZ 2W7SA 3V7TA 3LGUA 1EATA 1PYTD 2BD5A 3BTEE 3M5LA 1QJ1B 2J98A 3D49H 1PFXC 2FTLE 1WTHD 1PPGE 1TNLA 4X6OA 5F03A 1QGFA 4RI0A 2AIPA 2BD3A 4I8LA 4WH8A 2ODQA 7ESTE 4MPUA 4BTTB 2OCVB 5KGOA 3VGCB 4OS4A 2F83A 2GZ9A 5CE1A 5E8EH 3SNCA 1UCYE 2F9BH 4AFSA 3OE7D 3BF6H 1QRXA 3VEQB 1CE5A 3SZNA 4B74A 1HAZB 4K2YA 1W10U 1V2OT 3B9FH 1BJUA 1YPMH 1QQ4A 2HGTH 3LU9B 4ZH8A 4UD9H 1XVMA 1AQ7A 5DN6D 1TABE 2FP7B 2SNVA 4LK4A 1FPCH 7GCHG 1SLWB 2GCHG 1C2MA 1SHYA 4Y71A 1SSXA 4UFEH 2FOEA 4RT1A 1O2SA 2BB4A 2RDLA 1D9IA 1MQ6A 4FUBA 1J8AA 1BTXA 1SOTA 4X1NU 3A89A 1AVWA 3NCLA 3P17H 3SNBA 2JH6D 3BTQE 3O8DA 1DLKB 2J5UA 1O5EH 3SHCH 3P6ZB 1HAIH 2C8YB 4OS2A 3VG8A 5E2OA 1KLIH 2OC0A 4I8GA 2WV9A 1ESTA 1UHBB 3F6UH 1BTYA 1HJ9A 4RKJB 1VJAU 3STJA 1O2VA 5JPMH 3MO6A 1P01A 5F8TA 3GY6A 1AU8A 4NWLA 1CT2E 3SYJA 2Y7ZA 1BBRK 4Z1MD 2KFWA 1YBWA 2IOTA 2L6OA 1ZPZA 3QTOH 4X2VA 2KCAA 1ORFA 2UUKB 1G3CA 4MLFB 1C1UH 3MO9A 3AASA 2VGCC 1Z8IB 5DP9A 2JKHA 2GZ8A 2VVCA 2TIOA 1DOJA 4ESTE 1LKAA 1FAXA 2KM0A 4AZ2B 4AFUA 3R3GB 1C5XB 3A8CA 3I29A 2P8OC 1BDAA 2XW9A 3VFEA 1GI7B 2BLWA 4X6NA 3PRDA 1TGCA 1P2KA 3DCLA 3P8OA 3ZZ5A 1AZ8A 2FOGA 2ZWLH 4B6FA 2BDYA 2ZQ1A 1KLTA 4TY6A 5C0TA 3U28C 1A3EH 2IJD1 1C5QA 1XUKA 1IHTH 4TYDA 1O2QA 2IN2A 3H7TA 1QBOA 1WDIA 3T25A 1C1QA 1QFKH 3A86A 3MYWA 3A80A 2W3IA 1KXBA 2KX4A 4D7GA 1O2KA 1HAYB 3ZZCA 4NIWA 3SNAA 1KTTB 4K1TA 1CBWC 1RD3B 1CSOE 1MH0A 2ANKH 3CS7A 3RXAA 2KAIA 3G01A 3V3MA 1Y5UT 3GCOA 1C5TA 1SGFA 2Y5HA 4K8YA 2VIOA 2QY0B 2V7QD 4ACAA 5KEDA 3LC5A 3SU3A 3ZZ3A 1GHBG 1YWUA 2YMSB 4ABAA 1TMUH 3TGIE 5EXMA 1GBFA 1O3FA 1GJDB 3B23B 4JZDH 1SGCA 4Z6AH 4ZROA 3MU4A 4KTUA 1SLVB 2GV7A 3T2NA 1K22H 2PP6A 1FNIA 1OYTH 2G4UA 2WYGA 3QDZB 4UE7H 1H9LB 5GXPA 1OWKA 5A8XA 1O2HA 4CRGA 3JZ1B 1LHGH 1GBHA 4HTCH 2DE9A 1GBIA 1PPFE 1GBLA 1HBTH 2NU1E 2HVYB 3F9HA 1EZXC 1FY5A 4VGCB 1VITG 2RDEA 4MG3A 2QF4A 1V3XA 3BTFE 4I32A 3BSQA 3QLPH 1P03A 1NFUA 4I8HA 2BY9X 3DSPA 2ZHDA 4UDWH 5DP4A 1UVSH 4DOQA 1HUTH 1O31A 2VU8E 1CGIE 2GJGA 3KQDA 1GBEA 1O2TA 2C90B 3KYGA 1Z1IA 1WV7H 1ESBA 3NZIA 4NCYA 3SNEA 5JB9S 2JIZD 1BHXB 1O37A 1T32A 3RXJA 2VWMA 5DPAA 2WPDD 1PQ8A 1EOJA 5A0BA 2WPMS 4GCHF 4JZIA 1SFQB 3QGNB 3PMHB 1BJVA 1K1MA 1QB1A 1UK4A 4MDSA 1M9UA 3EE0B 3LT3A 2F9VA 3ZZ9A 2BHGA 2ZGXH 1C5MD 1JIRA 2BX3A 4RT0A 1MBMA 5H4IB 1NRSH 1RTKA 2B5TB 5C3NA 5EXLA 1V2MT 1FZZA 2XRCA 1MTUA 1BTWA 1GHZA 1AB9B 2SNWA 1JXPA 3GY7A 3OFND 1SQTA 1ANBA 1GJ6A 3GY2A 4K1EA 3RXUA 4B71A 4B73A 1YKTA 3D23A 1T8LA 1KSNA 1KXCA 1AWFH 3NWUA 3KEEA 3PO1B 1DLEA 3RXDA 3UFAA 3DFJA 1D3PB 2FOCA 5TCCA 4D8NA 1MTVA 1D3DB 1Z7KA 2D1JA 3UQVA 2F9PA 1BTHH 3IG6B 4JK6A 3VB5A 2OQ5A 5FCKA 1UTKA 2SGEE 1V6DA 3F2HA 5L30H 2BYAX 2OUAA 4CR5A 2UUJB 3W1EA 1T7CA 2IPQX 3ATIA 3M37A 3N7EA 3PM3A 1SGQE 2ZI2H 5DP8A 2FO9A 4U01A 4X0WU 4XBBA 4YT7H 2V6NA 4CREA 3PB1E 1D6WA 1LVMA 1O5AB 1SGRE 5IK2D 3P8NA 1IQJA 3RXRA 4Q4LA 1DANH 2K8IA 3D62A 2CGAA 3KQEA 3AAUA 2ZP0H 1E34B 4ZHLU 4F4OC 1G30B 5A8ZA 1SL3A 2Y81A 2VVVA 4XSKU 1OX1A 1YPHE 3T28A 1SGFG 3VB4A 3RXTA 1T8OA 1W0YH 1UMAH 1FN6A 5E0GA 2PUQH 3BTGE 3KNXA 1FX0B 1ELGA 1C2FA 5EJLA 2WPJS 1O2MA 4AORA 4I7YH 4ABJA 1DWEH 2PKAA 2AFQB 4E06H 3E0NB 3TPIZ 1VITH 3ATKA 1QRWA 2OINA 1S81A 5GNDA 1O3DA 1C2EA 1VCPA 2Y6TA 1VR1H 1ZGIA 1KXEA 1NBMD 4FUIA 4GHQA 3KQ5A 2Z9JA 2VINA 1FN8A 2FZZA 2F9UA 3LC3A 2A45B 2AIQA 2ZU1A 2WPKS 3SJIA 1CT0E 1S5SA 2XC5A 3SUEA 1K21H 4ZCNA 1HPGA 3A81A 1SGPE 5JBCS 1B5GH 2OLGA 4BTIB 1SR5C 1SGNE 2YMSC 5DK1A 1GJ8B 3GISB 1AGJA 3TK6A 7GCHF 4NWKA 5HM9A 1S6HA 2GCHF 1NRPH 1GHAG 4CBOA 4MNWA 2VH0A 2A7JA 1QBVH 2PKSC 1O34A 2AH4X 4KTCA 3S9BA 2G00A 2ZU5A 3MH4A 2JJ2D 3FANA 4CRAA 2CN0H 1QR3E 1J17T 1ELTA 1V2PT 1WCZA 3QWCH 3MTYA 4DJZB 1LMWB 1G3EA 2GTBA 2ZGJA 4Y8YA 5EOKA 4IN2A 1CO7E 1P2NA 1UCYH 3GY4A 4K8BA 5FPYA 3U69H 3U98H 4VGCC 1N8OB 1GI1A 4Q7ZA 1LVYA 4U30A 9LPRA 1GMDG 1UVPA 1GMCG 4YLQH 1J16A 1LTOA 1TNKA 1P9UA 1O30A 3RU4D 2NU3E 1C5WB 1GI8B 2VIPA 1MD8A 1TMBH 1Q31A 1O2NA 4NG9H 3SV6A 2XOKD 3ODFA 3MU5A 1TGSZ 3S7KB 4B2CA 1A46H 1WBGB 4NA9H 2BXTH 5TCAA 2Z6BD 1MKWH 5EIYA 1CQQA 5J4SA 2EI8A 1G32B 1EZUC 4Q80A 3URDA 1MABB 4O9VA 4YTAA 3UNQA 1C2LA 1A3BH 1C5SA 1H8ED 3M7QA 3EA7A 2WPLS 4XDEA 1YM0A 1C1NA 1DPOA 3BEIB 3CNRA 1LHCH 1W0KD 1W3CA 1GBBA 1ZRBA 1YCPM 3SHAH 3F1SB 1SLXB 2Y5GA 5I46H 1KYNA 2A5AA 2ZEBA 1WQVH 3RXEA 5C0UA 2QAAA 5DP3A 3UB0A 1C5RA 1O3IA 1EJMA 3RXMA 2FWWA 1ANCA 1LHEH 3GDVA 1AB9C 3U8TH 1G2LA 2O8LA 1BRUP 2ZO3H 2WPHS 1TQ7B 4H42U 2BOHB 3N99A 5FPTA 2LNCA 1ESAA 1ELEE 3SU1A 3MU1A 3F3BA 2AEIH 2PFEA 2QYIA 2ZZUH 2ANYA 1GJBB 1SGTA 1SGDE 5GIBA 1NFYA 1EAXA 2ZFRH 3PO1C 1ELCA 3EAJA 1KLJH 2JH0D 6GCHG 4X1RU 2WZQA 3E6PH 2ZU3A 3SBKA 1O5DH 3E0PB 1RTLA 3F2FA 1P11E 3PWCA 1N6YA 3RMMH 1EJNA 3ODDA 2TPIZ 3S7HB 3RXPA 3TNSA 1NBME 3SGAE 4D9QA 1P2JA 1VKYA 2BVSH 3NPSA 2QIQA 3RXVA 1O0DH 2BY8X 1GHBF 1BZXE 1C5PA 3SU6A 4ZKRU 3RM0H 8ESTE 1JBUH 4R0IA 3ZVFA 3ZV9A 3PV5A 3GYLB 1GBCA 4DVAU 3PROA 4B2AA 3FKSD 5EJZA 4FUFA 3P92A 1T4VH 1O3AA 3MI4A 4Y7BA 5EW1H 4SGAE 1S85A 2EI6A 5EGMA 3TLOA 4LZ1H 3RXKA 4DY7B 1MZAA 1YPJH 3TJUA 4FETA 5JBBS 2QXGA 4MTBA 3VB7A 1ARCA 2ZG0H 1FPHH 5DJ7A 1OWDA 2RA0A 2GMTC 1VITF 4MPWA 1EAWA 1Z8RA 5LPEA 1KDQB 1NFWA 1CT4E 1V2ST 1L4DA 2YNAA 1AKSA 2WSSD 1ZHRA 3KHVA 3BTWE 2A31A 1GJCB 1ZHPA 2F43B 1NFXA 1AFQC 1YLDA 2FPZA 2ZGBH 1ZSLA 2XCNA 5BRRE 3UNSA 1A1RA 2Y5FA 2W7UA 3RU4E 1UVOA 1CGHA 1BITA 1O3JA 4RN6A 4X8VH 2BMGB 4FU9A 1C4Y2 1TFXA 3A82A 1HLTH 6CHAC 1AMHA 4XFQA 2R3YA 4Y0YE 2BY7X 2HLDD 1P2IA 4FUEA 1O3NA 1HAVB 2GKVE 3TGKE 1YCPK 4JZFH 1VJ9U 4Q63A 4DIIH 2FLRH 1EB1H 3GDUA 1P12E 2ZGCA 2FX6A 1RTFB 2PWXA 2WINI 3QTVH 1EJAA 4JZ1A 1GL0E 2HLCA 1FUJA 1EPTB 1NT1A 2PSXA 3NXPA 4NIYA 2FXRA 3S0NA 2FESH 2KCPA 2UWPA 1JOUB 1DUAA 4NFFA 4X1SU 1YC0A 2J9NA 4ZKOU 2ZDAH 1E35B 1YPLH 3TK5A 3FP8E 3SOSA 5FX6A 2KAIB 2HWLB 1N8OC 2A0QB 4GLYA 4CRFA 1WSSH 3RUOA 2XYAA 5I25A 4MNYA 1LVBA 5FBIA 3DFLA 1ETSH 1V2UT 4LZ4B 5A0CA 1AI8H 4TWWA 1BBRH 2R0LA 1AO5A 1DX5M 3KF2A 1ANEA 5C2ZA 4UFFH 4FXGH 4Y7AA 2BLVA 1WYKA 1FONA 1C1WH 3U8RH 3OTPA 1OSSA 1O3OA 1NO9H 2ZECA 2A32A 4J2YB 1YYY1 1BMFD 2ZCHP 4ZXYH 4AGKA 3ZZ4A 5JBTA 1D3TB 3KL6A 3O8CA 1AY6H 2A5KA 2R9PA 2W26A 3WW7A 2XBVA 3M7UA 4ABHA 1XXDA 1A5IA 2V3HH 3LOXA 4BTUB 3RLYH 3SJOA 1C5VA 2NU4E 3MU0A 4DCDA 1OWEA 1LHDH 4O97A 4OGYA 2XBYA 2NWNA 3M35A 2G4TA 3ZVAA 1FI8A 4BAOB 3ENSB 5L2ZH 1EUFA 2FI3E 4Y6DA 1C5LH 1TX6A 3ZIAD 1AIXH 1C5ZB 3DHKH 3EA9A 2HOBA 4YZUA 1E38B 2GX4A 4INHA 1ABJH 1FY8E 2Z9LA 3V13A 1H8IH 3A84A 4X1PU 5DG6A 1P09A 3L6PA 3EYDA 3KYFA 3BN9A 3PLKA 1O2ZA 2HNTC 4NSYA 2FOFA 5F6MA 1KXAA 1QB6A 4CHAB 4DT4A 1QNJA 4ZKSU 1HIAA 2HPQH 2PW8H 2F9OA 3PV2A 5ETXA 2K0QA 3M7TA 3QX5H 3UIRA 3A8DA 1WXRA 4QT8C 3U1JB 2WV4A 1MMJN 1GJ7B 1TPSA 3TH3H 3CENA 4ISNA 1TX8A 1GHAF 1K2I1 2IPHA 1Y3VA 3I77A 1SFIA 5GJ4B 2JH5D 1C1MA 3EE7A 4H6SB 3C1KA 1T31A 1S83A 1TPAE 1BMAA 3UAIC 1GMHG 3RXGA 3F68H 4JMYA 4X6MA 1XUIA 5EQSA 1TIOA 1TNHA 2ZU4A 2P59A 2JETB 1UTOA 2Z9GA 4WMFA 3BTKE 4KTSA 4A92A 2J34A 3ZVDA 4Y79A 5HKKD 1EFRD 4BXSA 3RXBA 1AD8H 4XD7D 1P9SA 1VGCC 3BV9B 1GCTB 1K1LA 1C1SA 4P02A 2O8TA 1IHSH 1GMDF 2DUCA 1TONA 4GVUA 4D7FA 1PPBH 1GMCF 3VPKA 1L2EA 2R2WU 2AMPA 1FY4A 3M5MA 1GI9B 1HAXB 5C5OA 2CHAC 5T1VA 5A09A 2OBQA 3RMNH 1YGCH 2BM2A 2CK3D 3SI4H 2F9NA 1OXGA 2BQWB 1QHRB 5C94A 3PLPA 3SJ9A 1DT2A 1UTPA 2BDHA 1UTQA 2ANMH 1THPB 1K1PA 1IQLA 1WTGH 5C20A 5FPSA 1CA0B 4FUJA 3SN8A 3RXOA 2Z3EA 1MBQA 1Z1JA 1GGDB 4FVBA 1ZZZA 2J94A 3F9EA 4ZMAH 5JBAS 2QXIA 1RFNA 2UUFB 3C27B 2FTMA 1EPTC 2ZTXA 1ID5H 1BMNH 1TALA 5EPYA 1ZRKA 4XE4A 2ZU2A 2FOBA 4YOIA 4A6LA 1A61H 3Q76A 1ZPBA 3LH3A 1GPZA 1ELDE 3E91A 3VGCC 2UWLA 1O2XA 3F2GA 3PWBA 2FM2A 1BRAA 9ESTA 1FMGA 2ZFQH 4DW2U 1UHBA 1MTWA 2H2ZA 1ZOMA 1DUEA 1DWDH 1O3KA 2FLBH 3QZQA 4SGBE 3M5OA 1W0JD 3RMLH 4JYTA 2ZHQH 2Z3CA 6GCHF 2Z94A 3ZZ8A 3M5NA 1SKYE 1BBRE 4MNXA 3D65E 1FV9A 1GBKA 3TNTA 1IQEA 1WUNH 1C9PA 1GJ9B 4AOQA 1J9CH 2H5CA 1O2IA 4K3JA 3U1IB 3A7ZA 4F48B 8GCHG 1D6RA 3M3SA 4NGAH 1EP6A 4ZKNU 2AYWA 4JZEH 1BUIA 1KTSB 3AW1A 1N6XA 2ASUB 1BRBE 1O2YA 1Y3UA 2M5TA 3BEFB 1YPEH 2Q6DA 3HPTB 3LGIA 1OYQA 1BB0B 2BDGA 2AGIX 5JYIA 2H9EH 1C4V2 4NZLA 1O3LA 1ARBA 1PYTC 1XMNB 5EPNA 4E7NA 3KN2A 1ZTJA 1C2KA 1VCQA 1DDJA 4YESB 1RIWB 1CHOG 2A7HA 3ESTA 1OWIA 1INCA 1V2WT 3DUXH 2IJOB 2ZGHA 3GY5A 2FS8A 1BCUH 4X2YA 3UUZA 3MHWU 2A4GA 1BIOA 1HJAB 1COWD 1T8NA 3OSYA 2B8OH 2HVXA 4B1TA 3NUMA 2VH6A 5FCRA 4IW4E 1G3DA 2TBSA 3A85A 4AFZA 3LGYA 3TITA 1O2WA 1Y3XA 2CJIA 1C1TA 1V2LT 5GPIB 1NU9A 3UOUA 1KY9A 2AMQA 2PHBA 2C93B 1GHYH 5E0HA 5F8ZA 1PPEE 3M36A 1XVOA 2KCYA 5AF9H 5IDKA 1TRMA 1NESE 3BTDE 4NZQA 2ZFSA 4WJG2 2PV9B 3HKJB 4AGJA 2BY6X 3F0OA 2AS9A 1V2NT 3MU8A 3R0FA 3SV2H 5DP5A 1TYNA 2D26C 2ZPQA 4CBNA 3DSOA 3OTJE 4YOJA 4KGAA 2Y80A 2G52A 4AC9A 3PLBA 1E0FD 2BX4A 4FU7A 1E79D 3PV4A 1TRNA 2SGFE 4PROA 4AX9H 1TNJA 3DD2H 4DIHH 3KIDU 1W7XH 2VB0A 2Q6GA 4O3UA 1FIZA 4I8KA 3MH7A 2GCTB 1AUJA 5L6NH 5PTPA 3K6ZA 1GCTC 1P57B 3LGWA 2G5NA 4OS7A 4BAMB 1FLEE 1XUGA 1NC6A 2B0FA 2QGRA 4NA8A 5EU8A 2BD7A 1IOEA 1UK3A 1ZR0A 3GCHB 3ZVCA 5C1XA 3E8LA 3LPRA 2EY4C 3STIA 4LOYH 1MTNB 1AUTC 2XWAA 2GGVB 2EI7A 1FY3A 3IITA 3DSGA 4TSFD 2GP9B 3GS9A 3SW2B 1ETTH 1UTJA 2FYRA 4DGJA 1OWJA 1CA0C 3AVZA 5A0AE 1NROH 4FU8A 1G9IE 3LJJA 3HGPA 1DFPA 1O3BA 1DSTA 1ZPCA 2D2DA 3IWMA 5F8XA 1GGDC 1HXFH 3MOCA 3ZZAA 1F0RA 4B76A 2ZKSA 2CMYA 1NY22 3T5FH 4E05H 2ZQ2A 6LPRA 2RA3A 1GI6A 1H9IE 2ZFTA 4DG4A 3UR9A 3QZRA 2H9TH 4UFGH 3UWIA 5B6OA 4NIVA 1A7SA 1C1VH 1HYLA 1PPCE 2ODYB 3ZV8A 1HAHH 4F55A 4XBCA 2O8MA 4IMQA 1HFDA 4NSVA 2FOMB 2R2MB 4FUCA 2SGAA 1W7GH 5CDFE 2H6MA 2A7CA 5K0HA 3MNXA 2DE8A 1TGTA 2J92A 3K65B 1RJXB 4ZHMU 3HK3B 5A2MH 2YOLA 3ZVBA 4X2WA 1GVZA 2QV1A 2W6ID 3BIVH 1C1OA 1F92A 3TIUA 1UJ1A 2VJ1A 1J15A 2XBXA 2Y7XA 1WU1A 3UNRA 5EQRA 2ZF0H 2J98B 1FY1A 2STAE 2RCEA 1FAKH 3H7OA 3LKWA 4FOUC 3KQBA 1TGNA 1BTPA 3QUMP 3LDXH 4YOGA 2QXJA 1QA7A 2OTVA 5C5NA 3E3TA 2JDID 1GI0A 4FUHA 5EQQA 1MD7A 2ZTZA 3H5CB 5CMXH 3O8BA 4MVNA 1GMHF 1W11U 2VWOA 2WUBA 4WXIA 3TH2H 1ACBE 2QXHA 3OX7U 2PGBB 4TWYA 1FQ3A 3RXIA 3EA8A 4AB9A 4TY7A 2PLXA 2PSYA 3MO3A 1NTPA 2BQ7B 1EXFA 1O2OA 3BEUA 3ITIA 3ATLA 4LXBH 3QN7A 3U8OH 1QIXB 1SOZA 4ISIH 1TQ0B 1LKBA 4B2BA 4ZAEA 1SI5H 1O3GA 5E2PA 1S6FA 2TGTA 1C5YB 4X8SH 3EGKH 1UVTH 4Q7XA 3LH1A 1OOKB 3V12A 1ELFA 1MAXA 5GDSH 4Q7YA 1FDPA 3UQOA 1HAGE 3T27A 4B6EA 1YCPH 2EQNA 1WOFA 1W0ZU 2OBOA 3DA9B 2Q6FA 1AWHB 2W5EA 3GYMA 4Y8XA 3W94A 1MKXK 2TGPZ 2F3CE 2ZFPH 2P16A 3UTUH 2BTCE 2FX4A 3L3TA 3FOAA 3FO8D 1DWBH 1BT7A 2GZ7A 3RXHA 3FFGA 3ZZ7A 5DKMA 2XCFA 4B75A 1A4WH 1EX3A 1TMTH 1UW7A 2ZHFH 1SPJA 4ABBA 2AGEX 4RKOB 3SV9A 1DWCH 1SGEE 1SHHB 2P93A 4WF8A 3RXSA 3UY9A 1CBWB 1MTSA 1MCTA 2B7DH 1GI2A 2FIRH 4YLUA 4IMZA 4M9FA 1GWAA 2OC1A 5EG4A 1WAYB 1BRCE 2OQUA 4IS5A 3RP2A 1CVWH 5HIYA 2VWLA 1B0FA 3SJ8A 4CRCA 3LJOA 1HIAB 4BXWA 1P0SH 3RC6A 1ZMJA 2ANWA 2HNTF 4Z0KA 1HCGA 2XTTB 3P8GA 3A7YA 2VNTA 1P2QA 5AFZH 2GT7A 4YXWD 4ISHH 1Y5BT 1GI5A 2O8UA 4UONA 2ALPA 5FHTA 1MTNC 1NPMA 3EQ0H 5JDUB 1O2UA 3MFJA 2HNTE 1QBNA 1B0EA 2BY5X 1DY9A 1O5CB 1AE5A 1Z6EA 8GCHF 1S84A 4IGDA 5C17A 2P94A 4I31A 3ZYEA 4U2WA 3ZZ6A 2ZTYA 2AMDA 4GUXA 4ASHA 2VVUA 1K0HA 4THNH 4JYVH 4OS6A 1H8DH 1P3CA 2FDAA 2ULLA 3PYHA 3S9CA 3OY6U 1OP0A 1SMFE 1A2CH 3ATMA 1J14A 1CHOF 2ZDLA 3M3VA 2ZIQH 1C2DA 1A0JA 1OP2A 3U9AH 4Y0ZE 2GV6A 3Q00A 4FUDA 3KCGH 2STBE 3BTTE 1IQFA 1CGJE 1XUFA 3VB6A 5EODA 1C5NH 1LQEA 2QF5A 2EEKA 2A4RA 4NA7A 1EQ9A 3F9GA 3SGQE 1PPZA 1C4U2 1HXEH 1SVPA 2XNIA 3P70B 2WV5A 1QURH 2BD9A 1HJ8A 3UREA 1O2RA 4INLA 1TGBA 1QCPA 1DITH 1S82A 5G4BA 3UPEA 1UTMA 3S69A 2FOAA 3BG8A 1AZZA 3GY3A 3HGNA 5E0JA 4X1QU 2FOHA 3K9XB 3NK8A 5GCHG 3T29A 1GDQA 1GL1A 3KQCA 4IBLH 1MU8B 2ZDKA 4YT6H 1Z71A 2ZNKH 1RGQA 1THRH 1CU1A 2ZPSA 1EP5A 2VIQA 3ATWA 3ELAH 5CHAB 4KKDA 1WQSA 1LPKB 1OWHA 4BOHA 4F49A 3URCA 1XKAC 1TBRH 1IQGA 3GCTG 1F2SE 1TAWA 5C1YA 4AYVB 5HM2A 3E16B 1TNGA 2QCYA 1P2MA 4TPYA 2BD8A 4A1XA 5HGGA 4X6PA 4ABEA 2GT8A 2QA9E 1GVKB 4GAWA 1Y8TA 3BG4B 1KDQA 4IC5A 2KZ4A 1HNEE 3WWFA 1ELAA 5DP7A 3TJVA 1F7ZA 2CV3A 4BAHB 2R3UA 1QRZA 2C4FH 1JIMA 1QY6A 1NZQH 2A2QH 1IQHA 4Y10E 3SUDA 2RG3A 2NU2E 4ISLA 2ZHWH 2YMSD 4JYUH 4WVPE 2LP6A 1ZHMA 2TRMA 5T6GA 1GBTA 4BANB 5L2YH 3RMOH 4AFQA 2SGQE 3SORA 1GBMA 3OY5U 4WXVA 3UR6A 3RXQA 5IYTA 1L0ZA 5F53A 1HAVA 1IAUA 1GG6B 2VIWA 2BD2A 1LPZB 2M2AA 3LGTA 1YPGH 1LDTT 2C8ZB 1A0HB 1PJPA 3CP7A 3SV8A 1ZSKA 2P3FH 4XRNA 1IQKA 1SGYE 3A8BA 3AW0A 5FXLA 1HGTH 1JRTA 2LELA 3AAVA 4U32A 4ZHAA 4KELA 3SI3H 1FXYA 1EKBB 1EPTA 1V2QT 3GY8A 4ZUHA 4HGCA 2QF0A 1QQUA 2VIVA 1QL7A 3GDSA 4BNRA 3GCNA 1C2IA 1YPKH 2OP9A 1H1BA 1PQ7A 2Z9IA 3LONA 5ESTE 2OK5A 2BDBA 5K7RA 1QL9A 1DE7H 5T6DA 5JB8S 1LVOA 3SU5A 5C67A 2J95A 3MNBA 2ZA5A 3SJKA 1Y59T 4D76A 3H09A 4WWYA 3MWIU 3SV7A 1O3CA 2WPIS 4HG6A 1EASA 1SC8U 1UTLM 3VXFH 5GWZA 5BPEA 4XOJA 4TT3D 2CF8H 2OD3B 4ABIA 7LPRA 2G55A 2Z3DA 3LIWA 3QGJA 1T8MA 1TOMH 2I6QA 1IQMA 3RC5A 1P02A 2PKSB 4Y8ZA 3HKIB 1S0QA 4WY3A 1Z8JB 1BOQA 2ODPA 5HIZA 2SGPE 2GVFA 1DXPA 1C2JA 2ZPRA 1C2GA 5LPRA 1HAPH 3TVJB 3PTBA 4I8JA 4D9RA 5FBEA 2FODA 1E1RD 2PKAB 1X7AC 1QL8A 3E1XB 3KGPA 4FUGA 2FS9A 4J1YA 1FJSA 2O8WA 2BD4A 4AN7A 1T4UH 1OKXA 1QJ7B 3RM2H 3SU4A 4ABGA 1VZQH 3NRLA 4ACBA 1Z8GA 4H6TA 3Q3XA 4JCNA 5B6LA 1BA8B 2BVRH 2PTNA 1JMOH 2VIDA 5KECA 5CHBA 3RXLA 1K9OE 4YM9A 4NFEA 3A8AA 1TPPA 3TU7H 2A4OA 1O38A 1K1NA 1TX7A 3OU0A 1DY8A 1K1JA 3SGBE 1GI3A 5ABWA 4R8TB 1ELBA 4KP0A 1QZ8A 1KXFA 3ZZBA 2Q1JA 1W2KH 2XWBI 3M3TA 1XM1A 1PQAA 1Y3YA 1L1JA 5AHGH 1O32A 3A7TA 3P8FA 2V3OH 1NRNH 4HI3A 4O3TA 3Q3KA 1BQYA 2ILNA 3A7WA 3SU2A 1D3QB 1XUJA 1G3BA 1JWTA 1KIGH 1GVLA 2QC2A 4DT7B 1V2JT 4ABDA 5CHAC 4AG2A 1TA2A 4I86A 3OAAD 3RXFA 2CXVA 4M7GA 2A4QA 2NU0E 5T3HA 5LPFA 1YLNA 3PMBB 1O3PB 1QB9A 3Q77A 2PR3A 3FP7E 5C1UA 1SQRA 1U6QA 8KME2 1BTUA 4A7IB 5FL7D 1RRKA 1GHXH 2A5IA 2V35A 4MQAA 3VXEH 2TGDA 1HRTH 1KXDA 5SGAE 4DURA 3RC4A 2OXSA 1Q2WA 3EDXB 1BHXF 3BG4C 2SFAA 4CHAC 1H4WA 1LPGB 3P95A 1LQDB 2ALVA 1QTFA 2A1DB 1NRQH 1ZMNA 1C1RA 1ZSJA 1KMHB 1ZYOA 2XBWA 2WHXA 2C3SA 1EB2A 1TPOA 1MUEB 2QN5T 3SQEE 1IQNA 4UFDH 5FAHA 2ZDVH 4AB8A 3FP6E 3TH4H 4YO9A 5AFYH 1O33A 2A2XH 1TRYA 3A7VA 3HATH 2THFB 1MZDA 1RS0A 1GHVH 1XXFA 1P10A 2BDIA 2KCOA 3MQKC 2FI5E 1SLUB 1TNIA 1NS3A 1GG6C 1TE0A 2P3UB 4MNVA 2G81E 1B7XB 2JETC 2Z7FE 3BIUH 2XC0A 4GSOA 5LGOA 1GJ5H 2KR7A 1MAYA 1BMLA 5FX5A 1E1QD 1NN6A 2AGGX 1D4PB 2ZC9H 4WMEA 7KMEH 3Q3YA 3SUFA 2C8XB 2GMTB 1AN1E 3TJNA 1NRRH 5ESBA 4A1TA 1L4ZA 4K69A 4OS5A 2WUCA 1A0LA 3B8JA 1Y3WA 1AVXA 3L33A 3RLWH 3ZYDA 4RSPA 2F91A 4A5TS 1YP9A 1CHGA 1AFQB 2YNBA 1O3HA 4ZXXH 1A5HA 1Q3XA 3TK9A 2VBCA 1XKBC 1H9HE 3I78A 2G5VA 1O5FH 1ETRH 1OS8A 1V2TT 4ISOA 4NIXA 4X8TH 1QJ6B 1DSUA 1UVUH 3WY8A 1C2HA 4O03A 2O9QA 1S6LA 6CHAB 3MH6A 1N1LA 2BLQA 2J97A 1PQ5A 3QK1A 1W14U 3FZZA 2AHME 1MQ5A 3ZVEA 2BZ6H 2V0BA 2BVXH 1E36B 3A87A 4OS1A 4HZHA 2Z9KA 1HB0B 4MPVA 1C5UA 2P95A 2R0KA 1LO6A 1NU7B 3SU0A 1F5RA 1P3EA 3DT0H 2JJ1D 3F0PA 2GD4B 1DM4B 1OPHB 2SGDE 1TLDA 5EXNA 5T6FA 4K60A 5GCHF 1O2PA 4I33A 2BXUH 3PTNA 3V0XA 1QA0A 1GJAB 1C5OH 2L74A 4ASUD 1O36A 4X2XA 1GJ4H 1DICA 1OHHD 1SBWA 3M61U 2C8WB 1AKSB 1E37B 2XC4A 5AVDA 3FN8A 1AFEH 3A83A 4Y11E 1ZGVA 1K1OA 1GBAA 1F5LA 2ZCKP 3GCTF 3RXCA 2ZDNA 1LHFH 3SNDA 3SZEA 3PRBA 4CRBA 3HK6B 2G51A 4XBDA 1ZTKA 4IN1A 1O3EA 2RFKC 4H4FA 2QF3A 1P04A 4P00A 2J4IA 1V2VT 2ZFFH 3MNSA 4HFPB 1IQIA 1GBJA 1EZSC 2AERH 1C1PA 1ZMLA 3GICB 1XUHA 1ANDA 3JZ2B 1W8BH 4BAQB 1G36A 1TA6A 1EAIA 2W3KA 3NKKA 1SQAA 4FVDA 3OYPA 4WMDA 5DO4H 2B9LA 1F5KU 1ELVA 1TOCB 2PTCE 1THSH 2FMJA 3TJOA 1O2LA 1O2JA 2J38A 1YPHC 3OEHD 1C9TA 2TGAA 4GPGA 4CR9A 2BLOA 1MCVA 4X8UH 4CH2B 5HMAA 3E90B 3FAOA 2F4LA 1EOLA 1MKXH 5A8YA 3T26A 1P06A 1Z6JH 4INKA 3S9AA 4AYYB 1UCYK 3K2UA 1DS2E 1MU6B 1LCYA 1RIWC 3WWBA 1SQOA 1BTZA 4ABFA 3TGJE 1ABIH 1YF4A 2FYQA 3N7OA 3VB3A 3MH5A 2VWNA 1GI4A 1DVAH 2QE7D 1HJAC 1ZJDA 2OC7A 1V2KT 1ZLRA 1P8VC 1GBDA 1UO6A 1O5GH 2GDDA 1O35A 1UTNA 2W6JD 1HV7A 1V2RT 3N7DA 2I6SA 1MKWK 4OGXA 5EW2H 2XNDD 5J4QA 2H5DA 2VGCB 1GHWH 3FVFB 4GCHG 2XXLA 5DSFA 1F0UA 1GDUA 1SG8B 2D8WA 1A5GH 2Y82A 3PMJA 1AHTH 1G2MA 1G37A 2ZCLP 1O39A 3UWJH 2P8OB 2H1UA 1TBQH 3LGVA 1O3MA 2UWOA 2EC9H 1P05A 1EAUA 3RU4T 1W13U 1O5BB 1TWXB 2K1QA 1JRSA 4GHTA 2BDCA 1PPHE 1OP8A 2PGQB 3ZZDA 3PMAB 1TB6H 1Y5AT 8LPRA 1ZTLA 5LH8A 2BOKA 1ZJKA 2ESTE 4Y76A 1GDNA 3MNCA 4UEHH 3BTHE 4OM9A 1FIWA 1RXPA 1BMMH 1K1IA 3CS0A 4IC6A 2CF9H 2G8TA 5HYOA 1K28D 1UK2A 5HXFA 1DXWA 4BAKB 3AK5A 1HAOH 3SUGA 3T62A 3W95A 2PUXB 2OC8A 3A88A 2LPRA 4A1VA 4MPXA 3A7XA 2FI4E 3F9FA 3BTME 2GCTC 4JK5A 1XX9A 1VGCB 2H9HA 1YLCA 2FEQH 2HRVA 1YY3A 4WH6A 3MMGA 1HDTH 2UUYA 1L1GA 4AG1A 4CRDA 3SO3A 3K6YA 3FZDA 2CHAB 3GCHC 1VCWA 2V3MA 3ZVGA 4K1SA 5TJXA 1H8HD 6ESTA 1P2OA 1AVGH 2ZHEH 3OEED 2BDAA 3SQHE 4Q2KA 1F0TA 5DP6A
chains in the Genus database with same CATH topology
2WYJA 5DGJA 1O2GH 3QO6A 1NM6A 2HALA 1EZQA 3RDZA 2J2UA 2GDEH 4CH8B 4E7RG 2HPPH 1L1NA 4K5ZA 3O8RA 1CA8B 1F0SA 1GCDA 1SGIB 2ZDMA 1S0RA 2BZAA 3UOPA 1AE8H 2EA3A 1SB1H 2P3TB 2BQ6B 3GOVB 1TBZH 1W12U 4TPIZ 2W7SA 3V7TA 3LGUA 1EATA 1PYTD 2BD5A 3BTEE 3M5LA 1QJ1B 3D49H 1PFXC 2FTLE 1WTHD 1PPGE 1TNLA 4X6OA 5F03A 1QGFA 2AIPA 2BD3A 4I8LA 4WH8A 2ODQA 7ESTE 4MPUA 4BTTB 2OCVB 3VGCB 4OS4A 2F83A 2GZ9A 5CE1A 5E8EH 3SNCA 1UCYE 2F9BH 4AFSA 3BF6H 1QRXA 3VEQB 1CE5A 3SZNA 4B74A 1HAZB 4K2YA 1W10U 1V2OT 3B9FH 1BJUA 1YPMH 1QQ4A 2HGTH 3LU9B 4ZH8A 4UD9H 1XVMA 1AQ7A 1TABE 2FP7B 2SNVA 4LK4A 1FPCH 7GCHG 1SLWB 2GCHG 1C2MA 1SHYA 4Y71A 1SSXA 4UFEH 2FOEA 1O2SA 2BB4A 2RDLA 1D9IA 1MQ6A 4FUBA 1J8AA 1BTXA 1SOTA 4X1NU 3A89A 1AVWA 3NCLA 3P17H 3SNBA 2JH6D 3BTQE 3O8DA 1DLKB 1O5EH 3SHCH 3P6ZB 1HAIH 2C8YB 4OS2A 5E2OA 1KLIH 2OC0A 4I8GA 1ESTA 1UHBB 3F6UH 1BTYA 1HJ9A 4RKJB 1VJAU 3STJA 1O2VA 5JPMH 3MO6A 1P01A 5F8TA 3GY6A 1AU8A 4NWLA 1CT2E 2Y7ZA 1BBRK 1YBWA 2IOTA 1ZPZA 3QTOH 4X2VA 1ORFA 2UUKB 1G3CA 4MLFB 1C1UH 3MO9A 3AASA 2VGCC 1Z8IB 5DP9A 2JKHA 2GZ8A 2VVCA 2TIOA 1DOJA 4ESTE 1LKAA 1FAXA 4AZ2B 4AFUA 3R3GB 1C5XB 3A8CA 3I29A 2P8OC 1BDAA 2XW9A 3VFEA 1GI7B 2BLWA 4X6NA 1TGCA 1P2KA 3P8OA 3ZZ5A 1AZ8A 2FOGA 2ZWLH 2BDYA 2ZQ1A 1KLTA 4TY6A 1A3EH 1C5QA 1XUKA 1IHTH 4TYDA 1O2QA 2IN2A 3H7TA 1QBOA 3T25A 1C1QA 1QFKH 3A86A 3MYWA 3A80A 2W3IA 1KXBA 4D7GA 1O2KA 1HAYB 3ZZCA 4NIWA 3SNAA 1KTTB 4K1TA 1CBWC 1RD3B 1CSOE 1MH0A 2ANKH 3CS7A 3RXAA 2KAIA 3G01A 3V3MA 1Y5UT 3GCOA 1C5TA 1SGFA 2Y5HA 4K8YA 2VIOA 2QY0B 3LC5A 3SU3A 3ZZ3A 1GHBG 4ABAA 1TMUH 3TGIE 5EXMA 1GBFA 1O3FA 1GJDB 3B23B 4JZDH 1SGCA 4Z6AH 4ZROA 3MU4A 4KTUA 1SLVB 2GV7A 3T2NA 1K22H 1FNIA 1OYTH 2G4UA 2WYGA 3QDZB 4UE7H 1H9LB 5GXPA 1OWKA 5A8XA 1O2HA 4CRGA 3JZ1B 1LHGH 1GBHA 4HTCH 2DE9A 1GBIA 1PPFE 1GBLA 1HBTH 2NU1E 3F9HA 1EZXC 1FY5A 4VGCB 1VITG 4MG3A 1V3XA 3BTFE 4I32A 3BSQA 3QLPH 1P03A 1NFUA 4I8HA 2BY9X 2ZHDA 4UDWH 5DP4A 1UVSH 4DOQA 1HUTH 1O31A 2VU8E 1CGIE 3KQDA 1GBEA 1O2TA 2C90B 1Z1IA 1WV7H 1ESBA 3NZIA 4NCYA 3SNEA 5JB9S 1BHXB 1O37A 1T32A 3RXJA 2VWMA 5DPAA 1PQ8A 1EOJA 5A0BA 2WPMS 4GCHF 4JZIA 1SFQB 3QGNB 3PMHB 1BJVA 1K1MA 1QB1A 1UK4A 4MDSA 1M9UA 3EE0B 3LT3A 2F9VA 3ZZ9A 2BHGA 2ZGXH 1C5MD 1JIRA 2BX3A 1MBMA 5H4IB 1NRSH 1RTKA 2B5TB 5C3NA 5EXLA 1V2MT 1FZZA 2XRCA 1MTUA 1BTWA 1GHZA 1AB9B 2SNWA 1JXPA 3GY7A 1SQTA 1ANBA 1GJ6A 3GY2A 4K1EA 3RXUA 4B71A 4B73A 1YKTA 3D23A 1T8LA 1KSNA 1KXCA 1AWFH 3NWUA 3KEEA 3PO1B 1DLEA 3RXDA 3UFAA 3DFJA 1D3PB 2FOCA 5TCCA 4D8NA 1MTVA 1D3DB 1Z7KA 2D1JA 3UQVA 2F9PA 1BTHH 3IG6B 4JK6A 3VB5A 2OQ5A 5FCKA 1UTKA 2SGEE 1V6DA 5L30H 2BYAX 2OUAA 4CR5A 2UUJB 1T7CA 3ATIA 3M37A 3PM3A 1SGQE 2ZI2H 5DP8A 2FO9A 4U01A 4X0WU 4XBBA 4YT7H 2V6NA 4CREA 3PB1E 1D6WA 1LVMA 1O5AB 1SGRE 3P8NA 1IQJA 3RXRA 1DANH 3D62A 2CGAA 3KQEA 3AAUA 2ZP0H 1E34B 4ZHLU 4F4OC 1G30B 5A8ZA 1SL3A 2Y81A 2VVVA 4XSKU 1OX1A 1YPHE 3T28A 1SGFG 3VB4A 3RXTA 1T8OA 1W0YH 1UMAH 1FN6A 5E0GA 2PUQH 3BTGE 3KNXA 1ELGA 1C2FA 2WPJS 1O2MA 4AORA 4I7YH 4ABJA 1DWEH 2PKAA 2AFQB 4E06H 3E0NB 3TPIZ 1VITH 3ATKA 1QRWA 2OINA 1S81A 1O3DA 1C2EA 1VCPA 2Y6TA 1VR1H 1ZGIA 1KXEA 4FUIA 4GHQA 2Z9JA 2VINA 1FN8A 2FZZA 2F9UA 3LC3A 2A45B 2AIQA 2ZU1A 2WPKS 3SJIA 1CT0E 1S5SA 2XC5A 3SUEA 1K21H 1HPGA 3A81A 1SGPE 5JBCS 1B5GH 2OLGA 4BTIB 1SR5C 1SGNE 5DK1A 1GJ8B 3GISB 1AGJA 3TK6A 7GCHF 4NWKA 5HM9A 1S6HA 2GCHF 1NRPH 1GHAG 4CBOA 4MNWA 2VH0A 2A7JA 1QBVH 2PKSC 1O34A 2AH4X 4KTCA 3S9BA 2G00A 2ZU5A 3MH4A 3FANA 4CRAA 2CN0H 1QR3E 1J17T 1ELTA 1V2PT 1WCZA 3QWCH 3MTYA 4DJZB 1LMWB 1G3EA 2GTBA 2ZGJA 4Y8YA 5EOKA 4IN2A 1CO7E 1P2NA 1UCYH 3GY4A 4K8BA 5FPYA 3U69H 3U98H 4VGCC 1N8OB 1GI1A 4Q7ZA 1LVYA 4U30A 9LPRA 1GMDG 1UVPA 1GMCG 4YLQH 1J16A 1LTOA 1TNKA 1P9UA 1O30A 3RU4D 2NU3E 1C5WB 1GI8B 2VIPA 1MD8A 1TMBH 1Q31A 1O2NA 4NG9H 3SV6A 3ODFA 3MU5A 1TGSZ 3S7KB 4B2CA 1A46H 1WBGB 4NA9H 2BXTH 5TCAA 2Z6BD 1MKWH 1CQQA 5J4SA 2EI8A 1G32B 1EZUC 4Q80A 3URDA 3UNQA 4O9VA 4YTAA 1C2LA 1A3BH 1C5SA 3M7QA 3EA7A 2WPLS 4XDEA 1YM0A 1C1NA 1DPOA 3BEIB 1LHCH 1W3CA 1GBBA 1ZRBA 1YCPM 3SHAH 3F1SB 1SLXB 2Y5GA 5I46H 1KYNA 2A5AA 2ZEBA 1WQVH 3RXEA 2QAAA 5DP3A 1C5RA 1O3IA 1EJMA 3RXMA 2FWWA 1ANCA 1LHEH 3GDVA 1AB9C 3U8TH 1G2LA 2O8LA 1BRUP 2ZO3H 2WPHS 1TQ7B 4H42U 2BOHB 5FPTA 2LNCA 1ESAA 1ELEE 3SU1A 3MU1A 2AEIH 2PFEA 2QYIA 2ZZUH 2ANYA 1GJBB 1SGTA 1SGDE 5GIBA 1NFYA 1EAXA 2ZFRH 3PO1C 1ELCA 3EAJA 1KLJH 2JH0D 6GCHG 4X1RU 3E6PH 2ZU3A 3SBKA 1O5DH 3E0PB 1RTLA 1P11E 3PWCA 1N6YA 3RMMH 1EJNA 3ODDA 2TPIZ 3S7HB 3RXPA 3TNSA 3SGAE 4D9QA 1P2JA 2BVSH 3NPSA 2QIQA 3RXVA 1O0DH 2BY8X 1GHBF 1BZXE 1C5PA 3SU6A 4ZKRU 3RM0H 8ESTE 1JBUH 4R0IA 3ZVFA 3ZV9A 3GYLB 1GBCA 4DVAU 3PROA 4B2AA 4FUFA 3P92A 1T4VH 1O3AA 3MI4A 4Y7BA 5EW1H 4SGAE 1S85A 2EI6A 5EGMA 3TLOA 4LZ1H 3RXKA 4DY7B 1MZAA 1YPJH 3TJUA 5JBBS 2QXGA 4MTBA 3VB7A 1ARCA 2ZG0H 1FPHH 5DJ7A 1OWDA 2RA0A 2GMTC 1VITF 4MPWA 1EAWA 1Z8RA 5LPEA 1KDQB 1NFWA 1CT4E 1V2ST 1L4DA 2YNAA 1AKSA 1ZHRA 3KHVA 3BTWE 2A31A 1GJCB 1ZHPA 1NFXA 1AFQC 1YLDA 2FPZA 2ZGBH 1ZSLA 2XCNA 5BRRE 3UNSA 1A1RA 2Y5FA 2W7UA 3RU4E 1UVOA 1CGHA 1BITA 1O3JA 4RN6A 4X8VH 2BMGB 4FU9A 1C4Y2 1TFXA 3A82A 1HLTH 6CHAC 1AMHA 4XFQA 2R3YA 4Y0YE 2BY7X 1P2IA 4FUEA 1O3NA 1HAVB 2GKVE 3TGKE 1YCPK 4JZFH 1VJ9U 4DIIH 2FLRH 1EB1H 3GDUA 1P12E 2ZGCA 2FX6A 1RTFB 2PWXA 2WINI 3QTVH 1EJAA 4JZ1A 1GL0E 2HLCA 1FUJA 1EPTB 1NT1A 2PSXA 3NXPA 4NIYA 2FXRA 3S0NA 2FESH 2UWPA 1JOUB 1DUAA 4NFFA 4X1SU 1YC0A 2J9NA 4ZKOU 2ZDAH 1E35B 1YPLH 3TK5A 3FP8E 3SOSA 5FX6A 2KAIB 2HWLB 1N8OC 2A0QB 4GLYA 4CRFA 1WSSH 3RUOA 2XYAA 5I25A 4MNYA 1LVBA 5FBIA 3DFLA 1ETSH 1V2UT 4LZ4B 5A0CA 1AI8H 4TWWA 1BBRH 2R0LA 1AO5A 1DX5M 3KF2A 1ANEA 5C2ZA 4UFFH 4FXGH 4Y7AA 2BLVA 1WYKA 1FONA 1C1WH 3U8RH 1OSSA 1O3OA 1NO9H 2ZECA 2A32A 4J2YB 1YYY1 2ZCHP 4ZXYH 4AGKA 3ZZ4A 5JBTA 1D3TB 3KL6A 3O8CA 1AY6H 2A5KA 2R9PA 2W26A 2XBVA 3M7UA 4ABHA 1XXDA 1A5IA 2V3HH 3LOXA 4BTUB 3RLYH 3SJOA 1C5VA 2NU4E 3MU0A 4DCDA 1OWEA 1LHDH 4O97A 4OGYA 2XBYA 2NWNA 3M35A 2G4TA 3ZVAA 1FI8A 4BAOB 3ENSB 5L2ZH 1EUFA 2FI3E 4Y6DA 1C5LH 1TX6A 1AIXH 1C5ZB 3DHKH 3EA9A 2HOBA 4YZUA 1E38B 2GX4A 4INHA 1ABJH 1FY8E 2Z9LA 3V13A 1H8IH 3A84A 4X1PU 5DG6A 1P09A 3L6PA 3EYDA 3BN9A 3PLKA 1O2ZA 2HNTC 4NSYA 2FOFA 5F6MA 1KXAA 1QB6A 4CHAB 1QNJA 4ZKSU 1HIAA 2HPQH 2PW8H 2F9OA 5ETXA 3M7TA 3QX5H 3UIRA 3A8DA 4QT8C 3U1JB 2WV4A 1MMJN 1GJ7B 1TPSA 3TH3H 3CENA 4ISNA 1TX8A 1GHAF 1K2I1 2IPHA 1Y3VA 3I77A 1SFIA 5GJ4B 2JH5D 1C1MA 4H6SB 3C1KA 1T31A 1S83A 1TPAE 1BMAA 1GMHG 3RXGA 3F68H 4JMYA 4X6MA 1XUIA 5EQSA 1TIOA 1TNHA 2ZU4A 2P59A 2JETB 1UTOA 2Z9GA 4WMFA 3BTKE 4KTSA 4A92A 2J34A 3ZVDA 4Y79A 4BXSA 3RXBA 1AD8H 1P9SA 1VGCC 3BV9B 1GCTB 1K1LA 1C1SA 2O8TA 1IHSH 1GMDF 2DUCA 1TONA 4GVUA 4D7FA 1PPBH 1GMCF 3VPKA 1L2EA 2R2WU 2AMPA 1FY4A 3M5MA 1GI9B 1HAXB 5C5OA 2CHAC 5A09A 2OBQA 3RMNH 1YGCH 2BM2A 3SI4H 2F9NA 1OXGA 2BQWB 1QHRB 3PLPA 3SJ9A 1DT2A 1UTPA 2BDHA 1UTQA 2ANMH 1THPB 1K1PA 1IQLA 1WTGH 5C20A 5FPSA 1CA0B 4FUJA 3SN8A 3RXOA 2Z3EA 1MBQA 1Z1JA 1GGDB 4FVBA 1ZZZA 2J94A 3F9EA 4ZMAH 5JBAS 2QXIA 1RFNA 2UUFB 3C27B 2FTMA 1EPTC 2ZTXA 1ID5H 1BMNH 1TALA 5EPYA 1ZRKA 4XE4A 2ZU2A 2FOBA 4YOIA 4A6LA 1A61H 3Q76A 1ZPBA 3LH3A 1GPZA 1ELDE 3E91A 3VGCC 2UWLA 1O2XA 3PWBA 2FM2A 1BRAA 9ESTA 1FMGA 2ZFQH 4DW2U 1UHBA 1MTWA 2H2ZA 1ZOMA 1DUEA 1DWDH 1O3KA 2FLBH 3QZQA 4SGBE 3M5OA 3RMLH 4JYTA 2ZHQH 2Z3CA 6GCHF 2Z94A 3ZZ8A 3M5NA 1BBRE 4MNXA 3D65E 1FV9A 1GBKA 3TNTA 1IQEA 1WUNH 1C9PA 1GJ9B 4AOQA 1J9CH 2H5CA 1O2IA 4K3JA 3U1IB 3A7ZA 8GCHG 1D6RA 3M3SA 4NGAH 1EP6A 4ZKNU 2AYWA 4JZEH 1BUIA 1KTSB 3AW1A 1N6XA 2ASUB 1BRBE 1O2YA 1Y3UA 2M5TA 3BEFB 1YPEH 2Q6DA 3HPTB 3LGIA 1OYQA 1BB0B 2BDGA 2AGIX 5JYIA 2H9EH 1C4V2 4NZLA 1O3LA 1ARBA 1PYTC 1XMNB 5EPNA 4E7NA 3KN2A 1ZTJA 1C2KA 1VCQA 1DDJA 4YESB 1RIWB 1CHOG 2A7HA 3ESTA 1OWIA 1INCA 1V2WT 3DUXH 2IJOB 2ZGHA 3GY5A 2FS8A 1BCUH 4X2YA 3UUZA 3MHWU 2A4GA 1BIOA 1HJAB 1T8NA 3OSYA 2B8OH 2HVXA 4B1TA 3NUMA 2VH6A 5FCRA 4IW4E 1G3DA 2TBSA 3A85A 4AFZA 3LGYA 3TITA 1O2WA 1Y3XA 2CJIA 1C1TA 1V2LT 5GPIB 1NU9A