4B2BA

Structure of the factor xa-like trypsin variant triple-ala (tgpa) in complex with eglin c
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDAGGPVVCSGKLQGIVSWGEGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermodynamic signatures in macromolecular interactions involving conformational flexibility.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CATIONIC TRYPSIN
total genus 55
structure length 223
sequence length 223
chains with identical sequence C
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b2bA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b2bA02
2WV4A 5FPTA 1UK2A 1MD8A 2BD2A 1O2MA 1SQOA 3STIA 1SBWA 2ZTZA 3M5NA 2PWXA 2BVSH 3TGIE 1NTPA 3PMHB 2VJ1A 1AU8A 2TGTA 4X8VH 5J4SA 4LK4A 4ZXXH 4FU8A 1A3BH 1AZZA 5GIBA 1EB1H 1O34A 1O2SA 3BTEE 2BOKA 1G36A 2ASUB 1NS3A 3QUMP 9LPRA 3TH3H 4E05H 3ZZBA 4NIVA 1GBHA 1AN1E 5FBEA 1LHCH 2PR3A 2A7CA 1SLXB 1UTKA 1KTTB 2BDYA 3DUXH 3FAOA 1CSOE 3FZDA 3M7UA 4GCHF 5T3HA 2CHAB 4B74A 3BTGE 2GV6A 5K7RA 2GD4B 3GCNA 1EZXC 5LPFA 1TNKA 2TGPZ 4UFDH 5C2ZA 3NKKA 2P93A 3ITIA 1KLJH 4AG2A 4D8NA 1OYQA 1C1NA 1GCTB 1VJ9U 2STAE 2AGIX 4ZHMU 3ATWA 1GL1A 1HAGE 3E1XB 3UY9A 1OWIA 1AVGH 4IC6A 3A86A 3ZZ8A 2HNTF 2FX6A 1FIWA 2BDGA 3AAVA 4BANB 1F5LA 1F92A 1DXWA 3NPSA 1BHXF 4O3UA 4RSPA 1F2SE 3M7QA 1JRTA 4WVPE 1GVZA 1Z6JH 1HPGA 4WH8A 3MH4A 3UOUA 2HGTH 1TBQH 3RXIA 2PW8H 4OGYA 4X0WU 1YGCH 3TNTA 1NY22 1A4WH 3ODFA 4F4OC 2SNWA 1W2KH 1ZTJA 3IITA 3U8TH 2ZEBA 4E7RG 4MNYA 2J92A 2H9TH 1GBAA 2P8OB 1HNEE 1C2DA 2W3IA 3MNXA 4UE7H 4I32A 3I77A 3PM3A 3VGCB 3K65B 1YPEH 3MU5A 5F8TA 2QGRA 4OS7A 1P0SH 3MU1A 3URDA 2VGCC 3F9FA 1DSUA 1YPKH 1H9HE 2Z9IA 4GHTA 1DUAA 3RXDA 1QNJA 4X6MA 1EPTA 3QK1A 3BTFE 4PROA 1XKBC 2ANMH 4AFZA 1ID5H 2FX4A 4OS2A 3A84A 4YLUA 1M9UA 4AOQA 1UMAH 1AFQC 1LKAA 1WAYB 1TWXB 1J9CH 1O0DH 2ANWA 2F91A 1TRYA 1BTPA 3SUEA 2B8OH 4YLQH 1O2GH 1HAXB 1SLUB 4CHAC 3A7WA 3QN7A 3AW1A 3PO1B 1HBTH 2UWPA 2ZU1A 3MU4A 2SGQE 4MQAA 1O30A 3ZYEA 6LPRA 1K1OA 3ZZ6A 1ANCA 1ETTH 2ZECA 5GCHF 2Y5FA 1TA2A 1D6RA 1HYLA 4GAWA 1DVAH 5EXLA 2FOHA 2GP9B 2WYGA 1G3CA 4X1PU 1O2WA 3DD2H 1ORFA 4NA7A 2FWWA 1BCUH 3MFJA 1C5VA 2FS9A 2QXGA 4LXBH 1LHDH 2XBXA 1BBRH 3PLBA 2Y81A 4YT7H 3FZZA 3RXTA 3VB3A 1DM4B 1TGBA 3RXBA 3U1IB 1NROH 1BITA 2XC4A 1QB6A 1GJ5H 1ZSKA 3LGVA 2GV7A 1ELBA 2ESTE 1BJVA 1PYTD 1ELTA 2Z3DA 3MU0A 3TH4H 1UHBB 4WJG2 1W7GH 3O8CA 1GHYH 2AMPA 4K1TA 1GMCF 2VWMA 1P2QA 4YTAA 3A8AA 1SOTA 1THRH 4ZKSU 3ATIA 1FI8A 3RXPA 4DIIH 1J14A 5EW2H 2XBYA 1D3QB 7LPRA 1NRPH 1K9OE 1JIMA 1FY4A 4JYTA 3RXMA 3OSYA 1H8DH 1SGCA 1IHSH 1BTUA 3GOVB 7GCHF 2YOLA 3LGUA 4H42U 4X8TH 5T6FA 2NU0E 5LPRA 2FYQA 1IQIA 1GHWH 1QBOA 2NU2E 2B9LA 3P17H 3UQOA 2FODA 1ZZZA 1XUFA 1NRQH 1TMUH 3EE0B 1C1QA 3PMAB 4NIWA 1CGIE 1ZPCA 1GG6C 1KTSB 2FLBH 4VGCC 1NN6A 1LQDB 2UUKB 3ATKA 2OUAA 2V3HH 1LTOA 4B2BA 4JYUH 1B0FA 3M3VA 1ANEA 2LPRA 7GCHG 4BAMB 1P2KA 3S9AA 3VPKA 3MH5A 5A0CA 3D23A 3M5LA 3H5CB 1RIWC 1O5EH 1UCYK 5DGJA 4TWWA 5DK1A 3RC5A 1Y8TA 1O2HA 1MTVA 3LU9B 2PGBB 6GCHF 1KXFA 1SC8U 4X2VA 2BTCE 3PTBA 4IS5A 5DJ7A 3O8BA 4CRCA 2A7HA 3GDVA 1G2LA 4ZROA 1KDQB 4TY6A 1TGNA 3S9BA 1QGFA 1C2GA 1CBWB 1CT0E 2IPHA 2PV9B 2A45B 5FX5A 1MQ5A 1A0LA 1GBTA 3ZZ4A 1QA0A 1TX6A 2ZU3A 4I31A 5EGMA 2FOGA 1N6YA 1V3XA 1A7SA 5ETXA 3E16B 4DJZB 3SJKA 4RKJB 1HB0B 2BDHA 3QWCH 4YT6H 5AFYH 5J4QA 1G32B 2OP9A 3UR6A 2D1JA 3K6ZA 1OSSA 1FN8A 1W10U 1UK3A 4JZIA 4Q2KA 2B7DH 4DGJA 2FMJA 4IMZA 1OWHA 3DFLA 1OS8A 1GDQA 4QT8C 1TX8A 1ELDE 5A8YA 1GHBF 3P8FA 2BQ7B 1K22H 1GI8B 1KXBA 1QRXA 3FANA 1Y3UA 2Y80A 2G5NA 1O3GA 2F9NA 2ZA5A 1HGTH 1EB2A 1G9IE 3A85A 3URCA 3NXPA 1QBVH 1GJDB 3ZVEA 1BUIA 2ZDAH 1ZMJA 3RXAA 5C3NA 4I7YH 2RA3A 1QBNA 2GDEH 1P05A 1EOLA 3ZVBA 5HYOA 4MPUA 3P92A 5GPIB 1NC6A 1C5UA 1TABE 2K1QA 1IQFA 1WV7H 1C5NH 1PYTC 4ABBA 5JB8S 1O5FH 1TGSZ 1SGTA 3LC3A 1ELCA 2BQWB 1F0TA 1CHGA 2J94A 3MMGA 1O2XA 3ZZ7A 4B75A 1GBFA 2TIOA 1DXPA 2PKSC 4IC5A 3CENA 2P16A 3U9AH 4NZLA 5ESBA 1RS0A 1CO7E 3KN2A 5AF9H 2BY5X 3MO3A 1BZXE 4TPIZ 3Q3KA 4CRGA 3PWBA 2JH6D 1O2NA 5F03A 3MYWA 1ZHRA 4YZUA 3G01A 1AB9B 1TLDA 1OOKB 4BXWA 1PJPA 2R0KA 3E6PH 1PPCE 3F1SB 2BY6X 1S84A 1YP9A 5JBCS 1W12U 1EATA 1HAVA 1YF4A 1KXEA 3BN9A 4X1RU 3BG4B 3D49H 3JZ1B 1OYTH 3S69A 1ZMNA 2ZC9H 1V2UT 3GCTG 4VGCB 3D62A 5EQRA 1N8OC 2WUCA 2O8MA 2R2WU 2OC8A 1J16A 2VH6A 1BDAA 4DG4A 4MG3A 2V35A 1P2OA 3GY4A 6ESTA 2GT8A 4CH2B 3TVJB 2ZFRH 1C5QA 5CMXH 1P9SA 1HJ9A 2FI4E 3PO1C 3Q3XA 1S6HA 3RXOA 4U01A 2TGAA 3TJVA 1YM0A 1P2MA 2O8TA 1BTXA 3KQCA 3QLPH 1K21H 4IW4E 3SQEE 1G37A 3A89A 4X8SH 4Y0ZE 1VITG 2VB0A 3S7KB 3QGJA 6CHAC 2BZ6H 2FTLE 3HGPA 1ETSH 1BHXB 3BG4C 1P04A 1EAUA 1LPKB 3L6PA 4TYDA 3W95A 1SSXA 2P95A 2ZKSA 4AGJA 2XCNA 1PQ8A 1DWEH 4NG9H 2FP7B 2Z9KA 4KGAA 5CHAB 4DY7B 1GPZA 4XBBA 3S9CA 5GJ4B 1C1WH 7ESTE 2BDBA 1FN6A 1EJAA 3GY3A 1QTFA 3L33A 5AHGH 3HKIB 4DVAU 4IN1A 4A7IB 1OPHB 3RXFA 1GMDF 4XOJA 1JIRA 2OQUA 3U1JB 2C8XB 4YESB 1SR5C 1GGDC 2C8WB 3QX5H 3LKWA 1DE7H 2HNTE 4AORA 4B76A 3T2NA 1C5MD 3SN8A 2H6MA 1JXPA 4DCDA 1Y3WA 2I6QA 4U30A 1MTUA 1J8AA 1XUIA 3Q3YA 1PFXC 3VB5A 5E8EH 5L6NH 4NWLA 1SGQE 1ELAA 1FAKH 1C5PA 1NFXA 2GCHG 4K8YA 3QZRA 1VGCC 3RXQA 1NFYA 4O97A 1HAVB 4K8BA 3RC4A 2A2XH 1C2MA 4ISNA 1V2KT 2G81E 4F49A 1FJSA 1V2JT 4NIYA 4Q80A 4MPVA 2PHBA 3GCHC 1NFUA 3IWMA 3UQVA 4WMEA 4FVDA 1O2QA 1BT7A 2UWOA 1DY9A 1T8NA 3SOSA 3MWIU 1E38B 3MO9A 1K1LA 4AFUA 4GCHG 1F7ZA 4SGAE 1V2PT 1PPZA 3PLKA 1YYY1 4X2YA 5EXMA 1XVMA 2HLCA 1SGFA 1O3EA 1TQ7B 1GMHG 1H9IE 4FU9A 1A5IA 1Z8RA 4WXVA 1MZDA 2WUBA 1LMWB 1WCZA 1W0ZU 3KNXA 1SFQB 1UJ1A 4A1TA 1W13U 1UTPA 1WU1A 5DP6A 5DKMA 2H2ZA 4AX9H 1AKSB 3B8JA 2CJIA 3SGQE 3M5OA 2FXRA 2EI8A 1BRUP 2SFAA 2P94A 4I8JA 2STBE 4HGCA 2A5KA 2ZFFH 4RN6A 3TIUA 1PPHE 1VITF 3QTOH 2GTBA 2F9PA 1RRKA 4A1VA 3TK5A 1AY6H 2J9NA 1E36B 3ESTA 1GI2A 1BQYA 2ZHFH 1V2MT 1NU9A 1T31A 3T27A 1TNJA 3CS7A 1P12E 4NFEA 4A92A 1C5WB 1GBKA 1ARCA 1FV9A 1MKWH 4YM9A 1BTHH 2ANYA 1XUGA 2PGQB 4ZKOU 2VIWA 2YNBA 1NESE 1AUTC 2P3TB 2VIOA 4CH8B 1YC0A 1Z71A 1AZ8A 1K1IA 2GCTB 1GBJA 1C1OA 2JH0D 1XXDA 2OINA 2J38A 4NIXA 4CBNA 1AI8H 1P06A 1ABIH 1BBRK 3KQBA 2ZIQH 3P8OA 4Y79A 1GJCB 4GSOA 5EODA 1O2UA 1YLCA 4JZFH 3RM0H 1KXAA 1O5BB 3F9GA 3FP7E 2FLRH 1WSSH 2VVCA 3NCLA 2C90B 3SNEA 5FCKA 1JOUB 2ZCKP 1A0JA 3STJA 3ZZAA 1KIGH 3BTTE 3RXLA 2BHGA 1PQ5A 3P70B 2HVXA 4Y8ZA 4NSVA 2ZPRA 2ZF0H 3SUFA 1B0EA 5LH8A 1ZHMA 2A2QH 1UTOA 2ODYB 2BZAA 1GBIA 4WXIA 4AZ2B 2ZTYA 2P59A 3PB1E 3PWCA 4CRAA 2BB4A 3SNBA 1PPFE 5C1XA 1SLWB 3KEEA 2KAIA 5LPEA 1S0QA 1O5DH 2B5TB 2D2DA 1F0UA 1XM1A 3TU7H 5E0JA 5F8ZA 5HMAA 2QAAA 4UONA 4ZHLU 4FUFA 2ZFPH 2VINA 4Y10E 3PMJA 1ESAA 1BRAA 1PPBH 5TCCA 3BEUA 3FP6E 1HXEH 1CT2E 1QQ4A 5HM2A 1AFQB 1NRNH 1LDTT 3OX7U 4TPYA 4AFSA 4H6SB 2J4IA 3NUMA 4UFFH 5BRRE 4D76A 4MDSA 3A88A 1C1UH 3SNDA 1MTNB 2ZDNA 4J1YA 4FXGH 3TGJE 2XRCA 1KLIH 3SO3A 2LNCA 3AASA 1GHZA 4UFEH 2Q6DA 2A1DB 1NZQH 3GYMA 2OC1A 1RGQA 3I29A 1EP5A 3LGWA 1GI0A 1CBWC 1TPAE 3OY5U 1Y5AT 1CHOG 1HJAB 1C5TA 1YCPH 5GDSH 3LPRA 3T29A 3ZV8A 1SGPE 2G51A 5ESTE 3RXEA 1BRBE 1DANH 3CP7A 1XKAC 1EAIA 3Q77A 1L1JA 1UTLM 1YCPM 1P8VC 4ASHA 1IAUA 3SJ8A 2HPQH 1O3KA 2Z3CA 4MPWA 4B1TA 3PMBB 2BLOA 2NU1E 3KIDU 2BD9A 1NRRH 2ZU5A 5FCRA 2ZWLH 4Y8YA 1UVSH 3NZIA 3SNCA 4FUJA 4CREA 4O9VA 1TONA 2NU3E 1TPOA 3MNBA 1EZUC 4U32A 2JETC 4AGKA 3MNSA 3GCOA 3UR9A 1AKSA 2C8ZB 1SGYE 2D26C 3A87A 2F9BH 2FO9A 1YBWA 3VB6A 4K1SA 1BMLA 1HIAB 1SFIA 5C1UA 1ZGIA 1CA0C 3U98H 1SGRE 2IN2A 1AQ7A 2SGPE 3BV9B 4UDWH 1B7XB 2ZGJA 3BTDE 2BMGB 4KKDA 4X1SU 1LVMA 5EOKA 4AYYB 1BTZA 1XXFA 2WPMS 2QY0B 3MNCA 1FZZA 2TGDA 3ATMA 3LGIA 2EI7A 3A8DA 3UIRA 2AYWA 3M61U 3RXHA 1BA8B 1L0ZA 1ZMLA 1BBRE 1JMOH 1ZRBA 3P95A 1ZSJA 1GVLA 4JCNA 2QF0A 2WPKS 2QYIA 2DE9A 1VZQH 1OKXA 1MUEB 2VH0A 3UUZA 3HGNA 1EZQA 3VFEA 1SGNE 1V2LT 1EQ9A 1TA6A 5EPNA 1C2JA 1HDTH 4ZAEA 3EGKH 1NFWA 4HFPB 4MNVA 1HFDA 2XXLA 3SBKA 4OS5A 1X7AC 4OS4A 1IQMA 1OWEA 3FP8E 5DP8A 2BVRH 2BD7A 3B23B 8LPRA 3RLWH 2AIPA 1THPB 2RA0A 1AVWA 1EOJA 3ELAH 1SGDE 2I6SA 3RDZA 1F5RA 3TH2H 1QB9A 3BTQE 1TOMH 4ZXYH 1Q3XA 3LJOA 4NZQA 2H5CA 1O3JA 3L3TA 1UTNA 1T32A 1TALA 3E0PB 3IG6B 2BD3A 3EQ0H 1LCYA 4JZEH 1C2KA 4I8GA 1UTQA 1QIXB 1UO6A 2CF8H 5HM9A 4ZH8A 1FQ3A 2XC0A 1Z1JA 2ZHWH 2BD8A 5L2ZH 1MKXH 1A0HB 1AWHB 1HAZB 2ANKH 1VITH 3EYDA 2F9UA 3SQHE 1GJBB 2FYRA 1C5LH 2GKVE 5FBIA 1O5GH 2PSXA 2SGDE 1Z6EA 3LONA 1BJUA 1A46H 3RXJA 1WTGH 1FPCH 4O3TA 3VXEH 2PTNA 1O2ZA 1LHFH 1T8OA 1V2RT 1LVYA 1J17T 1W11U 3GDUA 3GY2A 5DPAA 3UFAA 1O3NA 1W14U 4Y8XA 3SU0A 3NK8A 1ZYOA 3LDXH 2ZHQH 3RXCA 1FAXA 1L1NA 3D65E 1GI4A 1BMMH 2F83A 2G4UA 1IQKA 2WYJA 1KDQA 2ZG0H 1GBBA 1GCTC 1PQAA 2XWBI 3MH6A 1SHYA 1L1GA 4AB9A 4ABFA 1ELGA 1WBGB 2OTVA 3F6UH 2ZGBH 1MTSA 1NPMA 4BAQB 1GHAG 1IQNA 2VVUA 2FPZA 1QR3E 2W5EA 2Z94A 1AE8H 1TE0A 1GBMA 1UCYH 1C2HA 4Y76A 1JRSA 1BRCE 4XE4A 5FPYA 3RU4E 2AMQA 2V6NA 3ODDA 4FUEA 3A80A 1OP8A 1MMJN 2BYAX 1LVOA 4MNWA 4NA8A 1WQVH 4X8UH 2G52A 2QC2A 1DT2A 3EA7A 4DOQA 2ZDLA 4NSYA 3AVZA 3BEFB 1AO5A 2AH4X 3K9XB 1OWJA 4I33A 1ANBA 1G2MA 1J15A 1BTWA 3RXSA 2CHAC 3MH7A 2BDAA 5GXPA 3MI4A 5A2MH 2BXTH 4ABGA 2NWNA 3SU3A 4YO9A 1CGJE 1UCYE 4B73A 2TRMA 1P2IA 3LJJA 1SGIB 1MH0A 1QL9A 2QIQA 2FTMA 3SNAA 1SL3A 2DUCA 4WMFA 5FX6A 1TQ0B 2QF3A 2C4FH 3SUDA 3F9HA 5JPMH 2FI5E 2GX4A 4SGBE 2FOAA 4Y0YE 2ZO3H 3PTNA 8ESTE 1HUTH 1BIOA 4K1EA 3T25A 4CR9A 5AFZH 1ZGVA 3SU4A 3GY7A 2WPHS 3ZVAA 1CE5A 3GDSA 3PROA 3ATLA 2H9EH 2XCFA 2QCYA 1QB1A 3K6YA 4A5TS 1MU8B 8KME2 1O3CA 1S82A 1DICA 4BNRA 4K3JA 4CHAB 4GPGA 2BQ6B 3NWUA 2PKAA 2FM2A 1DX5M 3ZVGA 2Z9GA 4D7FA 1ESTA 3BTKE 3RM2H 2XBVA 2ILNA 2F9OA 1NM6A 4X6OA 4CRDA 2VGCB 8GCHG 3KF2A 1E0FD 1HAPH 4K69A 7KMEH 1CU1A 3E91A 1TPSA 2ZU2A 2O9QA 5T6GA 2BD5A 1GBCA 4ISHH 3JZ2B 4KELA 1RTLA 1ACBE 1QL8A 4AN7A 3TJUA 4YOJA 2SNVA 4A6LA 2Z9JA 1ZPZA 4BTTB 3SW2B 1Z8IB 3SZNA 2XYAA 1O2KA 1K1NA 2FS8A 4WMDA 3E3TA 1O37A 1SLVB 3SGBE 4X1NU 8GCHF 1FIZA 1DUEA 1Z8JB 3V13A 1V2NT 5GWZA 2ZFQH 1UVUH 2FEQH 2OXSA 3AW0A 2CXVA 1S5SA 2PFEA 2H1UA 3SU2A 1C4V2 3ENSB 4FVBA 1O2LA 1F0RA 1C4U2 2XC5A 1Q2WA 2VIVA 3HATH 4Q7YA 1L4ZA 1O38A 2FI3E 2ZFSA 3UREA 2RG3A 4THNH 3Q76A 4WY3A 2Y82A 1HIAA 4LOYH 3SV6A 1T8LA 4AB8A 3MU8A 1W7XH 1HLTH 1YLDA 2Y6TA 4IMQA 2G4TA 1SG8B 3ZZ5A 5EXNA 1QHRB 4KTUA 2VIDA 2WPJS 1D3PB 1C1MA 1TAWA 2XWAA 4BAOB 1MBQA 1MCTA 4Z0KA 5C5NA 1SQTA 3UWIA 2SGEE 5CHAC 1C4Y2 1EZSC 1CA8B 4INLA 2HALA 1GI3A 2BVXH 1D6WA 2BX4A 1DWBH 3SUGA 1B5GH 5A0BA 2HWLB 4X6PA 2IJOB 5EU8A 5EW1H 1FONA 3LC5A 3Q00A 4HTCH 1IQEA 4U2WA 3SU5A 1FPHH 1QCPA 1VCWA 1O3HA 3UPEA 3QO6A 2QXIA 1SQAA 3TPIZ 1ARBA 2Q6GA 2CMYA 2R2MB 1O3BA 3TJNA 1QURH 1NO9H 4CRBA 1ZHPA 3F9EA 1Y5BT 2QXJA 3RP2A 2ZDKA 4YOIA 5LGOA 1OP0A 3A7TA 1GHXH 1P2JA 2Y5GA 2BLWA 4Q7XA 1YPLH 3A83A 4Y6DA 1Y3VA 1S0RA 2ZNKH 3E0NB 1Q31A 1MCVA 1BB0B 4GVUA 4XDEA 4GLYA 4ABHA 2P3UB 1DY8A 1GDNA 2ZDVH 1O32A 2BD4A 1GG6B 3M7TA 3QZQA 1DDJA 4BAKB 2O8UA 3TLOA 3RMLH 2CN0H 5IYTA 1IOEA 1O2VA 3A7VA 1A1RA 1O5CB 1Y3YA 4XSKU 4Z6AH 1MZAA 1P3CA 1P01A 1OXGA 3TJOA 1GHVH 1C5YB 3MTYA 3V12A 3V3MA 1F5KU 5E0GA 1SVPA 1XUKA 2GZ9A 2WV5A 1AUJA 3M3TA 2G5VA 2AEIH 1RJXB 4ISOA 1ZJDA 3R3GB 2PUXB 1LHEH 3ZV9A 2B0FA 1WUNH 4GHQA 3TK9A 4JZ1A 3GYLB 1DLEA 2BY9X 1GBDA 1MU6B 2W26A 3A8CA 1INCA 1IHTH 5IDKA 2A4RA 1O2IA 1G30B 1DWDH 5JBTA 4AYVB 1TNGA 3SJ9A 1HAHH 4ZUHA 4ESTE 1CT4E 5EQSA 3RMNH 1ETRH 4LZ1H 5TJXA 4AG1A 3MOCA 1ZSLA 4JK6A 1ZRKA 3RMMH 4K60A 2WINI 2GCTC 4X2XA 1QRZA 3GY5A 1XUJA 4FUBA 2CV3A 1SMFE 3OTJE 2PLXA 4I8KA 1O39A 1EASA 2BM2A 1C5RA 3P8NA 5B6OA 1P02A 3QDZB 1G3EA 2GDDA 4X1QU 1GI6A 4GUXA 1GI5A 4BAHB 4INHA 1EKBB 2FOEA 2SGAA 3P8GA 1QRWA 3CS0A 2A5AA 4NGAH 3SU1A 1O35A 3MO6A 1O3LA 1O2TA 1KSNA 1EPTC 2ZGXH 1V2TT 3C27B 1KLTA 2QA9E 3UNQA 1P11E 1GVKB 3F68H 2PUQH 2WPLS 1CHOF 1WYKA 1EJMA 1Y5UT 4RKOB 4BTUB 2THFB 4MPXA 1L4DA 1BMNH 3KCGH 2ZP0H 4DT7B 3TGKE 1EAXA 2BY8X 1H8IH 9ESTA 1U6QA 4R0IA 2GGVB 4FUCA 1E35B 2A32A 2GVFA 1WOFA 1AFEH 4XBCA 4I8LA 4JMYA 1N8OB 3GCHB 4FUDA 1D4PB 2RCEA 1O3DA 1G3DA 1TX7A 4UEHH 2EEKA 1LO6A 3RXRA 1LKBA 2A0QB 2ZTXA 3LGTA 4WH6A 2HOBA 3QTVH 3H7TA 1DWCH 2FOMB 4OGXA 5C5OA 4MLFB 1EX3A 5A0AE 4DIHH 3KQEA 1RFNA 1PPGE 5A09A 1TGTA 1SGEE 5EQQA 2JKHA 1V2VT 4ZMAH 2XBWA 1K1PA 1CGHA 1D3TB 1O2RA 3ZZ3A 1VCQA 1TFXA 1FY5A 1AE5A 1IQGA 1QFKH 3A81A 1SGFG 1BTYA 1NU7B 3RLYH 4D9RA 1H4WA 3EA9A 1QJ6B 2ZGHA 3PYHA 3QGNB 1LPZB 5DP7A 3A7YA 1S83A 1VJAU 1GI9B 1FMGA 2C8YB 1YPGH 1WQSA 1ZLRA 1O3IA 2J34A 1FY1A 1SHHB 1TB6H 3U69H 2H9HA 3RMOH 3UNSA 1HAIH 2J95A 2UUYA 2CGAA 3ZVDA 4Q7ZA 1QJ1B 2Z7FE 2ZHDA 4H4FA 2O8LA 1DFPA 3SGAE 1ANDA 2ZDMA 1SB1H 2GMTC 2FOFA 5EG4A 3BIVH 2VWOA 1S81A 1C2LA 3SHAH 4ABEA 2ZU4A 1VR1H 2ALPA 3SORA 4NA9H 2V3OH 2ZQ1A 2R3UA 1UTMA 1TPPA 1H9LB 1CQQA 2OBOA 3W94A 3T62A 2FOCA 3GY8A 3M3SA 2FIRH 3VGCC 4DW2U 3LGYA 2A31A 2VVVA 1EUFA 3R0FA 1Y59T 1MQ6A 1QL7A 2Y7XA 3M5MA 2OC7A 2XW9A 1OWKA 3B9FH 1ZJKA 2AMDA 5I25A 1TNHA 5K0HA 3V0XA 1P3EA 1VGCB 1YPHC 5F8XA 1P03A 1O3OA 2HPPH 3EDXB 2A4OA 3DFJA 1UVOA 4ABDA 6GCHG 1KXDA 2Q1JA 2IOTA 2TPIZ 1ZTKA 5JBAS 2F9VA 1UHBA 1XUHA 4MNXA 2W7SA 2A4GA 2BLVA 1ZTLA 2Z9LA 2A5IA 2RDLA 1A2CH 3OYPA 1C9TA 1TIOA 2BXUH 5HXFA 2V0BA 1DOJA 2EI6A 1YPMH 2GT7A 3T26A 1GHBG 1DLKB 3BTWE 1K1MA 3BSQA 1A61H 3K2UA 2Y7ZA 2DE8A 1CA0B 3TK6A 2ODQA 2VIQA 5F6MA 1D3DB 4TWYA 3FFGA 4J2YB 4BTIB 3LIWA 2BDCA 5L2YH 1N1LA 1T8MA 2ZPQA 5AVDA 1C1SA 5HGGA 5L30H 4D7GA 3H7OA 2R9PA 1GJ7B 4KP0A 2A4QA 2M5TA 4MVNA 4A1XA 3T28A 1C1PA 2PKSB 5BPEA 4OS1A 1LQEA 4ISIH 3LT3A 4E7NA 4WWYA 4KTSA 1ELEE 4JK5A 1RTFB 3T5FH 3SV9A 1MKWK 1N6XA 1BMAA 3U8OH 1G3BA 1GMCG 1IQLA 1GJ8B 1GBEA 2ZFTA 4R8TB 1O2PA 3M37A 3AAUA 3I78A 1TYNA 2GCHF 1HAYB 1O3AA 1KXCA 4B71A 2VWNA 3VXFH 1MKXK 1RXPA 1D9IA 1GGDB 3BEIB 1BOQA 2AS9A 1QQUA 2ULLA 2JETB 4CBOA 1GL0E 3SHCH 3SI3H 1C1RA 3KHVA 3RXGA 1YPHE 2XTTB 1P57B 1QY6A 1HRTH 3HK3B 4X2WA 1LHGH 3RC6A 1DS2E 4NCYA 4ZHAA 3TNSA 4FUHA 1OWDA 1AHTH 4INKA 4D9QA 5JYIA 5H4IB 2AGGX 1MAXA 2PTCE 1ELFA 1GJ6A 3RUOA 3U8RH 3DT0H 3EA8A 2BDIA 3LH1A 2R3YA 1YCPK 2SGFE 2ZPSA 2VWLA 3A7XA 5DP4A 2UWLA 3ZZDA 4BXSA 3M36A 4E06H 1NT1A 1S6FA 3ZVFA 5GCHG 5DO4H 2G55A 1RIWB 3HK6B 4Y71A 2GZ8A 2Y5HA 2Q6FA 3RXKA 3SU6A 3BF6H 2FZZA 3VB7A 2WPIS 1GJ4H 1MTWA 2QV1A 3RU4T 5ABWA 1O3FA 3A7ZA 1LPGB 4CRFA 1F0SA 3GCTF 1OX1A 1UVPA 1Y3XA 3UOPA 3E90B 5DP3A 5E0HA 2H5DA 1HJAC 4I8HA 3S0NA 3OY6U 5G4BA 1C5SA 3VB4A 1O36A 1C2IA 1KY9A 1HAOH 5PTPA 4UD9H 4B2AA 1JBUH 3SJIA 5DG6A 2HRVA 3FVFB 5JDUB 1TNLA 2AIQA 5E2PA 1A5GH 1MD7A 1O5AB 1P9UA 4NFFA 1T4UH 2HNTC 5C20A 1XVOA 1UVTH 2EC9H 2GZ7A 1SOZA 4FUIA 5DP9A 1ELVA 3O8DA 4LZ4B 1GWAA 1MAYA 1C5XB 3BG8A 1SI5H 1V6DA 3PV4A 2GMTB 5EPYA 2BX3A 1TMBH 3ZVCA 3RXUA 1GJ9B 3C1KA 1TBRH 2P3FH 3LH3A 2VNTA 2W3KA 1HXFH 5C1YA 3KL6A 1PPEE 1A3EH 1YPJH 1LVBA 1O2JA 4DURA 1GI1A 1K2I1 5FHTA 1YKTA 2KAIB 1FY3A 1FDPA 2F3CE 3UNRA 1HV7A 2PSYA 3DHKH 3M35A 3VEQB 2OD3B 4ABJA 2QN5T 4Y11E 1V2WT 3SV2H 1C1VH 2VU8E 3UWJH 1O2OA 4MTBA 1ZR0A 5FPSA 3SV7A 3LOXA 1DPOA 1RD3B 1DSTA 1QJ7B 1K1JA 2C3SA 1GMDG 4JZDH 2FDAA 3SI4H 2W7UA 4Y7BA 3BIUH 4IGDA 3GISB 4WF8A 2Z3EA 1GJAB 1O3MA 1O2YA 1AWFH 3BTHE 3A8BA 4ZKNU 1T7CA 1SPJA 4UFGH 1RTKA 2VIPA 1FXYA 5E2OA 4HI3A 1ZOMA 2EA3A 1C5OH 1W0YH 1JWTA 3E8LA 5A8ZA 1K28D 3A82A 3WY8A 1THSH 2ZI2H 4TY7A 1FUJA 1TBZH 4X6NA 4CR5A 1Z8GA 2AERH 1H1BA 3S7HB 4XFQA 1TOCB 1AB9C 2BLQA 1T4VH 2G8TA 3ZZ9A 1C5ZB 2ZGCA 1W8BH 1Z7KA 1E34B 2J2UA 1DITH 4K2YA 1QA7A 1XX9A 2OCVB 4ABAA 3O8RA 5DP5A 3DA9B 1A5HA 1HCGA 3KGPA 3GICB 2QXHA 2O8WA 4O03A 1P10A 1KYNA 1E37B 3KQDA 4ZKRU 1EAWA 1AD8H 1FY8E 1CVWH 2ZCLP 1L2EA 1V2OT 1ESBA 1TRNA 1V2ST 1NRSH 2ALVA 1GBLA 4IN2A 5C67A 1GMHF 3UTUH 1W3CA 3N7OA 1S85A 2PKAB 1AVXA 2OC0A 5A8XA 1WTHD 5JBBS 2Z6BD 5SGAE 1AMHA 1Z1IA 5T6DA 4FU7A 1HJ8A 1EP6A 2C93B 2ZQ2A 1O31A 1TNIA 1XMNB 4B2CA 2D8WA 2ZHEH 2AGEX 4KTCA 1IQJA 4AFQA 1C1TA 4XBDA 3HPTB 2NU4E 5TCAA 3PLPA 2OBQA 4K5ZA 4NWKA 4Y7AA 2YNAA 1VCPA 3EAJA 4FUGA 2G00A 4JYVH 1ABJH 4HZHA 2XNIA 6CHAB 3RU4D 3ZZCA 1PQ7A 2OLGA 2R0LA 1EXFA 2CF9H 3P6ZB 1FLEE 1EJNA 3OU0A 1AGJA 2FESH 4OS6A 3BTME 2UUFB 2OQ5A 1UK4A 1TRMA 1GDUA 2ODPA 1P09A 4IBLH 1GHAF 3SV8A 1GI7B 3TITA 1O3PB 1MBMA 1MTNC 1C2FA 2ZCHP 1OP2A 3HKJB 1ZPBA 1O33A 1TMTH 5FAHA 2AFQB 2A7JA 2FOBA 1EPTB 2JH5D 3MHWU 4BOHA 1GCDA 4ISLA 4M7GA 5I46H 2UUJB 2TBSA 3GY6A 1AIXH 1UTJA 5JB9S 4YOGA 3SJOA 3RXVA 2P8OC 1P2NA 1V2QT 3ZYDA 5CE1A 1C2EA 2ZZUH 2BY7X 1C9PA 5FXLA 1FNIA 3V7TA 4H6TA 1TGCA 4ABIA 2BOHB 1IQHA
chains in the Genus database with same CATH superfamily
2WV4A 5FPTA 2GJGA 1UK2A 3OE7D 1MD8A 2BD2A 1O2MA 1SQOA 3STIA 1SBWA 2ZTZA 3M5NA 2PWXA 2BVSH 3TGIE 1NTPA 3PMHB 2VJ1A 1AU8A 2TGTA 4X8VH 5J4SA 4LK4A 4ZXXH 3UAIC 4FU8A 1A3BH 1AZZA 5GIBA 1EB1H 1O34A 1O2SA 3BTEE 2BOKA 1G36A 2ASUB 1NS3A 3QUMP 9LPRA 3TH3H 4E05H 3ZZBA 4NIVA 1GBHA 1AN1E 5FBEA 1LHCH 2PR3A 2A7CA 1SLXB 1UTKA 1KTTB 2BDYA 3DUXH 3FAOA 1CSOE 3FZDA 3M7UA 4OM9A 4GCHF 5T3HA 2CHAB 4B74A 3BTGE 2GV6A 5K7RA 2GD4B 3GCNA 1EZXC 4YXWD 5LPFA 1TNKA 2TGPZ 4UFDH 5C2ZA 3UB0A 3NKKA 2P93A 3ITIA 1KLJH 4AG2A 4D8NA 1OYQA 1C1NA 1GCTB 1VJ9U 2STAE 2AGIX 4ZHMU 2EQNA 3ATWA 1GL1A 1HAGE 3E1XB 3UY9A 1OWIA 1AVGH 4IC6A 3A86A 3ZZ8A 2HNTF 2FX6A 1FIWA 2BDGA 3AAVA 4BANB 1F5LA 1F92A 1DXWA 3NPSA 1BHXF 4O3UA 4RSPA 1F2SE 3M7QA 1JRTA 4WVPE 1GVZA 1Z6JH 1HPGA 4WH8A 3MH4A 3UOUA 2HGTH 1TBQH 3RXIA 2LP6A 2PW8H 4OGYA 4X0WU 1YGCH 3TNTA 1NY22 1A4WH 3F3BA 3ODFA 4F4OC 2SNWA 1W2KH 1ZTJA 3IITA 3U8TH 2ZEBA 4E7RG 4MNYA 2WSSD 2J92A 2H9TH 1GBAA 2P8OB 3F0PA 1HNEE 1C2DA 2W3IA 3MNXA 4UE7H 4I32A 3I77A 3PM3A 3VGCB 3K65B 1YPEH 3MU5A 5F8TA 2QGRA 4OS7A 1P0SH 3MU1A 3URDA 2VGCC 3F9FA 1DSUA 1YPKH 1H9HE 2EY4C 2Z9IA 4GHTA 1DUAA 3RXDA 1QNJA 4X6MA 1EPTA 3QK1A 3BTFE 4PROA 1XKBC 2ANMH 4AFZA 4DT4A 1ID5H 2FX4A 4OS2A 3A84A 4YLUA 1M9UA 4AOQA 1UMAH 1AFQC 1LKAA 1WAYB 1TWXB 1J9CH 1O0DH 2ANWA 2F91A 2RFKC 1TRYA 1BTPA 3SUEA 2B8OH 4YLQH 1O2GH 1HAXB 1SLUB 4CHAC 3A7WA 3QN7A 3AW1A 3PO1B 1HBTH 2UWPA 2ZU1A 3MU4A 2SGQE 4MQAA 1O30A 3ZYEA 6LPRA 1K1OA 3ZZ6A 4P02A 1ANCA 1ETTH 2ZECA 5GCHF 5C0UA 2Y5FA 1TA2A 1D6RA 1HYLA 4GAWA 1DVAH 5EXLA 2FOHA 2GP9B 2WYGA 1G3CA 4X1PU 1O2WA 3DD2H 1ORFA 2XOKD 3W1EA 4NA7A 2FWWA 1BCUH 3MFJA 1C5VA 2FS9A 2QXGA 4LXBH 2K0QA 1LHDH 2IPQX 2XBXA 1BBRH 3PLBA 2Y81A 4YT7H 3FZZA 3RXTA 3VB3A 1DM4B 1TGBA 3RXBA 3U1IB 1NROH 1BITA 2XC4A 1QB6A 1GJ5H 1ZSKA 3LGVA 2GV7A 1ELBA 2ESTE 1BJVA 1PYTD 1ELTA 2Z3DA 3MU0A 3TH4H 1H8ED 1UHBB 4WJG2 1W7GH 3O8CA 2J97A 1GHYH 2AMPA 4K1TA 1GMCF 2VWMA 1P2QA 4YTAA 3A8AA 1SOTA 1THRH 4ZKSU 3ATIA 1FI8A 3RXPA 3AK5A 4DIIH 1J14A 5EW2H 2XBYA 1D3QB 7LPRA 1NRPH 1K9OE 1JIMA 1FY4A 4JYTA 3RXMA 3OSYA 1H8DH 1SGCA 1IHSH 1BTUA 3GOVB 7GCHF 2YOLA 3LGUA 4H42U 4X8TH 5T6FA 2NU0E 4Q4LA 5LPRA 2FYQA 1IQIA 1GHWH 1QBOA 2NU2E 2B9LA 3P17H 3UQOA 2FODA 1ZZZA 1XUFA 1NRQH 1H8HD 1TMUH 3EE0B 1C1QA 3PMAB 4NIWA 1CGIE 1ZPCA 1GG6C 1KTSB 2FLBH 4VGCC 1NN6A 1LQDB 1SQRA 2UUKB 3ATKA 2OUAA 2V3HH 1LTOA 4B2BA 4JYUH 1B0FA 3M3VA 1ANEA 2LPRA 7GCHG 4BAMB 1P2KA 3S9AA 3VPKA 3MH5A 5A0CA 3D23A 3M5LA 3H5CB 1RIWC 1O5EH 1UCYK 5DGJA 4TWWA 5DK1A 3RC5A 1Y8TA 1O2HA 1MTVA 4XRNA 3LU9B 2PGBB 6GCHF 1KXFA 1SC8U 4X2VA 2BTCE 3PTBA 1OHHD 4IS5A 5DJ7A 3O8BA 4CRCA 2A7HA 3GDVA 1G2LA 4ZROA 1KDQB 4TY6A 1TGNA 3GS9A 3S9BA 1QGFA 1C2GA 1CBWB 1CT0E 2IPHA 2PV9B 2A45B 5FX5A 1MQ5A 3WWBA 1A0LA 1GBTA 3ZZ4A 1QA0A 1TX6A 2ZU3A 4I31A 5EGMA 2FOGA 1N6YA 1V3XA 1A7SA 5ETXA 3E16B 4DJZB 3SJKA 4RKJB 1HB0B 2BDHA 3QWCH 4YT6H 5AFYH 5J4QA 1G32B 2OP9A 3UR6A 2D1JA 3K6ZA 1OSSA 1FN8A 1W10U 1UK3A 4JZIA 4Q2KA 2B7DH 4ASUD 4DGJA 2FMJA 4FOUC 4IMZA 1OWHA 3DFLA 1OS8A 1GDQA 4QT8C 1TX8A 1ELDE 5A8YA 1GHBF 3P8FA 2BQ7B 1K22H 1GI8B 1KXBA 1QRXA 3FANA 5KECA 1Y3UA 2Y80A 2G5NA 1BMFD 1O3GA 2F9NA 2ZA5A 1HGTH 1EB2A 1G9IE 3A85A 3URCA 3NXPA 2J98B 1QBVH 1GJDB 3ZVEA 1BUIA 2ZDAH 1ZMJA 3RXAA 5C3NA 4I7YH 2KCPA 2RA3A 1QBNA 2GDEH 1P05A 1EOLA 3ZVBA 5HYOA 4MPUA 3P92A 4RT0A 5GPIB 1NC6A 1C5UA 1TABE 2K1QA 1IQFA 2LELA 1WV7H 1C5NH 1PYTC 4ABBA 5JB8S 1O5FH 1TGSZ 1SGTA 3LC3A 1ELCA 2BQWB 1F0TA 1CHGA 3MQKC 2J94A 3MMGA 1O2XA 3ZZ7A 4B75A 1GBFA 2TIOA 1DXPA 2PKSC 4IC5A 3CENA 2P16A 3U9AH 4NZLA 5ESBA 1RS0A 1CO7E 3KN2A 5AF9H 2BY5X 3MO3A 1BZXE 4TPIZ 3Q3KA 4CRGA 3PWBA 2JH6D 1O2NA 5F03A 3MYWA 1ZHRA 4YZUA 3G01A 1AB9B 3N7DA 1TLDA 1OOKB 4BXWA 1PJPA 1K0HA 2R0KA 3E6PH 1PPCE 3F1SB 2BY6X 1S84A 1YP9A 5JBCS 1W12U 1EATA 1HAVA 1YF4A 1KXEA 3BN9A 4X1RU 3BG4B 3D49H 3JZ1B 1OYTH 3S69A 1ZMNA 2ZC9H 1V2UT 3GCTG 4VGCB 3D62A 5EQRA 1N8OC 2WUCA 2O8MA 2R2WU 2OC8A 1J16A 2VH6A 1BDAA 4DG4A 4MG3A 2V35A 1P2OA 3GY4A 6ESTA 2GT8A 4CH2B 3TVJB 2ZFRH 1C5QA 5CMXH 1P9SA 1HJ9A 2FI4E 3PO1C 3Q3XA 1S6HA 3RXOA 4U01A 2TGAA 3TJVA 1YM0A 1P2MA 2O8TA 1BTXA 3KQCA 3QLPH 1K21H 2YMSC 3VG8A 4IW4E 3FN8A 3SQEE 1G37A 3A89A 4X8SH 4Y0ZE 1VITG 2VB0A 3S7KB 3QGJA 6CHAC 2BZ6H 2FTLE 3HGPA 1ETSH 1BHXB 3BG4C 1P04A 1EAUA 1LPKB 3L6PA 4TYDA 3W95A 1SSXA 2P95A 2ZKSA 4AGJA 2XCNA 1PQ8A 1DWEH 4NG9H 2FP7B 2Z9KA 4KGAA 5CHAB 4DY7B 1GPZA 4XBBA 3S9CA 5GJ4B 1C1WH 7ESTE 2BDBA 5DN6D 1FN6A 1EJAA 3GY3A 1QTFA 5KGOA 3L33A 5AHGH 3HKIB 4DVAU 1MABB 4IN1A 4A7IB 1OPHB 3RXFA 1GMDF 4XOJA 1JIRA 2OQUA 3U1JB 2C8XB 4YESB 1SR5C 1GGDC 2C8WB 3QX5H 3LKWA 1DE7H 2HNTE 4AORA 4B76A 3T2NA 1C5MD 3SN8A 2H6MA 1JXPA 4DCDA 1Y3WA 1KMHB 2I6QA 4U30A 1MTUA 1J8AA 1XUIA 3Q3YA 1PFXC 3VB5A 5E8EH 5L6NH 4NWLA 1SGQE 1ELAA 1FAKH 1C5PA 1NFXA 2GCHG 4K8YA 3H09A 3QZRA 1VGCC 3RXQA 1NFYA 2IJD1 4O97A 1HAVB 4K8BA 3RC4A 2A2XH 1C2MA 2KFWA 4ISNA 1V2KT 2G81E 4F49A 1FJSA 1V2JT 4NIYA 4Q80A 4MPVA 2PHBA 3GCHC 1NFUA 3IWMA 2PP6A 3UQVA 4WMEA 4FVDA 1O2QA 3OTPA 1BT7A 2UWOA 1DY9A 3F0OA 1T8NA 3SOSA 3MWIU 1E38B 3MO9A 1K1LA 4AFUA 4GCHG 1F7ZA 4SGAE 1V2PT 1PPZA 3PLKA 1YYY1 4X2YA 5EXMA 1XVMA 2HLCA 1SGFA 1O3EA 1TQ7B 1GMHG 1H9IE 4FU9A 3N7EA 1A5IA 1Z8RA 4WXVA 1MZDA 2WUBA 1LMWB 1WCZA 1W0ZU 3KNXA 1SFQB 1UJ1A 4A1TA 1W13U 1UTPA 1WU1A 5DP6A 5DKMA 2H2ZA 1E1RD 4AX9H 1AKSB 3B8JA 2CJIA 3SGQE 2L6OA 3M5OA 2FXRA 2EI8A 1BRUP 2SFAA 2P94A 4I8JA 2STBE 4HGCA 2A5KA 2ZFFH 4RN6A 3TIUA 1PPHE 1VITF 3QTOH 2GTBA 2F9PA 1RRKA 4A1VA 3TK5A 1AY6H 2J9NA 1E36B 3ESTA 1GI2A 1BQYA 2ZHFH 1V2MT 1NU9A 1T31A 3T27A 1TNJA 3CS7A 1P12E 4NFEA 4A92A 1C5WB 1GBKA 1ARCA 1FV9A 1MKWH 2M2AA 4YM9A 2KX4A 3F2HA 1BTHH 2ANYA 4P00A 1XUGA 2PGQB 4ZKOU 2VIWA 2YNBA 1NESE 1AUTC 2P3TB 2VIOA 4CH8B 1YC0A 1Z71A 1AZ8A 1K1IA 2GCTB 1GBJA 1C1OA 2JH0D 1XXDA 2OINA 2J38A 4NIXA 4CBNA 1AI8H 1P06A 1ABIH 1BBRK 2AHME 3KQBA 2ZIQH 3P8OA 4Y79A 1GJCB 4GSOA 5EODA 1O2UA 1YLCA 4JZFH 3RM0H 1KXAA 1O5BB 3F9GA 3FP7E 2FLRH 1WSSH 2VVCA 3NCLA 2C90B 3SNEA 5FCKA 1JOUB 2ZCKP 1A0JA 3STJA 3ZZAA 1KIGH 3BTTE 3RXLA 2BHGA 1PQ5A 3P70B 1E79D 2HVXA 4Y8ZA 4NSVA 2ZPRA 2ZF0H 3SUFA 1B0EA 5LH8A 1ZHMA 2A2QH 1UTOA 2ODYB 2BZAA 1GBIA 4WXIA 4AZ2B 2ZTYA 2P59A 3PB1E 3PWCA 4CRAA 2BB4A 3SNBA 1PPFE 5C1XA 1SLWB 3KEEA 2KAIA 5LPEA 1S0QA 1O5DH 2B5TB 2D2DA 1F0UA 1XM1A 3TU7H 5E0JA 5F8ZA 5HMAA 2QAAA 5IK2D 5B6LA 4UONA 1SKYE 4ZHLU 4FUFA 2ZFPH 2VINA 4Y10E 4RI0A 3PMJA 1ESAA 1BRAA 1PPBH 5TCCA 3BEUA 3FP6E 1HXEH 1EFRD 1CT2E 1QQ4A 2JJ1D 2F4LA 5HM2A 1AFQB 1NRNH 1LDTT 3OX7U 4TPYA 4XD7D 4AFSA 4H6SB 2J4IA 3NUMA 4UFFH 5BRRE 4D76A 4MDSA 3A88A 1C1UH 3DSPA 3SNDA 1MTNB 2ZDNA 4J1YA 5GNDA 4FXGH 3TGJE 2XRCA 1KLIH 3SO3A 2LNCA 3AASA 1GHZA 3KYFA 4UFEH 2Q6DA 2A1DB 1NZQH 3GYMA 2OC1A 1RGQA 3I29A 1EP5A 3LGWA 2V7QD 1GI0A 1CBWC 1TPAE 3OY5U 1Y5AT 1CHOG 1HJAB 1C5TA 1YCPH 5GDSH 3LPRA 3T29A 3ZV8A 1SGPE 2G51A 2JIZD 5ESTE 3RXEA 1BRBE 1DANH 3CP7A 1XKAC 1EAIA 3Q77A 1L1JA 1UTLM 1YCPM 1P8VC 4ASHA 1IAUA 3SJ8A 2HPQH 1O3KA 2Z3CA 4MPWA 4B1TA 3PMBB 2BLOA 2NU1E 3KIDU 2BD9A 1NRRH 2ZU5A 5FCRA 2ZWLH 2WPDD 4Y8YA 1UVSH 3NZIA 3SNCA 4FUJA 4CREA 4O9VA 1TONA 2NU3E 1TPOA 3MNBA 1EZUC 4U32A 2JETC 4AGKA 3MNSA 3GCOA 3UR9A 1AKSA 2C8ZB 1SGYE 2D26C 3A87A 2F9BH 2FO9A 1YBWA 3VB6A 1UW7A 4K1SA 1BMLA 1HIAB 1SFIA 5C1UA 4FETA 1ZGIA 1CA0C 3U98H 1SGRE 2IN2A 1AQ7A 1YWUA 2SGPE 3BV9B 4UDWH 1B7XB 2ZGJA 3BTDE 2BMGB 4KKDA 4X1SU 1LVMA 3SYJA 5EOKA 4AYYB 1BTZA 1XXFA 2WPMS 2QY0B 3MNCA 1FZZA 2TGDA 3ATMA 3LGIA 2EI7A 3A8DA 3UIRA 2AYWA 3M61U 3RXHA 1BA8B 1L0ZA 4TSFD 2HVYB 1ZMLA 1BBRE 1JMOH 1ZRBA 3P95A 1ZSJA 1GVLA 4JCNA 2QF0A 2WPKS 2QYIA 2DE9A 1VZQH 1OKXA 1MUEB 2VH0A 3UUZA 3HGNA 1EZQA 3VFEA 1SGNE 1V2LT 2JDID 1EQ9A 1TA6A 2QF4A 5EPNA 1C2JA 1HDTH 4ZAEA 3EGKH 1NFWA 4HFPB 4MNVA 1HFDA 2XXLA 3SBKA 4OS5A 1X7AC 4OS4A 1IQMA 1OWEA 3FP8E 5DP8A 2BVRH 2BD7A 3B23B 8LPRA 3RLWH 2AIPA 1THPB 2RA0A 1AVWA 1EOJA 3ELAH 1SGDE 2I6SA 3RDZA 1F5RA 3TH2H 1QB9A 3BTQE 1TOMH 4ZXYH 1Q3XA 3LJOA 4NZQA 2H5CA 1O3JA 3L3TA 1UTNA 1T32A 1TALA 3E0PB 3IG6B 3NRLA 2BD3A 3EQ0H 1LCYA 4JZEH 1C2KA 4I8GA 1UTQA 1QIXB 1UO6A 2CF8H 5HM9A 4ZH8A 1FQ3A 2XC0A 1Z1JA 2ZHWH 2BD8A 5L2ZH 1MKXH 1A0HB 1AWHB 1HAZB 2ANKH 1VITH 3EYDA 2F9UA 3SQHE 1GJBB 2FYRA 1C5LH 2GKVE 5FBIA 1O5GH 2PSXA 2SGDE 1Z6EA 3LONA 1BJUA 1A46H 3RXJA 1WTGH 1FPCH 4O3TA 3VXEH 2PTNA 1O2ZA 1LHFH 2KCAA 1T8OA 1V2RT 1LVYA 1J17T 1W11U 3GDUA 3GY2A 5DPAA 3UFAA 1O3NA 1W14U 4Y8XA 3SU0A 3NK8A 1ZYOA 5T1VA 3LDXH 2ZHQH 3RXCA 1FAXA 1L1NA 2YMSB 3D65E 1GI4A 1BMMH 2F83A 2G4UA 1IQKA 2WYJA 1KDQA 2ZG0H 1GBBA 1GCTC 1PQAA 1FX0B 2XWBI 3MH6A 1SHYA 1L1GA 4AB9A 4ABFA 3DSGA 1ELGA 1WBGB 2OTVA 3F6UH 2ZGBH 1MTSA 1NPMA 4BAQB 1NBME 1GHAG 1IQNA 3FO8D 2VVUA 2FPZA 1QR3E 2W5EA 2Z94A 1AE8H 1TE0A 1GBMA 1UCYH 1C2HA 4Y76A 1JRSA 1BRCE 4XE4A 5FPYA 3RU4E 2AMQA 2V6NA 3ODDA 4FUEA 3A80A 1OP8A 1MMJN 2BYAX 1LVOA 4MNWA 4NA8A 1WQVH 4X8UH 2G52A 2QC2A 1DT2A 3EA7A 4DOQA 2ZDLA 4NSYA 3AVZA 3BEFB 1AO5A 2AH4X 3K9XB 1OWJA 4I33A 1ANBA 1G2MA 1J15A 1BTWA 3RXSA 2CHAC 5KEDA 3MH7A 2BDAA 5GXPA 3MI4A 5A2MH 2BXTH 4ABGA 2NWNA 3SU3A 4YO9A 1CGJE 1UCYE 4B73A 2TRMA 1P2IA 3LJJA 1SGIB 1MH0A 1QL9A 2QIQA 2FTMA 3SNAA 1SL3A 2DUCA 4WMFA 5FX6A 5HKKD 1TQ0B 2QF3A 2C4FH 3SUDA 3F9HA 5JPMH 2FI5E 2GX4A 4SGBE 2FOAA 4Y0YE 2ZO3H 1W0KD 3PTNA 8ESTE 1HUTH 2JJ2D 1BIOA 4K1EA 3T25A 4CR9A 5AFZH 1ZGVA 3SU4A 3GY7A 2WPHS 3ZVAA 1CE5A 3GDSA 4TT3D 3PROA 3ATLA 2H9EH 2XCFA 2QCYA 1COWD 1QB1A 3K6YA 4A5TS 1MU8B 8KME2 1O3CA 1S82A 1DICA 4BNRA 4K3JA 4CHAB 4GPGA 2BQ6B 3NWUA 2PKAA 2FM2A 1DX5M 3ZVGA 2Z9GA 4D7FA 5C17A 1ESTA 3BTKE 3RM2H 2XBVA 2ILNA 2F9OA 1NM6A 4X6OA 4CRDA 2VGCB 8GCHG 3KF2A 1E0FD 1HAPH 4K69A 7KMEH 1CU1A 3E91A 1TPSA 2ZU2A 2O9QA 5T6GA 2BD5A 3EE7A 1GBCA 4ISHH 3JZ2B 4KELA 1RTLA 5EJ1A 1QZ8A 1ACBE 1QL8A 3SZEA 3TJUA 4AN7A 4YOJA 2SNVA 4A6LA 2Z9JA 1ZPZA 4BTTB 4ACAA 3SW2B 1Z8IB 3SZNA 2XYAA 1O2KA 4M9FA 1K1NA 2FS8A 4WMDA 3E3TA 1O37A 1SLVB 3SGBE 4X1NU 8GCHF 1FIZA 1DUEA 1Z8JB 3V13A 1V2NT 5GWZA 2ZFQH 1UVUH 2FEQH 2OXSA 3AW0A 2CXVA 1S5SA 2PFEA 2H1UA 3SU2A 5DSFA 1C4V2 3ENSB 4FVBA 1O2LA 1F0RA 1C4U2 2XC5A 1Q2WA 2VIVA 5C0TA 3HATH 4Q7YA 1L4ZA 1O38A 2FI3E 3N99A 2ZFSA 3UREA 2RG3A 4THNH 3Q76A 4WY3A 2Y82A 1HIAA 4LOYH 4B6EA 3SV6A 1T8LA 4AB8A 3MU8A 1W7XH 1HLTH 1YLDA 2Y6TA 4IMQA 2G4TA 1SG8B 3ZZ5A 5EXNA 1QHRB 4KTUA 2VIDA 2WPJS 1D3PB 1C1MA 1TAWA 2XWAA 4BAOB 1MBQA 1MCTA 4Z0KA 5C5NA 1SQTA 3UWIA 2SGEE 5CHAC 1C4Y2 1EZSC 1CA8B 4INLA 2HALA 1GI3A 2BVXH 1D6WA 2BX4A 1DWBH 3SUGA 1B5GH 5A0BA 2HWLB 4X6PA 2IJOB 5EU8A 5EW1H 1FONA 3LC5A 3Q00A 4HTCH 1IQEA 4U2WA 3SU5A 1FPHH 1QCPA 1VCWA 1O3HA 3UPEA 3QO6A 2QXIA 1SQAA 3TPIZ 1ARBA 2Q6GA 2CMYA 2R2MB 1O3BA 3TJNA 1QURH 1NO9H 4CRBA 1ZHPA 3F9EA 1Y5BT 2QXJA 3RP2A 2ZDKA 4YOIA 5LGOA 1OP0A 3A7TA 1GHXH 1P2JA 2Y5GA 2BLWA 4Q7XA 1YPLH 3A83A 2VBCA 4Y6DA 1Y3VA 1S0RA 2ZNKH 3E0NB 1Q31A 1MCVA 1BB0B 4GVUA 4XDEA 4GLYA 4ABHA 2P3UB 1DY8A 2WHXA 1GDNA 2ZDVH 1O32A 2BD4A 1GG6B 3M7TA 3QZQA 1DDJA 4BAKB 2O8UA 1YLNA 3TLOA 3RMLH 2CN0H 5IYTA 1IOEA 1O2VA 2L74A 4F55A 3A7VA 1A1RA 1O5CB 1Y3YA 4XSKU 4Z6AH 1MZAA 1P3CA 1P01A 1OXGA 3TJOA 1GHVH 1C5YB 3MTYA 2J5UA 3V12A 3V3MA 1F5KU 5E0GA 1SVPA 1XUKA 2GZ9A 2WV5A 1AUJA 2F43B 3M3TA 1NBMD 5FL7D 2G5VA 2AEIH 1RJXB 4ISOA 1ZJDA 3R3GB 2PUXB 1LHEH 3ZV9A 2B0FA 1WUNH 4GHQA 3TK9A 4JZ1A 3GYLB 1DLEA 2BY9X 1WDIA 1GBDA 1MU6B 3PRDA 2W26A 3A8CA 1INCA 1IHTH 5IDKA 2A4RA 1O2IA 1G30B 1DWDH 5JBTA 4AYVB 3F2GA 1TNGA 3SJ9A 1HAHH 4ZUHA 4ESTE 1CT4E 5EQSA 3RMNH 1ETRH 4LZ1H 5TJXA 4AG1A 3MOCA 1ZSLA 5C94A 4JK6A 1ZRKA 3RMMH 4K60A 2WINI 2GCTC 4X2XA 1QRZA 3GY5A 1XUJA 4FUBA 2CV3A 1SMFE 4HG6A 3OTJE 2PLXA 4I8KA 1O39A 1EASA 2BM2A 1C5RA 3P8NA 5B6OA 1P02A 3QDZB 1G3EA 2GDDA 4X1QU 1GI6A 4GUXA 1GI5A 4BAHB 4INHA 1EKBB 2FOEA 2SGAA 3P8GA 1QRWA 3CS0A 2A5AA 4NGAH 3SU1A 2W6ID 1O35A 1E1QD 3MO6A 1O3LA 1O2TA 4AC9A 1KSNA 1EPTC 2ZGXH 1V2TT 3C27B 1KLTA 2QA9E 3UNQA 1P11E 4ACBA 1GVKB 3F68H 2PUQH 2WPLS 1CHOF 1WYKA 1EJMA 1Y5UT 4RKOB 4BTUB 2THFB 4MPXA 1L4DA 1BMNH 3KCGH 2ZP0H 4DT7B 3TGKE 1EAXA 2BY8X 1H8IH 9ESTA 1U6QA 4R0IA 2GGVB 4FUCA 1E35B 2A32A 2QE7D 2GVFA 1WOFA 1AFEH 4XBCA 5CDFE 4I8LA 4JMYA 1N8OB 3GCHB 2J98A 4FUDA 2RCEA 1D4PB 1O3DA 1G3DA 1TX7A 4UEHH 2EEKA 1LO6A 3RXRA 1LKBA 3F2FA 2A0QB 2ZTXA 3LGTA 4WH6A 2HOBA 3QTVH 3H7TA 1DWCH 2FOMB 4OGXA 5C5OA 4MLFB 2HLDD 1EX3A 5A0AE 4I86A 3KQEA 4DIHH 5F53A 1RFNA 1PPGE 5A09A 1TGTA 1SGEE 5EQQA 2JKHA 1V2VT 4ZMAH 2XBWA 1K1PA 1CGHA 1D3TB 1S6LA 1O2RA 3ZZ3A 1VCQA 1TFXA 1FY5A 1AE5A 1IQGA 1QFKH 3A81A 4F48B 1SGFG 1BTYA 1NU7B 3RLYH 4D9RA 1H4WA 3EA9A 1QJ6B 2ZGHA 3PYHA 3QGNB 1LPZB 5DP7A 3A7YA 1S83A 1VJAU 1GI9B 1FMGA 2C8YB 1YPGH 1WQSA 1ZLRA 1O3IA 2J34A 1FY1A 3CNRA 1SHHB 1TB6H 3U69H 2H9HA 3RMOH 3UNSA 1HAIH 2J95A 2UUYA 2CGAA 3ZVDA 4Q7ZA 1QJ1B 5EJLA 2Z7FE 2ZHDA 4H4FA 2O8LA 1DFPA 3SGAE 1ANDA 2ZDMA 1SB1H 2GMTC 2FOFA 5EG4A 3BIVH 2KM0A 2VWOA 1S81A 2RDEA 1C2LA 3SHAH 4ABEA 2ZU4A 1VR1H 2ALPA 3SORA 4NA9H 2V3OH 2ZQ1A 2R3UA 3DSOA 1UTMA 1TPPA 3PV5A 1H9LB 1CQQA 2OBOA 3W94A 3T62A 2FOCA 3GY8A 3M3SA 2FIRH 3VGCC 4DW2U 3LGYA 2A31A 2VVVA 1EUFA 3U28C 3R0FA 1Y59T 1MQ6A 1QL7A 2Y7XA 2QF5A 3M5MA 2OC7A 2XW9A 1OWKA 3B9FH 1ZJKA 2AMDA 5I25A 1TNHA 5K0HA 3V0XA 1P3EA 2V3MA 1VGCB 1YPHC 5F8XA 1P03A 1O3OA 2HPPH 3EDXB 2A4OA 5EJZA 3DFJA 1UVOA 4ABDA 6GCHG 1KXDA 2Q1JA 2IOTA 2TPIZ 1ZTKA 5JBAS 2F9VA 1UHBA 1XUHA 4MNXA 2XNDD 2W7SA 2A4GA 2BLVA 1ZTLA 2Z9LA 2A5IA 2RDLA 1A2CH 3OAAD 3OYPA 1C9TA 1TIOA 2BXUH 5HXFA 2V0BA 1DOJA 2EI6A 1YPMH 2GT7A 3T26A 1GHBG 1DLKB 3BTWE 1K1MA 3BSQA 1A61H 3K2UA 2Y7ZA 2DE8A 1CA0B 3TK6A 2ODQA 2VIQA 5F6MA 1D3DB 4TWYA 3FFGA 4J2YB 4BTIB 3LIWA 2BDCA 5L2YH 1N1LA 1T8MA 3OFND 2ZPQA 5AVDA 1C1SA 5HIYA 5HGGA 5L30H 4D7GA 3H7OA 2R9PA 1GJ7B 4KP0A 2A4QA 2M5TA 4MVNA 4A1XA 3T28A 1C1PA 2PKSB 5BPEA 4OS1A 1LQEA 3OEHD 4ISIH 3LT3A 4E7NA 4WWYA 4KTSA 1ELEE 5EIYA 4JK5A 1RTFB 3T5FH 3SV9A 1MKWK 1N6XA 1BMAA 3U8OH 1G3BA 1GMCG 1IQLA 1GJ8B 1GBEA 2ZFTA 4RT1A 4R8TB 1O2PA 3M37A 3AAUA 1W0JD 3I78A 1YY3A 1TYNA 2GCHF 1HAYB 1O3AA 1KXCA 4B71A 2VWNA 3VXFH 1MKXK 1RXPA 1D9IA 1GGDB 3BEIB 1BOQA 2AS9A 1QQUA 2ULLA 2JETB 3ZIAD 4CBOA 1GL0E 3SHCH 3SI3H 1C1RA 3KHVA 3RXGA 1YPHE 2XTTB 1P57B 1QY6A 1HRTH 3WWFA 3HK3B 4X2WA 1LHGH 3RC6A 1DS2E 4NCYA 4ZHAA 3TNSA 4FUHA 1OWDA 1AHTH 4INKA 4D9QA 5JYIA 5H4IB 2AGGX 1MAXA 2PTCE 1ELFA 1GJ6A 3RUOA 3U8RH 3DT0H 3EA8A 2BDIA 3LH1A 2R3YA 1YCPK 2SGFE 2ZPSA 2VWLA 3A7XA 5DP4A 2UWLA 3ZZDA 4BXSA 3M36A 4E06H 2YMSD 1NT1A 1S6FA 3ZVFA 5GCHG 5DO4H 2G55A 1RIWB 3HK6B 4Y71A 2GZ8A 2Y5HA 2Q6FA 3RXKA 3SU6A 3BF6H 2FZZA 3VB7A 2WPIS 1GJ4H 1MTWA 2QV1A 3RU4T 5ABWA 1O3FA 5HIZA 3A7ZA 1LPGB 4CRFA 1F0SA 3GCTF 1OX1A 1UVPA 1Y3XA 3UOPA 3E90B 5DP3A 5E0HA 2H5DA 1HJAC 4I8HA 3KYGA 3S0NA 3OY6U 5G4BA 1C5SA 3VB4A 1O36A 2OK5A 1C2IA 1KY9A 1HAOH 5PTPA 2K8IA 4UD9H 1JBUH 3SJIA 4B2AA 5DG6A 2HRVA 3FVFB 5JDUB 1TNLA 2AIQA 5E2PA 1A5GH 1MD7A 2KZ4A 1O5AB 1P9UA 4NFFA 1T4UH 2HNTC 5C20A 4ZCNA 1XVOA 1UVTH 2EC9H 2GZ7A 3FOAA 1SOZA 4FUIA 5DP9A 1ELVA 3O8DA 4LZ4B 1GWAA 1MAYA 1C5XB 3BG8A 1SI5H 1V6DA 3PV4A 2GMTB 5EPYA 2BX3A 1TMBH 3DCLA 3ZVCA 3RXUA 1GJ9B 3C1KA 1TBRH 2P3FH 3LH3A 1VKYA 2VNTA 2W3KA 1HXFH 5C1YA 3KL6A 1PPEE 1A3EH 1YPJH 1LVBA 1O2JA 4DURA 1GI1A 1K2I1 5FHTA 1YKTA 2KAIB 1FY3A 1FDPA 2F3CE 3UNRA 1HV7A 2PSYA 3DHKH 3M35A 3VEQB 3FKSD 2OD3B 4ABJA 2QN5T 4Y11E 1V2WT 3SV2H 1C1VH 2VU8E 3UWJH 3PV2A 1O2OA 4MTBA 1ZR0A 5FPSA 3SV7A 3LOXA 1DPOA 1RD3B 1DSTA 1QJ7B 1K1JA 2C3SA 1GMDG 4B6FA 4JZDH 2FDAA 3SI4H 2W7UA 4Y7BA 3BIUH 4IGDA 3GISB 4WF8A 2Z3EA 1GJAB 1O3MA 1O2YA 1AWFH 3BTHE 3A8BA 4ZKNU 1T7CA 1SPJA 3PRBA 1RTKA 2VIPA 1FXYA 2KCYA 4UFGH 5E2OA 4HI3A 1ZOMA 2EA3A 1C5OH 1W0YH 1JWTA 3E8LA 5A8ZA 1K28D 3A82A 3WY8A 2CK3D 1THSH 2ZI2H 4TY7A 1FUJA 1TBZH 4X6NA 4CR5A 1Z8GA 2AERH 1H1BA 3S7HB 4XFQA 1TOCB 1AB9C 2BLQA 1T4VH 2G8TA 3ZZ9A 1C5ZB 2ZGCA 1W8BH 1Z7KA 1E34B 2J2UA 1DITH 4K2YA 1QA7A 1XX9A 2OCVB 4ABAA 3O8RA 5DP5A 3DA9B 1A5HA 1HCGA 3KGPA 3GICB 2QXHA 5CHBA 2O8WA 4O03A 1P10A 1KYNA 1E37B 3KQDA 4ZKRU 2KCOA 1EAWA 1AD8H 1FY8E 1CVWH 2ZCLP 1L2EA 1V2OT 1ESBA 1TRNA 1V2ST 1NRSH 2ALVA 1GBLA 4IN2A 5C67A 1GMHF 3UTUH 1W3CA 3N7OA 1S85A 1WXRA 2PKAB 1AVXA 2OC0A 5A8XA 1WTHD 5JBBS 2Z6BD 5SGAE 1AMHA 1Z1IA 5T6DA 4FU7A 2WV9A 1HJ8A 1EP6A 2C93B 2ZQ2A 1O31A 1TNIA 1XMNB 4B2CA 2D8WA 2ZHEH 2AGEX 4KTCA 1IQJA 4AFQA 1C1TA 4XBDA 3HPTB 2NU4E 5TCAA 3PLPA 4Q63A 2OBQA 2W6JD 4K5ZA 4NWKA 4Y7AA 2YNAA 1VCPA 3EAJA 4FUGA 2KR7A 2G00A 4JYVH 1ABJH 4HZHA 2XNIA 2WZQA 6CHAB 3RU4D 3ZZCA 1PQ7A 2OLGA 2R0LA 1EXFA 2CF9H 3P6ZB 1FLEE 1EJNA 3WW7A 3OU0A 1AGJA 2FESH 4OS6A 3BTME 2UUFB 2OQ5A 1UK4A 1TRMA 1GDUA 2ODPA 1P09A 4IBLH 1GHAF 3SV8A 1GI7B 3TITA 1O3PB 1MBMA 1MTNC 1C2FA 2ZCHP 1OP2A 3HKJB 1ZPBA 1O33A 1TMTH 5FAHA 2AFQB 2A7JA 2FOBA 1EPTB 2JH5D 3MHWU 4BOHA 1GCDA 4ISLA 4M7GA 5I46H 2UUJB 2TBSA 3GY6A 1AIXH 1UTJA 3OEED 5JB9S 4YOGA 3SJOA 3KQ5A 3RXVA 2P8OC 4Z1MD 1P2NA 1V2QT 3ZYDA 5CE1A 1C2EA 2ZZUH 2BY7X 1C9PA 5FXLA 1FNIA 3V7TA 4H6TA 1TGCA 4ABIA 2BOHB 1IQHA
chains in the Genus database with same CATH topology
2WV4A 5FPTA 1UK2A 1MD8A 2BD2A 1O2MA 1SQOA 3STIA 1SBWA 2ZTZA 3M5NA 2PWXA 2BVSH 3TGIE 1NTPA 3PMHB 2VJ1A 1AU8A 2TGTA 4X8VH 5J4SA 4LK4A 4ZXXH 4FU8A 1A3BH 1AZZA 5GIBA 1EB1H 1O34A 1O2SA 3BTEE 2BOKA 1G36A 2ASUB 1NS3A 3QUMP 9LPRA 3TH3H 4E05H 3ZZBA 4NIVA 1GBHA 1AN1E 5FBEA 1LHCH 2PR3A 2A7CA 1SLXB 1UTKA 1KTTB 2BDYA 3DUXH 3FAOA 1CSOE 3FZDA 3M7UA 4GCHF 5T3HA 2CHAB 4B74A 3BTGE 2GV6A 5K7RA 2GD4B 3GCNA 1EZXC 5LPFA 1TNKA 2TGPZ 4UFDH 5C2ZA 3NKKA 2P93A 3ITIA 1KLJH 4AG2A 4D8NA 1OYQA 1C1NA 1GCTB 1VJ9U 2STAE 2AGIX 4ZHMU 3ATWA 1GL1A 1HAGE 3E1XB 3UY9A 1OWIA 1AVGH 4IC6A 3A86A 3ZZ8A 2HNTF 2FX6A 1FIWA 2BDGA 3AAVA 4BANB 1F5LA 1F92A 1DXWA 3NPSA 1BHXF 4O3UA 4RSPA 1F2SE 3M7QA 1JRTA 4WVPE 1GVZA 1Z6JH 1HPGA 4WH8A 3MH4A 3UOUA 2HGTH 1TBQH 3RXIA 2PW8H 4OGYA 4X0WU 1YGCH 3TNTA 1NY22 1A4WH 3ODFA 4F4OC 2SNWA 1W2KH 1ZTJA 3IITA 3U8TH 2ZEBA 4E7RG 4MNYA 2J92A 2H9TH 1GBAA 2P8OB 1HNEE 1C2DA 2W3IA 3MNXA 4UE7H 4I32A 3I77A 3PM3A 3VGCB 3K65B 1YPEH 3MU5A 5F8TA 2QGRA 4OS7A 1P0SH 3MU1A 3URDA 2VGCC 3F9FA 1DSUA 1YPKH 1H9HE 2Z9IA 4GHTA 1DUAA 3RXDA 1QNJA 4X6MA 1EPTA 3QK1A 3BTFE 4PROA 1XKBC 2ANMH 4AFZA 1ID5H 2FX4A 4OS2A 3A84A 4YLUA 1M9UA 4AOQA 1UMAH 1AFQC 1LKAA 1WAYB 1TWXB 1J9CH 1O0DH 2ANWA 2F91A 1TRYA 1BTPA 3SUEA 2B8OH 4YLQH 1O2GH 1HAXB 1SLUB 4CHAC 3A7WA 3QN7A 3AW1A 3PO1B 1HBTH 2UWPA 2ZU1A 3MU4A 2SGQE 4MQAA 1O30A 3ZYEA 6LPRA 1K1OA 3ZZ6A 1ANCA 1ETTH 2ZECA 5GCHF 2Y5FA 1TA2A 1D6RA 1HYLA 4GAWA 1DVAH 5EXLA 2FOHA 2GP9B 2WYGA 1G3CA 4X1PU 1O2WA 3DD2H 1ORFA 4NA7A 2FWWA 1BCUH 3MFJA 1C5VA 2FS9A 2QXGA 4LXBH 1LHDH 2XBXA 1BBRH 3PLBA 2Y81A 4YT7H 3FZZA 3RXTA 3VB3A 1DM4B 1TGBA 3RXBA 3U1IB 1NROH 1BITA 2XC4A 1QB6A 1GJ5H 1ZSKA 3LGVA 2GV7A 1ELBA 2ESTE 1BJVA 1PYTD 1ELTA 2Z3DA 3MU0A 3TH4H 1UHBB 4WJG2 1W7GH 3O8CA 1GHYH 2AMPA 4K1TA 1GMCF 2VWMA 1P2QA 4YTAA 3A8AA 1SOTA 1THRH 4ZKSU 3ATIA 1FI8A 3RXPA 4DIIH 1J14A 5EW2H 2XBYA 1D3QB 7LPRA 1NRPH 1K9OE 1JIMA 1FY4A 4JYTA 3RXMA 3OSYA 1H8DH 1SGCA 1IHSH 1BTUA 3GOVB 7GCHF 2YOLA 3LGUA 4H42U 4X8TH 5T6FA 2NU0E 5LPRA 2FYQA 1IQIA 1GHWH 1QBOA 2NU2E 2B9LA 3P17H 3UQOA 2FODA 1ZZZA 1XUFA 1NRQH 1TMUH 3EE0B 1C1QA 3PMAB 4NIWA 1CGIE 1ZPCA 1GG6C 1KTSB 2FLBH 4VGCC 1NN6A 1LQDB 2UUKB 3ATKA 2OUAA 2V3HH 1LTOA 4B2BA 4JYUH 1B0FA 3M3VA 1ANEA 2LPRA 7GCHG 4BAMB 1P2KA 3S9AA 3VPKA 3MH5A 5A0CA 3D23A 3M5LA 3H5CB 1RIWC 1O5EH 1UCYK 5DGJA 4TWWA 5DK1A 3RC5A 1Y8TA 1O2HA 1MTVA 3LU9B 2PGBB 6GCHF 1KXFA 1SC8U 4X2VA 2BTCE 3PTBA 4IS5A 5DJ7A 3O8BA 4CRCA 2A7HA 3GDVA 1G2LA 4ZROA 1KDQB 4TY6A 1TGNA 3S9BA 1QGFA 1C2GA 1CBWB 1CT0E 2IPHA 2PV9B 2A45B 5FX5A 1MQ5A 1A0LA 1GBTA 3ZZ4A 1QA0A 1TX6A 2ZU3A 4I31A 5EGMA 2FOGA 1N6YA 1V3XA 1A7SA 5ETXA 3E16B 4DJZB 3SJKA 4RKJB 1HB0B 2BDHA 3QWCH 4YT6H 5AFYH 5J4QA 1G32B 2OP9A 3UR6A 2D1JA 3K6ZA 1OSSA 1FN8A 1W10U 1UK3A 4JZIA 4Q2KA 2B7DH 4DGJA 2FMJA 4IMZA 1OWHA 3DFLA 1OS8A 1GDQA 4QT8C 1TX8A 1ELDE 5A8YA 1GHBF 3P8FA 2BQ7B 1K22H 1GI8B 1KXBA 1QRXA 3FANA 1Y3UA 2Y80A 2G5NA 1O3GA 2F9NA 2ZA5A 1HGTH 1EB2A 1G9IE 3A85A 3URCA 3NXPA 1QBVH 1GJDB 3ZVEA 1BUIA 2ZDAH 1ZMJA 3RXAA 5C3NA 4I7YH 2RA3A 1QBNA 2GDEH 1P05A 1EOLA 3ZVBA 5HYOA 4MPUA 3P92A 5GPIB 1NC6A 1C5UA 1TABE 2K1QA 1IQFA 1WV7H 1C5NH 1PYTC 4ABBA 5JB8S 1O5FH 1TGSZ 1SGTA 3LC3A 1ELCA 2BQWB 1F0TA 1CHGA 2J94A 3MMGA 1O2XA 3ZZ7A 4B75A 1GBFA 2TIOA 1DXPA 2PKSC 4IC5A 3CENA 2P16A 3U9AH 4NZLA 5ESBA 1RS0A 1CO7E 3KN2A 5AF9H 2BY5X 3MO3A 1BZXE 4TPIZ 3Q3KA 4CRGA 3PWBA 2JH6D 1O2NA 5F03A 3MYWA 1ZHRA 4YZUA 3G01A 1AB9B 1TLDA 1OOKB 4BXWA 1PJPA 2R0KA 3E6PH 1PPCE 3F1SB 2BY6X 1S84A 1YP9A 5JBCS 1W12U 1EATA 1HAVA 1YF4A 1KXEA 3BN9A 4X1RU 3BG4B 3D49H 3JZ1B 1OYTH 3S69A 1ZMNA 2ZC9H 1V2UT 3GCTG 4VGCB 3D62A 5EQRA 1N8OC 2WUCA 2O8MA 2R2WU 2OC8A 1J16A 2VH6A 1BDAA 4DG4A 4MG3A 2V35A 1P2OA 3GY4A 6ESTA 2GT8A 4CH2B 3TVJB 2ZFRH 1C5QA 5CMXH 1P9SA 1HJ9A 2FI4E 3PO1C 3Q3XA 1S6HA 3RXOA 4U01A 2TGAA 3TJVA 1YM0A 1P2MA 2O8TA 1BTXA 3KQCA 3QLPH 1K21H 4IW4E 3SQEE 1G37A 3A89A 4X8SH 4Y0ZE 1VITG 2VB0A 3S7KB 3QGJA 6CHAC 2BZ6H 2FTLE 3HGPA 1ETSH 1BHXB 3BG4C 1P04A 1EAUA 1LPKB 3L6PA 4TYDA 3W95A 1SSXA 2P95A 2ZKSA 4AGJA 2XCNA 1PQ8A 1DWEH 4NG9H 2FP7B 2Z9KA 4KGAA 5CHAB 4DY7B 1GPZA 4XBBA 3S9CA 5GJ4B 1C1WH 7ESTE 2BDBA 1FN6A 1EJAA 3GY3A 1QTFA 3L33A 5AHGH 3HKIB 4DVAU 4IN1A 4A7IB 1OPHB 3RXFA 1GMDF 4XOJA 1JIRA 2OQUA 3U1JB 2C8XB 4YESB 1SR5C 1GGDC 2C8WB 3QX5H 3LKWA 1DE7H 2HNTE 4AORA 4B76A 3T2NA 1C5MD 3SN8A 2H6MA 1JXPA 4DCDA 1Y3WA 2I6QA 4U30A 1MTUA 1J8AA 1XUIA 3Q3YA 1PFXC 3VB5A 5E8EH 5L6NH 4NWLA 1SGQE 1ELAA 1FAKH 1C5PA 1NFXA 2GCHG 4K8YA 3QZRA 1VGCC 3RXQA 1NFYA 4O97A 1HAVB 4K8BA 3RC4A 2A2XH 1C2MA 4ISNA 1V2KT 2G81E 4F49A 1FJSA 1V2JT 4NIYA 4Q80A 4MPVA 2PHBA 3GCHC 1NFUA 3IWMA 3UQVA 4WMEA 4FVDA 1O2QA 1BT7A 2UWOA 1DY9A 1T8NA 3SOSA 3MWIU 1E38B 3MO9A 1K1LA 4AFUA 4GCHG 1F7ZA 4SGAE 1V2PT 1PPZA 3PLKA 1YYY1 4X2YA 5EXMA 1XVMA 2HLCA 1SGFA 1O3EA 1TQ7B 1GMHG 1H9IE 4FU9A 1A5IA 1Z8RA 4WXVA 1MZDA 2WUBA 1LMWB 1WCZA 1W0ZU 3KNXA 1SFQB 1UJ1A 4A1TA 1W13U 1UTPA 1WU1A 5DP6A 5DKMA 2H2ZA 4AX9H 1AKSB 3B8JA 2CJIA 3SGQE 3M5OA 2FXRA 2EI8A 1BRUP 2SFAA 2P94A 4I8JA 2STBE 4HGCA 2A5KA 2ZFFH 4RN6A 3TIUA 1PPHE 1VITF 3QTOH 2GTBA 2F9PA 1RRKA 4A1VA 3TK5A 1AY6H 2J9NA 1E36B 3ESTA 1GI2A 1BQYA 2ZHFH 1V2MT 1NU9A 1T31A 3T27A 1TNJA 3CS7A 1P12E 4NFEA 4A92A 1C5WB 1GBKA 1ARCA 1FV9A 1MKWH 4YM9A 1BTHH 2ANYA 1XUGA 2PGQB 4ZKOU 2VIWA 2YNBA 1NESE 1AUTC 2P3TB 2VIOA 4CH8B 1YC0A 1Z71A 1AZ8A 1K1IA 2GCTB 1GBJA 1C1OA 2JH0D 1XXDA 2OINA 2J38A 4NIXA 4CBNA 1AI8H 1P06A 1ABIH 1BBRK 3KQBA 2ZIQH 3P8OA 4Y79A 1GJCB 4GSOA 5EODA 1O2UA 1YLCA 4JZFH 3RM0H 1KXAA 1O5BB 3F9GA 3FP7E 2FLRH 1WSSH 2VVCA 3NCLA 2C90B 3SNEA 5FCKA 1JOUB 2ZCKP 1A0JA 3STJA 3ZZAA 1KIGH 3BTTE 3RXLA 2BHGA 1PQ5A 3P70B 2HVXA 4Y8ZA 4NSVA 2ZPRA 2ZF0H 3SUFA 1B0EA 5LH8A 1ZHMA 2A2QH 1UTOA 2ODYB 2BZAA 1GBIA 4WXIA 4AZ2B 2ZTYA 2P59A 3PB1E 3PWCA 4CRAA 2BB4A 3SNBA 1PPFE 5C1XA 1SLWB 3KEEA 2KAIA 5LPEA 1S0QA 1O5DH 2B5TB 2D2DA 1F0UA 1XM1A 3TU7H 5E0JA 5F8ZA 5HMAA 2QAAA 4UONA 4ZHLU 4FUFA 2ZFPH 2VINA 4Y10E 3PMJA 1ESAA 1BRAA 1PPBH 5TCCA 3BEUA 3FP6E 1HXEH 1CT2E 1QQ4A 5HM2A 1AFQB 1NRNH 1LDTT 3OX7U 4TPYA 4AFSA 4H6SB 2J4IA 3NUMA 4UFFH 5BRRE 4D76A 4MDSA 3A88A 1C1UH 3SNDA 1MTNB 2ZDNA 4J1YA 4FXGH 3TGJE 2XRCA 1KLIH 3SO3A 2LNCA 3AASA 1GHZA 4UFEH 2Q6DA 2A1DB 1NZQH 3GYMA 2OC1A 1RGQA 3I29A 1EP5A 3LGWA 1GI0A 1CBWC 1TPAE 3OY5U 1Y5AT 1CHOG 1HJAB 1C5TA 1YCPH 5GDSH 3LPRA 3T29A 3ZV8A 1SGPE 2G51A 5ESTE 3RXEA 1BRBE 1DANH 3CP7A 1XKAC 1EAIA 3Q77A 1L1JA 1UTLM 1YCPM 1P8VC 4ASHA 1IAUA 3SJ8A 2HPQH 1O3KA 2Z3CA 4MPWA 4B1TA 3PMBB 2BLOA 2NU1E 3KIDU 2BD9A 1NRRH 2ZU5A 5FCRA 2ZWLH 4Y8YA 1UVSH 3NZIA 3SNCA 4FUJA 4CREA 4O9VA 1TONA 2NU3E 1TPOA 3MNBA 1EZUC 4U32A 2JETC 4AGKA 3MNSA 3GCOA 3UR9A 1AKSA 2C8ZB 1SGYE 2D26C 3A87A 2F9BH 2FO9A 1YBWA 3VB6A 4K1SA 1BMLA 1HIAB 1SFIA 5C1UA 1ZGIA 1CA0C 3U98H 1SGRE 2IN2A 1AQ7A 2SGPE 3BV9B 4UDWH 1B7XB 2ZGJA 3BTDE 2BMGB 4KKDA 4X1SU 1LVMA 5EOKA 4AYYB 1BTZA 1XXFA 2WPMS 2QY0B 3MNCA 1FZZA 2TGDA 3ATMA 3LGIA 2EI7A 3A8DA 3UIRA 2AYWA 3M61U 3RXHA 1BA8B 1L0ZA 1ZMLA 1BBRE 1JMOH 1ZRBA 3P95A 1ZSJA 1GVLA 4JCNA 2QF0A 2WPKS 2QYIA 2DE9A 1VZQH 1OKXA 1MUEB 2VH0A 3UUZA 3HGNA 1EZQA 3VFEA 1SGNE 1V2LT 1EQ9A 1TA6A 5EPNA 1C2JA 1HDTH 4ZAEA 3EGKH 1NFWA 4HFPB 4MNVA 1HFDA 2XXLA 3SBKA 4OS5A 1X7AC 4OS4A 1IQMA 1OWEA 3FP8E 5DP8A 2BVRH 2BD7A 3B23B 8LPRA 3RLWH 2AIPA 1THPB 2RA0A 1AVWA 1EOJA 3ELAH 1SGDE 2I6SA 3RDZA 1F5RA 3TH2H 1QB9A 3BTQE 1TOMH 4ZXYH 1Q3XA 3LJOA 4NZQA 2H5CA 1O3JA 3L3TA 1UTNA 1T32A 1TALA 3E0PB 3IG6B 2BD3A 3EQ0H 1LCYA 4JZEH 1C2KA 4I8GA 1UTQA 1QIXB 1UO6A 2CF8H 5HM9A 4ZH8A 1FQ3A 2XC0A 1Z1JA 2ZHWH 2BD8A 5L2ZH 1MKXH 1A0HB 1AWHB 1HAZB 2ANKH 1VITH 3EYDA 2F9UA 3SQHE 1GJBB 2FYRA 1C5LH 2GKVE 5FBIA 1O5GH 2PSXA 2SGDE 1Z6EA 3LONA 1BJUA 1A46H 3RXJA 1WTGH 1FPCH 4O3TA 3VXEH 2PTNA 1O2ZA 1LHFH 1T8OA 1V2RT 1LVYA 1J17T 1W11U 3GDUA 3GY2A 5DPAA 3UFAA 1O3NA 1W14U 4Y8XA 3SU0A 3NK8A 1ZYOA 3LDXH 2ZHQH 3RXCA 1FAXA 1L1NA 3D65E 1GI4A 1BMMH 2F83A 2G4UA 1IQKA 2WYJA 1KDQA 2ZG0H 1GBBA 1GCTC 1PQAA 2XWBI 3MH6A 1SHYA 1L1GA