4B2BA

Structure of the factor xa-like trypsin variant triple-ala (tgpa) in complex with eglin c
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDAGGPVVCSGKLQGIVSWGEGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermodynamic signatures in macromolecular interactions involving conformational flexibility.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CATIONIC TRYPSIN
total genus 55
structure length 223
sequence length 223
chains with identical sequence C
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b2bA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b2bA02
2Z7FE 3TNSA 1MKWK 4OS5A 5DG6A 5GXPA 1T8LA 1TBRH 3TJUA 1ELBA 1O3JA 2I6QA 1QRZA 4X2WA 3MYWA 1AE5A 2PHBA 3LPRA 3VEQB 4CRBA 1L1GA 1OWHA 4X1RU 3NWUA 2BD4A 5A0BA 4K69A 2BD3A 2BOKA 1DY9A 4F49A 3QX5H 4NFEA 1HAGE 1FJSA 3GISB 1KXBA 1SG8B 1C5PA 1VITF 1LHEH 1P0SH 5DGJA 2AH4X 5E0JA 1MQ6A 1LTOA 1WQSA 2I6SA 2XXLA 3P17H 1KXAA 2ZI2H 2H9TH 3O8BA 1UVSH 2AGIX 2EEKA 3MU0A 3E8LA 2G4TA 1ELAA 3BF6H 2ZNKH 3M7QA 3B23B 2HPPH 1SOTA 1LQDB 2GGVB 2W26A 1TNJA 2CJIA 1MMJN 4NA7A 1GBIA 2PWXA 1AGJA 1NFUA 4WY3A 1C5QA 4ZXYH 4WJG2 1QRXA 4ZAEA 1O2JA 2ZHWH 4BAHB 1FONA 2XC0A 1WYKA 1P04A 4OS1A 5EQQA 3SNBA 1SL3A 2PLXA 1SGYE 2VH0A 1F5RA 2SGQE 3F9EA 2ZPSA 3RLYH 4WMDA 1HAXB 1GJ5H 2PKAB 1P2JA 3UREA 5DP9A 3RXRA 3A83A 1ELEE 2ZGHA 1AZ8A 3MH7A 2ZHQH 1TALA 1C4Y2 4UFEH 1TRMA 1SQAA 1EOLA 3KHVA 2BD2A 2OLGA 1RFNA 2SGEE 1MTVA 3Q00A 1P2OA 2G81E 3H7OA 1G3EA 3TGJE 1DUAA 1NRRH 2H6MA 4TYDA 2H5DA 3U69H 1CBWB 4IC6A 1ETRH 2F9NA 1X7AC 3LDXH 1LVYA 2OC0A 4XDEA 4BANB 1GMHG 1V2RT 2BQWB 3ATIA 1YC0A 1AKSA 2G52A 1KLTA 2V3HH 1T7CA 1JIRA 1C1OA 1SGNE 3RP2A 5T6FA 3GCOA 1G2MA 3SV9A 5EPYA 2UUKB 5L30H 1EP6A 4AG1A 4K1SA 4INHA 5C20A 3KQCA 1NU9A 1DITH 3K9XB 4O97A 1EQ9A 3SZNA 1K1PA 1INCA 1CT4E 1NT1A 3ZZDA 5TCCA 4MPUA 1TAWA 5F6MA 1NFXA 2FIRH 1QBOA 2Z9GA 3DHKH 4BTIB 1AWHB 1SPJA 3VGCB 2FMJA 2F9OA 4B71A 3MO3A 5H4IB 4BAMB 1T31A 4ESTE 4GHQA 2J94A 3SGQE 1F5KU 1KSNA 3SU2A 1DOJA 4O9VA 1BUIA 1C5MD 1NS3A 1WTGH 4Z6AH 1EATA 1SGRE 1BRCE 1P11E 4F4OC 1VR1H 2KAIB 1BCUH 4CH8B 1S85A 5FBEA 1EOJA 4ISIH 1BJVA 2F83A 1O3DA 2TGAA 4AORA 2A45B 1DS2E 4BTUB 2WYGA 1HB0B 2QV1A 3UTUH 2IN2A 2NU3E 5C2ZA 1EB1H 3M3SA 1UJ1A 1CHGA 4CRDA 2P59A 2OD3B 1O37A 3SU3A 1KIGH 3BTDE 1J14A 2BHGA 4Q7XA 1SGTA 2G5VA 4FUCA 2OQ5A 3EA7A 1BOQA 3NPSA 1T8OA 3BIUH 1ELCA 3SGAE 4H42U 4GPGA 2ZPRA 2FEQH 2RA0A 1G2LA 4AZ2B 2AMPA 4B73A 5F03A 3S0NA 1GDUA 3ZZ5A 2A0QB 1GJCB 1LQEA 3MOCA 2PGBB 1W12U 1XVMA 4A5TS 1PPZA 1YKTA 5TCAA 3ATMA 1S6HA 4YT6H 2PKAA 1SGCA 2HOBA 1SVPA 1Y8TA 4XOJA 2GCHF 1HXEH 1S6FA 2FX4A 2DE9A 2A4QA 2HVXA 3DD2H 4KELA 1C5TA 1GDQA 4D8NA 4DG4A 5JB8S 3ZZ8A 5IYTA 3RXGA 4U01A 1HAHH 3K2UA 2FOEA 3JZ2B 2J95A 3P8OA 1AVWA 2C8XB 4J2YB 1AU8A 1H8IH 1LKBA 2QYIA 1TGNA 2BQ7B 1RGQA 2GCTC 4FU8A 4A1XA 1QFKH 2GCHG 1YPEH 4D9QA 4Y7BA 3B9FH 1NO9H 2VIWA 3MNCA 1FXYA 2TPIZ 3Q77A 2P94A 2OBQA 3RXQA 3UWJH 1ZLRA 6GCHF 5EW1H 2Z9LA 2PR3A 1GWAA 1O2SA 1TMTH 5DO4H 4KTCA 2BVRH 1GDNA 1FQ3A 1D3DB 3ZVEA 2PKSB 2QXJA 4JMYA 4MPXA 5HMAA 1HAVB 5EXMA 1GBLA 4AG2A 1PQ8A 1BBRE 2ZF0H 3L6PA 1XVOA 4CHAB 3S69A 4OS7A 3RMOH 1CVWH 3RMNH 4FUGA 4BNRA 1C2KA 3A7TA 1D9IA 5F8XA 1DXWA 1ZGVA 2FI5E 6GCHG 2PUXB 2AS9A 1DUEA 3UWIA 1NY22 1ZR0A 2W7SA 2ODPA 1UK4A 1A46H 3RUOA 1GHYH 2ANMH 3ZVFA 2FOFA 6CHAC 1UO6A 1TIOA 5PTPA 3VB6A 1Y3YA 2GTBA 3T28A 2BZ6H 3TH4H 1BMLA 1EAXA 3EAJA 2THFB 3RDZA 1C5YB 4D7FA 3BEUA 1GJ7B 2ZTZA 3UUZA 2C93B 2ZTXA 1C5RA 2BMGB 1IQMA 2EI8A 1OS8A 1KXFA 1UK2A 5EW2H 2DUCA 3A7VA 1JIMA 2D1JA 3RU4T 5JBCS 2P3FH 1EJAA 2ZHFH 1NRNH 5EPNA 5AFZH 3PWCA 2XNIA 5C5NA 4ZMAH 1GGDC 3ZZAA 1GBEA 3UNSA 3F9GA 1UMAH 2BLOA 1ESBA 1AI8H 1BTUA 1WAYB 3ATWA 1RTLA 2GD4B 4GSOA 2XRCA 2VINA 1AMHA 1FY3A 4ZKRU 2F9VA 2B0FA 1P05A 4BXSA 4Q7YA 3SUGA 2VVUA 1GBKA 3FANA 1ZMJA 3TK6A 2BDGA 3NUMA 1J16A 1O2TA 4X2YA 8GCHG 2ALVA 1UVPA 3F9FA 1FN6A 2SGAA 2ZFSA 3RU4D 3OU0A 1TQ0B 2XBXA 2TGPZ 1QTFA 3QTVH 4YT7H 3SV8A 3BTHE 1BB0B 2W7UA 4Y11E 5T3HA 1GHXH 1P57B 1ORFA 3SJOA 3RC5A 1ELDE 2ZGBH 4U30A 5K0HA 2FS8A 3GY7A 3LT3A 3SQEE 3TK9A 3SV7A 4JZFH 2BDYA 4A1VA 1PYTD 3HKIB 1DY8A 1P9UA 2R3UA 1C1RA 4MTBA 4CRGA 4MPWA 3P95A 3BIVH 1TQ7B 2FPZA 4A7IB 1ZZZA 1FAXA 1TONA 1ESTA 1QIXB 3HKJB 5A8ZA 4AN7A 4DT7B 1W2KH 1BHXB 1AB9B 3SO3A 2XCNA 1FY8E 2VWLA 1VCQA 2XC4A 1AHTH 2A7HA 5A09A 1SQOA 2Q1JA 2WPKS 4I8JA 4CRAA 1FLEE 1M9UA 2CMYA 4MVNA 1DANH 5TJXA 1GI6A 2ZFFH 4AYYB 4UFDH 5ESTE 3GYLB 3RXPA 3U8OH 3RXUA 3BTWE 3ZZ9A 1UTPA 1C2IA 2PV9B 4YZUA 1G37A 1BT7A 3RXVA 3AW1A 1J17T 1O5GH 1V6DA 4DW2U 3Q76A 4FUIA 1K28D 2XBYA 1GI1A 1C5LH 2BLVA 4Y0YE 2SGFE 2Y5HA 1EB2A 4E06H 1Q31A 3E0PB 3F1SB 3RXEA 2EC9H 1UVOA 3MU5A 1UHBA 5FCRA 1ZMLA 4X8VH 5E0GA 4FUBA 1HJ9A 3ZVCA 1XM1A 3GY3A 3SU5A 2YOLA 5GWZA 1Y5BT 4GLYA 3HK6B 1XKAC 2B9LA 3M5MA 3P8FA 2OXSA 1DVAH 1RTKA 1GI0A 1WUNH 1YF4A 1TNGA 3SN8A 2GKVE 3VB4A 1O2HA 1IQHA 4MLFB 1QQ4A 3OY6U 4GHTA 1S83A 4INLA 2O8LA 1C2MA 3D23A 5C67A 2BLWA 3GCHC 1EXFA 3RXLA 1CA0C 1GJBB 3A84A 4DVAU 1S0RA 3TVJB 2A1DB 1C2GA 2VVCA 2GT8A 4B1TA 1HXFH 1KDQB 2EI7A 2HLCA 5BPEA 4B2BA 3QLPH 1ZJDA 1WOFA 2BDCA 5DPAA 1GHWH 1WV7H 5GCHF 2OCVB 2BD5A 4X6PA 2C90B 1EASA 3STJA 1ZSKA 2BY5X 3ZZ7A 1OKXA 2FI3E 1DLKB 1W0ZU 2G55A 1EUFA 3I78A 3HK3B 3RXKA 2HNTE 2ZFPH 4FUJA 1KLJH 2Z9JA 1E38B 3RXTA 3SU1A 6ESTA 3Q3XA 5A2MH 1C1UH 1ZPBA 4X2XA 1J8AA 3BTGE 1MU6B 1ELFA 2FZZA 4CRCA 1GI3A 3LJJA 1MCVA 2AYWA 2FTMA 1DXPA 2BXTH 2BDHA 1FY1A 1AUJA 2ANYA 4Y8XA 4ZXXH 1UVTH 1LHGH 3ZVAA 1NTPA 3DFJA 3DA9B 1Z1JA 5HYOA 1P12E 2IJOB 4ISNA 1ACBE 5DJ7A 1UTOA 4Y7AA 1OPHB 2BY7X 1IQKA 1ZMNA 1TA6A 3A87A 1BMMH 3E0NB 5CHAC 4MNYA 3IG6B 4YOIA 2OC1A 1AUTC 1MCTA 1OP0A 3A7WA 2BDIA 1QJ7B 3RXJA 3LGYA 1V2PT 3SI4H 1TPOA 1BITA 1ARBA 2KAIA 1TFXA 2ZEBA 2ZDNA 1GCTB 1FY5A 1GGDB 2AIQA 1NM6A 1EJNA 4A6LA 1O5AB 1D6WA 1QHRB 3GCNA 5HM2A 1P2MA 1VZQH 1ZTKA 2FOAA 1YM0A 3ODFA 3SGBE 3HPTB 1ARCA 3QZRA 4YLUA 3VXEH 1L4DA 4YESB 3VB7A 4ABFA 2TGTA 2V3OH 4I31A 1C5XB 1VJAU 1FPHH 1K1IA 1O2RA 2ZC9H 1TRNA 1T8NA 1LPZB 1ZYOA 1UTNA 3TJVA 4UE7H 3TK5A 3MI4A 3RXIA 3B8JA 1ELGA 8LPRA 1CA0B 1W11U 1GI4A 4NGAH 4H6SB 4IN1A 1C1SA 2V6NA 1HNEE 1SGFA 5T6DA 3H7TA 1O2MA 1FPCH 2UWLA 4R0IA 3UQVA 3GCHB 1RTFB 4FU7A 2ZHEH 1ZHPA 4BAOB 1OXGA 1XXFA 2ZGCA 1P03A 1TX8A 1O5BB 2ZTYA 2BYAX 2CV3A 1P2NA 3SOSA 1HJ8A 1VITH 1TMUH 2C8YB 3A7XA 3DFLA 1QCPA 2FYQA 2Y5FA 3KN2A 3I77A 2ZU5A 3E16B 5CHAB 1K9OE 1PYTC 3OSYA 3R3GB 3RXAA 4CREA 1YPGH 2UUYA 2ZU2A 1FUJA 2CHAB 5FX5A 1SGFG 1B0FA 5GDSH 1OSSA 2WV4A 1LPKB 1O2ZA 2HGTH 3EYDA 4FXGH 2FODA 2PKSC 3MO9A 1CHOF 2ZA5A 3T62A 1E36B 1P9SA 4HGCA 5HXFA 1MKWH 4UEHH 7ESTE 1G36A 1ETTH 1QR3E 3P8NA 5AHGH 1GI2A 1DWEH 1GI5A 3UQOA 5JDUB 3PMHB 1XUFA 1HAPH 2YNBA 1BTPA 2AGGX 1Z71A 2UUFB 3BG4C 1GJ8B 2BDBA 1XUJA 4H4FA 1SFIA 4MNWA 4WXIA 1KDQA 2ZDVH 5LPFA 1D6RA 3QGJA 3QN7A 5ETXA 1AQ7A 2AMQA 1LCYA 3RXOA 3ZYEA 4TPYA 1D4PB 3M7TA 5JBBS 5GCHG 2WPHS 3FP7E 1DLEA 5JYIA 1C2JA 2BVXH 1O2NA 1O3FA 3O8RA 1SGIB 1BDAA 3BEFB 1QNJA 1EZSC 1A1RA 1V2VT 2F9PA 3ATKA 3NZIA 1N1LA 1ZRKA 5FBIA 3U9AH 3K65B 1W0YH 5K7RA 1EX3A 2BD8A 2GVFA 3CP7A 2ZU3A 4JYTA 1O31A 1HAVA 3EQ0H 1O5FH 3LU9B 2OTVA 1EKBB 1TNIA 3Q3KA 3SU4A 4J1YA 1ANEA 1Y5AT 1P3CA 3TH3H 2WYJA 2FWWA 2WINI 3LGWA 1YCPH 4WMEA 5HM9A 5C1XA 7KMEH 4DCDA 4CRFA 4B76A 1K2I1 3L33A 5EQRA 3KIDU 2WPJS 3ZZ4A 2QXHA 1C1WH 2H9HA 5L2YH 2QXGA 1UCYH 1LVBA 1WTHD 2EA3A 1A5GH 1O3PB 4AB9A 2A4OA 4RKOB 1YLDA 1NFYA 2FOGA 1ELTA 5EXNA 1F0TA 4AFUA 5A0CA 1RXPA 2NWNA 2F3CE 3M61U 3QUMP 4NA9H 3ZVGA 3K6ZA 1DWDH 1NFWA 1OWEA 1ZTLA 1BA8B 3MO6A 5E2OA 3SJ8A 1ZPZA 4Z0KA 1EP5A 2R2MB 3BTQE 2ZKSA 3E6PH 3U8RH 1P01A 2HRVA 2Y7XA 2WUBA 3RXCA 1TBZH 2FS9A 2PW8H 1CT0E 1QB1A 4CBNA 1UCYK 3D62A 2ZDLA 3A82A 1TOMH 1KYNA 2ZP0H 3U98H 3OTJE 2GDDA 4AOQA 2Z3CA 1BJUA 2Z3DA 5C5OA 2ZCLP 2H9EH 1C1NA 5DP5A 1Y3WA 3UPEA 1MTUA 2QXIA 1VGCB 1XUHA 5EGMA 3TH2H 3RXSA 1ELVA 1O2PA 3UOPA 1AN1E 1MKXH 3F9HA 1Z6EA 4ABBA 2Y5GA 2J38A 1O3AA 3LC5A 4GCHG 1PFXC 1HDTH 4NWLA 1EJMA 5IDKA 4Y71A 3ZYDA 1QQUA 4WF8A 1YPMH 4GAWA 2HALA 3MNSA 1O2UA 1GJ6A 4JCNA 2CF9H 3PV4A 2UWOA 1E34B 4Y6DA 1GHBG 4GUXA 1S5SA 2Y7ZA 2ULLA 1SFQB 1T32A 1DDJA 2R2WU 1GCTC 3M5OA 3I29A 3UIRA 3VPKA 1QJ1B 4ZHMU 2ZDMA 2XTTB 2Z9KA 1GI9B 1CT2E 2VVVA 3V3MA 4K3JA 5JPMH 1QL8A 4JK6A 4O3UA 1P06A 5FXLA 1O36A 2ZU4A 2ZFRH 1FMGA 1SOZA 2OINA 1JBUH 1JWTA 1ZHMA 1DWCH 1GG6B 1HUTH 1TRYA 2D26C 3Q3YA 2FOBA 1T4VH 1O3IA 2VGCB 1WCZA 2FXRA 2SFAA 1IQLA 3UNRA 3LGIA 1VITG 1SGDE 4ABHA 7GCHG 1GMDG 2W5EA 5L2ZH 5DP3A 1OWKA 2TRMA 1THSH 3VB5A 3JZ1B 3SHAH 4BOHA 3GDSA 3IITA 1L0ZA 3KCGH 4K5ZA 4YLQH 3GCTG 3GDUA 3MMGA 2VIPA 4ABAA 2GZ9A 3GDVA 1QA7A 3RM0H 1GVKB 3MNBA 2ZHDA 4IMZA 4IN2A 4IW4E 1MBQA 1ZPCA 1MQ5A 1TPSA 2AEIH 1VCPA 2H1UA 1OP2A 1V2LT 1OP8A 1TYNA 1A5HA 3SJ9A 2OUAA 1L2EA 2P8OC 3NKKA 4DIHH 3KGPA 1NC6A 3EGKH 1TGCA 1Y3VA 4AX9H 2GZ7A 3A88A 1O3CA 1N6XA 2BM2A 1A0HB 1C2HA 3LJOA 2BD9A 6LPRA 1RD3B 1NRPH 3TGKE 3BTKE 4LZ4B 1IHSH 2VIOA 4FUEA 2W3KA 3SORA 1S0QA 3SUFA 1J9CH 4FVBA 5EG4A 1DSTA 1H1BA 3SNDA 1Z8GA 3RXDA 2B8OH 5DP6A 2VWOA 1GMHF 2D8WA 2BTCE 3D65E 3QTOH 3SHCH 3GICB 4ZKOU 4LOYH 4K8YA 4TY6A 1B0EA 3ATLA 2FOHA 1QGFA 1RJXB 3ZV8A 3W95A 1BRAA 4NIVA 2BX3A 1ID5H 5JBAS 3SJIA 4ZROA 1AIXH 1PPEE 1K1LA 4RN6A 4I8LA 2OP9A 1Y3XA 3GOVB 1E35B 4JZEH 2ESTE 1GHVH 2VWMA 2WUCA 2BX4A 1P2QA 3CS7A 1MD8A 1GHAG 1CGHA 3GY2A 5FPTA 3GY5A 5FPYA 3PO1B 1MTSA 2A2QH 1TGSZ 3MHWU 1V2OT 1LPGB 1O0DH 4U2WA 1Y59T 2PSYA 3U8TH 2WV5A 1ZSLA 4KKDA 1O3MA 4WVPE 1YPHC 1NN6A 4MDSA 2GZ8A 1FNIA 2VGCC 2CF8H 2Z9IA 3K6YA 4ISHH 1SMFE 2TIOA 2ALPA 3PLKA 1V2WT 4KGAA 4X0WU 3URDA 4I32A 1GJ4H 1KLIH 2RCEA 1IQGA 2ZWLH 1O2WA 4X8TH 4GCHF 1Z8IB 1P02A 2FI4E 2ZPQA 1GG6C 9LPRA 1AVGH 4JYVH 2GCTB 1AB9C 5EODA 2R3YA 5GIBA 3BSQA 3GY8A 1ZTJA 1PPBH 1W13U 2ILNA 3AW0A 2ZZUH 2A5KA 1F0RA 2A7JA 1CGIE 1O2IA 8GCHF 3LGUA 2PUQH 1TX7A 2XC5A 1O2QA 5E0HA 1B5GH 1NESE 1SHYA 2NU4E 2Q6FA 1G3DA 4THNH 2JH0D 2OC7A 2A5IA 2IPHA 1SLXB 4OGYA 1TNKA 3PO1C 5BRRE 1A7SA 1OWIA 1VJ9U 2ANKH 3F68H 4JZIA 3OX7U 1O30A 1GJDB 3STIA 1IHTH 1W7XH 4K2YA 1VCWA 1WQVH 2NU0E 3LIWA 1HAZB 2ZECA 3V7TA 3HGPA 5LPEA 1MU8B 7GCHF 1GMDF 1YCPK 3KQBA 3EE0B 1YP9A 1YPJH 4ABJA 1BBRK 1GI8B 1SSXA 3MTYA 2CHAC 2GX4A 1S84A 3MNXA 3DUXH 1O3BA 3S9CA 3GCTF 3O8CA 3GYMA 1BRBE 4IBLH 1H9LB 2VU8E 3PMAB 1BTXA 4YO9A 1AFEH 3QO6A 1UCYE 3LOXA 3RLWH 4WMFA 2WPIS 1E0FD 4B74A 1MBMA 1GJ9B 2ZIQH 3NK8A 1KTSB 1BTWA 1GBDA 3TJNA 3A89A 3KEEA 3TGIE 4NIXA 3S9BA 4TPIZ 3IWMA 1W8BH 2W3IA 1BIOA 4I8KA 1HPGA 1GMCG 1FAKH 4M7GA 4FU9A 5JB9S 4ZKSU 1C5VA 1O2YA 5AFYH 2RDLA 1BHXF 2UWPA 2XBVA 5C1UA 3VGCC 1TE0A 3BG8A 5DP4A 1AVXA 4ZKNU 4XE4A 1IAUA 1O32A 3P6ZB 2B7DH 5GJ4B 1D3PB 1O3OA 3A86A 4Q2KA 1K1OA 1FI8A 1HV7A 2ZCKP 5A8XA 2P16A 1VGCC 2Y80A 1TA2A 2AGEX 1NRSH 2GMTC 3OYPA 1C1QA 3BTTE 3FFGA 2ASUB 5AF9H 1MTWA 2QF0A 4BTTB 3BEIB 1GBHA 3U1IB 3KQEA 4UD9H 2BXUH 2WPLS 3ZZBA 1ZRBA 1W7GH 2DE8A 1PQAA 2ZCHP 2F91A 5J4SA 3H5CB 2BY6X 3BN9A 1WBGB 1O5CB 4K1TA 2STBE 1SI5H 4GVUA 3UOUA 1K1JA 3HATH 3N7OA 5FHTA 4B2CA 3PB1E 4BAKB 1FIZA 4LZ1H 3ZVBA 1SQTA 3EA9A 4XBDA 5C3NA 3ODDA 1C2LA 3VFEA 1V2ST 1UTKA 5G4BA 1O2VA 1GBAA 3UR6A 5JBTA 3FZDA 4FUHA 1A61H 4NG9H 1AE8H 3ESTA 3LGTA 1GPZA 3M35A 1UTJA 1IQNA 2J4IA 2AIPA 4IMQA 2SGDE 2BD7A 2Q6DA 3W94A 4CH2B 1PPGE 1CE5A 1IQEA 2A4GA 3PWBA 4AYVB 2PTNA 3LGVA 3SJKA 1K21H 2G8TA 4X6MA 3SUEA 1C5WB 4X1NU 3P8GA 1RRKA 4RKJB 1P3EA 4ZUHA 2QY0B 1MUEB 4XSKU 3URCA 2GV7A 1OX1A 1QL9A 3RC4A 1KY9A 3NXPA 2Q6GA 1SR5C 3C27B 4X1SU 1IQIA 2GT7A 1C1VH 1LVOA 3PTBA 8ESTE 1KXDA 5DK1A 2F9BH 1O34A 2BB4A 3A8CA 3PM3A 1Z8JB 1YGCH 3LKWA 1A0JA 1DICA 1P2KA 2VWNA 4K1EA 4BXWA 2J34A 1C5UA 3A80A 1XUKA 1UHBB 1C5NH 1XUIA 4TWWA 2H2ZA 2ZDAH 2STAE 2JH6D 1HLTH 1PPFE 2VH6A 3LONA 1C5SA 1KXEA 2TBSA 2ZGXH 1FY4A 3TLOA 1W3CA 1GJAB 2P93A 3P92A 1C1MA 2ZGJA 1A0LA 1A3BH 1SC8U 1GL0E 2SGPE 1V2UT 2HPQH 1ZHRA 2SNVA 2ZQ2A 4I33A 2QF3A 1HAIH 1MAYA 1MKXK 3RC6A 3SNAA 4A1TA 1TNLA 4YOJA 1BMNH 1ANDA 1P10A 4YOGA 3PTNA 2BOHB 4HTCH 1TX6A 1AFQC 3FAOA 3V12A 4NZLA 2H5CA 1XMNB 2C3SA 3A7YA 1HRTH 4JZ1A 3M5LA 1C2DA 3G01A 2O8UA 2A7CA 2LPRA 4LXBH 2RG3A 1U6QA 4Y8ZA 4AFSA 2AERH 1P8VC 2CXVA 1FV9A 1CSOE 4NIYA 1A5IA 1C2FA 2V35A 4Q80A 1O2KA 3PMJA 3RMLH 5EXLA 2QA9E 3SQHE 4CR5A 1SB1H 1E37B 4XBCA 1FN8A 1G30B 1GMCF 3U1JB 4YTAA 1C1TA 1K22H 1SLVB 3NCLA 3R0FA 1C1PA 5FCKA 5I46H 3SV2H 3TJOA 1A4WH 2FOMB 3TITA 4O3TA 1C9PA 3EDXB 2FYRA 1L1JA 1DX5M 2YNAA 1G3CA 3QZQA 1OOKB 3TU7H 3C1KA 1CBWC 3OY5U 1UTMA 3SNCA 5L6NH 3RXFA 2ZDKA 2O9QA 1AZZA 1GCDA 1GBCA 1PPHE 1O3LA 1JRTA 3RU4E 5F8TA 1O2XA 2FX6A 2VIVA 3ZZCA 2Y6TA 2A32A 2CN0H 4NSVA 4UDWH 3WY8A 1CHOG 4NA8A 1CO7E 1MD7A 1QA0A 2Y81A 1DWBH 4D7GA 4O03A 5CMXH 1MTNB 1F2SE 1BRUP 4UFFH 5LH8A 4NWKA 1O3GA 2A5AA 4OS4A 2ZFQH 3T25A 1TMBH 1WSSH 1D3TB 2R9PA 3A85A 5J4QA 3M5NA 2JKHA 1YPKH 1HBTH 3AASA 3MFJA 3ZZ3A 1BZXE 3ITIA 3GY4A 3FP6E 1AWFH 5GPIB 2NU2E 1HGTH 2J9NA 2ZO3H 3BV9B 1CGJE 2XWBI 4DY7B 1C4V2 4NIWA 3TNTA 1LHFH 2IOTA 2ANWA 1QRWA 5FAHA 5DKMA 3A8DA 3LH1A 1O3HA 2A2XH 1UVUH 1SGQE 3D49H 1LDTT 2BLQA 1LVMA 2C8ZB 1W10U 1WU1A 2BZAA 2C4FH 4NZQA 1OWJA 4MNVA 1QBVH 1QL7A 3MH5A 4ISOA 1JOUB 2BQ6B 1FDPA 4HI3A 3V13A 4IGDA 4Y8YA 3AAVA 4WH6A 4CHAC 1O38A 9ESTA 1GVLA 2FOCA 2BY8X 4U32A 2FTLE 1Z8RA 1P09A 2C8WB 4B75A 3EA8A 4DIIH 1DSUA 1H9IE 1OWDA 2P3UB 3T29A 3MU8A 4VGCC 5SGAE 1P2IA 3PROA 3M3VA 1SBWA 1AY6H 1H9HE 1EZXC 5DP8A 1UK3A 1RIWB 1TBQH 1LO6A 1CA8B 4ZH8A 3PLPA 1YYY1 8KME2 1ZSJA 1ESAA 1FIWA 1BMAA 5F8ZA 1HJAB 4X8SH 1OYQA 4WH8A 1YLCA 1K1NA 1YPHE 2PFEA 3KNXA 2ODYB 1V2MT 1AKSB 3F6UH 1V2QT 1PQ5A 1RS0A 2FLRH 1EAWA 2XCFA 1W14U 3M7UA 4SGBE 1PPCE 4TY7A 4Y10E 5DP7A 4B2AA 1BTYA 4E05H 3CENA 1F0SA 2Z94A 1GBBA 4ZHAA 4RSPA 2P3TB 3L3TA 4NCYA 1TLDA 3RXHA 1C5ZB 1IQFA 1O3KA 2GDEH 1QURH 3E91A 5EU8A 4JYUH 1NROH 1A3EH 2PGQB 1H8DH 2FO9A 4OS2A 5ESBA 3M3TA 4TWYA 1F0UA 2BVSH 4X2VA 1SGEE 1XUGA 3E1XB 3LH3A 1LHCH 1HFDA 1G32B 1XX9A 1KTTB 4I8GA 3MU1A 4UONA 2VIQA 4Q7ZA 3MU4A 1F92A 1GBFA 1ZGIA 3KF2A 4DURA 1Q3XA 1MZAA 4FVDA 2QCYA 1Z6JH 3A7ZA 4X1QU 2G00A 1O39A 4MPVA 1IOEA 1O2OA 2B5TB 4JK5A 4KTUA 4D9RA 3RXMA 3AVZA 1GHZA 5CE1A 1TWXB 1V2KT 2PTCE 3A8BA 3SU6A 3UNQA 4Y79A 1TABE 1TGBA 4OS6A 2OC8A 2R0LA 3V0XA 3QDZB 4YM9A 1EAUA 2HWLB 1PJPA 3RXBA 1V3XA 1HYLA 1G3BA 4R8TB 1JXPA 2FM2A 4AGKA 3SNEA 4ABGA 2ZU1A 3ZVDA 1EZQA 3BTFE 1V2NT 2BY9X 4AGJA 1TPAE 1DFPA 1TGTA 1F7ZA 4ISLA 5EOKA 2Z6BD 3BG4B 3GY6A 3ZZ6A 3MH6A 2GMTB 1MZDA 1EZUC 1C2EA 1Y5UT 2UUJB 2F9UA 5A8YA 1K1MA 1ZOMA 3UR9A 3M37A 1THPB 1GI7B 1C9TA 1O2GH 4PROA 1QY6A 2VNTA 1ABJH 4K60A 2EI6A 2NU1E 1HJAC 1FZZA 3QWCH 1TPPA 3AAUA 1SGPE 4A92A 4X1PU 1V2TT 4AB8A 1EAIA 3SI3H 5A0AE 1ZJKA 3QK1A 1JMOH 1AFQB 2O8MA 1QB6A 1QBNA 2VB0A 4X6OA 4SGAE 3T26A 2Y82A 1YBWA 5EQSA 5B6OA 7LPRA 1MH0A 1TOCB 2A31A 4ABDA 4ABIA 2SNWA 2Z3EA 1GVZA 4E7RG 1YCPM 3QGNB 3E3TA 5HGGA 1IQJA 1DT2A 3A81A 1T4UH 1YPLH 3RMMH 1XKBC 1NZQH 3E90B 4AFZA 3PLBA 1ETSH 2JETB 1TB6H 1A2CH 4E7NA 1DPOA 4XBBA 3PYHA 2OQUA 1S81A 4LK4A 3PMBB 6CHAB 2FP7B 4IS5A 1Y3UA 2QGRA 4X8UH 2G5NA 5LPRA 1XXDA 4WWYA 4IC5A 1C5OH 2QN5T 2RA3A 4BAQB 3KQDA 4DOQA 2V0BA 3VXFH 2P95A 4KP0A 3TIUA 2JETC 2R0KA 2VIDA 2ZG0H 3S9AA 1O5EH 1OYTH 1J15A 4CBOA 1HIAB 1LMWB 3UY9A 1F5LA 1EPTC 2J92A 1HAOH 2XW9A 3MH4A 1HCGA 4INKA 4HFPB 4ASHA 1O35A 2M5TA 3MWIU 1SHHB 5FX6A 4D76A 2O8TA 1NU7B 3T5FH 1ANBA 1NPMA 2HNTF 3SU0A 4DJZB 3ENSB 1BQYA 2XBWA 1H4WA 1LKAA 3ZV9A 2A4RA 1O2LA 1S82A 4HZHA 2G4UA 1GBTA 3VB3A 1GBJA 1KXCA 2JH5D 2OBOA 3T2NA 1EPTB 4FUFA 2QC2A 2ZFTA 3O8DA 1ANCA 1GL1A 1LHDH 1DM4B 1N6YA 5E8EH 3S7HB 2TGDA 2J2UA 4Y0ZE 4CR9A 1UTLM 1V2JT 3A8AA 4OGXA 2GP9B 2K1QA 3KL6A 1L1NA 3FP8E 1TNHA 1MTNC 3BTEE 2P8OB 4K8BA 4QT8C 1SLUB 5E2PA 2AFQB 1ABIH 5LGOA 3LC3A 4JZDH 1C4U2 1QJ6B 1GHAF 1UTQA 2QIQA 4Y76A 3SBKA 1BTZA 1PQ7A 3HGNA 1JRSA 2PSXA 2O8WA 2CGAA 4AFQA 1CQQA 2QAAA 4I7YH 3UFAA 3RM2H 2BDAA 2LNCA 2XWAA 4I8HA 3ELAH 2G51A 3T27A 4MQAA 4ABEA 3BTME 2FESH 1G9IE 1O3EA 1CU1A 3FVFB 1T8MA 1Z1IA 1MAXA 1THRH 3TPIZ 4NSYA 5T6GA 5FPSA 1HIAA 1DE7H 1QB9A 1O33A 4KTSA 1O5DH 4ZHLU 3SW2B 1BTHH 1AD8H 1HAYB 5I25A 5AVDA 3CS0A 4DGJA 1Z7KA 2VJ1A 4MG3A 4WXVA 2AMDA 2HNTC 5C1YA 5ABWA 4UFGH 4MNXA 1O3NA 1EPTA 2D2DA 3DT0H 1N8OC 1B7XB 2GV6A 2ODQA 4H6TA 3M36A 3SV6A 4XFQA 3S7KB 1NRQH 2FDAA 4VGCB 1D3QB 4FUDA 3SUDA 1L4ZA 2XYAA 1GHBF 1SLWB 1BBRH 1Q2WA 1RIWC 3P70B 4NFFA 2FLBH 3FZZA 4X6NA 1GBMA 1N8OB 1AO5A 2ZQ1A 2WPMS
chains in the Genus database with same CATH superfamily
2Z7FE 3TNSA 1MKWK 4OS5A 5DG6A 2K0QA 4Q63A 1T8LA 5GXPA 1TBRH 3TJUA 1ELBA 1O3JA 2I6QA 1QRZA 4X2WA 3MYWA 1AE5A 2PHBA 3LPRA 3VEQB 4CRBA 1L1GA 1OWHA 4X1RU 3NWUA 2BD4A 5A0BA 4K69A 2BD3A 2BOKA 1DY9A 4F49A 3QX5H 4NFEA 1HAGE 1K0HA 1FJSA 3GISB 1KXBA 1SG8B 1C5PA 1VITF 1LHEH 1P0SH 5DGJA 2AH4X 5E0JA 1MQ6A 1LTOA 1WQSA 2I6SA 2XXLA 3P17H 1KXAA 2ZI2H 2H9TH 3O8BA 5CDFE 1UVSH 2AGIX 2EEKA 3MU0A 3E8LA 2G4TA 1ELAA 3BF6H 2ZNKH 3M7QA 3B23B 2HPPH 1SOTA 1LQDB 2GGVB 2W26A 1TNJA 2CJIA 1MMJN 4NA7A 1GBIA 2PWXA 1AGJA 1NFUA 4WY3A 1C5QA 4ZXYH 4WJG2 1QRXA 4ZAEA 1O2JA 2ZHWH 4BAHB 4RI0A 1FONA 2XC0A 1WYKA 2WPDD 1P04A 4OS1A 5EQQA 3SNBA 1SL3A 2PLXA 1SGYE 2VH0A 1F5RA 2SGQE 3F9EA 2ZPSA 3RLYH 4WMDA 1HAXB 1GJ5H 2PKAB 1P2JA 3UREA 5DP9A 3RXRA 3A83A 1ELEE 2ZGHA 1AZ8A 3FN8A 3MH7A 2ZHQH 1TALA 1C4Y2 4UFEH 1TRMA 1SQAA 1EOLA 3KHVA 2BD2A 2OLGA 1RFNA 2SGEE 1MTVA 2JJ2D 3Q00A 1P2OA 2G81E 3H7OA 1G3EA 3TGJE 1DUAA 1NRRH 2H6MA 4TYDA 2H5DA 3U69H 1CBWB 4IC6A 1ETRH 2F9NA 1X7AC 3LDXH 1LVYA 2OC0A 4XDEA 4BANB 1GMHG 1V2RT 2BQWB 3ATIA 1YC0A 1AKSA 2G52A 1KLTA 2V3HH 1T7CA 1JIRA 1C1OA 1SGNE 3RP2A 5T6FA 3GCOA 1G2MA 3SV9A 5EPYA 2UUKB 5L30H 1EP6A 4AG1A 4K1SA 4INHA 5C20A 3KQCA 1NU9A 1DITH 3K9XB 4O97A 1EQ9A 3SZNA 1K1PA 1INCA 1CT4E 1NT1A 3ZZDA 5TCCA 4MPUA 1TAWA 5F6MA 1NFXA 2FIRH 1QBOA 2Z9GA 3DHKH 4BTIB 1AWHB 1SPJA 3VGCB 2FMJA 2F9OA 4B71A 3MO3A 5H4IB 4BAMB 1T31A 4ESTE 4GHQA 2J94A 3SGQE 1F5KU 1KSNA 3SU2A 1DOJA 4O9VA 1BUIA 1C5MD 1NS3A 2OK5A 1WTGH 4Z6AH 1EATA 1SGRE 1BRCE 1P11E 4F4OC 1VR1H 2KAIB 1BCUH 4CH8B 3PV2A 1S85A 5FBEA 1EOJA 4ISIH 1BJVA 2F83A 1O3DA 2TGAA 4AORA 2A45B 1DS2E 4BTUB 2WYGA 1HB0B 2QV1A 5KEDA 3UTUH 2IN2A 2NU3E 5C2ZA 1EB1H 3M3SA 1UJ1A 1CHGA 4CRDA 2P59A 2OD3B 1O37A 2YMSB 4B6FA 1WDIA 3SU3A 1KIGH 3F2HA 3BTDE 1J14A 2BHGA 4Q7XA 2M2AA 1SGTA 2G5VA 4FUCA 2OQ5A 3EA7A 1BOQA 3NPSA 1T8OA 3BIUH 1ELCA 3SGAE 4H42U 4GPGA 2ZPRA 2FEQH 2RA0A 1G2LA 4AZ2B 2AMPA 4B73A 5F03A 3S0NA 1GDUA 4XD7D 3ZZ5A 2A0QB 1GJCB 1LQEA 3MOCA 2PGBB 1W12U 1XVMA 4A5TS 1PPZA 1E1QD 1YKTA 5TCAA 3ATMA 1S6HA 4YT6H 2PKAA 1SGCA 2HOBA 1SVPA 1Y8TA 4XOJA 2KFWA 2GCHF 1HXEH 1S6FA 2FX4A 2DE9A 2A4QA 2W6JD 2HVXA 3DD2H 4KELA 1C5TA 1GDQA 4D8NA 4DG4A 2L74A 5JB8S 3ZZ8A 5IYTA 3RXGA 4U01A 2XNDD 1HAHH 3K2UA 2FOEA 3JZ2B 2J95A 3P8OA 1AVWA 1SQRA 2C8XB 4J2YB 1AU8A 1H8IH 1LKBA 2QYIA 1TGNA 2BQ7B 1RGQA 2GCTC 4FU8A 4A1XA 1QFKH 2GCHG 1YPEH 4D9QA 4Y7BA 3B9FH 1NO9H 2VIWA 3MNCA 1FXYA 2L6OA 2TPIZ 3Q77A 2P94A 2OBQA 3RXQA 3UWJH 1ZLRA 6GCHF 5EW1H 2Z9LA 2PR3A 1GWAA 1O2SA 1TMTH 5DO4H 4KTCA 2BVRH 1GDNA 1FQ3A 1D3DB 2KCAA 4RT1A 3ZVEA 4ACBA 2PKSB 2QXJA 4JMYA 4MPXA 5HMAA 1HAVB 5EXMA 1GBLA 4AG2A 1PQ8A 1BBRE 2ZF0H 3L6PA 1XVOA 4CHAB 2WZQA 4OS7A 3S69A 3RMOH 1CVWH 3RMNH 4FUGA 3F3BA 4BNRA 1C2KA 3A7TA 1D9IA 5F8XA 1DXWA 1ZGVA 2FI5E 6GCHG 4ZCNA 2PUXB 2AS9A 1DUEA 3UWIA 1NY22 1ZR0A 4B6EA 2W7SA 2ODPA 1UK4A 1A46H 3RUOA 1GHYH 3OFND 2ANMH 3ZVFA 2FOFA 6CHAC 1UO6A 1TIOA 5PTPA 3VB6A 1Y3YA 2GTBA 3T28A 2BZ6H 3TH4H 1BMLA 2V7QD 1EAXA 3EAJA 2THFB 3RDZA 5HIYA 1C5YB 4D7FA 3BEUA 1GJ7B 2ZTZA 3PRBA 3UUZA 2C93B 2ZTXA 1C5RA 2BMGB 1IQMA 2EI8A 1OS8A 1KXFA 1UK2A 3DSGA 5EW2H 2DUCA 3A7VA 3FO8D 1JIMA 2D1JA 3RU4T 5JBCS 3NRLA 2P3FH 1EJAA 2ZHFH 1NRNH 5EPNA 5AFZH 3PWCA 2XNIA 5C5NA 4ZMAH 1GGDC 3ZZAA 1GBEA 3UNSA 3F9GA 1UMAH 2BLOA 1ESBA 1AI8H 1BTUA 1WAYB 3ATWA 1RTLA 2GD4B 4GSOA 2XRCA 2VINA 1AMHA 1FY3A 4ZKRU 2F9VA 2B0FA 1P05A 4BXSA 4Q7YA 3SUGA 2VVUA 1GBKA 3FANA 1ZMJA 3TK6A 2BDGA 3NUMA 1J16A 1O2TA 4X2YA 8GCHG 2ALVA 1UVPA 3F9FA 1FN6A 2SGAA 2ZFSA 3RU4D 3OU0A 1TQ0B 2TGPZ 1QTFA 2XBXA 3QTVH 4YT7H 3SV8A 3BTHE 4FOUC 1BB0B 2W7UA 4Y11E 5T3HA 2IPQX 1GHXH 1P57B 1ORFA 3SJOA 3RC5A 1ELDE 2ZGBH 4U30A 5K0HA 2FS8A 3GY7A 3LT3A 3SQEE 3TK9A 3SV7A 4JZFH 2BDYA 4A1VA 1PYTD 3HKIB 1DY8A 1P9UA 2R3UA 1C1RA 4MTBA 4CRGA 2EQNA 4MPWA 3P95A 3BIVH 1TQ7B 2FPZA 4A7IB 1ZZZA 2EY4C 1FAXA 1TONA 1ESTA 1QIXB 3HKJB 5A8ZA 4AN7A 4DT7B 1W2KH 1BHXB 1AB9B 3SO3A 2XCNA 1FY8E 1H8HD 1VCQA 2VWLA 2XC4A 1AHTH 2A7HA 3ZIAD 5A09A 1SQOA 2Q1JA 2WPKS 4I8JA 4CRAA 4I86A 1FLEE 1M9UA 2CMYA 3OEED 4MVNA 1DANH 5TJXA 1GI6A 2ZFFH 4AYYB 4UFDH 5ESTE 3GYLB 3RXPA 3U8OH 3RXUA 3BTWE 3ZZ9A 1UTPA 1C2IA 2PV9B 4YZUA 1G37A 1BT7A 3SZEA 3RXVA 3AW1A 1J17T 1O5GH 1V6DA 4DW2U 3Q76A 4FUIA 1K28D 1GI1A 1C5LH 2BLVA 2XBYA 4Y0YE 2SGFE 2Y5HA 1EB2A 4E06H 1Q31A 3E0PB 3F1SB 3RXEA 2EC9H 1UVOA 3MU5A 1UHBA 5FCRA 1ZMLA 4X8VH 5E0GA 4FUBA 1HJ9A 3ZVCA 4AC9A 1XM1A 3GY3A 3SU5A 2YOLA 5GWZA 1Y5BT 4GLYA 3HK6B 1XKAC 2B9LA 3M5MA 3P8FA 2OXSA 1DVAH 1RTKA 1GI0A 1WUNH 1YF4A 1TNGA 3SN8A 2GKVE 3VB4A 1O2HA 1IQHA 4MLFB 4P02A 1QQ4A 3OY6U 4GHTA 1S83A 4INLA 2O8LA 1BMFD 1C2MA 3D23A 5C67A 2BLWA 3GCHC 1EXFA 3RXLA 1CA0C 1GJBB 2GJGA 3A84A 4DVAU 1S0RA 3TVJB 3PRDA 2A1DB 1C2GA 5C94A 2VVCA 2GT8A 4B1TA 1HXFH 2V3MA 3GS9A 1KDQB 2EI7A 2HLCA 5BPEA 4B2BA 3QLPH 1ZJDA 3H09A 1WOFA 2BDCA 5DPAA 1GHWH 5EJLA 1WV7H 5GCHF 2OCVB 2BD5A 1YWUA 4X6PA 2C90B 1EASA 3STJA 1ZSKA 2BY5X 3ZZ7A 1OKXA 2WHXA 2FI3E 2KM0A 1DLKB 1W0ZU 2G55A 4DT4A 1EUFA 3I78A 3HK3B 3RXKA 2HNTE 2ZFPH 4FUJA 1KLJH 2Z9JA 1E38B 3RXTA 3SU1A 6ESTA 3Q3XA 5A2MH 5CHBA 1C1UH 1ZPBA 4X2XA 1J8AA 3BTGE 1MU6B 2AHME 1ELFA 2FZZA 4CRCA 1GI3A 3LJJA 1MCVA 2AYWA 2FTMA 1DXPA 2BXTH 2BDHA 1FY1A 1AUJA 3KQ5A 2ANYA 4Y8XA 4ZXXH 1UVTH 3MQKC 1LHGH 3ZVAA 4XRNA 1NTPA 2J97A 3N99A 3DFJA 3DA9B 1Z1JA 5HYOA 1P12E 2IJOB 4ISNA 1ACBE 5DJ7A 1UTOA 4Y7AA 1OPHB 2BY7X 1IQKA 2VBCA 1ZMNA 1TA6A 3A87A 1BMMH 3E0NB 5CHAC 4MNYA 3PV5A 3IG6B 4YOIA 2OC1A 1AUTC 1MCTA 1OP0A 3A7WA 2BDIA 1QJ7B 3RXJA 3LGYA 1V2PT 3SI4H 1TPOA 3N7EA 1BITA 1ARBA 2KAIA 1TFXA 2ZEBA 2QF5A 2ZDNA 1GCTB 1FY5A 1GGDB 2AIQA 1NM6A 1EJNA 4A6LA 1O5AB 1D6WA 1QHRB 3GCNA 5HM2A 1P2MA 1VZQH 1ZTKA 2FOAA 1YM0A 3ODFA 3SGBE 3HPTB 1ARCA 3QZRA 4YLUA 3VXEH 1L4DA 4YESB 3VB7A 4ABFA 2TGTA 2V3OH 4I31A 1C5XB 1VJAU 1FPHH 5F53A 1K1IA 1O2RA 1MABB 2ZC9H 1TRNA 2KCYA 1T8NA 1LPZB 2LELA 1ZYOA 1UTNA 3TJVA 4UE7H 3TK5A 3MI4A 3RXIA 3B8JA 1ELGA 8LPRA 1CA0B 1W11U 1GI4A 3W1EA 4NGAH 4H6SB 4IN1A 1C1SA 5KECA 2V6NA 1HNEE 1SGFA 5T6DA 3H7TA 1O2MA 1FPCH 2UWLA 4R0IA 3UAIC 3OE7D 3UQVA 3GCHB 1RTFB 4FU7A 2ZHEH 1ZHPA 4BAOB 1OXGA 1XXFA 2ZGCA 1P03A 1TX8A 1O5BB 2ZTYA 2BYAX 2CV3A 1P2NA 3SOSA 1HJ8A 1KMHB 1VITH 1TMUH 2C8YB 3A7XA 3DFLA 1QCPA 2FYQA 2Y5FA 3KN2A 3I77A 2ZU5A 3E16B 5CHAB 1K9OE 1PYTC 3OSYA 3R3GB 3RXAA 4CREA 1YPGH 2UUYA 2ZU2A 5C0UA 1FUJA 2CHAB 5FX5A 1SGFG 1B0FA 5GDSH 1OSSA 2WV4A 1LPKB 1O2ZA 2HGTH 3EYDA 4FXGH 2FODA 2PKSC 3MO9A 1CHOF 2ZA5A 3T62A 1E36B 2IJD1 1FX0B 1P9SA 5IK2D 4HGCA 5HXFA 1MKWH 4UEHH 7ESTE 1G36A 1NBME 1ETTH 1QR3E 3P8NA 5AHGH 1GI2A 1DWEH 1GI5A 3UQOA 5JDUB 3PMHB 1XUFA 1HAPH 2YNBA 1BTPA 2AGGX 1Z71A 2UUFB 3BG4C 1GJ8B 2BDBA 1XUJA 4H4FA 1SFIA 4MNWA 4WXIA 1KDQA 2ZDVH 5LPFA 5C0TA 1D6RA 3QGJA 3QN7A 5ETXA 1AQ7A 2AMQA 1LCYA 3RXOA 3ZYEA 4TPYA 1UW7A 1D4PB 3M7TA 5JBBS 5GCHG 3WWFA 2WPHS 1NBMD 3FP7E 1DLEA 5EJZA 5JYIA 1WXRA 1C2JA 2BVXH 1O2NA 1O3FA 3O8RA 1SGIB 1BDAA 3BEFB 1QNJA 1EZSC 1A1RA 1V2VT 2F9PA 3ATKA 3NZIA 1N1LA 1ZRKA 5FBIA 3U9AH 2PP6A 3K65B 1W0YH 5K7RA 1EX3A 2BD8A 2GVFA 3CP7A 2ZU3A 4JYTA 1O31A 1HAVA 3EQ0H 1O5FH 3LU9B 2OTVA 1EKBB 1TNIA 3Q3KA 3SU4A 4J1YA 1ANEA 1Y5AT 1P3CA 3F2GA 3TH3H 2WYJA 2FWWA 2WINI 3LGWA 1YCPH 4WMEA 5HM9A 5C1XA 7KMEH 4DCDA 4CRFA 4B76A 1K2I1 3L33A 2QE7D 5EQRA 3KIDU 2WPJS 3ZZ4A 3CNRA 2QXHA 1C1WH 2WSSD 2H9HA 5L2YH 2QXGA 1UCYH 1LVBA 1WTHD 2EA3A 1A5GH 1O3PB 4AB9A 2A4OA 4RKOB 1YLDA 1NFYA 3F0PA 1OHHD 2FOGA 1ELTA 5EXNA 1F0TA 4AFUA 5A0CA 1RXPA 2NWNA 2F3CE 3M61U 3QUMP 4NA9H 3ZVGA 3K6ZA 1DWDH 1NFWA 1OWEA 1ZTLA 5DSFA 1BA8B 3MO6A 5E2OA 3SJ8A 1ZPZA 4Z0KA 1EP5A 2R2MB 3BTQE 2ZKSA 4F55A 3E6PH 3U8RH 5DN6D 1P01A 2HRVA 2Y7XA 2WUBA 3RXCA 1TBZH 2FS9A 2PW8H 1CT0E 1QB1A 4CBNA 1UCYK 5KGOA 3D62A 2ZDLA 3A82A 1TOMH 1KYNA 2ZP0H 3U98H 3OTJE 2GDDA 4AOQA 2Z3CA 1BJUA 2Z3DA 5C5OA 2ZCLP 2H9EH 1C1NA 2W6ID 1Y3WA 5DP5A 3UPEA 1MTUA 2QXIA 1VGCB 1XUHA 5EGMA 3TH2H 3RXSA 1ELVA 1O2PA 3UOPA 1AN1E 1MKXH 3F9HA 1Z6EA 4ABBA 2Y5GA 2J38A 1O3AA 1E79D 3LC5A 3N7DA 4GCHG 1PFXC 1HDTH 4NWLA 1EJMA 5IDKA 4Y71A 3ZYDA 1QQUA 4WF8A 1YPMH 3KYGA 2HALA 4GAWA 3MNSA 1O2UA 1GJ6A 4JCNA 2CF9H 3PV4A 2UWOA 1E34B 4Y6DA 1GHBG 4GUXA 1S5SA 2Y7ZA 2ULLA 4Q4LA 1SFQB 1T32A 1DDJA 2R2WU 1GCTC 3F2FA 3M5OA 3I29A 3UIRA 3VPKA 1QJ1B 4ZHMU 2ZDMA 2XTTB 2Z9KA 1GI9B 1CT2E 2VVVA 3V3MA 4K3JA 5JPMH 1QL8A 4JK6A 4O3UA 1P06A 5FXLA 1O36A 2ZU4A 2ZFRH 1FMGA 1SOZA 2OINA 1JBUH 1JWTA 1ZHMA 1W0JD 1DWCH 1GG6B 1HUTH 1TRYA 2D26C 3Q3YA 2FOBA 1T4VH 1O3IA 2VGCB 1WCZA 2FXRA 2SFAA 1IQLA 3UNRA 3LGIA 1VITG 1SGDE 4ABHA 7GCHG 1GMDG 2W5EA 5L2ZH 5DP3A 1OWKA 2TRMA 1THSH 3VB5A 3JZ1B 3SHAH 4BOHA 3GDSA 3IITA 1L0ZA 3KCGH 4K5ZA 4YLQH 3GCTG 3FKSD 3GDUA 3MMGA 2VIPA 4ABAA 2KCPA 2GZ9A 3GDVA 1QA7A 3RM0H 2KX4A 1GVKB 2KZ4A 2ZHDA 3MNBA 4IN2A 4IMZA 4IW4E 1MBQA 1SKYE 1ZPCA 1MQ5A 1TPSA 2AEIH 1VCPA 2H1UA 1OP2A 1V2LT 1OP8A 1TYNA 1A5HA 3SJ9A 2OUAA 1L2EA 2P8OC 3NKKA 4DIHH 3KGPA 1NC6A 3EGKH 1TGCA 1Y3VA 4AX9H 2GZ7A 3A88A 1O3CA 1N6XA 2BM2A 1A0HB 1C2HA 3LJOA 2BD9A 6LPRA 1RD3B 1NRPH 3TGKE 3BTKE 4LZ4B 1IHSH 2VIOA 4FUEA 2W3KA 5HIZA 1S0QA 3SORA 3SUFA 1J9CH 4FVBA 5EG4A 1DSTA 1H1BA 3SNDA 1Z8GA 3RXDA 2B8OH 3DSOA 5DP6A 2VWOA 1GMHF 2D8WA 2BTCE 3D65E 3QTOH 3SHCH 3GICB 4ZKOU 4LOYH 4K8YA 4TY6A 1B0EA 3ATLA 2FOHA 1QGFA 1RJXB 3ZV8A 3W95A 1BRAA 4NIVA 3SYJA 4ACAA 2BX3A 1ID5H 5JBAS 3SJIA 4ZROA 1AIXH 1PPEE 1K1LA 3DCLA 4RN6A 4I8LA 2OP9A 1Y3XA 3GOVB 1E35B 4JZEH 2ESTE 1GHVH 2VWMA 2WUCA 2BX4A 1P2QA 3CS7A 1MD8A 1GHAG 1CGHA 3GY2A 5FPTA 3GY5A 5FPYA 3PO1B 1MTSA 2A2QH 1TGSZ 3MHWU 1V2OT 1LPGB 1H8ED 1O0DH 4U2WA 1Y59T 2PSYA 3U8TH 2WV5A 1ZSLA 3WW7A 4KKDA 1O3MA 4WVPE 1YPHC 1NN6A 4MDSA 2GZ8A 1FNIA 2VGCC 2CF8H 2Z9IA 3K6YA 4ISHH 1SMFE 2TIOA 2ALPA 3PLKA 1V2WT 2YMSC 4KGAA 4X0WU 3URDA 4I32A 3OEHD 1GJ4H 1KLIH 2RCEA 1IQGA 2ZWLH 1O2WA 4X8TH 4GCHF 1Z8IB 1P02A 2FI4E 2ZPQA 1GG6C 9LPRA 1AVGH 3KYFA 4JYVH 2GCTB 1AB9C 5EODA 2R3YA 5GIBA 3BSQA 3GY8A 1ZTJA 1PPBH 1W13U 2ILNA 3AW0A 2YMSD 2ZZUH 2A5KA 1F0RA 4OM9A 2A7JA 1CGIE 1O2IA 8GCHF 3LGUA 2PUQH 1TX7A 2XC5A 1O2QA 5E0HA 1B5GH 1NESE 2RFKC 1SHYA 2NU4E 2Q6FA 1G3DA 4THNH 2JH0D 2OC7A 2A5IA 2IPHA 1SLXB 4OGYA 1TNKA 3PO1C 5BRRE 1A7SA 1OWIA 1VJ9U 2ANKH 3F68H 4JZIA 3OX7U 1O30A 1GJDB 3STIA 1IHTH 1W7XH 4K2YA 1VCWA 1WQVH 2NU0E 4F48B 3LIWA 1HAZB 5EIYA 2ZECA 3V7TA 3HGPA 5LPEA 3VG8A 1MU8B 7GCHF 1GMDF 1YCPK 3KQBA 3EE0B 1YP9A 1YPJH 4ABJA 1BBRK 1GI8B 1SSXA 3MTYA 2CHAC 2GX4A 3U28C 1S84A 3MNXA 3DUXH 1O3BA 3S9CA 3GCTF 3O8CA 3GYMA 1BRBE 4IBLH 1H9LB 2VU8E 3PMAB 1BTXA 4YO9A 1AFEH 3QO6A 1UCYE 3LOXA 3DSPA 3RLWH 4WMFA 2WPIS 1E0FD 4B74A 1MBMA 1GJ9B 3AK5A 2ZIQH 3EE7A 3NK8A 1KTSB 1BTWA 1GBDA 3TJNA 3A89A 3KEEA 3TGIE 4NIXA 3S9BA 4TPIZ 3IWMA 1W8BH 2W3IA 1BIOA 4I8KA 1HPGA 1GMCG 1FAKH 4M7GA 4FU9A 5JB9S 4ZKSU 1C5VA 1O2YA 5AFYH 2RDLA 1BHXF 2UWPA 2XBVA 5C1UA 3VGCC 1TE0A 3BG8A 5DP4A 1AVXA 4ZKNU 4XE4A 1IAUA 1O32A 3P6ZB 2B7DH 5GJ4B 1D3PB 1O3OA 3A86A 4Q2KA 1K1OA 1FI8A 1HV7A 2ZCKP 5HKKD 2F43B 5A8XA 2P16A 1VGCC 2Y80A 1TA2A 2AGEX 1NRSH 2GMTC 3OYPA 1C1QA 3BTTE 3FFGA 2ASUB 5AF9H 1MTWA 2QF0A 4BTTB 3BEIB 1GBHA 3U1IB 3KQEA 4UD9H 2BXUH 2WPLS 3ZZBA 1ZRBA 1W7GH 2DE8A 1PQAA 2ZCHP 2F91A 5J4SA 3H5CB 2BY6X 3BN9A 1WBGB 1O5CB 4K1TA 2STBE 1SI5H 4GVUA 3UOUA 1K1JA 2HLDD 3HATH 4RT0A 3N7OA 5FHTA 4B2CA 3PB1E 3UB0A 4ASUD 4BAKB 1FIZA 4LZ1H 3ZVBA 2K8IA 1SQTA 3EA9A 4XBDA 5C3NA 3ODDA 1C2LA 3VFEA 1V2ST 1UTKA 5G4BA 1O2VA 1GBAA 3UR6A 5JBTA 3FZDA 4FUHA 1A61H 4NG9H 1AE8H 3ESTA 3LGTA 1GPZA 3OTPA 3M35A 1UTJA 1IQNA 2J4IA 2AIPA 4IMQA 2SGDE 2BD7A 2Q6DA 3W94A 4CH2B 1PPGE 1CE5A 1IQEA 2A4GA 3PWBA 4AYVB 2PTNA 3LGVA 3SJKA 1K21H 2G8TA 4X6MA 3SUEA 1C5WB 4X1NU 3P8GA 1RRKA 4RKJB 1P3EA 4ZUHA 2QY0B 1MUEB 4XSKU 3URCA 2GV7A 1OX1A 1QL9A 3RC4A 1KY9A 3NXPA 2Q6GA 1SR5C 3C27B 4X1SU 1IQIA 2GT7A 1C1VH 1LVOA 3PTBA 8ESTE 1KXDA 5DK1A 2F9BH 1O34A 2BB4A 3A8CA 3PM3A 1Z8JB 1YGCH 3LKWA 1A0JA 1DICA 1P2KA 2VWNA 4K1EA 4BXWA 2J34A 1C5UA 3A80A 1XUKA 1UHBB 1C5NH 1XUIA 4TWWA 2H2ZA 2ZDAH 2STAE 2JH6D 1HLTH 1PPFE 2VH6A 3LONA 2TBSA 1C5SA 1KXEA 2ZGXH 1FY4A 3TLOA 1W3CA 1GJAB 2P93A 3P92A 1C1MA 2ZGJA 1A0LA 1A3BH 1SC8U 1GL0E 2SGPE 1V2UT 2HPQH 1ZHRA 2SNVA 2F4LA 2ZQ2A 4I33A 2QF3A 1HAIH 1MAYA 1MKXK 3RC6A 3SNAA 4A1TA 1TNLA 4YOJA 1BMNH 1ANDA 1P10A 4YOGA 2QF4A 3PTNA 2BOHB 4HTCH 1TX6A 1AFQC 1YLNA 3FAOA 3V12A 4NZLA 2H5CA 4TSFD 1XMNB 2C3SA 3A7YA 1HRTH 4JZ1A 3M5LA 1C2DA 3G01A 2O8UA 2A7CA 2LPRA 4LXBH 2RG3A 1VKYA 1U6QA 4Y8ZA 4AFSA 2AERH 1P8VC 2CXVA 1FV9A 1CSOE 4NIYA 1A5IA 1C2FA 2V35A 4Q80A 1O2KA 3PMJA 3RMLH 5EXLA 2QA9E 3SQHE 4CR5A 1SB1H 1E37B 4XBCA 1FN8A 1G30B 1GMCF 3U1JB 4YTAA 1C1TA 1K22H 1SLVB 3NCLA 3R0FA 1C1PA 5FCKA 5I46H 3SV2H 4HG6A 1A4WH 2FOMB 3TJOA 3TITA 4O3TA 1C9PA 3EDXB 2FYRA 1L1JA 1DX5M 2YNAA 1G3CA 3QZQA 1OOKB 3TU7H 3C1KA 1CBWC 3OY5U 1UTMA 3SNCA 5L6NH 3RXFA 2ZDKA 2O9QA 1AZZA 1GCDA 1GBCA 1PPHE 1O3LA 1JRTA 3RU4E 5F8TA 1O2XA 2FX6A 2VIVA 3ZZCA 2Y6TA 1YY3A 2A32A 2CN0H 4NSVA 4UDWH 3WY8A 1CHOG 4NA8A 1CO7E 1MD7A 1QA0A 2Y81A 1DWBH 4D7GA 4O03A 5CMXH 1MTNB 1F2SE 1BRUP 4UFFH 5LH8A 4NWKA 1O3GA 2A5AA 4OS4A 2ZFQH 3T25A 1TMBH 1WSSH 1D3TB 2R9PA 3A85A 2RDEA 5J4QA 3M5NA 2JKHA 1YPKH 1HBTH 3AASA 3F0OA 3MFJA 3ZZ3A 1BZXE 3ITIA 3GY4A 3FP6E 1S6LA 1AWFH 5GPIB 2NU2E 1HGTH 2J9NA 2WV9A 2ZO3H 3BV9B 1CGJE 2XWBI 4DY7B 1C4V2 4NIWA 3TNTA 1LHFH 2IOTA 2ANWA 1QRWA 5FAHA 5DKMA 3A8DA 3LH1A 1O3HA 2A2XH 1UVUH 2J98A 1SGQE 3D49H 1LDTT 2BLQA 1LVMA 1QZ8A 1W10U 2C8ZB 1WU1A 2BZAA 2C4FH 4FETA 1OWJA 4NZQA 4MNVA 1QBVH 1QL7A 3MH5A 4ISOA 1JOUB 2BQ6B 1FDPA 4HI3A 3V13A 4IGDA 4Y8YA 3AAVA 4WH6A 5C17A 4CHAC 1O38A 9ESTA 1GVLA 2FOCA 2BY8X 4U32A 2FTLE 1Z8RA 1P09A 2C8WB 4P00A 4B75A 3EA8A 4DIIH 1DSUA 1H9IE 1OWDA 2P3UB 3T29A 3MU8A 4VGCC 5SGAE 1P2IA 3PROA 3M3VA 1SBWA 1AY6H 1H9HE 1EZXC 5DP8A 1UK3A 1RIWB 1TBQH 1LO6A 1CA8B 4ZH8A 3PLPA 1YYY1 8KME2 1ZSJA 1ESAA 1FIWA 1BMAA 5F8ZA 1HJAB 4X8SH 1OYQA 4WH8A 1YLCA 1K1NA 1YPHE 2PFEA 3KNXA 2ODYB 1V2MT 1AKSB 3F6UH 1V2QT 1PQ5A 1RS0A 2FLRH 1EAWA 2XCFA 1W14U 3M7UA 4SGBE 1PPCE 4TY7A 4Y10E 5DP7A 4B2AA 1BTYA 4E05H 4Z1MD 3CENA 1F0SA 2Z94A 1GBBA 4ZHAA 4RSPA 2P3TB 3L3TA 4NCYA 1TLDA 3RXHA 1C5ZB 1IQFA 1O3KA 2GDEH 2J98B 1QURH 3E91A 5EU8A 4JYUH 1NROH 1A3EH 2PGQB 5FL7D 1H8DH 2FO9A 4OS2A 5ESBA 3M3TA 4TWYA 1F0UA 2BVSH 4X2VA 1SGEE 1XUGA 3E1XB 3LH3A 1LHCH 1HFDA 1G32B 1XX9A 1KTTB 4I8GA 3MU1A 4UONA 2VIQA 4Q7ZA 2LP6A 3MU4A 1F92A 1GBFA 1ZGIA 3KF2A 4DURA 1Q3XA 1MZAA 4FVDA 2QCYA 1Z6JH 3A7ZA 4X1QU 5GNDA 4YXWD 2G00A 1COWD 1O39A 4MPVA 1IOEA 1O2OA 2B5TB 3OAAD 4JK5A 4KTUA 4D9RA 3RXMA 3AVZA 1GHZA 5CE1A 1TWXB 1V2KT 2PTCE 3A8BA 2XOKD 3SU6A 3UNQA 4Y79A 1TABE 1TGBA 4OS6A 2OC8A 2R0LA 3V0XA 3QDZB 4YM9A 1EAUA 2HWLB 1PJPA 3RXBA 1V3XA 1W0KD 1HYLA 1G3BA 4R8TB 1JXPA 5EJ1A 1EFRD 2FM2A 4AGKA 3SNEA 4ABGA 2ZU1A 2KCOA 3ZVDA 1EZQA 3BTFE 1V2NT 2BY9X 4AGJA 1TPAE 1DFPA 1TGTA 2CK3D 1F7ZA 4ISLA 5EOKA 2Z6BD 3BG4B 3GY6A 3ZZ6A 3MH6A 2GMTB 1MZDA 1EZUC 1C2EA 1Y5UT 2UUJB 2F9UA 5A8YA 1K1MA 1ZOMA 3UR9A 3M37A 1THPB 1GI7B 1C9TA 1O2GH 4PROA 1QY6A 2VNTA 1ABJH 4K60A 2EI6A 2NU1E 1HJAC 1FZZA 3QWCH 1TPPA 3AAUA 1SGPE 4A92A 4X1PU 1V2TT 4AB8A 1EAIA 3SI3H 5A0AE 1ZJKA 3QK1A 1JMOH 1AFQB 2O8MA 1QB6A 1QBNA 2VB0A 4X6OA 4SGAE 3T26A 2Y82A 1YBWA 5EQSA 5B6OA 7LPRA 1MH0A 1TOCB 2A31A 4ABDA 4ABIA 2SNWA 2Z3EA 1GVZA 3WWBA 4E7RG 1YCPM 3QGNB 3E3TA 5HGGA 1IQJA 1DT2A 3A81A 1T4UH 1YPLH 3RMMH 1XKBC 1NZQH 3E90B 4AFZA 3PLBA 1ETSH 2JETB 1TB6H 1A2CH 4E7NA 1DPOA 4XBBA 3PYHA 2OQUA 1S81A 4LK4A 3PMBB 6CHAB 2FP7B 4IS5A 1Y3UA 2QGRA 4X8UH 2G5NA 5LPRA 1XXDA 4WWYA 3FOAA 4IC5A 1C5OH 2QN5T 2RA3A 4BAQB 3KQDA 4DOQA 2V0BA 3VXFH 2P95A 4KP0A 3TIUA 2JETC 2R0KA 2VIDA 2ZG0H 3S9AA 1O5EH 1OYTH 1J15A 4CBOA 1HIAB 1LMWB 3UY9A 1F5LA 1EPTC 2J92A 1HAOH 2XW9A 3MH4A 1HCGA 4INKA 4HFPB 4ASHA 1O35A 2HVYB 2M5TA 3MWIU 1SHHB 2JJ1D 5FX6A 2O8TA 4D76A 1NU7B 3T5FH 1ANBA 1NPMA 2HNTF 3SU0A 4DJZB 3ENSB 1BQYA 1H4WA 2XBWA 1LKAA 2JDID 3ZV9A 2A4RA 1O2LA 1S82A 4HZHA 2G4UA 1GBTA 3VB3A 1GBJA 1KXCA 2JH5D 2OBOA 3T2NA 1EPTB 4FUFA 2QC2A 2ZFTA 3O8DA 1ANCA 1GL1A 1LHDH 1DM4B 1N6YA 5E8EH 3S7HB 2TGDA 2J2UA 4Y0ZE 4CR9A 1UTLM 1V2JT 3A8AA 4OGXA 2GP9B 2K1QA 3KL6A 1L1NA 3FP8E 1TNHA 1MTNC 3BTEE 2KR7A 2P8OB 4K8BA 4QT8C 1SLUB 5E2PA 2AFQB 1ABIH 5LGOA 3LC3A 4JZDH 1C4U2 1QJ6B 1GHAF 1UTQA 2QIQA 2JIZD 2J5UA 4Y76A 3SBKA 1BTZA 1PQ7A 3HGNA 1E1RD 1JRSA 2PSXA 2O8WA 2CGAA 4AFQA 1CQQA 2QAAA 4I7YH 3UFAA 3RM2H 2BDAA 2LNCA 2XWAA 4I8HA 3ELAH 2G51A 3T27A 4MQAA 4ABEA 3BTME 2FESH 1G9IE 1O3EA 1CU1A 3FVFB 1T8MA 1Z1IA 1MAXA 1THRH 3TPIZ 4NSYA 5T6GA 5FPSA 1HIAA 1DE7H 1QB9A 1O33A 4KTSA 1O5DH 4ZHLU 4M9FA 3SW2B 5B6LA 1BTHH 1AD8H 1HAYB 5I25A 5AVDA 3CS0A 4DGJA 1Z7KA 2VJ1A 4MG3A 4WXVA 2AMDA 2HNTC 5C1YA 5ABWA 4TT3D 4UFGH 4MNXA 1O3NA 1EPTA 2D2DA 3DT0H 1N8OC 1B7XB 2GV6A 2ODQA 4H6TA 3M36A 3SV6A 4XFQA 3S7KB 1NRQH 2FDAA 4VGCB 1D3QB 5T1VA 4FUDA 3SUDA 1L4ZA 1GHBF 1SLWB 1BBRH 1RIWC 1Q2WA 2XYAA 3P70B 4NFFA 2FLBH 3FZZA 4X6NA 1GBMA 1N8OB 1AO5A 2ZQ1A 2WPMS
chains in the Genus database with same CATH topology
2Z7FE 3TNSA 1MKWK 4OS5A 5DG6A 5GXPA 1T8LA 1TBRH 3TJUA 1ELBA 1O3JA 2I6QA 1QRZA 4X2WA 3MYWA 1AE5A 2PHBA 3LPRA 3VEQB 4CRBA 1L1GA 1OWHA 4X1RU 3NWUA 2BD4A 5A0BA 4K69A 2BD3A 2BOKA 1DY9A 4F49A 3QX5H 4NFEA 1HAGE 1FJSA 3GISB 1KXBA 1SG8B 1C5PA 1VITF 1LHEH 1P0SH 5DGJA 2AH4X 5E0JA 1MQ6A 1LTOA 1WQSA 2I6SA 2XXLA 3P17H 1KXAA 2ZI2H 2H9TH 3O8BA 1UVSH 2AGIX 2EEKA 3MU0A 3E8LA 2G4TA 1ELAA 3BF6H 2ZNKH 3M7QA 3B23B 2HPPH 1SOTA 1LQDB 2GGVB 2W26A 1TNJA 2CJIA 1MMJN 4NA7A 1GBIA 2PWXA 1AGJA 1NFUA 4WY3A 1C5QA 4ZXYH 4WJG2 1QRXA 4ZAEA 1O2JA 2ZHWH 4BAHB 1FONA 2XC0A 1WYKA 1P04A 4OS1A 5EQQA 3SNBA 1SL3A 2PLXA 1SGYE 2VH0A 1F5RA 2SGQE 3F9EA 2ZPSA 3RLYH 4WMDA 1HAXB 1GJ5H 2PKAB 1P2JA 3UREA 5DP9A 3RXRA 3A83A 1ELEE 2ZGHA 1AZ8A 3MH7A 2ZHQH 1TALA 1C4Y2 4UFEH 1TRMA 1SQAA 1EOLA 3KHVA 2BD2A 2OLGA 1RFNA 2SGEE 1MTVA 3Q00A 1P2OA 2G81E 3H7OA 1G3EA 3TGJE 1DUAA 1NRRH 2H6MA 4TYDA 2H5DA 3U69H 1CBWB 4IC6A 1ETRH 2F9NA 1X7AC 3LDXH 1LVYA 2OC0A 4XDEA 4BANB 1GMHG 1V2RT 2BQWB 3ATIA 1YC0A 1AKSA 2G52A 1KLTA 2V3HH 1T7CA 1JIRA 1C1OA 1SGNE 3RP2A 5T6FA 3GCOA 1G2MA 3SV9A 5EPYA 2UUKB 5L30H 1EP6A 4AG1A 4K1SA 4INHA 5C20A 3KQCA 1NU9A 1DITH 3K9XB 4O97A 1EQ9A 3SZNA 1K1PA 1INCA 1CT4E 1NT1A 3ZZDA 5TCCA 4MPUA 1TAWA 5F6MA 1NFXA 2FIRH 1QBOA 2Z9GA 3DHKH 4BTIB 1AWHB 1SPJA 3VGCB 2FMJA 2F9OA 4B71A 3MO3A 5H4IB 4BAMB 1T31A 4ESTE 4GHQA 2J94A 3SGQE 1F5KU 1KSNA 3SU2A 1DOJA 4O9VA 1BUIA 1C5MD 1NS3A 1WTGH 4Z6AH 1EATA 1SGRE 1BRCE 1P11E 4F4OC 1VR1H 2KAIB 1BCUH 4CH8B 1S85A 5FBEA 1EOJA 4ISIH 1BJVA 2F83A 1O3DA 2TGAA 4AORA 2A45B 1DS2E 4BTUB 2WYGA 1HB0B 2QV1A 3UTUH 2IN2A 2NU3E 5C2ZA 1EB1H 3M3SA 1UJ1A 1CHGA 4CRDA 2P59A 2OD3B 1O37A 3SU3A 1KIGH 3BTDE 1J14A 2BHGA 4Q7XA 1SGTA 2G5VA 4FUCA 2OQ5A 3EA7A 1BOQA 3NPSA 1T8OA 3BIUH 1ELCA 3SGAE 4H42U 4GPGA 2ZPRA 2FEQH 2RA0A 1G2LA 4AZ2B 2AMPA 4B73A 5F03A 3S0NA 1GDUA 3ZZ5A 2A0QB 1GJCB 1LQEA 3MOCA 2PGBB 1W12U 1XVMA 4A5TS 1PPZA 1YKTA 5TCAA 3ATMA 1S6HA 4YT6H 2PKAA 1SGCA 2HOBA 1SVPA 1Y8TA 4XOJA 2GCHF 1HXEH 1S6FA 2FX4A 2DE9A 2A4QA 2HVXA 3DD2H 4KELA 1C5TA 1GDQA 4D8NA 4DG4A 5JB8S 3ZZ8A 5IYTA 3RXGA 4U01A 1HAHH 3K2UA 2FOEA 3JZ2B 2J95A 3P8OA 1AVWA 2C8XB 4J2YB 1AU8A 1H8IH 1LKBA 2QYIA 1TGNA 2BQ7B 1RGQA 2GCTC 4FU8A 4A1XA 1QFKH 2GCHG 1YPEH 4D9QA 4Y7BA 3B9FH 1NO9H 2VIWA 3MNCA 1FXYA 2TPIZ 3Q77A 2P94A 2OBQA 3RXQA 3UWJH 1ZLRA 6GCHF 5EW1H 2Z9LA 2PR3A 1GWAA 1O2SA 1TMTH 5DO4H 4KTCA 2BVRH 1GDNA 1FQ3A 1D3DB 3ZVEA 2PKSB 2QXJA 4JMYA 4MPXA 5HMAA 1HAVB 5EXMA 1GBLA 4AG2A 1PQ8A 1BBRE 2ZF0H 3L6PA 1XVOA 4CHAB 3S69A 4OS7A 3RMOH 1CVWH 3RMNH 4FUGA 4BNRA 1C2KA 3A7TA 1D9IA 5F8XA 1DXWA 1ZGVA 2FI5E 6GCHG 2PUXB 2AS9A 1DUEA 3UWIA 1NY22 1ZR0A 2W7SA 2ODPA 1UK4A 1A46H 3RUOA 1GHYH 2ANMH 3ZVFA 2FOFA 6CHAC 1UO6A 1TIOA 5PTPA 3VB6A 1Y3YA 2GTBA 3T28A 2BZ6H 3TH4H 1BMLA 1EAXA 3EAJA 2THFB 3RDZA 1C5YB 4D7FA 3BEUA 1GJ7B 2ZTZA 3UUZA 2C93B 2ZTXA 1C5RA 2BMGB 1IQMA 2EI8A 1OS8A 1KXFA 1UK2A 5EW2H 2DUCA 3A7VA 1JIMA 2D1JA 3RU4T 5JBCS 2P3FH 1EJAA 2ZHFH 1NRNH 5EPNA 5AFZH 3PWCA 2XNIA 5C5NA 4ZMAH 1GGDC 3ZZAA 1GBEA 3UNSA 3F9GA 1UMAH 2BLOA 1ESBA 1AI8H 1BTUA 1WAYB 3ATWA 1RTLA 2GD4B 4GSOA 2XRCA 2VINA 1AMHA 1FY3A 4ZKRU 2F9VA 2B0FA 1P05A 4BXSA 4Q7YA 3SUGA 2VVUA 1GBKA 3FANA 1ZMJA 3TK6A 2BDGA 3NUMA 1J16A 1O2TA 4X2YA 8GCHG 2ALVA 1UVPA 3F9FA 1FN6A 2SGAA 2ZFSA 3RU4D 3OU0A 1TQ0B 2XBXA 2TGPZ 1QTFA 3QTVH 4YT7H 3SV8A 3BTHE 1BB0B 2W7UA 4Y11E 5T3HA 1GHXH 1P57B 1ORFA 3SJOA 3RC5A 1ELDE 2ZGBH 4U30A 5K0HA 2FS8A 3GY7A 3LT3A 3SQEE 3TK9A 3SV7A 4JZFH 2BDYA 4A1VA 1PYTD 3HKIB 1DY8A 1P9UA 2R3UA 1C1RA 4MTBA 4CRGA 4MPWA 3P95A 3BIVH 1TQ7B 2FPZA 4A7IB 1ZZZA 1FAXA 1TONA 1ESTA 1QIXB 3HKJB 5A8ZA 4AN7A 4DT7B 1W2KH 1BHXB 1AB9B 3SO3A 2XCNA 1FY8E 2VWLA 1VCQA 2XC4A 1AHTH 2A7HA 5A09A 1SQOA 2Q1JA 2WPKS 4I8JA 4CRAA 1FLEE 1M9UA 2CMYA 4MVNA 1DANH 5TJXA 1GI6A 2ZFFH 4AYYB 4UFDH 5ESTE 3GYLB 3RXPA 3U8OH 3RXUA 3BTWE 3ZZ9A 1UTPA 1C2IA 2PV9B 4YZUA 1G37A 1BT7A 3RXVA 3AW1A 1J17T 1O5GH 1V6DA 4DW2U 3Q76A 4FUIA 1K28D 2XBYA 1GI1A 1C5LH 2BLVA 4Y0YE 2SGFE 2Y5HA 1EB2A 4E06H 1Q31A 3E0PB 3F1SB 3RXEA 2EC9H 1UVOA 3MU5A 1UHBA 5FCRA 1ZMLA 4X8VH 5E0GA 4FUBA 1HJ9A 3ZVCA 1XM1A 3GY3A 3SU5A 2YOLA 5GWZA 1Y5BT 4GLYA 3HK6B 1XKAC 2B9LA 3M5MA 3P8FA 2OXSA 1DVAH 1RTKA 1GI0A 1WUNH 1YF4A 1TNGA 3SN8A 2GKVE 3VB4A 1O2HA 1IQHA 4MLFB 1QQ4A 3OY6U 4GHTA 1S83A 4INLA 2O8LA 1C2MA 3D23A 5C67A 2BLWA 3GCHC 1EXFA 3RXLA 1CA0C 1GJBB 3A84A 4DVAU 1S0RA 3TVJB 2A1DB 1C2GA 2VVCA 2GT8A 4B1TA 1HXFH 1KDQB 2EI7A 2HLCA 5BPEA 4B2BA 3QLPH 1ZJDA 1WOFA 2BDCA 5DPAA 1GHWH 1WV7H 5GCHF 2OCVB 2BD5A 4X6PA 2C90B 1EASA 3STJA 1ZSKA 2BY5X 3ZZ7A 1OKXA 2FI3E 1DLKB 1W0ZU 2G55A 1EUFA 3I78A 3HK3B 3RXKA 2HNTE 2ZFPH 4FUJA 1KLJH 2Z9JA 1E38B 3RXTA 3SU1A 6ESTA 3Q3XA 5A2MH 1C1UH 1ZPBA 4X2XA 1J8AA 3BTGE 1MU6B 1ELFA 2FZZA 4CRCA 1GI3A 3LJJA 1MCVA 2AYWA 2FTMA 1DXPA 2BXTH 2BDHA 1FY1A 1AUJA 2ANYA 4Y8XA 4ZXXH 1UVTH 1LHGH 3ZVAA 1NTPA 3DFJA 3DA9B 1Z1JA 5HYOA 1P12E 2IJOB 4ISNA 1ACBE 5DJ7A 1UTOA 4Y7AA 1OPHB 2BY7X 1IQKA 1ZMNA 1TA6A 3A87A 1BMMH 3E0NB 5CHAC 4MNYA 3IG6B 4YOIA 2OC1A 1AUTC 1MCTA 1OP0A 3A7WA 2BDIA 1QJ7B 3RXJA 3LGYA 1V2PT 3SI4H 1TPOA 1BITA 1ARBA 2KAIA 1TFXA 2ZEBA 2ZDNA 1GCTB 1FY5A 1GGDB 2AIQA 1NM6A 1EJNA 4A6LA 1O5AB 1D6WA 1QHRB 3GCNA 5HM2A 1P2MA 1VZQH 1ZTKA 2FOAA 1YM0A 3ODFA 3SGBE 3HPTB 1ARCA 3QZRA 4YLUA 3VXEH 1L4DA 4YESB 3VB7A 4ABFA 2TGTA 2V3OH 4I31A 1C5XB 1VJAU 1FPHH 1K1IA 1O2RA 2ZC9H 1TRNA 1T8NA 1LPZB 1ZYOA 1UTNA 3TJVA 4UE7H 3TK5A 3MI4A 3RXIA 3B8JA 1ELGA 8LPRA 1CA0B 1W11U 1GI4A 4NGAH 4H6SB 4IN1A 1C1SA 2V6NA 1HNEE 1SGFA 5T6DA 3H7TA 1O2MA 1FPCH 2UWLA 4R0IA 3UQVA 3GCHB 1RTFB 4FU7A 2ZHEH 1ZHPA 4BAOB 1OXGA 1XXFA 2ZGCA 1P03A 1TX8A 1O5BB 2ZTYA 2BYAX 2CV3A 1P2NA 3SOSA 1HJ8A 1VITH 1TMUH 2C8YB 3A7XA 3DFLA 1QCPA 2FYQA 2Y5FA 3KN2A 3I77A 2ZU5A 3E16B 5CHAB 1K9OE 1PYTC 3OSYA 3R3GB 3RXAA 4CREA 1YPGH 2UUYA 2ZU2A 1FUJA 2CHAB 5FX5A 1SGFG 1B0FA 5GDSH 1OSSA 2WV4A 1LPKB 1O2ZA 2HGTH 3EYDA 4FXGH 2FODA 2PKSC 3MO9A 1CHOF 2ZA5A 3T62A 1E36B 1P9SA 4HGCA 5HXFA 1MKWH 4UEHH 7ESTE 1G36A 1ETTH 1QR3E 3P8NA 5AHGH 1GI2A 1DWEH 1GI5A 3UQOA 5JDUB 3PMHB 1XUFA 1HAPH 2YNBA 1BTPA 2AGGX 1Z71A 2UUFB 3BG4C 1GJ8B 2BDBA 1XUJA 4H4FA 1SFIA 4MNWA 4WXIA 1KDQA 2ZDVH 5LPFA 1D6RA 3QGJA 3QN7A 5ETXA 1AQ7A 2AMQA 1LCYA 3RXOA 3ZYEA 4TPYA 1D4PB 3M7TA 5JBBS 5GCHG 2WPHS 3FP7E 1DLEA 5JYIA 1C2JA 2BVXH 1O2NA 1O3FA 3O8RA 1SGIB 1BDAA 3BEFB 1QNJA 1EZSC 1A1RA 1V2VT 2F9PA 3ATKA 3NZIA 1N1LA 1ZRKA 5FBIA 3U9AH 3K65B 1W0YH 5K7RA 1EX3A 2BD8A 2GVFA 3CP7A 2ZU3A 4JYTA 1O31A 1HAVA 3EQ0H 1O5FH 3LU9B 2OTVA 1EKBB 1TNIA 3Q3KA 3SU4A 4J1YA 1ANEA 1Y5AT 1P3CA 3TH3H 2WYJA 2FWWA 2WINI 3LGWA 1YCPH 4WMEA 5HM9A 5C1XA 7KMEH 4DCDA 4CRFA 4B76A 1K2I1 3L33A 5EQRA 3KIDU 2WPJS 3ZZ4A 2QXHA 1C1WH 2H9HA 5L2YH 2QXGA 1UCYH 1LVBA 1WTHD 2EA3A 1A5GH 1O3PB 4AB9A 2A4OA 4RKOB 1YLDA 1NFYA 2FOGA 1ELTA 5EXNA 1F0TA 4AFUA 5A0CA 1RXPA 2NWNA 2F3CE 3M61U 3QUMP 4NA9H 3ZVGA 3K6ZA 1DWDH 1NFWA 1OWEA 1ZTLA 1BA8B 3MO6A 5E2OA 3SJ8A 1ZPZA 4Z0KA 1EP5A 2R2MB 3BTQE 2ZKSA 3E6PH 3U8RH 1P01A 2HRVA 2Y7XA 2WUBA 3RXCA 1TBZH 2FS9A 2PW8H 1CT0E 1QB1A 4CBNA 1UCYK 3D62A 2ZDLA 3A82A 1TOMH 1KYNA 2ZP0H 3U98H 3OTJE 2GDDA 4AOQA 2Z3CA 1BJUA 2Z3DA 5C5OA 2ZCLP 2H9EH 1C1NA 5DP5A 1Y3WA 3UPEA 1MTUA 2QXIA 1VGCB 1XUHA 5EGMA 3TH2H 3RXSA 1ELVA 1O2PA 3UOPA 1AN1E 1MKXH 3F9HA 1Z6EA 4ABBA 2Y5GA 2J38A 1O3AA 3LC5A 4GCHG 1PFXC 1HDTH 4NWLA 1EJMA 5IDKA 4Y71A 3ZYDA 1QQUA 4WF8A 1YPMH 4GAWA 2HALA 3MNSA 1O2UA 1GJ6A 4JCNA 2CF9H 3PV4A 2UWOA 1E34B 4Y6DA 1GHBG 4GUXA 1S5SA 2Y7ZA 2ULLA 1SFQB 1T32A 1DDJA 2R2WU 1GCTC 3M5OA 3I29A 3UIRA 3VPKA 1QJ1B 4ZHMU 2ZDMA 2XTTB 2Z9KA 1GI9B 1CT2E 2VVVA 3V3MA 4K3JA 5JPMH 1QL8A 4JK6A 4O3UA 1P06A 5FXLA 1O36A 2ZU4A 2ZFRH 1FMGA 1SOZA 2OINA 1JBUH 1JWTA 1ZHMA 1DWCH 1GG6B 1HUTH 1TRYA 2D26C 3Q3YA 2FOBA 1T4VH 1O3IA 2VGCB 1WCZA 2FXRA 2SFAA 1IQLA 3UNRA 3LGIA 1VITG 1SGDE 4ABHA 7GCHG 1GMDG 2W5EA 5L2ZH 5DP3A 1OWKA 2TRMA 1THSH 3VB5A 3JZ1B 3SHAH 4BOHA 3GDSA 3IITA 1L0ZA 3KCGH 4K5ZA 4YLQH 3GCTG 3GDUA 3MMGA 2VIPA 4ABAA 2GZ9A 3GDVA 1QA7A 3RM0H 1GVKB