4B2BA

Structure of the factor xa-like trypsin variant triple-ala (tgpa) in complex with eglin c
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDAGGPVVCSGKLQGIVSWGEGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title Thermodynamic signatures in macromolecular interactions involving conformational flexibility.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
chains with identical sequence C
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b2bA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b2bA02
1P2IA 1ELAA 2J92A 1F0UA 4B74A 1XKBC 5EW2H 5JBBS 1O3MA 4YLQH 3BV9B 4AB8A 3RXJA 3SBKA 1T8NA 3KGPA 4INLA 1F2SE 3GY4A 3ZVCA 2PR3A 4JK5A 3E16B 1C5ZB 1EPTC 3D49H 1DWBH 1GMDF 2TRMA 1HJAB 1UK3A 4E7RG 1NRNH 3V12A 4D7GA 1TLDA 1HRTH 2G8TA 1DY8A 1RIWB 4AN7A 2BVRH 2FOEA 4ABHA 2NU4E 4ZUHA 5F8XA 2VWMA 3RXDA 1MKWH 1TBZH 2BY9X 3ZZ3A 1AUTC 1GI1A 2RDLA 4TY6A 5HYOA 3MU5A 1YM0A 4B73A 1PQ8A 2FODA 1TMBH 2P95A 2ZDMA 1EUFA 1BTYA 1PQ5A 1KYNA 1MH0A 2G00A 4QT8C 2ZU5A 4X2YA 1WYKA 2GV6A 1IQEA 3H7OA 1P01A 5GXPA 1VCPA 3GCTF 1QB1A 2WPMS 5DJ7A 3RXUA 1C4V2 2EI7A 3ZVEA 4MTBA 1UHBB 1H9HE 3E8LA 1BOQA 3GDVA 3RXRA 4RKJB 1GL1A 3BG4B 1T4UH 1C9TA 1XUJA 2O8UA 3SV6A 3RC6A 3RMLH 3M61U 1AZZA 5LGOA 3RM2H 2QN5T 1GHAG 1ZSJA 1P03A 1SPJA 1E37B 1VCQA 3PM3A 3MMGA 2OBOA 3RXGA 1P9UA 3A83A 4FUFA 1MTSA 4BXSA 4AORA 2NU3E 4WJG2 2QF0A 2PFEA 1TNJA 2ODPA 2A45B 4FVDA 3ZZ9A 5SGAE 2IN2A 3PROA 1A61H 3TJOA 1ESTA 2J4IA 1TFXA 3BTME 1DXPA 4E06H 3SU1A 4BAHB 3BIVH 4B75A 1PYTD 1J15A 1G3BA 2W26A 5E0JA 4JZ1A 1TNKA 5EXNA 2PTCE 1ESAA 5FAHA 1KLJH 3VGCB 1Z1IA 3TGKE 1VGCC 4Y71A 4Q2KA 1TB6H 1AD8H 2Z9JA 2PKAA 4NA7A 3LGUA 2HVXA 1E36B 4CH2B 1YYY1 2SGPE 3PV4A 3P6ZB 2A5IA 2VIQA 4GCHG 4X0WU 3VFEA 3SHCH 1LHGH 3W94A 2ODYB 2NU1E 1KXBA 2FOHA 1LPKB 4K2YA 4H6SB 1EP5A 3EA8A 2QXGA 1EQ9A 4DY7B 8LPRA 1DPOA 1FNIA 4Y11E 1T4VH 3EE0B 6GCHG 1LQDB 1KDQB 2EI6A 2F9VA 3C1KA 1CT4E 1O3HA 1O39A 3GDSA 1GJ7B 2GVFA 2RA3A 3E3TA 2A31A 6CHAC 3HKJB 5F8ZA 2A7HA 3BEIB 3A8AA 3Q77A 1NFXA 2FEQH 1YF4A 2QXHA 1NT1A 3TITA 1GI3A 2ZCKP 4THNH 4WMDA 1HB0B 4ISLA 3M7UA 4B2BA 4A92A 4X1RU 1V6DA 2OTVA 2XRCA 1GMCG 1MD7A 2WPLS 2AGIX 3HPTB 4AFSA 2FO9A 1TGCA 2STAE 2FOAA 1DFPA 1S6FA 1O2OA 3BTTE 4D76A 1GHYH 5E0HA 2ZFSA 1S84A 2OINA 2GDDA 3V0XA 1P12E 2SNWA 2TBSA 2BD9A 2P3UB 4INKA 1A1RA 1DS2E 3UY9A 4X6NA 1MZAA 2ANKH 3PO1B 1C4Y2 1SG8B 3VPKA 3HKIB 2JETC 5JPMH 1UHBA 1C1PA 1EATA 1FY5A 1ZSLA 4YT6H 1A5GH 5DGJA 4Z6AH 4NIWA 2FIRH 1BT7A 1SVPA 3S7KB 3VEQB 4LZ1H 2Z3CA 2G81E 1BMLA 2CV3A 4A1XA 4GHQA 3MFJA 2H5CA 1E38B 2TGDA 4DIIH 1OPHB 3TNSA 3SORA 5IYTA 5A2MH 2F9BH 1YPLH 2ZZUH 3PWBA 3ELAH 3GISB 1XUFA 1MTUA 3RP2A 5T6GA 2BY7X 2OD3B 4DT7B 1C1TA 1QNJA 1TBRH 1QQUA 1NO9H 1ABJH 1OWJA 1C2DA 1CBWB 1YPEH 3U8RH 3ODFA 1WAYB 3A80A 3M5LA 1LCYA 1ZR0A 3GCOA 3O8DA 2D26C 1C2HA 4YOJA 1BTHH 1YC0A 2ZU2A 1HDTH 1QQ4A 1H4WA 1MQ5A 3PTNA 4ESTE 5AHGH 2A2QH 2FESH 2O8MA 3P8GA 1TPOA 1P09A 1GI0A 1UK4A 4X8VH 4CHAB 1QL9A 3RXCA 5GCHG 2F9UA 2STBE 5DK1A 1GJ6A 1Z8GA 4GCHF 1AU8A 2A7CA 1BA8B 4CRCA 5JB8S 4JCNA 2FI4E 3U69H 3TU7H 2OC7A 1C2KA 2BOKA 5JBTA 1RD3B 1FN6A 4ASHA 3KQBA 1ZPCA 4X2WA 2VIWA 1XXFA 1NY22 2ALVA 1FPCH 3RU4T 5E8EH 2FX4A 5J4SA 1ZMNA 2F9PA 3JZ1B 4U32A 2FX6A 2VH0A 2IJOB 6GCHF 1O37A 2Z9IA 3STJA 1GBKA 3NCLA 2W3IA 3VB5A 8GCHG 1C5RA 2J34A 1O30A 4Y0YE 4ZKRU 4LZ4B 2M5TA 4ABFA 4PROA 3FAOA 2PUXB 1O3OA 3QDZB 3R3GB 1SC8U 3VB6A 1CGIE 3ZVFA 1QJ7B 1O3KA 2O9QA 1AKSA 1GJ9B 1D9IA 5HGGA 3C27B 4ZXXH 1SSXA 3ENSB 1GDUA 2QIQA 5T6FA 2BQ7B 2GKVE 1QBNA 1E34B 1GMCF 4ZAEA 1P10A 4OS1A 4TY7A 2PKSC 1C1OA 3BEUA 1NU9A 1ANCA 2GCTC 4CBOA 1Y3YA 3SJ8A 1W8BH 1WV7H 1BBRE 1ID5H 2GZ8A 1QTFA 1TIOA 2J38A 1W2KH 1TYNA 1A3EH 1BRBE 1L1GA 1TOCB 1KXEA 1MAXA 3LJOA 1G32B 1O2MA 3D23A 4BXWA 1QA0A 2ZFRH 2VWOA 1HGTH 4WY3A 3UR9A 3BTDE 1CA8B 3MH4A 1K1JA 2UUJB 1EJAA 1NRQH 1BTZA 1ZTJA 1GHBG 2ZFFH 4MNXA 4AFZA 2C8XB 1GJBB 3TK5A 4RN6A 3BG8A 1FMGA 3A7WA 4XBCA 4TWWA 1ELCA 1Z6EA 1Y5BT 2Z9GA 4FUIA 1MTNC 1GBFA 1T8LA 3MO9A 3UOPA 1C5UA 3M5NA 4YO9A 3Q3XA 2G51A 2FWWA 2GZ9A 1ARCA 1BTPA 1G3EA 3MI4A 4OGXA 3SUEA 1FJSA 1TNIA 4U01A 3A7XA 1Q3XA 1SGIB 1Y3WA 1YPMH 4Y8ZA 1QIXB 3EQ0H 1Y8TA 2FOMB 1W3CA 1EB1H 4DIHH 5JBCS 2BY6X 2THFB 2ZFQH 4JYVH 2VIOA 2CHAB 1JIMA 2A5AA 2VGCB 1YCPK 4VGCB 1MUEB 3O8BA 3L6PA 2JH5D 1O2QA 1ZSKA 1GVKB 5GCHF 4CRAA 2BLOA 2PUQH 1NRRH 3LH3A 1AQ7A 1C1VH 1TA2A 3ZV9A 3RXTA 2UWOA 1DVAH 2VNTA 1F0TA 4D9RA 1HJAC 5ESTE 1L1JA 3SU2A 1BCUH 2FM2A 2ALPA 2VVUA 1LPZB 1BHXB 1RIWC 2XCNA 1DUAA 1YCPM 4ZH8A 3SGBE 4Y7BA 5FCRA 1RTKA 5EXMA 4FUEA 1HNEE 2KAIA 1UMAH 1WTHD 1J8AA 2XBYA 1O3LA 1SLVB 1HAHH 1HBTH 1VJAU 2OQ5A 4UFDH 2UWLA 3NKKA 5FXLA 1P8VC 3SQHE 2PTNA 4Z0KA 3U9AH 3GY7A 3KEEA 2HNTF 5C1YA 1VITH 1QB9A 5GJ4B 1AI8H 1Q31A 2C8ZB 3FFGA 3RXIA 1AUJA 4U2WA 3E91A 5PTPA 3SGAE 1KTSB 3QZQA 1S85A 2BD4A 4BOHA 3SNEA 5A09A 5F8TA 2XC0A 2FI5E 3BG4C 1G37A 5TJXA 3TH3H 1IQKA 3GY6A 4IW4E 3QN7A 1QL7A 1SBWA 2UUKB 1HXEH 3ODDA 2Z6BD 1EJMA 5EXLA 3ZVDA 3EGKH 4X8UH 1BITA 4X6OA 1THSH 1BMAA 2FP7B 2ZEBA 2BTCE 1FAKH 1O2IA 1P06A 2Y5FA 3H5CB 1O2KA 1C5MD 5K7RA 1XUKA 1Y3VA 2FMJA 1YCPH 1LVBA 2FI3E 2G4UA 1O2WA 1D3TB 1HJ8A 5HM2A 1O2NA 2Y82A 1A3BH 1H8IH 3GICB 5DPAA 4DVAU 1JIRA 1DICA 1QL8A 1Z6JH 1AB9B 1SGPE 2P3TB 1PQAA 3F9FA 1L4DA 3FVFB 2A4GA 1P3CA 2BX3A 3Q76A 2XBWA 3M3VA 4CRBA 1V2MT 4X1PU 3S69A 1SGDE 1Z8IB 1ELBA 3K6YA 2GCHF 1DUEA 4H42U 1K1NA 1QY6A 3UPEA 2BQ6B 2EC9H 1KSNA 3TGIE 2FZZA 3TK9A 4Y6DA 3CS7A 5DP3A 3IITA 2R0KA 4X8TH 3TJUA 4GLYA 4ABBA 1J17T 2GT7A 3UWJH 5DP8A 5EPNA 1GHXH 3V3MA 2PKAB 1V2JT 9ESTA 1TX6A 4O97A 3TPIZ 4O3UA 1C1WH 1NRSH 2P59A 4WXVA 1MAYA 1YPHE 4KKDA 2ZTYA 2XBXA 3E6PH 4X2XA 3RU4E 3LGTA 1UO6A 3VXEH 1HAOH 2FYQA 1NFYA 1V2LT 2FLRH 2ZU3A 4MQAA 2ZQ1A 3KIDU 2VVCA 2P94A 3LT3A 1K1OA 3EDXB 5K0HA 1G2LA 2ASUB 4XBDA 1BTWA 1P9SA 5B6OA 4AX9H 3MH7A 1FZZA 4LXBH 2HPPH 3QWCH 3RMNH 4LK4A 2FTLE 3U98H 1BRCE 4ABDA 1C2MA 1J9CH 1RTLA 1S82A 1ZHRA 1GI4A 3N7OA 1FV9A 4YESB 1ELDE 4KTUA 1ZTKA 1HAXB 1SHHB 8ESTE 1MTVA 1C5SA 2V35A 2ZU1A 1HUTH 1GI2A 4YM9A 3UUZA 1GBLA 2Y7ZA 1O2HA 2ZGJA 3ESTA 3KQDA 1EAIA 2F3CE 4UFFH 2YNBA 2CJIA 3RXLA 4I8HA 4MLFB 4OS6A 3SQEE 1V2ST 3GY8A 4DG4A 4AFQA 1O3AA 4IS5A 4XBBA 1XUIA 4YT7H 1EB2A 1GBCA 1FDPA 4J2YB 1W14U 5DP7A 5BRRE 1FY8E 2VH6A 1A5IA 2P3FH 1YKTA 3Q3KA 3SU5A 3ZVGA 2OC1A 3RXSA 5CE1A 2BY8X 1H9LB 4DGJA 1S5SA 1GI5A 1TABE 5DP4A 1K21H 3MOCA 4ABIA 1H9IE 2ZQ2A 1N8OB 4CR5A 2W7UA 1LHFH 3FP6E 1O5BB 1UTLM 2ZHFH 1ELEE 3SO3A 1LTOA 2BZAA 3ZZAA 2QA9E 2XYAA 3EA7A 1S81A 2SGQE 3BTGE 5FPYA 2A0QB 1K2I1 2ZPSA 2ESTE 4NA9H 2NWNA 2ZA5A 3WY8A 3U8TH 3VB7A 3SV2H 1MZDA 2WV4A 3ITIA 1KY9A 3RXBA 1IQFA 3PMBB 1ANEA 1O3BA 1SFIA 4I8JA 2TGTA 2SNVA 2G5NA 3QGJA 2CMYA 3GOVB 1K28D 1TMUH 1L4ZA 2HNTC 1TX7A 2SGDE 2GX4A 4INHA 1GHWH 1VJ9U 5JDUB 1CO7E 2H1UA 1LVYA 3LC5A 5FX6A 1EX3A 4XE4A 2D1JA 3ZZ5A 1SQAA 3SNDA 2AERH 8KME2 4E05H 3SNBA 1O2ZA 3A85A 2F9NA 2ZFPH 2ULLA 1NU7B 1ETSH 1T31A 3TIUA 1HIAB 3RC4A 1MTWA 1TX8A 1PPHE 1NROH 3T29A 5FX5A 1FN8A 5CMXH 1UVTH 4Y8YA 3P8OA 2BDGA 3HK3B 5L6NH 2FYRA 3MU8A 3BTWE 1GBEA 2R3UA 3BF6H 1QHRB 1KLIH 1AKSB 3QO6A 1DLEA 3URCA 1FONA 1HAZB 1MCVA 1V3XA 3EAJA 3NZIA 1C5NH 3MNXA 5LH8A 2EEKA 1RGQA 1DM4B 1FIWA 2AH4X 2VVVA 1OP2A 3SV8A 1O35A 1A0JA 2FTMA 1Z8RA 2BLQA 3ZZ4A 3UNRA 2BVSH 3UQOA 4D8NA 3CENA 3LC3A 2A5KA 3R0FA 2P8OC 1MQ6A 1YLDA 2ZO3H 1UTKA 1AGJA 3SNAA 3LGVA 1C2LA 4IN2A 1EPTB 4JZFH 2AYWA 4NFFA 1PPBH 4Y76A 1GG6C 1FUJA 2WPJS 1TGTA 4YOGA 1KXCA 1AE8H 1UCYK 4ISIH 3ZZCA 4JZIA 3GCHC 3MTYA 2W7SA 1GHAF 1CA0C 1LPGB 1GJDB 2Z94A 1O2PA 3RXAA 3LGYA 4DURA 1V2PT 4VGCC 1B0EA 4UDWH 1KXFA 4Y79A 1DOJA 1YP9A 3M5MA 3ZVAA 1DANH 3VXFH 1F5LA 1V2UT 1GBAA 3LDXH 1ZRBA 1GJAB 2XCFA 5G4BA 4B1TA 4I33A 3MNBA 4D9QA 1HAPH 1O3GA 4Y0ZE 1ZZZA 1FQ3A 3MU1A 1QB6A 5I25A 1OWIA 3RDZA 1P2NA 3I78A 2C3SA 3U8OH 3S9CA 1OWEA 3F9GA 2R2MB 4Y8XA 1C1RA 3UQVA 3ZZDA 2BZ6H 2XC5A 4I7YH 2B9LA 4MPVA 1NZQH 2RG3A 1ZGIA 1C1NA 4JYTA 1GI9B 4WH8A 5F6MA 4M7GA 2AIQA 3SJIA 1JBUH 1AVGH 1GVZA 1OKXA 4DJZB 2HOBA 1TALA 3M37A 2GT8A 4U30A 2AS9A 1RXPA 1NC6A 2BDYA 2V3HH 2BVXH 4TYDA 3A82A 4NCYA 3DHKH 4ISHH 4NWLA 4BAQB 1TGSZ 1HIAA 4WXIA 7KMEH 2ZIQH 5EPYA 2NU2E 1MMJN 2JH6D 3SUDA 4WH6A 3DUXH 4ZXYH 2ZDAH 1N6XA 4K69A 5CHAB 2KAIB 3MO3A 1VGCB 3MO6A 5I46H 3NUMA 3TLOA 4ABEA 1YPGH 1ARBA 7GCHG 4JZDH 4K60A 3SU0A 2BLWA 1W10U 1F5KU 2QV1A 2QY0B 3QTVH 3ATWA 3OSYA 3ZVBA 1O5GH 1P0SH 1UCYH 3HATH 1ESBA 1BRAA 1HAVA 1WCZA 1WTGH 1TGNA 1IHTH 5FCKA 1D3DB 1O2RA 4CR9A 1BTUA 2BD2A 3M5OA 1AFEH 1P2OA 1G3CA 5A8ZA 1AFQB 1SQTA 2OUAA 1QURH 4NIYA 4Y10E 1O3IA 2GMTC 1BIOA 1PQ7A 3RC5A 1RJXB 2ZKSA 3AW1A 1ZTLA 1GJCB 1O2TA 5E2PA 3K9XB 2PSXA 2BY5X 2DUCA 3F1SB 3OY5U 4NWKA 2G55A 1A4WH 3SU6A 1TQ7B 2AFQB 1EAWA 1FY1A 6CHAB 2ZHDA 2LNCA 1EPTA 3G01A 3H7TA 1P57B 4H6TA 2I6SA 1HXFH 2RCEA 3SJ9A 3E0NB 3IWMA 2CXVA 3BTFE 2VU8E 5T6DA 2ZC9H 1OYQA 1NTPA 2Q6FA 1GBJA 3U1IB 1PPGE 3ATKA 3KF2A 1IHSH 1O2GH 4NIVA 3DFJA 5EW1H 1CQQA 3T25A 2CF9H 1TA6A 1G3DA 1OOKB 5BPEA 2ZPRA 5AFZH 5C1XA 1ELGA 2BOHB 3LGIA 5AF9H 4GHTA 1AIXH 4FUHA 1H8DH 2XXLA 5FPTA 1ORFA 4ZROA 3L3TA 1OS8A 3A89A 3F9HA 1LVOA 3P70B 1ZPBA 4BTUB 1O5DH 2JETB 1HV7A 2AEIH 3PTBA 3OX7U 4GPGA 4NZQA 1M9UA 1BQYA 4AGJA 2ZHQH 9LPRA 1UTOA 4IMZA 2D8WA 2FOBA 3K65B 1ZHMA 2EA3A 1IQHA 1CGJE 2TIOA 1O2YA 4GSOA 1V2QT 4LOYH 3QTOH 1SI5H 1EAUA 2Z7FE 1CT2E 1N6YA 2C90B 4R0IA 1ABIH 3SV7A 1HJ9A 3RM0H 1BJUA 2BYAX 3Q3YA 2ZDVH 1UVOA 5EQQA 5C1UA 2O8WA 1B5GH 1UTQA 3GY5A 2HLCA 1AY6H 2A7JA 1TOMH 3MNSA 3SNCA 1JMOH 5HM9A 1C4U2 3LJJA 3ZV8A 4DW2U 3MWIU 1K9OE 3AAVA 1MKXK 8GCHF 3BTQE 4NSVA 2GZ7A 2BXTH 2R3YA 1AWHB 1V2OT 1AN1E 1HAYB 2BMGB 3BTKE 1SQOA 1Z8JB 1TMTH 2H9HA 2XC4A 5LPFA 2XWBI 3MU0A 2Q6DA 1SGCA 2G5VA 1PFXC 5F03A 3SUFA 2W5EA 4UD9H 4WF8A 1BMNH 5HXFA 2FOCA 3NK8A 3PLPA 4CRGA 2UWPA 2V6NA 1CGHA 2ZFTA 1O5EH 1UTJA 1V2VT 4TWYA 2BDAA 3GYMA 4RKOB 1VCWA 1BTXA 1LHDH 5C5NA 1DE7H 1AVXA 1FIZA 5T3HA 5IDKA 1SFQB 7ESTE 1KXAA 2J2UA 1P2JA 4MNWA 4O9VA 1C1SA 1E35B 3I29A 2A1DB 3P92A 4KP0A 2UUYA 1W0ZU 1ZLRA 3SI4H 5E0GA 2K1QA 5AFYH 1TRMA 6LPRA 4UFEH 4X1NU 1OP0A 3HGNA 1K1LA 1SGEE 1S83A 2ZCHP 5A0AE 1F7ZA 1WBGB 2TPIZ 1XUGA 1TGBA 4KELA 1GHBF 2ZTXA 3GCTG 4NZLA 5DKMA 1KLTA 1ELFA 3VGCC 1YPKH 2GGVB 1RRKA 2ZTZA 2O8LA 3ZZ6A 2QYIA 1KTTB 2PKSB 4AG2A 3A8CA 1WU1A 1MU8B 1O2VA 3KQCA 4FUDA 1TPAE 1NFUA 1O33A 1TPPA 2BDHA 2C8YB 4FU8A 5L2YH 3Q00A 2ZHWH 1MKXH 4NA8A 3E90B 3LOXA 3UR6A 4AG1A 3E1XB 3MH6A 1MBMA 3A88A 3P95A 2BX4A 3LU9B 3S9BA 1NN6A 1A7SA 3E0PB 4Y7AA 1O3NA 2AMQA 2VWLA 3AASA 1KIGH 3ZZ7A 1QR3E 1DX5M 2BD5A 4FUBA 1FAXA 4FVBA 5ESBA 2A32A 1FLEE 2OP9A 2Z3EA 2ZGCA 2AGEX 4BTTB 2R9PA 1S0RA 2J9NA 3LONA 3OU0A 2BDIA 3B8JA 4HTCH 1Z7KA 2OQUA 3KCGH 2HRVA 3A7VA 5JB9S 1MTNB 3M7QA 4OS4A 1GBHA 2A4QA 4OS7A 2BD7A 2BD8A 3DA9B 2BD3A 1IQGA 2QGRA 5TCCA 1C5PA 1XX9A 1Z71A 1TAWA 2YNAA 1H1BA 2NU0E 2Z9LA 4MPXA 4X6MA 1TE0A 2ANMH 5JYIA 1IQNA 2GD4B 4KTSA 1BHXF 3BEFB 2ZWLH 2Y7XA 4XDEA 2XTTB 5A8XA 1OP8A 1A0HB 1EP6A 1G2MA 5ETXA 1JXPA 1W7XH 3DFLA 1O2XA 4J1YA 4Q7XA 1OX1A 4AOQA 3RXEA 2WYGA 3FZDA 3NXPA 4FUJA 1IQLA 3PO1C 2SGFE 1GL0E 1IQJA 3BTEE 4I32A 2PGBB 1D4PB 1VR1H 1N1LA 2AGGX 3RLYH 1UK2A 1C5LH 1O5CB 2ZGBH 2QF3A 1GMHG 4BTIB 3SHAH 4A7IB 2WPKS 3PLKA 1SGTA 1OWDA 1ANDA 1EASA 2H5DA 1DWCH 3B9FH 4IC6A 3UIRA 1GCDA 2F9OA 3DT0H 2O8TA 1DT2A 4NGAH 1LHEH 1BB0B 4RSPA 4OS5A 3SUGA 1F5RA 2PWXA 1FPHH 2TGPZ 3QGNB 1CBWC 1FY3A 3F68H 4MNVA 4WMFA 3QLPH 1HYLA 1ZJKA 1QJ6B 1XMNB 2F91A 4DCDA 4IMQA 1SGNE 4H4FA 3M36A 2ZECA 3RMOH 1O3DA 1SLUB 3RXMA 2AMDA 1C2GA 1GJ5H 3KL6A 4D7FA 2AMPA 3T28A 3HGPA 4IN1A 3SGQE 1GCTB 1CT0E 3LIWA 1O31A 4YZUA 3M3TA 1G9IE 1MD8A 1P05A 1SOTA 1ELVA 3CS0A 2VB0A 1CHGA 1ZJDA 3UREA 4CHAC 1IAUA 4AGKA 1LKBA 1V2TT 3W95A 1IOEA 2F83A 1BUIA 4AB9A 2JKHA 1RFNA 1BDAA 1DDJA 1SGFA 2YOLA 1CSOE 4GAWA 1TNHA 1EJNA 2ZGHA 3M7TA 4I31A 4K3JA 2XWAA 1GGDB 3SN8A 5HMAA 3B23B 2XW9A 2SGAA 3LKWA 1T8OA 1C2FA 4B2CA 4K1SA 2Y5HA 4AZ2B 1HFDA 3GCNA 5E2OA 1CHOG 2XBVA 1EZSC 2OXSA 2VIVA 1JRSA 2J94A 1O32A 1A2CH 4NSYA 5CHAC 5EODA 3QK1A 4F49A 3I77A 1O36A 1A46H 1GBDA 3MU4A 2H9EH 1DWEH 4IC5A 1XXDA 4MPWA 3SJKA 3LPRA 2WUCA 1V2NT 1K1IA 1C5VA 1SGRE 1YGCH 3OY6U 4ZHLU 3VB3A 1IQIA 4GUXA 1T32A 4UFGH 4Q80A 1UVSH 1PPEE 1EAXA 1HAGE 1O3FA 1G36A 4ZKNU 3QX5H 1UVUH 1OSSA 1AFQC 1INCA 1P11E 1O3CA 1PPFE 2ZF0H 1FY4A 5DO4H 4HZHA 1GI7B 2BXUH 1V2RT 2R2WU 3UOUA 4X8SH 3UNSA 3AVZA 1XVMA 4O3TA 5J4QA 1UJ1A 3KN2A 1HAVB 1GI8B 1GWAA 1D3QB 1T7CA 3BTHE 3MYWA 4K8YA 2GV7A 2ZI2H 5FHTA 1GMHF 1K1PA 1VITG 1D3PB 3RXPA 1YPHC 1Y5AT 4CRDA 2LPRA 3S0NA 1O3EA 1C9PA 1ETRH 2FPZA 2PW8H 3HK6B 3UWIA 1E0FD 1BJVA 5ABWA 1O3PB 4YOIA 3U1JB 2ZGXH 1TRNA 3ZYEA 2HPQH 1P04A 3STIA 3KQEA 4I8LA 2GTBA 2V0BA 2XNIA 1CVWH 3KHVA 4XSKU 2BB4A 3S7HB 5EQRA 2ZDNA 2FOGA 1C1UH 2C4FH 1J14A 1A0LA 2A4OA 4A1TA 4BNRA 4MNYA 2ZDLA 3ATIA 1C5YB 3URDA 2W3KA 1UTPA 2QXJA 2VJ1A 1K1MA 3NWUA 3TNTA 1S0QA 2CHAC 2VGCC 3M35A 1DSTA 1SGQE 1UCYE 3V7TA 2BHGA 1QJ1B 1YBWA 2ZDKA 1LKAA 3FZZA 1WQVH 1P02A 2DE9A 2PV9B 2ANYA 2ZP0H 3T26A 1AO5A 1P2MA 1Y3UA 1C5WB 5DP5A 1Y5UT 3BSQA 2C8WB 3A7YA 4YTAA 1XUHA 3SI3H 1PJPA 4ABJA 5FBIA 3QUMP 2QAAA 1OWKA 1PPCE 4TPIZ 3MNCA 1AZ8A 4JMYA 4K1TA 4K8BA 1O2JA 1QBVH 3K6ZA 3UTUH 4ZKOU 4KGAA 1CHOF 2B8OH 7LPRA 4IBLH 3T2NA 2WUBA 2FS8A 1WUNH 4WWYA 1GJ8B 2Q1JA 3SU4A 1EOJA 2WYJA 3SV9A 1LO6A 2FS9A 2QC2A 3MH5A 1W12U 2UUFB 1P3EA 1CE5A 3SW2B 1AVWA 1AMHA 1ANBA 1HLTH 1O34A 1D6WA 1W11U 4NG9H 1LMWB 1C2EA 2Y5GA 4OGYA 1YLCA 4E7NA 2FLBH 3ZZBA 1AE5A 4SGBE 5C3NA 4A5TS 3A86A 1ACBE 1SHYA 2IOTA 5JBAS 5C5OA 1U6QA 2JH0D 5GPIB 1J16A 4KTCA 3BIUH 4OS2A 1KDQA 3FP7E 1EXFA 3O8RA 4HI3A 1ZYOA 2G4TA 1F92A 1T8MA 4TPYA 1ETTH 1GBBA 2SFAA 2B5TB 1DY9A 1X7AC 1GI6A 4CH8B 3ZZ8A 5H4IB 4X1SU 4XFQA 4AYYB 4ZKSU 1GHVH 2Y81A 1UTMA 3EA9A 3D65E 1HAIH 3GDUA 4CRFA 1PYTC 3JZ2B 1WSSH 2OLGA 1EKBB 1OXGA 1VITF 2CF8H 3SOSA 2VINA 3O8CA 4BANB 2ZHEH 3A8BA 1NPMA 2FOFA 3L33A 3GYLB 1C1MA 3SJOA 2HALA 2IPHA 4CREA 1MBQA 1HCGA 1L0ZA 3TVJB 1AB9C 1UVPA 1SOZA 1Y59T 3V13A 4R8TB 1JRTA 1BBRK 3PB1E 1XVOA 4ISNA 3TH4H 2J95A 4Q7ZA 2R0LA 5TCAA 3T5FH 3UNQA 4X6PA 4ABAA 5DP9A 2BQWB 1LQEA 3PLBA 2P16A 1SR5C 1XM1A 4A1VA 5EG4A 2AIPA 2QCYA 4B2AA 4CBNA 1LVMA 5AVDA 2ILNA 1O38A 1O3JA 2H9TH 1TPSA 3LGWA 2CN0H 3RXHA 2DE8A 2PSYA 4BAMB 1FXYA 1WQSA 1EZUC 2PLXA 4FU9A 5DG6A 3SZNA 5L2ZH 4NIXA 3RUOA 3TGJE 1QFKH 1THRH 4B71A 1GPZA 4MDSA 3VB4A 2P8OB 1DITH 1C1QA 2I6QA 1C5XB 4HGCA 3T62A 1XKAC 1AWFH 4UEHH 3A81A 2VWNA 4X2VA 3RXOA 2WV5A 1BMMH 1GG6B 2GCHG 5FBEA 3NPSA 4HFPB 3P8NA 4ISOA 1Y3XA 2ZU4A 4O03A 4UONA 2H6MA 4I8GA 1HPGA 2A4RA 5A0BA 3GCHB 1Q2WA 3UFAA 1ZRKA 1IQMA 1C2IA 1CA0B 2QXIA 3TK6A 4AFUA 1SB1H 3F9EA 1ZMJA 1SGYE 1UTNA 5L30H 1BRUP 2ZPQA 3OTJE 4A6LA 1W7GH 1B0FA 1V2WT 4B76A 4NFEA 1P2KA 4I8KA 1ELTA 1PPZA 3K2UA 2EI8A 1LHCH 1V2KT 2BLVA 3SU3A 5EU8A 1BZXE 1GDNA 1BBRH 1QRZA 4WMEA 2P93A 3PMJA 4ZHAA 3RXFA 2PHBA 1QBOA 3T27A 5C67A 7GCHF 2OCVB 5GWZA 2HGTH 1NS3A 2WPIS 3A7TA 3PYHA 4K5ZA 3KNXA 2Z9KA 1NFWA 1CU1A 1DLKB 1ZMLA 4BAKB 3A87A 3IG6B 3M3SA 2HWLB 4K1EA 3A8DA 1O2LA 4FU7A 1A5HA 4XOJA 1QA7A 1GHZA 1TBQH 4Q7YA 1GMDG 4JYUH 3TJVA 1JWTA 1C5OH 1G30B 2Y6TA 2FXRA 1GDQA 1RS0A 1TWXB 1OWHA 5GIBA 3RLWH 5A0CA 1DWDH 1EZXC 1GJ4H 2WPHS 5LPEA 1GBIA 1GVLA 1OYTH 2B7DH 5EQSA 1GBMA 3A7ZA 1ZHPA 1FI8A 1JOUB 4X1QU 2GDEH 1O5AB 1EZQA 1GCTC 3AAUA 1L2EA 1N8OC 1MCTA 5A8YA 3RXVA 2G52A 1TNLA 2ZCLP 3EYDA 2RA0A 4F4OC 1O0DH 5C2ZA 1NRPH 1Z1JA 2BDBA 1GBTA 3OYPA 1WOFA 4DOQA 2TGAA 3FANA 3ATMA 4MPUA 4SGAE 1ZGVA 5EGMA 3PWCA 3PMHB 2BDCA 2ZNKH 3LH1A 3P8FA 3CP7A 3F6UH 1RTFB 1W0YH 2D2DA 1GGDC 1ZOMA 4ABGA 1C5QA 4YLUA 2SGEE 1P2QA 2GP9B 2GMTB 2B0FA 3MHWU 2OBQA 2GCTB 1S6HA 2HNTE 3TH2H 1SMFE 1EOLA 1LDTT 2BM2A 3FP8E 3A84A 3TJNA 2FDAA 1F0SA 2OC8A 3ATLA 1MKWK 2ANWA 2C93B 5FPSA 1DSUA 1SLXB 2CGAA 3P17H 4MVNA 1QGFA 4FUCA 6ESTA 5GDSH 1VZQH 3PMAB 4JZEH 1QRXA 3ZYDA 5EOKA 5C20A 1MU6B 2VIPA 2Y80A 1SGFG 3RXQA 4ZHMU 4FUGA 1L1NA 1O2UA 1F0RA 3AW0A 5DP6A 4UE7H 2OC0A 1B7XB 1K22H 3RXKA 3RU4D 4ZMAH 1O5FH 1AHTH 3GY3A 4IGDA 1ZPZA 4BAOB 1TONA 2WINI 3S9AA 4MG3A 1NM6A 3RMMH 5LPRA 2H2ZA 1DXWA 4AYVB 1TNGA 2Q6GA 1C5TA 1TQ0B 1QCPA 4JK6A 2ZG0H 1C2JA 1THPB 3DD2H 1YPJH 2A2XH 1TRYA 4WVPE 4FXGH 2ODQA 1D6RA 1QRWA 2Z3DA 1W13U 1SLWB 3BN9A 3QZRA 2V3OH 2PGQB 1KXDA 3D62A 4GVUA 3GY2A 1O2SA 1SL3A 1NESE 2VIDA
chains in the Genus database with same CATH superfamily
1P2IA 1ELAA 2J92A 1F0UA 4B74A 1XKBC 5EW2H 5JBBS 1O3MA 4YLQH 3BV9B 3DCLA 4AB8A 3RXJA 3SBKA 1T8NA 3KGPA 4INLA 1F2SE 3GY4A 3ZVCA 2PR3A 4JK5A 2F4LA 3E16B 1C5ZB 1EPTC 3D49H 1DWBH 1GMDF 2TRMA 1HJAB 1UK3A 4E7RG 1NRNH 3V12A 4D7GA 1TLDA 1HRTH 2G8TA 1DY8A 5C0TA 1RIWB 4AN7A 2BVRH 2FOEA 4ABHA 2NU4E 4ZUHA 5F8XA 2VWMA 3RXDA 1MKWH 1TBZH 2BY9X 3ZZ3A 3KYGA 1AUTC 1GI1A 2RDLA 4TY6A 5HYOA 3MU5A 1YM0A 4B73A 1PQ8A 2FODA 1TMBH 2P95A 2ZDMA 1EUFA 1BTYA 2J98B 1PQ5A 1KYNA 1MH0A 2G00A 4QT8C 2ZU5A 4X2YA 1WYKA 2GV6A 2PP6A 1IQEA 3H7OA 1P01A 5GXPA 1VCPA 3GCTF 1QB1A 2WPMS 5DJ7A 3RXUA 1C4V2 2EI7A 3ZVEA 4MTBA 1UHBB 1H9HE 3E8LA 1BOQA 3GDVA 3RXRA 4RKJB 1GL1A 3BG4B 1T4UH 1C9TA 1XUJA 2O8UA 3SV6A 1NBMD 3RC6A 3RMLH 3M61U 1AZZA 5LGOA 3RM2H 2QN5T 1GHAG 1ZSJA 1P03A 1SPJA 1E37B 1VCQA 3PM3A 3MMGA 2OBOA 3RXGA 3SYJA 1P9UA 3A83A 4FUFA 4F48B 1MTSA 4BXSA 4AORA 2NU3E 4WJG2 2QF0A 2PFEA 1TNJA 2ODPA 2A45B 4FVDA 3ZZ9A 5SGAE 1KMHB 2IN2A 3PROA 1A61H 3TJOA 1ESTA 2J4IA 1TFXA 3BTME 1DXPA 4E06H 3SU1A 4BAHB 3BIVH 4B75A 1PYTD 1J15A 1G3BA 2W26A 2KCPA 5E0JA 4JZ1A 2WHXA 1TNKA 5EXNA 2PTCE 1ESAA 5FAHA 1KLJH 3VGCB 1Z1IA 3EE7A 3TGKE 1VGCC 4Y71A 4Q2KA 1TB6H 1AD8H 2Z9JA 2PKAA 4NA7A 3LGUA 2HVXA 1E36B 4CH2B 1YYY1 2SGPE 3PV4A 3P6ZB 2A5IA 2VIQA 4GCHG 2IPQX 4X0WU 3VFEA 3SHCH 3ZIAD 1LHGH 3W94A 2ODYB 2NU1E 3F2GA 1KXBA 2FOHA 1LPKB 4K2YA 4H6SB 1EP5A 3EA8A 2QXGA 1EQ9A 4DY7B 8LPRA 1DPOA 1FNIA 4Y11E 1T4VH 3EE0B 6GCHG 1LQDB 1KDQB 2EI6A 2F9VA 3C1KA 1CT4E 1O3HA 1O39A 3GDSA 1GJ7B 2GVFA 2RA3A 3E3TA 2A31A 6CHAC 2JJ1D 3HKJB 5F8ZA 2A7HA 3BEIB 3A8AA 3Q77A 1NFXA 2FEQH 1YF4A 2QXHA 3AK5A 1NT1A 3TITA 1GI3A 2ZCKP 4THNH 4WMDA 4ACBA 1HB0B 4ISLA 3M7UA 4B2BA 4A92A 3FKSD 5CDFE 4X1RU 1V6DA 2OTVA 2XRCA 1GMCG 1MD7A 2WPLS 2AGIX 3HPTB 4AFSA 2FO9A 1TGCA 2STAE 2FOAA 1DFPA 1S6FA 1O2OA 3BTTE 4D76A 1GHYH 5E0HA 2ZFSA 1S84A 2OINA 2GDDA 3V0XA 1P12E 2SNWA 4Q63A 2TBSA 2BD9A 2P3UB 4INKA 1A1RA 1DS2E 3UY9A 4X6NA 1MZAA 2ANKH 3PO1B 5T1VA 1C4Y2 1SG8B 3VPKA 3HKIB 2JETC 5JPMH 1UHBA 1C1PA 1EATA 1FY5A 1ZSLA 4YT6H 1A5GH 5DGJA 4Z6AH 4NIWA 2FIRH 1BT7A 1SVPA 3S7KB 3VEQB 4LZ1H 2Z3CA 2G81E 1BMLA 2CV3A 4A1XA 4GHQA 5EJ1A 5HIZA 3MFJA 2H5CA 1E38B 2TGDA 4DIIH 1OPHB 3TNSA 3SORA 5IYTA 2GJGA 5A2MH 2F9BH 1YPLH 2ZZUH 3PWBA 3ELAH 3GISB 1XUFA 1MTUA 3RP2A 5T6GA 2BY7X 2OD3B 4DT7B 1C1TA 1QNJA 1TBRH 1QQUA 1NO9H 1ABJH 1OWJA 1C2DA 1CBWB 1YPEH 3U8RH 3ODFA 1WAYB 3A80A 3M5LA 1LCYA 1ZR0A 3GCOA 3O8DA 2D26C 1C2HA 4YOJA 1BTHH 1YC0A 2ZU2A 1HDTH 1QQ4A 1H4WA 1MQ5A 3PTNA 4ESTE 5AHGH 2A2QH 2FESH 2O8MA 4B6FA 3P8GA 1TPOA 1P09A 1GI0A 1UK4A 4OM9A 4X8VH 4CHAB 1QL9A 3RXCA 5GCHG 2F9UA 2STBE 5DK1A 1GJ6A 1Z8GA 4GCHF 1AU8A 2A7CA 1BA8B 3WW7A 4CRCA 4JCNA 2FI4E 5JB8S 3U69H 3TU7H 2OC7A 1C2KA 2BOKA 5JBTA 4RT1A 1RD3B 1FN6A 4ASHA 3KQBA 1ZPCA 4X2WA 2VIWA 1XXFA 5KECA 1NY22 2ALVA 1FPCH 3RU4T 5E8EH 2FX4A 5J4SA 1ZMNA 2F9PA 3JZ1B 4U32A 2FX6A 2VH0A 2IJOB 6GCHF 1O37A 2Z9IA 3STJA 1GBKA 2JDID 3NCLA 2W3IA 3VB5A 8GCHG 1C5RA 2J34A 1O30A 4Y0YE 4XD7D 4ZKRU 4LZ4B 2M5TA 4ABFA 4PROA 3FAOA 2M2AA 2PUXB 1O3OA 3QDZB 3R3GB 1SC8U 3VB6A 1CGIE 2F43B 3ZVFA 1QJ7B 2HVYB 1O3KA 2O9QA 1AKSA 1GJ9B 1D9IA 5HGGA 3C27B 4ZXXH 1SSXA 3ENSB 1GDUA 2QIQA 5T6FA 2BQ7B 2GKVE 1QBNA 1E34B 1GMCF 4ZAEA 1P10A 4OS1A 4TY7A 2PKSC 1C1OA 3BEUA 1NU9A 1ANCA 2GCTC 4CBOA 1Y3YA 3SJ8A 4RI0A 1W8BH 1WV7H 1BBRE 1ID5H 2GZ8A 1QTFA 1TIOA 3F2HA 2J38A 1W2KH 1TYNA 1A3EH 1BRBE 1L1GA 1TOCB 1KXEA 1MAXA 3LJOA 1G32B 1O2MA 3D23A 4BXWA 1QA0A 2ZFRH 2VWOA 1HGTH 4WY3A 3UR9A 3BTDE 1CA8B 3MH4A 1K1JA 2UUJB 1EJAA 1NRQH 1BTZA 2QE7D 1ZTJA 1GHBG 2ZFFH 4MNXA 4AFZA 2C8XB 1GJBB 3TK5A 2IJD1 4RN6A 3BG8A 1FMGA 3A7WA 4XBCA 4TWWA 1ELCA 1Z6EA 1Y5BT 2Z9GA 4FUIA 4TT3D 1MTNC 1GBFA 1T8LA 3MO9A 3DSGA 3UOPA 1C5UA 3M5NA 4YO9A 3Q3XA 2G51A 2FWWA 2GZ9A 1ARCA 1BTPA 1G3EA 3MI4A 4OGXA 3SUEA 1FJSA 1TNIA 4U01A 3A7XA 1Q3XA 1SGIB 1Y3WA 1YPMH 4Y8ZA 1QIXB 3EQ0H 1Y8TA 2FOMB 1W3CA 1EB1H 4DIHH 5JBCS 5C17A 2BY6X 2THFB 2ZFQH 4JYVH 2VIOA 2CHAB 1JIMA 2A5AA 2VGCB 1YCPK 4VGCB 1MUEB 3O8BA 3L6PA 2JH5D 1O2QA 1ZSKA 1GVKB 5GCHF 4CRAA 2BLOA 2PUQH 1NRRH 3LH3A 1AQ7A 1C1VH 1TA2A 2WPDD 3ZV9A 5HKKD 3RXTA 2UWOA 1DVAH 2VNTA 1F0TA 3FO8D 4D9RA 1HJAC 5ESTE 1L1JA 3SU2A 1BCUH 2FM2A 2ALPA 2VVUA 3U28C 4ACAA 1LPZB 1BHXB 1RIWC 2XCNA 1S6LA 1DUAA 1YCPM 4ZH8A 3SGBE 4Y7BA 5FCRA 1RTKA 5EXMA 4FUEA 1HNEE 2KAIA 1UMAH 1WTHD 1J8AA 2XBYA 1O3LA 1SLVB 1HAHH 1HBTH 1VJAU 2OQ5A 4UFDH 2UWLA 3NKKA 5FXLA 1P8VC 3SQHE 2PTNA 4Z0KA 3U9AH 3GY7A 3KEEA 2HNTF 5C1YA 1VITH 1QB9A 5GJ4B 1AI8H 1Q31A 2C8ZB 3FFGA 3RXIA 1AUJA 4U2WA 3E91A 5PTPA 3SGAE 1KTSB 3QZQA 1S85A 2BD4A 2L74A 4BOHA 3SNEA 5A09A 5F8TA 2XC0A 2FI5E 3BG4C 1G37A 5TJXA 3TH3H 1IQKA 3GY6A 4IW4E 3QN7A 1QL7A 1SBWA 2UUKB 1HXEH 3ODDA 2Z6BD 1EJMA 5EXLA 2YMSC 3EGKH 4X8UH 1BITA 3ZVDA 4X6OA 1THSH 1BMAA 2FP7B 2ZEBA 2BTCE 1FAKH 1O2IA 1P06A 2Y5FA 3H5CB 1O2KA 1C5MD 5K7RA 1XUKA 3KQ5A 1Y3VA 2L6OA 2FMJA 1YCPH 1LVBA 2FI3E 2G4UA 1O2WA 1D3TB 1HJ8A 5HM2A 1O2NA 2Y82A 1A3BH 1H8IH 3GICB 5DPAA 4DVAU 1JIRA 1DICA 1QL8A 1Z6JH 1AB9B 1SGPE 2P3TB 1PQAA 3F9FA 1L4DA 3FVFB 2A4GA 1P3CA 3NRLA 2BX3A 3Q76A 2XBWA 4P00A 3M3VA 4CRBA 1V2MT 4X1PU 3S69A 1SGDE 1Z8IB 1ELBA 3K6YA 2GCHF 5CHBA 1DUEA 4H42U 3F0OA 1K1NA 1QY6A 2KR7A 3UPEA 2BQ6B 2EC9H 1KSNA 3TGIE 4YXWD 2FZZA 3TK9A 4Y6DA 3CS7A 5DP3A 3IITA 2R0KA 4X8TH 3TJUA 4GLYA 4ABBA 1J17T 2GT7A 3UWJH 5DP8A 5EPNA 1GHXH 2EY4C 3V3MA 2PKAB 1V2JT 9ESTA 1TX6A 4O97A 3TPIZ 4O3UA 1C1WH 3KYFA 1NRSH 2P59A 4WXVA 1MAYA 1YPHE 4KKDA 2ZTYA 2XBXA 3E6PH 4I86A 3OFND 4X2XA 3RU4E 3LGTA 1UO6A 3VXEH 1HAOH 2FYQA 1NFYA 1V2LT 2FLRH 2ZU3A 4MQAA 2ZQ1A 3KIDU 2VVCA 1SKYE 2P94A 3LT3A 1K1OA 2KFWA 3EDXB 5K0HA 1G2LA 2ASUB 1E79D 4XBDA 1BTWA 1P9SA 5B6OA 4AX9H 3MH7A 1FZZA 5C94A 4LXBH 2HPPH 3QWCH 3RMNH 4LK4A 2QF4A 2FTLE 3U98H 1BRCE 4ABDA 1C2MA 1J9CH 1RTLA 1S82A 1ZHRA 1GI4A 3N7OA 1FV9A 4YESB 1ELDE 2JJ2D 4KTUA 1ZTKA 1HAXB 1SHHB 8ESTE 1MTVA 1C5SA 2V35A 2ZU1A 1HUTH 1GI2A 1YY3A 4YM9A 3UUZA 1GBLA 2Y7ZA 1O2HA 3N7EA 2ZGJA 3ESTA 3KQDA 1EAIA 2F3CE 4UFFH 2KCAA 2YNBA 2CJIA 3RXLA 4I8HA 3OEED 4MLFB 4OS6A 3SQEE 1V2ST 3GY8A 4DG4A 4AFQA 1O3AA 4IS5A 4XBBA 4F55A 1XUIA 4YT7H 1EB2A 1GBCA 1FDPA 4J2YB 1W14U 5DP7A 5BRRE 1FY8E 2VH6A 1A5IA 2P3FH 1YKTA 4FETA 3Q3KA 3SU5A 3ZVGA 2OC1A 3RXSA 5CE1A 2BY8X 1H9LB 4DGJA 1S5SA 1GI5A 1TABE 5DP4A 1K21H 3MOCA 4ABIA 1H9IE 2ZQ2A 1N8OB 4CR5A 2WV9A 2W7UA 1LHFH 3FP6E 1O5BB 1UTLM 2ZHFH 1ELEE 3SO3A 1LTOA 2BZAA 1NBME 3ZZAA 2QA9E 2XYAA 3EA7A 1S81A 2SGQE 3BTGE 5FPYA 2A0QB 1K2I1 2ZPSA 2ESTE 4NA9H 4DT4A 2NWNA 2ZA5A 3WY8A 3U8TH 3VB7A 3SV2H 1MZDA 1YLNA 2WV4A 3ITIA 1KY9A 3RXBA 1IQFA 3PMBB 2KX4A 1ANEA 1O3BA 1SFIA 4I8JA 2TGTA 2SNVA 2G5NA 3QGJA 2CMYA 3GOVB 1K28D 1TMUH 1L4ZA 2HNTC 1TX7A 2SGDE 2GX4A 4INHA 1GHWH 1VJ9U 3W1EA 5JDUB 1CO7E 2H1UA 1LVYA 3LC5A 5FX6A 1EX3A 4XE4A 2D1JA 3ZZ5A 1SQAA 3F3BA 3SNDA 2AERH 8KME2 4E05H 3SNBA 1O2ZA 3A85A 2F9NA 2ZFPH 2ULLA 1NU7B 1ETSH 1T31A 3TIUA 1K0HA 1HIAB 3RC4A 1MTWA 1TX8A 1PPHE 1NROH 3T29A 5FX5A 1FN8A 5CMXH 3H09A 1UVTH 4Y8YA 3P8OA 2BDGA 3HK3B 5L6NH 2FYRA 3MU8A 3BTWE 1GBEA 2R3UA 3BF6H 1QHRB 1KLIH 1AKSB 3QO6A 1DLEA 3URCA 1FONA 1HAZB 1MCVA 1V3XA 3EAJA 3NZIA 1C5NH 3MNXA 5LH8A 2EEKA 1RGQA 1DM4B 1FIWA 2AH4X 3F0PA 2VVVA 1OP2A 3SV8A 1O35A 1A0JA 2FTMA 1Z8RA 2BLQA 3ZZ4A 3UNRA 2BVSH 3UQOA 4ZCNA 4D8NA 3CENA 3LC3A 2A5KA 3R0FA 2P8OC 1MQ6A 1YLDA 2ZO3H 1UTKA 1AGJA 5KEDA 3SNAA 3LGVA 1C2LA 4IN2A 1EPTB 4JZFH 2AYWA 4NFFA 3OE7D 1PPBH 4Y76A 1GG6C 1FUJA 2WPJS 1TGTA 4YOGA 1KXCA 1AE8H 1UCYK 4ISIH 3ZZCA 4JZIA 3GCHC 3MTYA 2W7SA 1GHAF 1CA0C 1LPGB 1GJDB 2Z94A 1O2PA 3RXAA 3LGYA 4DURA 1V2PT 4VGCC 1B0EA 4UDWH 1KXFA 4Y79A 1DOJA 1YP9A 3M5MA 3ZVAA 5DSFA 1DANH 3VXFH 1F5LA 1V2UT 1GBAA 3LDXH 1ZRBA 1GJAB 2XCFA 5G4BA 4B1TA 4I33A 3MNBA 4D9QA 1HAPH 1O3GA 4Y0ZE 1ZZZA 1FQ3A 3MU1A 1QB6A 5I25A 1OWIA 3RDZA 1P2NA 3I78A 2C3SA 3U8OH 3S9CA 1OWEA 3F9GA 2R2MB 4Y8XA 1C1RA 3UQVA 3ZZDA 2BZ6H 2XC5A 4I7YH 2B9LA 4MPVA 1NZQH 2RG3A 4P02A 1ZGIA 1C1NA 4JYTA 4AC9A 1GI9B 4WH8A 5F6MA 1BMFD 4M7GA 2AIQA 3SJIA 3OTPA 1JBUH 1AVGH 1GVZA 1OKXA 2YMSD 4DJZB 2HOBA 1TALA 3M37A 2GT8A 4U30A 2AS9A 1RXPA 1NC6A 2BDYA 2V3HH 2BVXH 4TYDA 3A82A 4NCYA 3DHKH 4ISHH 4NWLA 4BAQB 1TGSZ 1HIAA 2W6ID 4WXIA 7KMEH 2ZIQH 5EPYA 2NU2E 1MMJN 2OK5A 2JH6D 3SUDA 4WH6A 3DUXH 4ZXYH 2ZDAH 1N6XA 4K69A 5CHAB 2KAIB 3MO3A 1VGCB 3MO6A 5I46H 3NUMA 3TLOA 4ABEA 1YPGH 1ARBA 7GCHG 4JZDH 4K60A 3SU0A 2BLWA 1W10U 1F5KU 2QV1A 2QY0B 3QTVH 3ATWA 3OSYA 3ZVBA 1O5GH 1P0SH 1W0KD 1UCYH 3HATH 1ESBA 1BRAA 1HAVA 1WCZA 1WTGH 1TGNA 1IHTH 5FCKA 1D3DB 1O2RA 4CR9A 1BTUA 2BD2A 3M5OA 1AFEH 1P2OA 1G3CA 3PRDA 5A8ZA 1AFQB 1SQTA 2OUAA 1QURH 4NIYA 4Y10E 3DSOA 1O3IA 2GMTC 1BIOA 1PQ7A 3RC5A 1RJXB 2ZKSA 3AW1A 1ZTLA 1GJCB 1O2TA 5E2PA 3K9XB 2PSXA 2BY5X 3PRBA 2DUCA 3F1SB 3OY5U 4NWKA 2G55A 1A4WH 3SU6A 1TQ7B 2AFQB 1EAWA 1FY1A 6CHAB 2ZHDA 2LNCA 1EPTA 3G01A 3H7TA 1P57B 4H6TA 5EJLA 2I6SA 1HXFH 2RCEA 3CNRA 3SJ9A 3E0NB 3IWMA 2CXVA 3BTFE 2VU8E 5T6DA 2ZC9H 1OYQA 5HIYA 1NTPA 2Q6FA 1GBJA 3U1IB 1PPGE 3ATKA 3KF2A 1IHSH 1O2GH 4NIVA 3DFJA 2XOKD 5EW1H 4HG6A 3WWFA 1CQQA 3T25A 2CF9H 1TA6A 1G3DA 1OOKB 5BPEA 2ZPRA 5AFZH 5C1XA 1ELGA 2BOHB 3LGIA 5AF9H 4GHTA 1AIXH 4FUHA 1H8DH 2XXLA 5FPTA 1ORFA 4ZROA 3L3TA 1OS8A 3A89A 3F9HA 1LVOA 3P70B 1ZPBA 4BTUB 1O5DH 2JETB 1HV7A 2AEIH 3PTBA 3OX7U 4GPGA 1YWUA 4NZQA 1M9UA 1BQYA 4AGJA 2ZHQH 9LPRA 1UTOA 4IMZA 3GS9A 2D8WA 2FOBA 3K65B 1ZHMA 2EA3A 1IQHA 1CGJE 2TIOA 1O2YA 4GSOA 1V2QT 4LOYH 3QTOH 1SI5H 1EAUA 2Z7FE 1CT2E 1N6YA 2C90B 4R0IA 1ABIH 3SV7A 1HJ9A 2KCOA 3RM0H 1BJUA 2BYAX 1COWD 2ZDVH 1UVOA 3Q3YA 3UB0A 5EQQA 5C1UA 2O8WA 1B5GH 1UTQA 3GY5A 2HLCA 1AY6H 2A7JA 1TOMH 3MNSA 3SNCA 1JMOH 5HM9A 1C4U2 3LJJA 3ZV8A 4DW2U 3MWIU 1K9OE 3AAVA 1MKXK 8GCHF 3BTQE 4NSVA 2GZ7A 2BXTH 2R3YA 1AWHB 1V2OT 1AN1E 1HAYB 2BMGB 3BTKE 1SQOA 1Z8JB 1TMTH 2H9HA 2XC4A 5LPFA 2XWBI 3MU0A 2Q6DA 1SGCA 2G5VA 1PFXC 5F03A 3SUFA 2W5EA 4UD9H 4WF8A 1BMNH 2KM0A 3VG8A 5HXFA 2FOCA 3NK8A 3PLPA 4CRGA 5EIYA 2UWPA 2V6NA 1CGHA 2ZFTA 1O5EH 1UTJA 1V2VT 4TWYA 2BDAA 3GYMA 4RKOB 1VCWA 1BTXA 1LHDH 2HLDD 5C5NA 1DE7H 1AVXA 1FIZA 3FN8A 5T3HA 5IDKA 1SFQB 7ESTE 1KXAA 2J2UA 1P2JA 4MNWA 4O9VA 1C1SA 3SZEA 1E35B 3I29A 2A1DB 3P92A 4KP0A 2KCYA 2UUYA 1W0ZU 1ZLRA 3SI4H 5E0GA 2K1QA 5AFYH 1TRMA 6LPRA 4UFEH 4X1NU 1OP0A 3HGNA 1K1LA 1SGEE 1S83A 2ZCHP 5A0AE 1F7ZA 1WBGB 2TPIZ 1XUGA 1TGBA 4KELA 2K8IA 2JIZD 1GHBF 2ZTXA 3GCTG 4NZLA 5DKMA 1KLTA 1ELFA 3VGCC 1YPKH 4RT0A 2GGVB 1RRKA 2ZTZA 2O8LA 3ZZ6A 2QYIA 1KTTB 2PKSB 4AG2A 3A8CA 1WU1A 1MU8B 1O2VA 3KQCA 4FUDA 1TPAE 1NFUA 1O33A 1TPPA 2BDHA 2C8YB 4FU8A 5L2YH 3Q00A 2ZHWH 2EQNA 3UAIC 1MKXH 4NA8A 3E90B 3LOXA 3UR6A 4AG1A 3E1XB 3MH6A 1MBMA 3A88A 3P95A 2BX4A 3LU9B 3S9BA 1NN6A 1A7SA 3E0PB 4Y7AA 1O3NA 2AMQA 2VWLA 3AASA 1KIGH 3ZZ7A 1QR3E 1DX5M 2BD5A 4FUBA 1FAXA 4FVBA 5ESBA 2A32A 1FLEE 2OP9A 2Z3EA 2ZGCA 2AGEX 4BTTB 2R9PA 1S0RA 2J9NA 3LONA 3OU0A 2BDIA 3B8JA 4HTCH 1Z7KA 2OQUA 4TSFD 3KCGH 2HRVA 3A7VA 5JB9S 1MTNB 3M7QA 4OS4A 1GBHA 2A4QA 4OS7A 2BD7A 2BD8A 3DA9B 2BD3A 1IQGA 2LELA 2QGRA 5TCCA 1C5PA 1XX9A 1Z71A 1TAWA 2YNAA 1H1BA 2NU0E 2Z9LA 4MPXA 4X6MA 1TE0A 2ANMH 5JYIA 1IQNA 2GD4B 4KTSA 1BHXF 3BEFB 2ZWLH 3F2FA 5KGOA 2Y7XA 4XDEA 2XTTB 1OHHD 1OP8A 5A8XA 1A0HB 1EP6A 1G2MA 5ETXA 1JXPA 1W7XH 3DFLA 1O2XA 4J1YA 4Q7XA 1OX1A 4AOQA 3PV5A 3RXEA 2WYGA 3FZDA 3NXPA 4FUJA 1IQLA 3PO1C 2SGFE 1GL0E 1IQJA 3BTEE 4I32A 2PGBB 1D4PB 1VR1H 1N1LA 2AGGX 3RLYH 1UK2A 1C5LH 1O5CB 2ZGBH 2QF3A 1GMHG 4BTIB 3SHAH 4A7IB 2WPKS 3PLKA 1SGTA 1OWDA 1ANDA 1EASA 2H5DA 1DWCH 1WDIA 4B6EA 3B9FH 4IC6A 3UIRA 1GCDA 2F9OA 3DT0H 2O8TA 1DT2A 4NGAH 1LHEH 1BB0B 4RSPA 1QZ8A 4OS5A 3SUGA 1F5RA 2PWXA 1FPHH 5IK2D 2TGPZ 5GNDA 3QGNB 1CBWC 1FY3A 3F68H 4MNVA 4WMFA 3QLPH 1HYLA 1ZJKA 1QJ6B 1XMNB 2F91A 4DCDA 4IMQA 1SGNE 4H4FA 3M36A 2J5UA 2ZECA 3RMOH 1O3DA 1SLUB 3RXMA 2AMDA 1C2GA 1GJ5H 3KL6A 4D7FA 2AMPA 3T28A 3HGPA 4IN1A 3SGQE 1GCTB 1CT0E 5FL7D 3LIWA 1O31A 4YZUA 3M3TA 1G9IE 1MD8A 1P05A 1SOTA 1ELVA 3CS0A 2VB0A 1CHGA 1ZJDA 3UREA 4CHAC 1IAUA 4Q4LA 4AGKA 1LKBA 1V2TT 2YMSB 3W95A 1IOEA 2F83A 3N99A 1BUIA 4AB9A 2JKHA 1RFNA 1BDAA 1DDJA 1SGFA 2YOLA 2QF5A 1CSOE 4GAWA 1TNHA 1EJNA 2ZGHA 3M7TA 4I31A 4K3JA 2XWAA 1GGDB 2V7QD 3SN8A 5HMAA 3B23B 2XW9A 2SGAA 3LKWA 1T8OA 1C2FA 4B2CA 3PV2A 4K1SA 2Y5HA 4M9FA 4AZ2B 1HFDA 3GCNA 5E2OA 1CHOG 2XBVA 1EZSC 2OXSA 2VIVA 1JRSA 2J94A 1O32A 1A2CH 4NSYA 5CHAC 5EODA 3QK1A 4F49A 3I77A 1O36A 1A46H 1GBDA 3MU4A 2H9EH 1DWEH 4IC5A 1XXDA 4MPWA 3SJKA 3LPRA 2WUCA 1V2NT 1K1IA 1C5VA 2K0QA 1SGRE 1YGCH 3OY6U 4ZHLU 3VB3A 1IQIA 4GUXA 1T32A 4UFGH 4Q80A 1UVSH 1PPEE 1EAXA 1HAGE 1O3FA 1G36A 4ZKNU 3QX5H 3MQKC 1UVUH 1OSSA 2V3MA 1AFQC 1INCA 1P11E 1O3CA 1PPFE 2ZF0H 1FY4A 5DO4H 4HZHA 1GI7B 2BXUH 1V2RT 2R2WU 3UOUA 4X8SH 3UNSA 3AVZA 5B6LA 1XVMA 4O3TA 5J4QA 1UJ1A 3KN2A 1HAVB 1GI8B 1GWAA 1D3QB 1T7CA 3BTHE 3MYWA 4K8YA 2GV7A 2ZI2H 5FHTA 1GMHF 1K1PA 1VITG 1D3PB 3RXPA 1YPHC 1Y5AT 4CRDA 2LPRA 3S0NA 3OAAD 1O3EA 1C9PA 1ETRH 2FPZA 2PW8H 3HK6B 3UWIA 1E0FD 1BJVA 5ABWA 1O3PB 4YOIA 3U1JB 2ZGXH 1TRNA 3ZYEA 2HPQH 1P04A 3STIA 3KQEA 4I8LA 2GTBA 2V0BA 2XNIA 1CVWH 3KHVA 4XSKU 2BB4A 3S7HB 2J98A 5EQRA 1H8ED 2ZDNA 2FOGA 1C1UH 2C4FH 1J14A 1A0LA 5EJZA 2A4OA 4A1TA 4BNRA 4MNYA 2ZDLA 1UW7A 1W0JD 3ATIA 1C5YB 3URDA 2W3KA 1UTPA 2QXJA 2VJ1A 3DSPA 4XRNA 1K1MA 3NWUA 3TNTA 1S0QA 2CHAC 2VGCC 3M35A 1DSTA 1SGQE 1UCYE 3V7TA 2BHGA 1QJ1B 1YBWA 2ZDKA 1LKAA 3FZZA 1WQVH 1P02A 2DE9A 1FX0B 2PV9B 2ANYA 2ZP0H 3T26A 1AO5A 1P2MA 1Y3UA 1C5WB 5DP5A 1Y5UT 3BSQA 2C8WB 3A7YA 4YTAA 1XUHA 3SI3H 1PJPA 4ABJA 5FBIA 3QUMP 2QAAA 1OWKA 1PPCE 4TPIZ 3MNCA 1AZ8A 4JMYA 4K1TA 4K8BA 1O2JA 1QBVH 3K6ZA 3UTUH 4ZKOU 4KGAA 1CHOF 2B8OH 7LPRA 4IBLH 3T2NA 2WUBA 1SQRA 2FS8A 1WUNH 4WWYA 1GJ8B 2Q1JA 3SU4A 1EOJA 2WYJA 3SV9A 1LO6A 2FS9A 2QC2A 3MH5A 1W12U 2UUFB 1P3EA 1CE5A 3SW2B 1AVWA 1AMHA 1ANBA 5F53A 1HLTH 1O34A 1D6WA 1W11U 4NG9H 1LMWB 1C2EA 2Y5GA 4OGYA 1YLCA 4E7NA 2XNDD 1EFRD 2FLBH 3ZZBA 1AE5A 4SGBE 5C3NA 4A5TS 3A86A 1ACBE 1SHYA 2IOTA 5JBAS 5C5OA 1U6QA 2JH0D 5GPIB 1J16A 4KTCA 3BIUH 4OS2A 1KDQA 3FP7E 1EXFA 3O8RA 4HI3A 1ZYOA 2G4TA 1F92A 1T8MA 4TPYA 1ETTH 1GBBA 2SFAA 2B5TB 1DY9A 1X7AC 1GI6A 4CH8B 3ZZ8A 5H4IB 4X1SU 2KZ4A 4XFQA 4AYYB 4ZKSU 1GHVH 2Y81A 1UTMA 3EA9A 3D65E 1HAIH 3GDUA 4CRFA 4ASUD 1PYTC 3JZ2B 1WSSH 2OLGA 1EKBB 1OXGA 1VITF 2CF8H 3SOSA 2VINA 3O8CA 2WZQA 4BANB 2ZHEH 3A8BA 5C0UA 1NPMA 2FOFA 3L33A 3GYLB 1C1MA 3SJOA 2HALA 2IPHA 4CREA 1MBQA 1HCGA 1L0ZA 3TVJB 1AB9C 1UVPA 1SOZA 1Y59T 3V13A 4R8TB 1JRTA 1BBRK 3PB1E 1XVOA 4ISNA 3TH4H 2J95A 4Q7ZA 1MABB 2R0LA 5TCAA 3T5FH 3UNQA 4X6PA 4ABAA 5DP9A 2BQWB 1LQEA 3PLBA 2P16A 1SR5C 1XM1A 4A1VA 5EG4A 2AIPA 2QCYA 4B2AA 4CBNA 1LVMA 5AVDA 2ILNA 1O38A 1O3JA 2H9TH 1TPSA 3LGWA 2CN0H 3RXHA 2DE8A 4Z1MD 2PSYA 4BAMB 1FXYA 1WQSA 1EZUC 2PLXA 3N7DA 4FU9A 3OEHD 5DG6A 3SZNA 5L2ZH 4NIXA 3RUOA 3TGJE 2AHME 1QFKH 1THRH 4B71A 1GPZA 4MDSA 3VB4A 2P8OB 1DITH 1C1QA 2I6QA 1C5XB 4HGCA 3T62A 1XKAC 1AWFH 2LP6A 4UEHH 3A81A 2VWNA 4X2VA 3RXOA 2WV5A 1BMMH 2WSSD 1GG6B 2GCHG 5FBEA 3NPSA 4HFPB 3P8NA 1WXRA 4ISOA 1Y3XA 2ZU4A 4O03A 4UONA 2H6MA 2W6JD 4I8GA 1HPGA 2A4RA 5A0BA 3GCHB 1Q2WA 3UFAA 1ZRKA 1IQMA 1C2IA 1CA0B 2QXIA 3TK6A 4AFUA 1SB1H 2VBCA 3F9EA 1ZMJA 1SGYE 1UTNA 5L30H 1BRUP 2ZPQA 3OTJE 4A6LA 1W7GH 1B0FA 1V2WT 4B76A 4NFEA 1P2KA 4I8KA 1ELTA 1PPZA 3K2UA 2EI8A 1LHCH 1V2KT 2BLVA 3SU3A 5EU8A 1BZXE 1GDNA 1BBRH 1QRZA 4WMEA 2P93A 3PMJA 4ZHAA 3RXFA 2PHBA 1QBOA 3T27A 5C67A 7GCHF 2RFKC 2OCVB 5GWZA 2HGTH 1NS3A 2WPIS 3A7TA 3PYHA 4K5ZA 3KNXA 2Z9KA 1NFWA 1CU1A 1DLKB 1ZMLA 4BAKB 3A87A 3IG6B 3M3SA 2HWLB 4K1EA 3A8DA 1O2LA 4FU7A 1A5HA 4XOJA 5DN6D 1QA7A 1GHZA 1TBQH 4Q7YA 1GMDG 4JYUH 3TJVA 1JWTA 1C5OH 1G30B 2Y6TA 2FXRA 1GDQA 1RS0A 1TWXB 1OWHA 5GIBA 3RLWH 5A0CA 1DWDH 1EZXC 1GJ4H 2WPHS 5LPEA 1GBIA 1GVLA 1OYTH 2B7DH 2RDEA 5EQSA 1GBMA 3A7ZA 1ZHPA 1FI8A 1JOUB 4X1QU 2GDEH 1O5AB 1EZQA 1GCTC 3AAUA 1L2EA 1N8OC 1MCTA 5A8YA 3RXVA 2G52A 1E1RD 1TNLA 2ZCLP 3EYDA 3FOAA 2RA0A 4F4OC 1O0DH 5C2ZA 1NRPH 1Z1JA 2BDBA 1GBTA 3OYPA 1WOFA 4DOQA 2TGAA 3FANA 3ATMA 4MPUA 4SGAE 1ZGVA 5EGMA 3PWCA 3PMHB 2BDCA 2ZNKH 3LH1A 3P8FA 3CP7A 3F6UH 1RTFB 1W0YH 2D2DA 1GGDC 1ZOMA 4ABGA 1C5QA 4YLUA 2SGEE 1P2QA 1E1QD 2GP9B 2GMTB 2B0FA 3MHWU 2OBQA 1VKYA 1S6HA 2GCTB 2HNTE 3TH2H 1SMFE 1EOLA 1LDTT 2BM2A 3FP8E 3A84A 3TJNA 2FDAA 1F0SA 2OC8A 3ATLA 1MKWK 2ANWA 2C93B 5FPSA 1DSUA 1SLXB 2CGAA 3P17H 4MVNA 1QGFA 4FUCA 6ESTA 3WWBA 2CK3D 5GDSH 1VZQH 3PMAB 4JZEH 1QRXA 3ZYDA 5EOKA 5C20A 1MU6B 2VIPA 2Y80A 1SGFG 3RXQA 4ZHMU 4FUGA 1L1NA 1H8HD 1O2UA 1F0RA 3AW0A 5DP6A 4UE7H 2J97A 2OC0A 1B7XB 1K22H 3RXKA 3RU4D 4ZMAH 1O5FH 1AHTH 3GY3A 4IGDA 1ZPZA 4BAOB 4FOUC 1TONA 2WINI 3S9AA 4MG3A 1NM6A 3RMMH 5LPRA 2H2ZA 1DXWA 4AYVB 1TNGA 2Q6GA 1C5TA 1TQ0B 1QCPA 4JK6A 2ZG0H 1C2JA 1THPB 3DD2H 1YPJH 2A2XH 1TRYA 4WVPE 4FXGH 2ODQA 1D6RA 1QRWA 2Z3DA 1W13U 1SLWB 3BN9A 3QZRA 2V3OH 2PGQB 1KXDA 3D62A 4GVUA 3GY2A 1O2SA 1SL3A 1NESE 2VIDA
chains in the Genus database with same CATH topology
1P2IA 1ELAA 2J92A 1F0UA 4B74A 1XKBC 5EW2H 5JBBS 1O3MA 4YLQH 3BV9B 4AB8A 3RXJA 3SBKA 1T8NA 3KGPA 4INLA 1F2SE 3GY4A 3ZVCA 2PR3A 4JK5A 3E16B 1C5ZB 1EPTC 3D49H 1DWBH 1GMDF 2TRMA 1HJAB 1UK3A 4E7RG 1NRNH 3V12A 4D7GA 1TLDA 1HRTH 2G8TA 1DY8A 1RIWB 4AN7A 2BVRH 2FOEA 4ABHA 2NU4E 4ZUHA 5F8XA 2VWMA 3RXDA 1MKWH 1TBZH 2BY9X 3ZZ3A 1AUTC 1GI1A 2RDLA 4TY6A 5HYOA 3MU5A 1YM0A 4B73A 1PQ8A 2FODA 1TMBH 2P95A 2ZDMA 1EUFA 1BTYA 1PQ5A 1KYNA 1MH0A 2G00A 4QT8C 2ZU5A 4X2YA 1WYKA 2GV6A 1IQEA 3H7OA 1P01A 5GXPA 1VCPA 3GCTF 1QB1A 2WPMS 5DJ7A 3RXUA 1C4V2 2EI7A 3ZVEA 4MTBA 1UHBB 1H9HE 3E8LA 1BOQA 3GDVA 3RXRA 4RKJB 1GL1A 3BG4B 1T4UH 1C9TA 1XUJA 2O8UA 3SV6A 3RC6A 3RMLH 3M61U 1AZZA 5LGOA 3RM2H 2QN5T 1GHAG 1ZSJA 1P03A 1SPJA 1E37B 1VCQA 3PM3A 3MMGA 2OBOA 3RXGA 1P9UA 3A83A 4FUFA 1MTSA 4BXSA 4AORA 2NU3E 4WJG2 2QF0A 2PFEA 1TNJA 2ODPA 2A45B 4FVDA 3ZZ9A 5SGAE 2IN2A 3PROA 1A61H 3TJOA 1ESTA 2J4IA 1TFXA 3BTME 1DXPA 4E06H 3SU1A 4BAHB 3BIVH 4B75A 1PYTD 1J15A 1G3BA 2W26A 5E0JA 4JZ1A 1TNKA 5EXNA 2PTCE 1ESAA 5FAHA 1KLJH 3VGCB 1Z1IA 3TGKE 1VGCC 4Y71A 4Q2KA 1TB6H 1AD8H 2Z9JA 2PKAA 4NA7A 3LGUA 2HVXA 1E36B 4CH2B 1YYY1 2SGPE 3PV4A 3P6ZB 2A5IA 2VIQA 4GCHG 4X0WU 3VFEA 3SHCH 1LHGH 3W94A 2ODYB 2NU1E 1KXBA 2FOHA 1LPKB 4K2YA 4H6SB 1EP5A 3EA8A 2QXGA 1EQ9A 4DY7B 8LPRA 1DPOA 1FNIA 4Y11E 1T4VH 3EE0B 6GCHG 1LQDB 1KDQB 2EI6A 2F9VA 3C1KA 1CT4E 1O3HA 1O39A 3GDSA 1GJ7B 2GVFA 2RA3A 3E3TA 2A31A 6CHAC 3HKJB 5F8ZA 2A7HA 3BEIB 3A8AA 3Q77A 1NFXA 2FEQH 1YF4A 2QXHA 1NT1A 3TITA 1GI3A 2ZCKP 4THNH 4WMDA 1HB0B 4ISLA 3M7UA 4B2BA 4A92A 4X1RU 1V6DA 2OTVA 2XRCA 1GMCG 1MD7A 2WPLS 2AGIX 3HPTB 4AFSA 2FO9A 1TGCA 2STAE 2FOAA 1DFPA 1S6FA 1O2OA 3BTTE 4D76A 1GHYH 5E0HA 2ZFSA 1S84A 2OINA 2GDDA 3V0XA 1P12E 2SNWA 2TBSA 2BD9A 2P3UB 4INKA 1A1RA 1DS2E 3UY9A 4X6NA 1MZAA 2ANKH 3PO1B 1C4Y2 1SG8B 3VPKA 3HKIB 2JETC 5JPMH 1UHBA 1C1PA 1EATA 1FY5A 1ZSLA 4YT6H 1A5GH 5DGJA 4Z6AH 4NIWA 2FIRH 1BT7A 1SVPA 3S7KB 3VEQB 4LZ1H 2Z3CA 2G81E 1BMLA 2CV3A 4A1XA 4GHQA 3MFJA 2H5CA 1E38B 2TGDA 4DIIH 1OPHB 3TNSA 3SORA 5IYTA 5A2MH 2F9BH 1YPLH 2ZZUH 3PWBA 3ELAH 3GISB 1XUFA 1MTUA 3RP2A 5T6GA 2BY7X 2OD3B 4DT7B 1C1TA 1QNJA 1TBRH 1QQUA 1NO9H 1ABJH 1OWJA 1C2DA 1CBWB 1YPEH 3U8RH 3ODFA 1WAYB 3A80A 3M5LA 1LCYA 1ZR0A 3GCOA 3O8DA 2D26C 1C2HA 4YOJA 1BTHH 1YC0A 2ZU2A 1HDTH 1QQ4A 1H4WA 1MQ5A 3PTNA 4ESTE 5AHGH 2A2QH 2FESH 2O8MA 3P8GA 1TPOA 1P09A 1GI0A 1UK4A 4X8VH 4CHAB 1QL9A 3RXCA 5GCHG 2F9UA 2STBE 5DK1A 1GJ6A 1Z8GA 4GCHF 1AU8A 2A7CA 1BA8B 4CRCA 5JB8S 4JCNA 2FI4E 3U69H 3TU7H 2OC7A 1C2KA 2BOKA 5JBTA 1RD3B 1FN6A 4ASHA 3KQBA 1ZPCA 4X2WA 2VIWA 1XXFA 1NY22 2ALVA 1FPCH 3RU4T 5E8EH 2FX4A 5J4SA 1ZMNA 2F9PA 3JZ1B 4U32A 2FX6A 2VH0A 2IJOB 6GCHF 1O37A 2Z9IA 3STJA 1GBKA 3NCLA 2W3IA 3VB5A 8GCHG 1C5RA 2J34A 1O30A 4Y0YE 4ZKRU 4LZ4B 2M5TA 4ABFA 4PROA 3FAOA 2PUXB 1O3OA 3QDZB 3R3GB 1SC8U 3VB6A 1CGIE 3ZVFA 1QJ7B 1O3KA 2O9QA 1AKSA 1GJ9B 1D9IA 5HGGA 3C27B 4ZXXH 1SSXA 3ENSB 1GDUA 2QIQA 5T6FA 2BQ7B 2GKVE 1QBNA 1E34B 1GMCF 4ZAEA 1P10A 4OS1A 4TY7A 2PKSC 1C1OA 3BEUA 1NU9A 1ANCA 2GCTC 4CBOA 1Y3YA 3SJ8A 1W8BH 1WV7H 1BBRE 1ID5H 2GZ8A 1QTFA 1TIOA 2J38A 1W2KH 1TYNA 1A3EH 1BRBE 1L1GA 1TOCB 1KXEA 1MAXA 3LJOA 1G32B 1O2MA 3D23A 4BXWA 1QA0A 2ZFRH 2VWOA 1HGTH 4WY3A 3UR9A 3BTDE 1CA8B 3MH4A 1K1JA 2UUJB 1EJAA 1NRQH 1BTZA 1ZTJA 1GHBG 2ZFFH 4MNXA 4AFZA 2C8XB 1GJBB 3TK5A 4RN6A 3BG8A 1FMGA 3A7WA 4XBCA 4TWWA 1ELCA 1Z6EA 1Y5BT 2Z9GA 4FUIA 1MTNC 1GBFA 1T8LA 3MO9A 3UOPA 1C5UA 3M5NA 4YO9A 3Q3XA 2G51A 2FWWA 2GZ9A 1ARCA 1BTPA 1G3EA 3MI4A 4OGXA 3SUEA 1FJSA 1TNIA 4U01A 3A7XA 1Q3XA 1SGIB 1Y3WA 1YPMH 4Y8ZA 1QIXB 3EQ0H 1Y8TA 2FOMB 1W3CA 1EB1H 4DIHH 5JBCS 2BY6X 2THFB 2ZFQH 4JYVH 2VIOA 2CHAB 1JIMA 2A5AA 2VGCB 1YCPK 4VGCB 1MUEB 3O8BA 3L6PA 2JH5D 1O2QA 1ZSKA 1GVKB 5GCHF 4CRAA 2BLOA 2PUQH 1NRRH 3LH3A 1AQ7A 1C1VH 1TA2A 3ZV9A 3RXTA 2UWOA 1DVAH 2VNTA 1F0TA 4D9RA 1HJAC 5ESTE 1L1JA 3SU2A 1BCUH 2FM2A 2ALPA 2VVUA 1LPZB 1BHXB 1RIWC 2XCNA 1DUAA 1YCPM 4ZH8A 3SGBE 4Y7BA 5FCRA 1RTKA 5EXMA 4FUEA 1HNEE 2KAIA 1UMAH 1WTHD 1J8AA 2XBYA 1O3LA 1SLVB 1HAHH 1HBTH 1VJAU 2OQ5A 4UFDH 2UWLA 3NKKA 5FXLA 1P8VC 3SQHE 2PTNA 4Z0KA 3U9AH 3GY7A 3KEEA 2HNTF 5C1YA 1VITH 1QB9A 5GJ4B 1AI8H 1Q31A 2C8ZB 3FFGA 3RXIA 1AUJA 4U2WA 3E91A 5PTPA 3SGAE 1KTSB 3QZQA 1S85A 2BD4A 4BOHA 3SNEA 5A09A 5F8TA 2XC0A 2FI5E 3BG4C 1G37A 5TJXA 3TH3H 1IQKA 3GY6A 4IW4E 3QN7A 1QL7A 1SBWA 2UUKB 1HXEH 3ODDA 2Z6BD 1EJMA 5EXLA 3ZVDA 3EGKH 4X8UH 1BITA 4X6OA 1THSH 1BMAA 2FP7B 2ZEBA 2BTCE 1FAKH 1O2IA 1P06A 2Y5FA 3H5CB 1O2KA 1C5MD 5K7RA 1XUKA 1Y3VA 2FMJA 1YCPH 1LVBA 2FI3E 2G4UA 1O2WA 1D3TB 1HJ8A 5HM2A 1O2NA 2Y82A 1A3BH 1H8IH 3GICB 5DPAA 4DVAU 1JIRA 1DICA 1QL8A 1Z6JH 1AB9B 1SGPE 2P3TB 1PQAA 3F9FA 1L4DA 3FVFB 2A4GA 1P3CA 2BX3A 3Q76A 2XBWA 3M3VA 4CRBA 1V2MT 4X1PU 3S69A 1SGDE 1Z8IB 1ELBA 3K6YA 2GCHF 1DUEA 4H42U 1K1NA 1QY6A 3UPEA 2BQ6B 2EC9H 1KSNA 3TGIE 2FZZA 3TK9A 4Y6DA 3CS7A 5DP3A 3IITA 2R0KA 4X8TH 3TJUA 4GLYA 4ABBA 1J17T 2GT7A 3UWJH 5DP8A 5EPNA 1GHXH 3V3MA 2PKAB 1V2JT 9ESTA 1TX6A 4O97A 3TPIZ 4O3UA 1C1WH 1NRSH 2P59A 4WXVA 1MAYA 1YPHE 4KKDA 2ZTYA 2XBXA 3E6PH 4X2XA 3RU4E 3LGTA 1UO6A 3VXEH 1HAOH 2FYQA 1NFYA 1V2LT 2FLRH 2ZU3A 4MQAA 2ZQ1A 3KIDU 2VVCA 2P94A 3LT3A 1K1OA 3EDXB 5K0HA 1G2LA 2ASUB 4XBDA 1BTWA 1P9SA 5B6OA 4AX9H 3MH7A 1FZZA 4LXBH 2HPPH 3QWCH 3RMNH 4LK4A 2FTLE 3U98H 1BRCE 4ABDA 1C2MA 1J9CH 1RTLA 1S82A 1ZHRA 1GI4A 3N7OA 1FV9A 4YESB 1ELDE 4KTUA 1ZTKA 1HAXB 1SHHB 8ESTE 1MTVA 1C5SA 2V35A 2ZU1A 1HUTH 1GI2A 4YM9A 3UUZA 1GBLA 2Y7ZA 1O2HA 2ZGJA 3ESTA 3KQDA 1EAIA 2F3CE 4UFFH 2YNBA 2CJIA 3RXLA 4I8HA 4MLFB 4OS6A 3SQEE 1V2ST 3GY8A 4DG4A 4AFQA 1O3AA 4IS5A 4XBBA 1XUIA 4YT7H 1EB2A 1GBCA 1FDPA 4J2YB 1W14U 5DP7A 5BRRE 1FY8E 2VH6A 1A5IA 2P3FH 1YKTA 3Q3KA 3SU5A 3ZVGA 2OC1A 3RXSA 5CE1A 2BY8X 1H9LB 4DGJA 1S5SA 1GI5A 1TABE 5DP4A 1K21H 3MOCA 4ABIA 1H9IE 2ZQ2A 1N8OB 4CR5A 2W7UA 1LHFH 3FP6E 1O5BB 1UTLM 2ZHFH 1ELEE 3SO3A 1LTOA 2BZAA 3ZZAA 2QA9E 2XYAA 3EA7A 1S81A 2SGQE 3BTGE 5FPYA 2A0QB 1K2I1 2ZPSA 2ESTE 4NA9H 2NWNA 2ZA5A 3WY8A 3U8TH 3VB7A 3SV2H 1MZDA 2WV4A 3ITIA 1KY9A 3RXBA 1IQFA 3PMBB 1ANEA 1O3BA 1SFIA 4I8JA 2TGTA 2SNVA 2G5NA 3QGJA 2CMYA 3GOVB 1K28D 1TMUH 1L4ZA 2HNTC 1TX7A 2SGDE 2GX4A 4INHA 1GHWH 1VJ9U 5JDUB 1CO7E 2H1UA 1LVYA 3LC5A 5FX6A 1EX3A 4XE4A 2D1JA 3ZZ5A 1SQAA 3SNDA 2AERH 8KME2 4E05H 3SNBA 1O2ZA 3A85A 2F9NA 2ZFPH 2ULLA 1NU7B 1ETSH 1T31A 3TIUA 1HIAB 3RC4A 1MTWA 1TX8A 1PPHE 1NROH 3T29A 5FX5A 1FN8A 5CMXH 1UVTH 4Y8YA 3P8OA 2BDGA 3HK3B 5L6NH 2FYRA 3MU8A 3BTWE 1GBEA 2R3UA 3BF6H 1QHRB 1KLIH 1AKSB 3QO6A 1DLEA 3URCA 1FONA 1HAZB 1MCVA 1V3XA 3EAJA 3NZIA 1C5NH 3MNXA 5LH8A 2EEKA 1RGQA 1DM4B 1FIWA 2AH4X 2VVVA 1OP2A 3SV8A 1O35A 1A0JA 2FTMA 1Z8RA 2BLQA 3ZZ4A 3UNRA 2BVSH 3UQOA 4D8NA 3CENA 3LC3A 2A5KA 3R0FA 2P8OC 1MQ6A 1YLDA 2ZO3H 1UTKA 1AGJA 3SNAA 3LGVA 1C2LA 4IN2A 1EPTB 4JZFH 2AYWA 4NFFA 1PPBH 4Y76A 1GG6C 1FUJA 2WPJS 1TGTA 4YOGA 1KXCA 1AE8H 1UCYK 4ISIH 3ZZCA 4JZIA 3GCHC 3MTYA 2W7SA 1GHAF 1CA0C 1LPGB 1GJDB 2Z94A 1O2PA 3RXAA 3LGYA 4DURA 1V2PT 4VGCC 1B0EA 4UDWH 1KXFA 4Y79A 1DOJA 1YP9A 3M5MA 3ZVAA 1DANH 3VXFH 1F5LA 1V2UT 1GBAA 3LDXH 1ZRBA 1GJAB 2XCFA 5G4BA 4B1TA 4I33A 3MNBA 4D9QA 1HAPH 1O3GA 4Y0ZE 1ZZZA 1FQ3A 3MU1A 1QB6A 5I25A 1OWIA 3RDZA 1P2NA 3I78A 2C3SA 3U8OH 3S9CA 1OWEA 3F9GA 2R2MB 4Y8XA 1C1RA 3UQVA 3ZZDA 2BZ6H 2XC5A 4I7YH 2B9LA 4MPVA 1NZQH 2RG3A 1ZGIA 1C1NA 4JYTA 1GI9B 4WH8A 5F6MA 4M7GA 2AIQA 3SJIA 1JBUH 1AVGH 1GVZA 1OKXA 4DJZB 2HOBA 1TALA 3M37A 2GT8A 4U30A 2AS9A 1RXPA 1NC6A 2BDYA 2V3HH 2BVXH 4TYDA 3A82A 4NCYA 3DHKH 4ISHH 4NWLA 4BAQB 1TGSZ 1HIAA 4WXIA 7KMEH 2ZIQH 5EPYA 2NU2E 1MMJN 2JH6D 3SUDA 4WH6A 3DUXH 4ZXYH 2ZDAH 1N6XA 4K69A 5CHAB 2KAIB 3MO3A 1VGCB 3MO6A 5I46H 3NUMA 3TLOA 4ABEA 1YPGH 1ARBA 7GCHG 4JZDH 4K60A 3SU0A 2BLWA 1W10U 1F5KU 2QV1A 2QY0B 3QTVH 3ATWA 3OSYA 3ZVBA 1O5GH 1P0SH 1UCYH 3HATH 1ESBA 1BRAA 1HAVA 1WCZA 1WTGH 1TGNA 1IHTH 5FCKA 1D3DB 1O2RA 4CR9A 1BTUA 2BD2A 3M5OA 1AFEH 1P2OA 1G3CA 5A8ZA 1AFQB 1SQTA 2OUAA 1QURH 4NIYA 4Y10E