4B2BA

Structure of the factor xa-like trypsin variant triple-ala (tgpa) in complex with eglin c
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDAGGPVVCSGKLQGIVSWGEGCAQKNKPGFYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title Thermodynamic signatures in macromolecular interactions involving conformational flexibility.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
chains with identical sequence C
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b2bA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4b2bA02
4TPIZ 1NU7B 1AD8H 5LPRA 3U8RH 5A8XA 3P8NA 4ZXXH 1C1TA 1GBJA 1V2ST 5ESBA 2BD3A 1GI1A 1TA2A 3PLPA 1RXPA 5FPSA 4ASHA 3P70B 1Y5BT 1MQ5A 2EA3A 1QRZA 2ZNKH 2FMJA 4H6TA 1E0FD 1X7AC 1HUTH 2RDLA 3LC5A 1SI5H 5CHAB 5C67A 2V35A 4X1RU 1YCPM 4LZ4B 1QBNA 1K9OE 1P9SA 2Y5FA 2H9HA 3SV7A 2A45B 1UTLM 1J8AA 1WQVH 1MU8B 2Z3CA 1SR5C 3BTME 1ESTA 2BVXH 3LPRA 1HCGA 1QL8A 1ZPBA 1WCZA 2Q6DA 6GCHF 3RXRA 1FXYA 4FUDA 3ZVEA 4B75A 1G9IE 8GCHG 1ELBA 4U2WA 2ZECA 2BOKA 3F9EA 3M36A 1RRKA 3RC5A 3RM0H 3RXOA 4X6NA 1MZDA 2O8MA 4ZHAA 2AMQA 3S7HB 1T4VH 1BMNH 1TYNA 1EB1H 5LH8A 5JBAS 1TGTA 1O31A 5EGMA 5TCCA 1MBMA 1Y3XA 1ZOMA 2PGQB 1BJVA 4X2VA 3RXKA 4ZAEA 1AFQB 3A89A 3HGPA 2ZU3A 4BAKB 1EPTA 1QY6A 1DDJA 1A5GH 2FLRH 4X1PU 3KQBA 1P2OA 4BXWA 2B0FA 3N7OA 1DSUA 3SUDA 1V2WT 1OWKA 3KQEA 1GBBA 4CRCA 1IQEA 1C1WH 1V2VT 3BTHE 3TH3H 7GCHG 2M5TA 1GMDG 2O8TA 4JMYA 4ZH8A 1S84A 1DLEA 1SGYE 2BLQA 5EOKA 3ZZ8A 1ANBA 4BAHB 2H5DA 4FUJA 3M7TA 3UNQA 2P3UB 4OS1A 2F9VA 3KEEA 3SO3A 1P02A 1DXWA 3WY8A 1G3CA 2QGRA 4IGDA 3TGKE 3EA8A 2H9TH 1OP8A 1ZJKA 2LNCA 1AWHB 2F3CE 2GDEH 1JBUH 4AGKA 1BTXA 3MNBA 5GJ4B 2R2WU 5JPMH 2A5KA 4AB8A 2QCYA 1ARBA 1YBWA 1SGIB 4YESB 1F0UA 1YKTA 3NPSA 2ZGBH 1YPMH 3SUFA 4FUIA 1XUKA 2ZU4A 3L6PA 1BB0B 1SG8B 1O2GH 2QF0A 2BXTH 2LPRA 1HV7A 3MNSA 1O3NA 4ZKNU 2GT7A 1GHZA 1C5LH 1NPMA 1VCWA 1AZ8A 1EJNA 4SGBE 1A0HB 5LPFA 3SNCA 4LXBH 1O2SA 2GVFA 1DOJA 5GPIB 5ESTE 1XVOA 1FN6A 2A5AA 2FTMA 2PUQH 3A87A 2B5TB 1GVKB 2H1UA 5DKMA 1ZSJA 4ZKOU 2HWLB 2GCTB 1F5KU 1TQ7B 3SQEE 3T25A 4MPVA 1THSH 2QAAA 1N1LA 2WINI 1ELGA 1NRRH 2XW9A 1P01A 2CMYA 1UTKA 3L3TA 1GI6A 1K28D 1SQOA 3E8LA 1JMOH 1V2JT 2BLWA 3SQHE 1H9IE 1ZHMA 3RXSA 4DVAU 1GI8B 2BD9A 2GCTC 3ZZCA 3LU9B 4AOQA 2A31A 5L30H 1S82A 1O39A 4BAOB 2PKSB 2W26A 1O5CB 2C93B 1O2MA 1O2WA 1TLDA 2AGGX 4CRGA 1J14A 1MD7A 1L0ZA 2NU3E 1GMHG 5C1YA 3E90B 4OS5A 1CT0E 3GY6A 1AQ7A 1RIWC 6CHAC 1BTHH 4BOHA 1DPOA 5T3HA 1D3DB 2TGDA 4ISHH 1TGBA 3TH2H 1YPHE 4Q7XA 1FY8E 4MPXA 3A7YA 2PKSC 2PW8H 1C5ZB 1J15A 1LHCH 3SNEA 1HDTH 2XYAA 2FM2A 3KF2A 1BTUA 1HXEH 1BHXB 3M37A 4X8VH 1ZPZA 4Y0YE 4AZ2B 4I8JA 1FY4A 1TPAE 3QGJA 1JRSA 4AORA 1OYTH 1VZQH 1DWEH 1GHWH 2B8OH 2QXIA 3SU6A 4AFUA 2I6QA 1CGJE 1NFWA 2G8TA 1NT1A 1ZRBA 1HLTH 2P16A 1K2I1 3EA7A 4Q7YA 5DP7A 1NM6A 3U8OH 1CA0B 4HI3A 1UMAH 1SGEE 3DFLA 1UTOA 3HKIB 2Z94A 1ZTJA 3GY5A 1B0EA 5PTPA 2J34A 4JK5A 4K8YA 1QL7A 2ANKH 1PQ7A 1VJAU 4UE7H 1O3EA 1NO9H 1O2NA 4Z0KA 1P04A 5DO4H 5EQQA 3NUMA 1LHGH 2P8OC 1DVAH 1A4WH 1CA0C 2XC0A 3U8TH 1O3OA 4NIVA 4NA8A 4YLQH 3RXPA 3GY2A 4Y8ZA 1CGHA 2IOTA 4ISIH 2V6NA 1IHSH 2R9PA 2ZU2A 1D3QB 1ESAA 3BG8A 1S6HA 3LGTA 4JZFH 3FVFB 1DUAA 1P57B 5GIBA 4YOJA 1TALA 2BZAA 3TJNA 1FPCH 1N6YA 4YT6H 1DWBH 3CS7A 3LH3A 1E37B 4IC5A 2Y81A 2BM2A 2PSXA 4O3UA 1F5LA 4MVNA 1PPFE 2ZC9H 1AN1E 2VNTA 1OPHB 1IQHA 1AFEH 1GBFA 2GV7A 1QJ6B 4GSOA 2QY0B 1FPHH 4E7RG 4AFSA 5L2YH 8GCHF 2ZGHA 1INCA 3RXUA 1NESE 1O3IA 1RTLA 1F0SA 2BY8X 1RFNA 1UVTH 1KXCA 3MH6A 3Q3YA 1QA7A 3SV2H 3M35A 3QN7A 1RTKA 1HJAB 1OX1A 3BIUH 2XC5A 1HAOH 1S5SA 3A8AA 4HTCH 1P2QA 1EOLA 3AAUA 2D26C 4GCHF 1P2JA 1P12E 3DUXH 2F9NA 2H9EH 1YYY1 1A1RA 3UUZA 5DP8A 5C5NA 2VU8E 1P8VC 2NU1E 3QGNB 1QGFA 1HJAC 1HJ9A 1WYKA 4B76A 3NXPA 2OBQA 5F8TA 5E2OA 3RXHA 4GHTA 7GCHF 3DD2H 1GMDF 2ZHDA 3AVZA 1HAIH 1HAXB 1V2RT 7LPRA 2BQWB 3MU1A 3ZVAA 5DJ7A 1P2MA 2V3OH 3T2NA 4X2YA 4O03A 1LCYA 1TBRH 4UFFH 1IQJA 1CE5A 1TNIA 1BTZA 1TNKA 4AFQA 1HAGE 3STIA 1IHTH 2BD5A 9ESTA 1UTPA 2A4QA 1C1VH 3LGIA 1NS3A 3QZQA 3W95A 1KLTA 1P3EA 4NGAH 3TVJB 2G52A 1C2IA 1EASA 1GI9B 1DUEA 1HRTH 4WMDA 2AIPA 3FZZA 1W7GH 1Z1IA 4NCYA 1ZTKA 3NK8A 2TRMA 2FYQA 5HMAA 6LPRA 2ZA5A 2ZFSA 3EA9A 5E0HA 2BDAA 1AWFH 5DG6A 3VB3A 1TNLA 2C8WB 4B73A 8KME2 1Q3XA 1O5GH 1C2EA 2A7JA 1WTGH 1NN6A 1D3TB 3BTWE 1E35B 2F9UA 1GPZA 2ZTXA 1MTUA 2NU4E 3RM2H 2ANYA 3KL6A 1GBCA 3FZDA 4WXVA 1C1MA 5EQRA 1V6DA 1L1GA 5FCKA 1FZZA 1Q2WA 1O3KA 4I32A 3QO6A 2ZFQH 4OS2A 3ZZ4A 1Q31A 4I8KA 4KTSA 3UPEA 2FEQH 1ZHRA 1J9CH 1J17T 1AGJA 1C5QA 3VB6A 4FUBA 1TMUH 3FFGA 1EJAA 1MU6B 3FP8E 1TPOA 4UONA 1Y8TA 2WUBA 1S81A 3DFJA 1ZGIA 1EAIA 1SGNE 1V3XA 2B9LA 3GYLB 5EU8A 4ABFA 3MU5A 2EEKA 3R0FA 2PKAB 1U6QA 4IN2A 3AASA 5A0AE 2A7CA 4A5TS 1GG6C 1C5RA 2J9NA 3F1SB 2ALVA 4ZHMU 4ABIA 1WQSA 3L33A 1SLVB 4Y0ZE 5EW1H 2ZPQA 1P11E 1MCVA 3JZ2B 4X8UH 1O3MA 1ABIH 1L2EA 1O3DA 4X8SH 1W0ZU 2SGEE 5E2PA 1UVUH 1XMNB 2GP9B 1GMHF 1P2NA 3RLWH 1RS0A 3K9XB 4XDEA 1Y3UA 1CO7E 1QQ4A 3K6ZA 3S69A 2IPHA 1JOUB 1LPZB 2AGEX 4Y7BA 5ABWA 4YZUA 2QN5T 1K1IA 1AKSB 1KXAA 5DPAA 1NFUA 5FHTA 2OBOA 1O2UA 4NSYA 1HFDA 1F2SE 2EC9H 1GJ6A 5AFYH 1LPKB 3SU4A 2O8UA 1HIAB 1C5XB 9LPRA 4A1VA 1W2KH 1TQ0B 1O2RA 1W14U 5EXLA 1CGIE 1TB6H 4GAWA 1P2IA 3ZVBA 2ZO3H 1DY8A 3TK6A 1TGCA 2OLGA 1HXFH 4MPWA 3PYHA 3GCHB 1SHHB 1K1LA 3SZNA 2Z9KA 4WJG2 5DK1A 3ZZ7A 3S9CA 1NU9A 3RXBA 2OC1A 4DIHH 4FUCA 4AYYB 2QF3A 2TIOA 5EXNA 2R0KA 4UD9H 5JBTA 2HGTH 3A7VA 1G3BA 2FODA 1XVMA 4JYUH 3Q3XA 1O3HA 3QK1A 2VVUA 2Y82A 1GJDB 2ZHEH 1TE0A 2HRVA 3RXDA 3A83A 2OC7A 4H6SB 1SPJA 5SGAE 2THFB 2SGAA 1B7XB 2UUYA 4Y7AA 2SGPE 1V2TT 1TABE 1ETSH 3TJOA 2WPLS 4KTUA 1MUEB 1YGCH 1LKBA 1XUGA 4CRAA 3GCTG 4RN6A 2F9BH 8LPRA 4IMQA 4WMFA 1K21H 3RXMA 4B1TA 4AG2A 1HAVB 1C2JA 1C1NA 1ZZZA 4ABHA 2HPPH 1VJ9U 1EZSC 3JZ1B 2P3TB 1MTNB 3A80A 3F9FA 3A84A 1W10U 1GMCF 2BXUH 2R0LA 3K2UA 4QT8C 2BX3A 5F8XA 4WXIA 4X1SU 2FYRA 3PTBA 1ABJH 2BX4A 2ZGCA 2AFQB 2Z9LA 1UJ1A 1ELVA 3BEIB 4ABJA 4CRFA 1MAXA 2TBSA 3EAJA 1ARCA 1C5WB 1QFKH 1OOKB 1S0RA 3M61U 4BNRA 1MTNC 5C1XA 1QJ1B 5B6OA 1SHYA 4X6PA 1VITH 2GD4B 1WSSH 1BDAA 1FV9A 2G00A 2EI7A 3U69H 1LKAA 1CHOG 1IQMA 2IN2A 2VWMA 1GHXH 2A1DB 4O9VA 4JYTA 4U30A 1FMGA 5FBIA 3T26A 1HIAA 1O3GA 4K1TA 5HYOA 3GY8A 3GY7A 2G55A 4K1SA 5CHAC 5L6NH 2F91A 1C5MD 1IQFA 4Y79A 1MCTA 3H5CB 4KP0A 1C5NH 2W5EA 1W12U 4VGCB 4WH8A 4D7GA 3VB5A 5E8EH 1OS8A 5F03A 4CH2B 2ZWLH 4O97A 1ZSLA 1AVGH 1OKXA 2OC8A 4M7GA 1V2MT 3QTOH 3NKKA 5TCAA 1O3BA 1UHBB 1O37A 3PB1E 4HFPB 4I31A 1IOEA 3RU4D 4YOGA 1O3AA 2Q6FA 2VIQA 5E0JA 1GBHA 3PM3A 5C1UA 4UEHH 3BF6H 5A8YA 3SV9A 3SGQE 3V7TA 2GZ9A 2ZDNA 1FIZA 4MPUA 1UK4A 2ZU5A 4Y76A 2WPKS 3QWCH 1TA6A 4DY7B 4DG4A 1AFQC 2BB4A 2ZZUH 3ATKA 1Y5AT 3TJUA 1O5BB 1BRUP 2B7DH 4IC6A 1ELFA 3SJOA 4XE4A 1GI7B 1UO6A 2H5CA 3ITIA 1TMTH 1Z6JH 2UUJB 3LGUA 1O38A 2OC0A 3ATIA 2AS9A 1O2QA 1UCYK 4I7YH 1F0TA 1GHVH 3RDZA 5BPEA 4DCDA 2NWNA 1G37A 4FU8A 3P95A 2GT8A 1TRNA 1EAXA 1AVXA 1O5FH 3BTQE 3LJJA 4GPGA 4LOYH 3U1JB 2VGCB 1BT7A 3K65B 1GVZA 1PPZA 1YP9A 1SGDE 4DW2U 1BMLA 2ZQ1A 1S83A 5JYIA 3ATMA 1C2DA 2ZPSA 1O2YA 4KTCA 3MO9A 2QV1A 1DLKB 4WMEA 4JZIA 1YM0A 3Q76A 4INKA 2D2DA 1GJCB 4INLA 5A09A 1XXFA 1MBQA 1GJ5H 3SGBE 3MO6A 1MMJN 1O5AB 3ZZ6A 2VGCC 1C5UA 1DANH 2ZCLP 4K5ZA 2WPHS 3UREA 5T6DA 1KLJH 2RCEA 1OWJA 5DP9A 2FOFA 1K1JA 4ISLA 2KAIB 3D62A 4R8TB 3RC4A 2ZI2H 3VGCB 2YNAA 4IN1A 3GCOA 3PO1B 3E6PH 3SNDA 3B23B 3QTVH 1TFXA 3KGPA 1BOQA 2PUXB 3SORA 1UHBA 2ZQ2A 2FTLE 2BY9X 3G01A 1UTMA 1C5PA 1F0RA 2EI6A 4ZXYH 3IWMA 1LMWB 1V2PT 3VGCC 1UTJA 1C2LA 1DT2A 1KLIH 1C1SA 2CHAB 3MU8A 2C8XB 3I77A 1B5GH 3A81A 2I6SA 1LHEH 4LK4A 4MNVA 3P8GA 2TPIZ 3H7OA 3VB7A 3KN2A 5JB8S 1LVBA 2ZF0H 2FS8A 1ZMNA 5C5OA 2PTCE 2GZ8A 4K69A 4BAMB 5E0GA 6ESTA 3RMOH 2CF8H 3GDVA 1P03A 1BBRK 2BQ7B 3SI3H 2CHAC 1C2GA 4I33A 3ZZ3A 1E38B 1RTFB 1WOFA 4HGCA 1QTFA 2PWXA 1C9PA 3BTKE 2XBWA 3PMHB 1T31A 3D65E 2ZFTA 3BIVH 5TJXA 1QCPA 2ULLA 3FAOA 2ODPA 3H7TA 1GGDB 3P8OA 5GCHG 3ZVDA 2XWAA 1QB6A 3MO3A 2HPQH 4AB9A 4ZHLU 3GCTF 1O0DH 2WV4A 3T62A 1K1MA 1LTOA 2FI3E 5J4QA 2VB0A 2ZGJA 1FONA 3ESTA 5A2MH 1V2NT 5HXFA 2VIOA 1Y5UT 2GKVE 1BMAA 3B8JA 1GDNA 2Q1JA 2GDDA 5HM9A 4WVPE 4CRBA 2TGAA 1PPBH 4NA9H 3GDSA 1EZUC 5JBBS 4IMZA 2VH0A 1V2QT 1GI5A 3RU4T 1ANDA 5EXMA 5GDSH 1O2ZA 3FP7E 1PYTC 2BDGA 1N8OB 1CVWH 1S0QA 2ZTYA 3LT3A 3KNXA 2W7SA 1DE7H 2P94A 1JRTA 3AW0A 2K1QA 3BEUA 3V12A 1AHTH 3PWBA 1C4U2 3ODDA 5JBCS 4ABBA 1THRH 2KAIA 4D7FA 1CHOF 1L1NA 1N6XA 1F92A 2ZCHP 1MTWA 2O8WA 4BXSA 4DT7B 1YPHC 2H6MA 1IQIA 1CBWB 1GI3A 4ZMAH 1VR1H 4A1XA 2FS9A 1O2JA 1JWTA 2ZIQH 8ESTE 3TNTA 1ORFA 2XXLA 1NTPA 2CV3A 1FIWA 1SSXA 5CE1A 3M3SA 3M7UA 2ZDLA 3BTFE 3PTNA 1YPEH 2Q6GA 1O2KA 1KY9A 2ZKSA 4R0IA 1YF4A 1CU1A 3UTUH 2PFEA 1TNGA 1O3FA 1GHAG 4OGYA 3URDA 2SGDE 4MNYA 1ZTLA 2C3SA 4NG9H 4BTIB 1HPGA 1ZYOA 5HM2A 1A5IA 2QIQA 1A46H 3EGKH 3RXJA 4B74A 3UFAA 3SW2B 4LZ1H 1PPEE 3A8BA 1KSNA 4E06H 2Z3EA 1TMBH 1SGFG 2FI5E 2BYAX 1P0SH 3UOPA 5BRRE 3A82A 4FVBA 1UVSH 3RXIA 3RXCA 1GCTB 1QBVH 1ZR0A 1GJ9B 2PV9B 1QQUA 1ZMLA 1FNIA 1SLXB 1D6WA 1C5TA 1AZZA 4A7IB 3F9HA 3KQCA 4YM9A 1BRBE 2Z6BD 2PR3A 1H8DH 3A86A 1UK2A 1P09A 2NU2E 2J92A 4MTBA 2ZTZA 3GDUA 3P92A 1ZPCA 1BITA 3QLPH 1GBAA 4CBOA 1QL9A 1QRXA 4ZKSU 1ZSKA 3LDXH 3ZVFA 1O2OA 1SOTA 5FXLA 1W0YH 5GXPA 1BUIA 3OX7U 4K60A 4D9QA 4B2CA 2Z7FE 2SNVA 4F4OC 3PLKA 1AE8H 4BANB 1ACBE 4U01A 2OCVB 1C9TA 5C3NA 1W11U 2VWNA 4KKDA 1HAYB 3UR6A 1EB2A 1BQYA 2G4TA 3UWIA 1SGFA 1GJAB 1O3CA 1HGTH 2XCNA 3UWJH 2FX4A 3E91A 5EODA 1SGCA 1KIGH 3LOXA 3TITA 1G3EA 4IW4E 3SNBA 2ALPA 1GHYH 1F7ZA 2DE9A 1AY6H 2R3YA 1QRWA 1Z8GA 3KIDU 1UK3A 5H4IB 4CHAB 1ELEE 2ZG0H 3ZYDA 2FOHA 3LGWA 1ELTA 1KDQB 5FAHA 3SU1A 3BN9A 3RXFA 3UQVA 3TIUA 1P3CA 2VIVA 1KXFA 2FP7B 2HNTE 1EZQA 1Z7KA 3EDXB 2PSYA 2UWOA 2YNBA 2Z9IA 3TU7H 1IQLA 1G2LA 3BG4B 4ABEA 3RXQA 1M9UA 1AUJA 3ZZAA 1VCQA 4IS5A 3HATH 2CJIA 1EQ9A 1BIOA 1WUNH 1QIXB 3OYPA 3LIWA 2QXJA 1MKWK 1S6FA 3SJ9A 3A8CA 3MYWA 3U1IB 1TX8A 1PPGE 5IDKA 1FY5A 1UCYH 2BDBA 2H2ZA 2XC4A 3ZYEA 3OY5U 3TK9A 5AF9H 1C5OH 1AI8H 3BG4C 4Y8YA 5I46H 4XFQA 2AMPA 2ZDMA 5GWZA 2OUAA 1G30B 1AB9B 4FXGH 3VEQB 2PLXA 3MU4A 2WPJS 1NC6A 3MH4A 2V3HH 3MNXA 2BY7X 3ZZDA 1GJ4H 3V3MA 5T6GA 3FP6E 5L2ZH 2FOEA 2RA0A 1T32A 1P06A 3ELAH 2QYIA 5GCHF 1AE5A 3UQOA 2ODQA 5EW2H 1OSSA 1T8LA 5G4BA 4INHA 4RKJB 1RGQA 1FQ3A 3PMJA 1OP2A 2VIWA 3CS0A 5A8ZA 2BVRH 2CF9H 1HNEE 1TX6A 3TGIE 3RMLH 2BTCE 5FBEA 2FPZA 1O32A 2HNTC 1WAYB 1C2FA 1H1BA 2WYGA 1DS2E 1C5VA 3E0PB 2STAE 3GICB 4OGXA 1YCPK 2R2MB 1EXFA 4B2AA 5EQSA 1QB1A 4ABAA 2VWOA 5K0HA 4ABDA 1C1OA 1Y3WA 4BTTB 4YLUA 1TOCB 3GCHC 4AYVB 1A3BH 1GL1A 4FUGA 2XTTB 3V0XA 1SLWB 2ASUB 2ODYB 2D1JA 3VFEA 3SHAH 4Z6AH 4PROA 4A92A 1BHXF 1HB0B 4NZLA 4AN7A 3C27B 1EX3A 2GCHG 2QXGA 1KDQA 1GI0A 1SFIA 7ESTE 1Z8IB 3SU0A 4RKOB 5LPEA 3M5NA 2EI8A 1C1UH 1EPTB 1TPPA 3AW1A 5K7RA 1TBQH 3LH1A 4H4FA 1C4V2 2PKAA 2NU0E 2ZHWH 3MI4A 1YPJH 1BBRH 3O8BA 1L1JA 3T29A 4CRDA 2XNIA 1XUJA 1GDUA 1OWDA 1L4ZA 1XX9A 1EOJA 4CREA 2BVSH 2AH4X 3R3GB 1GBEA 5F8ZA 4J2YB 3O8RA 2JH5D 1P9UA 3VXEH 4IBLH 1O2LA 5FCRA 1T8MA 2JETB 3RXGA 1LHFH 1C2MA 1GBKA 1ZHPA 2ESTE 2Y7ZA 1K1PA 1GHAF 2W7UA 1HAHH 3F9GA 2A32A 2ANWA 1T8NA 2BDYA 4CH8B 1NFYA 2GV6A 2FOMB 4MDSA 1T4UH 3KQDA 2DUCA 3P17H 3TNSA 1NRQH 1TPSA 1BRCE 1AKSA 1P2KA 1PFXC 2BY6X 2JETC 1SOZA 1TWXB 2VIPA 1XXDA 3HK6B 4NIYA 2TGTA 3M3VA 1C1QA 1BMMH 2JH6D 3GOVB 5DP5A 1GHBG 1T8OA 4X1NU 1YLCA 3OSYA 1MTSA 4Q7ZA 4OS4A 1O33A 3T27A 3O8DA 3MOCA 1C2HA 2J2UA 1V2KT 4THNH 1AMHA 1JXPA 1MKXK 3RU4E 3SUGA 1O2VA 3EQ0H 3SI4H 4ESTE 2A4OA 2BD7A 2A4RA 4MNXA 3SJIA 1EKBB 2Y5HA 1XUFA 3BTGE 2STBE 1IQNA 2CXVA 3MMGA 3ZVGA 1BCUH 3NCLA 4TY6A 2PTNA 3ZZ5A 4YO9A 4MLFB 4VGCC 3K6YA 3S9AA 3TK5A 1PQ5A 3O8CA 1FAKH 2QXHA 1FJSA 5A0CA 1EUFA 1G36A 4NIWA 4FU9A 3TLOA 3M5MA 2GGVB 2Y5GA 3D49H 3DHKH 1SVPA 4GCHG 2ILNA 3EYDA 2XWBI 1C1RA 2WYJA 4KGAA 1UTNA 4MG3A 1ZRKA 3LGVA 2OP9A 2ZCKP 3AAVA 1A3EH 2AERH 4FUHA 5FX5A 1HAVA 1QBOA 1VITG 1PPCE 1C5SA 2R3UA 2OXSA 1DFPA 2F9OA 4ZKRU 5EG4A 3URCA 1GI2A 4TYDA 1BRAA 4DURA 1G32B 1IQGA 1OYQA 2FXRA 4O3TA 1ELCA 2FESH 1FY3A 4J1YA 5FPTA 5C2ZA 3SOSA 3Q00A 2Y80A 3Q3KA 4XSKU 4XOJA 4Y71A 3I29A 3DA9B 2JKHA 2Y6TA 1QNJA 3RXAA 4K1EA 4WWYA 3PWCA 2BHGA 2G51A 1DX5M 1O3JA 1XKAC 3MH7A 1K1OA 5JDUB 1K1NA 2VVVA 3HPTB 2BD4A 4Q80A 4UFEH 1O2XA 2ZFFH 3A88A 4KELA 3SU2A 1BTYA 1GBLA 2HLCA 1IAUA 2VIDA 4CBNA 4K2YA 3PROA 4NFEA 3DT0H 4NA7A 3CENA 1TX7A 2Z9JA 4WF8A 4DIIH 1SFQB 1A5HA 3KHVA 1D9IA 4I8LA 1ESBA 1SGTA 3SN8A 2G5VA 2J95A 1V2LT 3LC3A 1C4Y2 1FI8A 1C1PA 1FLEE 2RA3A 1MZAA 3UNRA 3RXLA 3HGNA 2O9QA 4NWLA 3UR9A 4UFGH 3ATLA 3BTEE 2FZZA 3D23A 4X2XA 2VJ1A 4XBBA 2Y7XA 1GJ7B 1ZLRA 4E7NA 1HAZB 3U98H 2P95A 3MTYA 3I78A 4NSVA 2CGAA 2TGPZ 1ANCA 1O36A 2ZU1A 3TGJE 1GJBB 1QB9A 1A7SA 3NWUA 1C5YB 2BDHA 3OY6U 1Y59T 4NWKA 3T5FH 1PQ8A 2W3KA 2ANMH 1G2MA 5EPNA 2GTBA 1W3CA 5ETXA 4YT7H 1YLDA 4SGAE 4CR9A 1BTPA 2A2QH 1KXBA 2BZ6H 1V2UT 2P59A 4WY3A 1FDPA 5DGJA 3ENSB 3PO1C 1SLUB 5HGGA 2BLOA 1Z8RA 3A7XA 3SU5A 4JZEH 2UWPA 5DP6A 2W3IA 1CT4E 2XCFA 1RIWB 2FLBH 2BLVA 6CHAB 4D8NA 2VH6A 1FUJA 1QHRB 1Z6EA 1W8BH 1LPGB 1W13U 1W7XH 2C4FH 3RXTA 4GVUA 2BY5X 1ZJDA 2J4IA 1ANEA 1LVOA 1SGRE 3SV8A 3TPIZ 3MH5A 3ZZ9A 1FY1A 3ODFA 2A5IA 1TRMA 1MTVA 4TWWA 1DITH 2F83A 2SGQE 1GDQA 1MKWH 4X6OA 3M5OA 1Y3VA 1TIOA 3TJVA 1H4WA 4YOIA 2WV5A 4HZHA 1E34B 1EZXC 5AHGH 2HNTF 1EP5A 2GCHF 2XBVA 3RP2A 1EAWA 1GCDA 1PYTD 5I25A 4AX9H 2D8WA 1NRPH 3VPKA 1G3DA 3W94A 3RLYH 1NY22 3FANA 1O2TA 3E3TA 1BTWA 1GGDC 1SGPE 3M7QA 1BJUA 3QZRA 1ETTH 3LGYA 1SGQE 1TBZH 1XKBC 2QC2A 1WTHD 2ZPRA 1LQDB 3KCGH 4TPYA 3A8DA 5LGOA 1O2HA 1QA0A 1WV7H 2P8OB 3CP7A 1TONA 5C20A 1E36B 2ZEBA 4NZQA 4CR5A 1DSTA 4GUXA 3GISB 2QA9E 1N8OC 1BA8B 1Z1JA 4AGJA 1YCPH 3V13A 3ATWA 1YPLH 1GL0E 4F49A 2G81E 3A85A 3RMNH 1GHBF 1ELDE 1LVYA 1OP0A 2C8YB 1C2KA 1B0FA 3GYMA 3RXEA 2BDCA 3MWIU 4AG1A 1AUTC 4U32A 4Q2KA 1GBTA 3OU0A 1DY9A 4X0WU 2O8LA 3MFJA 4WH6A 1CBWC 4ZUHA 2FI4E 3M3TA 1O2PA 7KMEH 1O3PB 1HYLA 3BV9B 1ELAA 1GMCG 2OINA 2Z3DA 3HKJB 4FU7A 4NIXA 3PMAB 1H9LB 5J4SA 1PPHE 1TGNA 2VWLA 1SMFE 1DWCH 3ZVCA 2ZFPH 1OXGA 2Z9GA 1QURH 2AGIX 1YPGH 3ZZBA 1YC0A 1HBTH 3TH4H 5AFZH 2BQ6B 5EPYA 1A0JA 1GBDA 5DP3A 2J38A 1KYNA 1Z71A 3HK3B 1EJMA 1RD3B 3SU3A 1AVWA 4K8BA 3P6ZB 1SB1H 4JZDH 1VITF 1CT2E 2HALA 1GJ8B 1NRSH 1GWAA 2CN0H 2F9PA 2WPMS 1OWHA 1BZXE 1QJ7B 2DE8A 1Z8JB 3BSQA 6GCHG 2JH0D 2SFAA 2UUFB 3SGAE 1GCTC 3C1KA 1OWEA 3UY9A 4GLYA 3UOUA 3T28A 3QX5H 1GVLA 3MNCA 2C8ZB 3P8FA 1CSOE 2G4UA 1XUHA 5FPYA 2A4GA 2VVCA 2IJOB 2PGBB 3E0NB 4B71A 3IITA 1AO5A 1GI4A 2FOAA 3A7WA 2FOBA 1RJXB 1A61H 1MKXH 2GMTB 1ETRH 1O5EH 1MD8A 1MAYA 1H9HE 1CHGA 4DGJA 1J16A 3S9BA 1V2OT 1IQKA 4D76A 1F5RA 2XRCA 5IYTA 1VGCB 1O2IA 4B2BA 1JIRA 4ABGA 4TY7A 2GMTC 4BAQB 1FAXA 3ZV9A 1DICA 4YTAA 2FOGA 1D6RA 5FX6A 2ZHFH 3VB4A 1DM4B 1KXDA 4ZROA 3STJA 3ZV8A 1P05A 1SBWA 1VGCC 3QDZB 3S7KB 1O34A 1TNJA 1GBMA 4Y10E 5A0BA 1TGSZ 3SHCH 4Y11E 4OS6A 1UCYE 3GY3A 1ZMJA 2YOLA 1NROH 2BOHB 2GZ7A 2C90B 1H8IH 4X2WA 2XBXA 4JZ1A 4CHAC 1GG6B 4XBCA 4GHQA 5AVDA 3PMBB 5CMXH 1K22H 3E1XB 1THPB 4ISOA 2BD2A 4Y8XA 1NZQH 1TOMH 3SJKA 3BEFB 4FUFA 3QUMP 1GBIA 4UDWH 4UFDH 1LVMA 3NZIA 3U9AH 1PQAA 3RMMH 1D3PB 1SQTA 2BDIA 1AU8A 1ID5H 4RSPA 3VXFH 4BTUB 1XM1A 1TAWA 2GX4A 2BMGB 3M5LA 3B9FH 4A1TA 1O30A 5JB9S 4TWYA 1L4DA 2ZP0H 1DXPA 1TNHA 2WUCA 1FN8A 2HVXA 2PHBA 3PLBA 4OS7A 4X8TH 2AIQA 3E16B 1SQAA 3RXVA 1KTSB 2UWLA 4A6LA 1A0LA 3A7TA 1CQQA 1EATA 1AB9C 4Y6DA 2V0BA 4X1QU 2J94A 1KXEA 1S85A 2FX6A 1WBGB 1OWIA 4ISNA 1TRYA 1XUIA 4JYVH 3UIRA 1LQEA 2A2XH 2AMDA 4JK6A 2FO9A 4E05H 3SBKA 3S0NA 2G5NA 2AYWA 1T7CA 1O3LA 3LJOA 1CA8B 2ZHQH 1KTTB 4NFFA 1JIMA 4X6MA 3SUEA 1HAPH 5T6FA 1EAUA 4JCNA 1LO6A 3OTJE 2FIRH 1UVPA 2RG3A 3UNSA 3BTDE 3MU0A 1BBRE 2WPIS 2A0QB 3IG6B 1Y3YA 4I8HA 2FWWA 1A2CH 1DWDH 1AIXH 1LHDH 1ZGVA 3BTTE 4K3JA 3SJ8A 4MNWA 4DOQA 1LDTT 1MQ6A 1UVOA 4I8GA 3MHWU 2ZGXH 3GY4A 1O5DH 3SV6A 2ZDKA 3RUOA 3F6UH 2AEIH 2OTVA 4AFZA 3GCNA 1EP6A 2ZDAH 1PJPA 3LKWA 3Q77A 2SGFE 1SL3A 2OD3B 1MH0A 2XBYA 2A7HA 2OQUA 1NRNH 1O35A 2OQ5A 3A7ZA 2UUKB 3EE0B 3PV4A 2HOBA 2VINA 2ZDVH 2SNWA 1WU1A 4H42U 4XBDA 4DJZB 3F68H 1QR3E 2P93A 1EPTC 1VCPA 1UTQA 5F6MA 1D4PB 5DP4A 1YPKH 3RC6A 1SC8U 2FOCA 1HJ8A 2P3FH 4MQAA 4FUEA 2BD8A 3LONA 2ZFRH 1P10A 4FVDA 2FDAA 3SNAA 4D9RA 1NFXA
chains in the Genus database with same CATH superfamily
1MABB 4TPIZ 1NU7B 1AD8H 5LPRA 3U8RH 5A8XA 3P8NA 4ZXXH 1C1TA 1GBJA 1V2ST 5ESBA 2BD3A 1GI1A 1TA2A 3PLPA 1RXPA 5FPSA 4ASHA 3P70B 1Y5BT 1MQ5A 2EA3A 1QRZA 3N7EA 2ZNKH 2FMJA 1W0JD 4H6TA 1E0FD 1X7AC 1HUTH 2RDLA 3LC5A 1SI5H 5CHAB 5C67A 2V35A 4X1RU 1YCPM 4LZ4B 1QBNA 1K9OE 1P9SA 2Y5FA 2H9HA 2RFKC 3SV7A 2A45B 1UTLM 1J8AA 1WQVH 1MU8B 2Z3CA 1SR5C 3BTME 1ESTA 2BVXH 3LPRA 1HCGA 1QL8A 1ZPBA 1WCZA 2Q6DA 4ZCNA 6GCHF 3RXRA 1FXYA 4FUDA 3ZVEA 4B75A 1G9IE 8GCHG 1ELBA 4U2WA 2ZECA 2BOKA 3F9EA 3M36A 1RRKA 3RC5A 3RM0H 3RXOA 4X6NA 1MZDA 2O8MA 4ZHAA 2AMQA 3S7HB 1T4VH 1BMNH 1TYNA 1EB1H 5LH8A 5JBAS 1TGTA 1O31A 5EGMA 5TCCA 1ZOMA 1MBMA 1Y3XA 2PGQB 1BJVA 4X2VA 3RXKA 4ZAEA 1AFQB 3A89A 3HGPA 2ZU3A 4BAKB 1EPTA 1QY6A 1DDJA 1A5GH 2FLRH 4X1PU 3KQBA 1P2OA 4XD7D 4BXWA 2B0FA 3N7OA 1DSUA 3SUDA 1V2WT 1OWKA 3KQEA 2J97A 1GBBA 4CRCA 1IQEA 1C1WH 1V2VT 3BTHE 3TH3H 7GCHG 2M5TA 1GMDG 2O8TA 4JMYA 4ZH8A 1S84A 1DLEA 1SGYE 2BLQA 5EOKA 3ZZ8A 1ANBA 4BAHB 2H5DA 4FUJA 3M7TA 3UNQA 2P3UB 4OS1A 2F9VA 3KEEA 3SO3A 1P02A 1DXWA 4AC9A 3WY8A 1G3CA 2QGRA 2XNDD 4IGDA 3TGKE 3EA8A 2H9TH 1OP8A 2IPQX 1ZJKA 2LNCA 1OHHD 1AWHB 2F3CE 2GDEH 1JBUH 3PV2A 4AGKA 1BTXA 3MNBA 5GJ4B 2R2WU 5JPMH 2A5KA 4AB8A 2QCYA 1ARBA 1YBWA 1SGIB 4YESB 1F0UA 1YKTA 3NPSA 2ZGBH 1YPMH 3SUFA 4FUIA 1XUKA 2L74A 2ZU4A 3L6PA 1BB0B 1SG8B 1O2GH 2QF0A 2BXTH 2LPRA 1HV7A 5EJ1A 3MNSA 1O3NA 4ZKNU 2GT7A 1GHZA 1C5LH 1NPMA 1VCWA 1AZ8A 1EJNA 4SGBE 1A0HB 5LPFA 3SNCA 4LXBH 1O2SA 2GVFA 1DOJA 4I86A 5GPIB 5ESTE 3UAIC 1XVOA 1FN6A 2A5AA 2FTMA 2PUQH 3A87A 2B5TB 1GVKB 2H1UA 5DKMA 1ZSJA 4ZKOU 2HWLB 2GCTB 1F5KU 1TQ7B 3SQEE 3T25A 4MPVA 3WWBA 1THSH 2QAAA 1N1LA 3OFND 2WINI 1ELGA 1NRRH 2XW9A 1P01A 2CMYA 1UTKA 3L3TA 1GI6A 1K28D 1SQOA 3E8LA 1JMOH 1V2JT 2BLWA 3SQHE 1H9IE 1ZHMA 3RXSA 4DVAU 1GI8B 2BD9A 2GCTC 3ZZCA 3LU9B 4AOQA 2A31A 5L30H 1K0HA 1S82A 3SZEA 1O39A 4BAOB 2PKSB 2W26A 1O5CB 2C93B 1O2MA 1O2WA 1TLDA 2AGGX 4CRGA 1J14A 1MD7A 1L0ZA 2NU3E 1GMHG 5C1YA 3E90B 4OS5A 1CT0E 3GY6A 1AQ7A 1RIWC 6CHAC 1BTHH 4BOHA 1DPOA 2IJD1 5T3HA 1D3DB 2TGDA 4ISHH 1TGBA 3TH2H 1YPHE 4Q7XA 1FY8E 4MPXA 3A7YA 2PKSC 2PW8H 1C5ZB 1KMHB 1J15A 1LHCH 3SNEA 1HDTH 2XYAA 2FM2A 3KF2A 1BTUA 1HXEH 1BHXB 3M37A 4P00A 4X8VH 1ZPZA 4Y0YE 4AZ2B 4I8JA 1FY4A 1TPAE 3QGJA 1JRSA 4AORA 1OYTH 1VZQH 1DWEH 1GHWH 2B8OH 2QXIA 3SU6A 4AFUA 2I6QA 1CGJE 1NFWA 2G8TA 1NT1A 1ZRBA 1HLTH 2P16A 1K2I1 3EA7A 4Q7YA 5DP7A 1NM6A 3U8OH 1CA0B 4HI3A 1UMAH 1SGEE 3DFLA 1UTOA 3HKIB 2Z94A 1ZTJA 3GY5A 1B0EA 5PTPA 2J98B 2J34A 2KFWA 4JK5A 4K8YA 1QL7A 3WWFA 2ANKH 1PQ7A 1VJAU 4UE7H 1O3EA 1NO9H 1O2NA 4Z0KA 1P04A 3F2HA 5DO4H 5EQQA 3NUMA 1LHGH 2P8OC 1DVAH 1A4WH 1CA0C 2XC0A 3U8TH 1O3OA 4NIVA 4NA8A 4YLQH 3RXPA 3GY2A 4Y8ZA 1CGHA 2IOTA 4ISIH 2V6NA 1IHSH 2R9PA 2ZU2A 1D3QB 1ESAA 3BG8A 1S6HA 3LGTA 4JZFH 3FVFB 1DUAA 1P57B 5FL7D 5GIBA 4YOJA 1TALA 2BZAA 3TJNA 4ACBA 1FPCH 1N6YA 4YT6H 1DWBH 3PRDA 3CS7A 2EQNA 1E37B 3LH3A 4IC5A 5EJLA 2Y81A 2BM2A 2PSXA 4O3UA 1F5LA 4MVNA 1PPFE 2ZC9H 1AN1E 2VNTA 1OPHB 1IQHA 1AFEH 1GBFA 2GV7A 1QJ6B 4GSOA 2QY0B 1FPHH 4E7RG 4AFSA 5L2YH 8GCHF 2ZGHA 1INCA 3RXUA 1NESE 1O3IA 1RTLA 1F0SA 2BY8X 1RFNA 1UVTH 3NRLA 2YMSC 1KXCA 3MH6A 3Q3YA 1QA7A 3SV2H 3M35A 3QN7A 1RTKA 1HJAB 1OX1A 3BIUH 2XC5A 1HAOH 1E1QD 1S5SA 3A8AA 4HTCH 1P2QA 1EOLA 3AAUA 2D26C 4GCHF 1P2JA 1P12E 3DUXH 2F9NA 2H9EH 1YYY1 1A1RA 3UUZA 5DP8A 5C5NA 2VU8E 1P8VC 2NU1E 3QGNB 1QGFA 1HJAC 1HJ9A 1WYKA 4B76A 3NXPA 2OBQA 5F8TA 4HG6A 5E2OA 2LP6A 3RXHA 4GHTA 7GCHF 3DD2H 1GMDF 2ZHDA 3AVZA 1HAIH 1HAXB 1V2RT 7LPRA 2BQWB 3MU1A 3ZVAA 5DJ7A 1P2MA 2V3OH 3T2NA 4X2YA 4O03A 1LCYA 1TBRH 4UFFH 1IQJA 1CE5A 1TNIA 1BTZA 1TNKA 2J98A 4AFQA 4M9FA 1HAGE 3STIA 1IHTH 2BD5A 9ESTA 1UTPA 5KECA 3W1EA 2A4QA 1C1VH 3LGIA 1NS3A 3QZQA 3W95A 1KLTA 1P3EA 4NGAH 4FOUC 2KM0A 2G52A 1C2IA 1EASA 1GI9B 1DUEA 1HRTH 4WMDA 3TVJB 2AIPA 3FZZA 1W7GH 1Z1IA 4NCYA 1ZTKA 3NK8A 2TRMA 2FYQA 5HMAA 6LPRA 2XOKD 2ZA5A 2ZFSA 3EA9A 5E0HA 2BDAA 1AWFH 5DG6A 3VB3A 1TNLA 2C8WB 4B73A 8KME2 1Q3XA 1O5GH 1C2EA 2A7JA 1WTGH 1NN6A 1D3TB 3BTWE 1E35B 2F9UA 1GPZA 2ZTXA 1MTUA 2NU4E 2LELA 3RM2H 2ANYA 3KL6A 1GBCA 3FZDA 4WXVA 1C1MA 1NBMD 5EJZA 5EQRA 1V6DA 1L1GA 5FCKA 1FZZA 1Q2WA 1O3KA 1YLNA 3QO6A 2ZFQH 4I32A 4OS2A 3ZZ4A 1Q31A 4I8KA 5KGOA 1H8HD 4KTSA 3UPEA 2FEQH 1ZHRA 1J9CH 1J17T 1AGJA 1C5QA 3VB6A 4FUBA 1TMUH 4B6EA 3FFGA 1EJAA 1MU6B 3FP8E 5T1VA 1TPOA 2KX4A 4UONA 1Y8TA 2WUBA 1S81A 3DFJA 1ZGIA 1EAIA 1SGNE 1V3XA 2B9LA 3GYLB 5EU8A 4ABFA 3MU5A 2EEKA 3R0FA 2PKAB 1U6QA 4IN2A 2RDEA 3AASA 5A0AE 2A7CA 4A5TS 1GG6C 1C5RA 5HIYA 2J9NA 3F1SB 2ALVA 4ZHMU 4ABIA 1WQSA 3L33A 1SLVB 4Y0ZE 5DSFA 2ZPQA 1P11E 3OTPA 1MCVA 3JZ2B 4X8UH 5EW1H 1O3MA 1ABIH 1L2EA 1O3DA 4X8SH 1W0ZU 2SGEE 5E2PA 1UVUH 1XMNB 4XRNA 2GP9B 1GMHF 1P2NA 3RLWH 1RS0A 3K9XB 4XDEA 1Y3UA 1CO7E 1QQ4A 3K6ZA 3S69A 2IPHA 1JOUB 1LPZB 2AGEX 4Y7BA 5ABWA 4YZUA 2QN5T 1K1IA 1AKSB 1KXAA 5DPAA 1NFUA 5FHTA 2OBOA 1O2UA 4NSYA 1HFDA 1F2SE 2EC9H 1GJ6A 5AFYH 1LPKB 3SU4A 2O8UA 1HIAB 1C5XB 9LPRA 2EY4C 1W2KH 1TQ0B 4A1VA 1O2RA 1W14U 5EXLA 1VKYA 1CGIE 1TB6H 4GAWA 1P2IA 3U28C 3ZVBA 2ZO3H 1DY8A 3TK6A 1TGCA 2OLGA 3FN8A 1HXFH 4MPWA 3PYHA 3GCHB 1SHHB 3FO8D 1K1LA 3SZNA 2Z9KA 4WJG2 5DK1A 3ZZ7A 3S9CA 1NU9A 3RXBA 2OC1A 4DIHH 4FUCA 4AYYB 2QF3A 2TIOA 5EXNA 2R0KA 4UD9H 5JBTA 2HGTH 3A7VA 1G3BA 2FODA 1XVMA 4JYUH 3Q3XA 1O3HA 3QK1A 2VVUA 2Y82A 1GJDB 2ZHEH 1TE0A 2HRVA 2K8IA 3A83A 3RXDA 2OC7A 4H6SB 1SPJA 5SGAE 2THFB 2SGAA 1B7XB 2UUYA 4Y7AA 2SGPE 1V2TT 1TABE 1ETSH 3TJOA 2WPLS 4KTUA 1MUEB 1YGCH 1LKBA 1XUGA 4CRAA 3GCTG 4RN6A 2F9BH 8LPRA 4IMQA 4WMFA 3SYJA 1K21H 3RXMA 4B1TA 4AG2A 1HAVB 1C2JA 1C1NA 1ZZZA 4ABHA 2HPPH 1VJ9U 1EZSC 3JZ1B 2P3TB 1MTNB 3A80A 3F9FA 3A84A 1W10U 1GMCF 2BXUH 2R0LA 3K2UA 4QT8C 2BX3A 5F8XA 4WXIA 4X1SU 2FYRA 3PTBA 1ABJH 2BX4A 2ZGCA 2AFQB 2Z9LA 1UJ1A 1ELVA 3BEIB 4ABJA 4CRFA 1MAXA 2TBSA 3EAJA 1ARCA 1C5WB 1QFKH 1OOKB 1S0RA 4TT3D 1BMFD 3M61U 4BNRA 1MTNC 2W6ID 5C1XA 1QJ1B 5B6OA 1SHYA 4X6PA 1VITH 2GD4B 1WSSH 1BDAA 2JJ2D 1FV9A 2G00A 2EI7A 3U69H 1LKAA 1CHOG 1IQMA 2IN2A 2VWMA 1GHXH 2A1DB 4O9VA 4ACAA 4JYTA 4U30A 1FMGA 5FBIA 3T26A 1HIAA 1O3GA 3OAAD 4K1TA 5CHBA 3GY8A 5HYOA 3GY7A 2G55A 4K1SA 5CHAC 5L6NH 2F91A 3UB0A 1C5MD 1IQFA 4Y79A 1MCTA 3H5CB 4KP0A 1C5NH 2W5EA 1W12U 4VGCB 4WH8A 4D7GA 3VB5A 5E8EH 1OS8A 5F03A 4CH2B 2ZWLH 4O97A 1ZSLA 4Z1MD 1AVGH 1OKXA 2OC8A 4M7GA 1V2MT 3QTOH 3NKKA 5TCAA 1O3BA 1UHBB 1O37A 3PB1E 4HFPB 4I31A 1IOEA 3RU4D 3PV5A 4YOGA 2L6OA 1O3AA 2Q6FA 2VIQA 5E0JA 1GBHA 3PM3A 5C1UA 4UEHH 3BF6H 5A8YA 3SV9A 3SGQE 3V7TA 2GZ9A 2ZDNA 1FIZA 4MPUA 1UK4A 2ZU5A 4Y76A 2WPKS 3QWCH 1TA6A 4DY7B 4DG4A 1AFQC 2BB4A 2ZZUH 3ATKA 1Y5AT 3TJUA 2WV9A 1O5BB 1BRUP 2B7DH 4IC6A 1ELFA 3SJOA 4XE4A 1GI7B 1UO6A 2H5CA 3ITIA 1TMTH 1Z6JH 3KYGA 2UUJB 3LGUA 1O38A 2OC0A 2CK3D 3ATIA 2AS9A 1O2QA 1UCYK 4I7YH 1F0TA 1GHVH 3RDZA 5BPEA 3MQKC 4DCDA 2NWNA 1G37A 4FU8A 3P95A 2GT8A 1TRNA 2WSSD 1EAXA 1AVXA 1O5FH 3BTQE 3LJJA 4GPGA 4LOYH 3U1JB 2VGCB 1BT7A 3K65B 1GVZA 2J5UA 1PPZA 1YP9A 1SGDE 4DW2U 1BMLA 2ZQ1A 1S83A 5JYIA 3ATMA 4FETA 1C2DA 2ZPSA 1O2YA 4KTCA 3MO9A 2QV1A 1DLKB 4WMEA 4JZIA 1YM0A 3OEHD 3Q76A 4INKA 2D2DA 1GJCB 4INLA 2V7QD 5A09A 1XXFA 1MBQA 1GJ5H 3SGBE 3MO6A 1MMJN 1O5AB 3ZZ6A 2VGCC 1C5UA 1DANH 2ZCLP 4K5ZA 2WPHS 3UREA 5T6DA 1KLJH 2RCEA 1OWJA 5DP9A 2FOFA 1K1JA 4ISLA 2KAIB 3D62A 4R8TB 3RC4A 2ZI2H 2HLDD 3VGCB 2QF4A 2YNAA 4IN1A 3GCOA 3PO1B 3E6PH 3SNDA 3B23B 3QTVH 1TFXA 3KGPA 1BOQA 2PUXB 3SORA 1UHBA 2ZQ2A 2FTLE 2BY9X 3G01A 1UTMA 1C5PA 1F0RA 2EI6A 4ZXYH 3IWMA 1LMWB 1V2PT 3VGCC 1UTJA 1C2LA 1DT2A 1KLIH 1C1SA 2CHAB 3MU8A 2C8XB 3I77A 1B5GH 3A81A 2I6SA 1LHEH 4LK4A 4MNVA 3P8GA 2TPIZ 3H7OA 3VB7A 3KN2A 5JB8S 1LVBA 2ZF0H 2FS8A 1ZMNA 5C5OA 2PTCE 2GZ8A 4K69A 4BAMB 5E0GA 6ESTA 3RMOH 2CF8H 3GDVA 1P03A 3CNRA 1BBRK 2BQ7B 3SI3H 2CHAC 1C2GA 4I33A 3ZZ3A 1E38B 1RTFB 1WOFA 4HGCA 1QTFA 2PWXA 1C9PA 3BTKE 2XBWA 3PMHB 1T31A 3D65E 2ZFTA 3BIVH 5TJXA 1QCPA 2ULLA 3FAOA 2ODPA 3H7TA 1GGDB 3P8OA 5GCHG 3ZVDA 2XWAA 1QB6A 3MO3A 2HPQH 4AB9A 4ZHLU 3GCTF 1O0DH 2WV4A 3T62A 1K1MA 1LTOA 2FI3E 5J4QA 2VB0A 2ZGJA 1FONA 3ESTA 5A2MH 1V2NT 5HXFA 2VIOA 1Y5UT 2GKVE 1BMAA 3B8JA 1GDNA 5EIYA 2Q1JA 2GDDA 3VG8A 5HM9A 4WVPE 4CRBA 2TGAA 1PPBH 4NA9H 3GDSA 1EZUC 5JBBS 4IMZA 2VH0A 1V2QT 1GI5A 3RU4T 1ANDA 5EXMA 5GDSH 1O2ZA 3FP7E 1PYTC 2BDGA 1N8OB 1CVWH 1S0QA 2ZTYA 3LT3A 3KNXA 2W7SA 1DE7H 2P94A 1JRTA 3AW0A 2K1QA 3BEUA 3V12A 1AHTH 3PWBA 1C4U2 3ODDA 3F0PA 5JBCS 4ABBA 1THRH 2KAIA 4D7FA 2AHME 1CHOF 1L1NA 1N6XA 2YMSD 1F92A 2ZCHP 1MTWA 2O8WA 4BXSA 4DT7B 1YPHC 2H6MA 1IQIA 1CBWB 1GI3A 4ZMAH 1VR1H 4A1XA 2FS9A 1O2JA 1JWTA 2ZIQH 8ESTE 3TNTA 1ORFA 2XXLA 1NTPA 4RT1A 2CV3A 1FIWA 1SSXA 5CE1A 2W6JD 3M3SA 3M7UA 2ZDLA 3BTFE 3PTNA 1YPEH 2Q6GA 1O2KA 1KY9A 2ZKSA 4R0IA 1YF4A 1CU1A 3UTUH 2PFEA 1TNGA 1O3FA 1GHAG 4OGYA 3URDA 2SGDE 4MNYA 1ZTLA 2C3SA 4NG9H 4BTIB 1HPGA 1ZYOA 5HM2A 1A5IA 2QIQA 1A46H 3EGKH 3RXJA 4B74A 3UFAA 3ZIAD 3SW2B 4LZ1H 1PPEE 3A8BA 1KSNA 4E06H 2Z3EA 1TMBH 1SGFG 2FI5E 5B6LA 2BYAX 1P0SH 3UOPA 5BRRE 3A82A 1FX0B 4FVBA 1UVSH 3RXIA 3RXCA 1GCTB 1QBVH 1ZR0A 1GJ9B 2PV9B 1QQUA 1ZMLA 1FNIA 1SLXB 1D6WA 1C5TA 5DN6D 1AZZA 4A7IB 3F9HA 3KQCA 4YM9A 1BRBE 2Z6BD 2PR3A 1H8DH 3A86A 1UK2A 1P09A 2NU2E 2J92A 4MTBA 2ZTZA 3GDUA 3P92A 1ZPCA 1BITA 3QLPH 1GBAA 4CBOA 1QL9A 1QRXA 4ZKSU 1ZSKA 1NBME 3LDXH 3ZVFA 1O2OA 1SOTA 5FXLA 1W0YH 1S6LA 5GXPA 1BUIA 3OX7U 4K60A 4D9QA 4B2CA 2Z7FE 2SNVA 4F4OC 3PLKA 1AE8H 4BANB 1ACBE 3F3BA 4U01A 2OCVB 1C9TA 5C3NA 1W11U 2VWNA 4KKDA 2OK5A 1HAYB 3UR6A 1EB2A 1BQYA 2G4TA 3UWIA 1SGFA 1GJAB 1O3CA 1HGTH 2XCNA 3UWJH 2FX4A 3E91A 5EODA 1SGCA 1KIGH 3LOXA 3TITA 1G3EA 1SQRA 4IW4E 3SNBA 2ALPA 1GHYH 1F7ZA 2DE9A 1AY6H 2R3YA 1QRWA 1Z8GA 3KIDU 1UK3A 5H4IB 4CHAB 1ELEE 2JIZD 2ZG0H 3ZYDA 2FOHA 3LGWA 1ELTA 1KDQB 5FAHA 3SU1A 3BN9A 3RXFA 3UQVA 3TIUA 1P3CA 2VIVA 1KXFA 2FP7B 2HNTE 1EZQA 1Z7KA 3EDXB 2PSYA 2M2AA 2UWOA 2YNBA 2Z9IA 3TU7H 1IQLA 1G2LA 3BG4B 4ABEA 3RXQA 1M9UA 1AUJA 3ZZAA 1VCQA 4IS5A 3HATH 2CJIA 1EQ9A 1BIOA 1WUNH 1QIXB 3OYPA 3LIWA 2QXJA 1MKWK 1S6FA 3SJ9A 3A8CA 3MYWA 3U1IB 1TX8A 1PPGE 5IDKA 1FY5A 1UCYH 2BDBA 2H2ZA 2K0QA 2XC4A 3ZYEA 3OY5U 3TK9A 3N7DA 5AF9H 1C5OH 1AI8H 3BG4C 4Y8YA 5I46H 4XFQA 2AMPA 2ZDMA 5GWZA 2OUAA 1G30B 1AB9B 4FXGH 3VEQB 2PLXA 3MU4A 2WPJS 1NC6A 3MH4A 2V3HH 3WW7A 3MNXA 2BY7X 3ZZDA 1GJ4H 3V3MA 5T6GA 3FP6E 5L2ZH 2FOEA 2RA0A 1T32A 1P06A 3ELAH 2QYIA 5GCHF 1AE5A 3UQOA 2ODQA 5EW2H 1OSSA 1T8LA 5G4BA 4INHA 2F43B 1RGQA 4RKJB 5C17A 1FQ3A 3PMJA 1OP2A 2VIWA 3CS0A 5A8ZA 1COWD 2BVRH 2CF9H 1HNEE 1TX6A 3TGIE 3RMLH 2BTCE 5FBEA 2FPZA 1O32A 2HNTC 1WAYB 1C2FA 1H1BA 2WYGA 1DS2E 1C5VA 3E0PB 2STAE 3GICB 4OGXA 1YCPK 1W0KD 2R2MB 1EXFA 4B2AA 5EQSA 2PP6A 1QB1A 4ABAA 2VWOA 5K0HA 4ABDA 1C1OA 1Y3WA 4BTTB 4YLUA 1TOCB 3GCHC 4AYVB 1A3BH 1GL1A 4FUGA 2XTTB 3V0XA 1SLWB 2KCYA 2ASUB 2ODYB 2D1JA 3VFEA 2KCOA 3SHAH 4PROA 4A92A 1BHXF 4Z6AH 1HB0B 4NZLA 4AN7A 3C27B 1EX3A 2GCHG 2QXGA 1KDQA 1GI0A 1SFIA 7ESTE 1Z8IB 3SU0A 4RKOB 5LPEA 3M5NA 2EI8A 1C1UH 1EPTB 1TPPA 3AW1A 5K7RA 1TBQH 3LH1A 4H4FA 1C4V2 2PKAA 2NU0E 2ZHWH 3MI4A 1YPJH 1BBRH 2JJ1D 3O8BA 1L1JA 3T29A 4CRDA 2XNIA 1XUJA 1GDUA 1OWDA 1L4ZA 1XX9A 1EOJA 4CREA 2BVSH 2AH4X 3R3GB 1GBEA 5F8ZA 4J2YB 3O8RA 2JH5D 1P9UA 3VXEH 4IBLH 1O2LA 5FCRA 1T8MA 2JETB 3RXGA 1LHFH 1C2MA 1GBKA 1ZHPA 2ESTE 2Y7ZA 1K1PA 1GHAF 2W7UA 1HAHH 3F9GA 2A32A 2ANWA 1T8NA 2BDYA 4Q63A 4CH8B 1NFYA 2GV6A 2FOMB 4MDSA 1T4UH 3KQDA 2DUCA 3P17H 3TNSA 1NRQH 1TPSA 1BRCE 1AKSA 1P2KA 1PFXC 2BY6X 2JETC 1SOZA 1TWXB 2VIPA 1XXDA 3HK6B 4NIYA 2TGTA 3M3VA 1C1QA 1BMMH 2JH6D 2KZ4A 3GOVB 5DP5A 1GHBG 1T8OA 4X1NU 1YLCA 3OSYA 1MTSA 4Q7ZA 4OS4A 1O33A 3T27A 3O8DA 3MOCA 1C2HA 2J2UA 1V2KT 4THNH 1AMHA 1JXPA 1MKXK 3RU4E 3SUGA 1O2VA 3EQ0H 3SI4H 4ESTE 2A4OA 2BD7A 2A4RA 4MNXA 3SJIA 1EKBB 2Y5HA 1XUFA 3BTGE 2STBE 1IQNA 2CXVA 3MMGA 3ZVGA 1BCUH 3NCLA 4TY6A 2PTNA 4TSFD 3ZZ5A 4YO9A 4MLFB 4VGCC 3K6YA 3S9AA 3TK5A 1PQ5A 3O8CA 1FAKH 4P02A 2QXHA 1FJSA 5A0CA 1EUFA 1G36A 4NIWA 4FU9A 3TLOA 3M5MA 2GGVB 3KYFA 2Y5GA 3D49H 3DHKH 3OEED 1SVPA 4GCHG 2ILNA 3EYDA 2XWBI 1C1RA 2WYJA 4KGAA 1UTNA 4MG3A 1ZRKA 1YY3A 3LGVA 2OP9A 2ZCKP 3AAVA 1A3EH 2AERH 4FUHA 5FX5A 1HAVA 1QBOA 1VITG 1PPCE 1C5SA 2R3UA 2OXSA 3KQ5A 1DFPA 2F9OA 4ZKRU 5EG4A 3URCA 1GI2A 4TYDA 1BRAA 4DURA 1G32B 1IQGA 1OYQA 2FXRA 4O3TA 1ELCA 2FESH 1FY3A 4J1YA 5FPTA 3F2GA 5C2ZA 4B6FA 2WPDD 3SOSA 3Q00A 3PRBA 2Y80A 3Q3KA 4XSKU 4XOJA 4Y71A 3I29A 3DA9B 2JKHA 2Y6TA 1QNJA 3RXAA 4K1EA 4WWYA 4DT4A 3PWCA 2BHGA 2G51A 1DX5M 1O3JA 1XKAC 3MH7A 1K1OA 5JDUB 1K1NA 2VVVA 3HPTB 2BD4A 4Q80A 4UFEH 1O2XA 2ZFFH 3A88A 4KELA 3SU2A 1BTYA 1GBLA 2HLCA 1IAUA 2VIDA 4CBNA 4K2YA 3PROA 4NFEA 3DT0H 4NA7A 3CENA 1TX7A 2Z9JA 4WF8A 4Q4LA 4DIIH 1SFQB 1A5HA 3KHVA 1D9IA 4I8LA 1ESBA 1SGTA 3SN8A 2G5VA 2J95A 1V2LT 3LC3A 1C4Y2 1FI8A 1C1PA 1FLEE 2RA3A 1MZAA 3UNRA 3RXLA 3HGNA 2O9QA 4NWLA 3UR9A 4UFGH 3ATLA 3BTEE 2FZZA 3D23A 4X2XA 5IK2D 2VJ1A 4XBBA 2Y7XA 1GJ7B 1ZLRA 4E7NA 1HAZB 3U98H 1H8ED 2P95A 3MTYA 3I78A 4NSVA 3F0OA 2CGAA 4YXWD 2TGPZ 3DSPA 1ANCA 3DCLA 1O36A 2ZU1A 3TGJE 1GJBB 1QB9A 1A7SA 3NWUA 1C5YB 2BDHA 3OY6U 1Y59T 4OM9A 4NWKA 3T5FH 2KCPA 1PQ8A 2W3KA 5HIZA 2ANMH 1G2MA 5EPNA 3FOAA 2GTBA 1W3CA 5ETXA 4YT7H 1YLDA 4SGAE 4CR9A 1BTPA 2A2QH 1KXBA 2BZ6H 1V2UT 2P59A 4WY3A 1FDPA 5DGJA 3ENSB 3PO1C 1SLUB 5HGGA 2BLOA 1Z8RA 3N99A 3A7XA 3SU5A 4JZEH 2UWPA 5DP6A 2W3IA 1CT4E 2XCFA 1RIWB 2FLBH 2BLVA 6CHAB 4D8NA 2VH6A 1FUJA 1QHRB 1Z6EA 1W8BH 1LPGB 1W13U 1W7XH 2C4FH 3RXTA 4GVUA 2BY5X 1ZJDA 2J4IA 1ANEA 1LVOA 1SGRE 2KCAA 3SV8A 3TPIZ 4F48B 3MH5A 2HVYB 3ZZ9A 1FY1A 3ODFA 2A5IA 1TRMA 1MTVA 4TWWA 1DITH 2F83A 2SGQE 1GDQA 1MKWH 4X6OA 3M5OA 1Y3VA 1TIOA 3TJVA 2F4LA 1H4WA 4YOIA 2WV5A 4HZHA 1E34B 1EZXC 5AHGH 2HNTF 1EP5A 2GCHF 2XBVA 3RP2A 1EAWA 1GCDA 1PYTD 5I25A 4AX9H 2D8WA 1NRPH 3VPKA 1G3DA 3W94A 3RLYH 1NY22 3FANA 1O2TA 3E3TA 1QZ8A 1BTWA 1GGDC 1SGPE 3M7QA 1BJUA 3QZRA 1ETTH 3LGYA 1SGQE 1TBZH 1XKBC 2QC2A 1WTHD 2ZPRA 1LQDB 2WHXA 3KCGH 4TPYA 3A8DA 5LGOA 1O2HA 1QA0A 1WV7H 2P8OB 3CP7A 3H09A 2JDID 1TONA 5C20A 1E36B 2ZEBA 4NZQA 4CR5A 1DSTA 4GUXA 3GISB 2QA9E 1N8OC 1BA8B 5C0TA 1Z1JA 4RT0A 4AGJA 1YCPH 3V13A 3ATWA 1YPLH 1GL0E 1SKYE 2G81E 3A85A 4F49A 3RMNH 1GHBF 1ELDE 1LVYA 1OP0A 2C8YB 1C2KA 1B0FA 5HKKD 3GYMA 3RXEA 2BDCA 3MWIU 4AG1A 1AUTC 4U32A 4Q2KA 1GBTA 3OU0A 1DY9A 4X0WU 2O8LA 2VBCA 3MFJA 2YMSB 4WH6A 1CBWC 4ZUHA 2FI4E 3M3TA 1O2PA 7KMEH 1O3PB 1HYLA 3BV9B 1ELAA 1GMCG 2OINA 2Z3DA 3HKJB 4FU7A 4NIXA 3PMAB 1H9LB 5J4SA 1E1RD 1PPHE 1TGNA 2VWLA 1SMFE 1DWCH 3ZVCA 2ZFPH 1OXGA 2Z9GA 1QURH 2AGIX 1YPGH 3ZZBA 1YC0A 1HBTH 3TH4H 5AFZH 1WXRA 2BQ6B 5EPYA 4F55A 1A0JA 1GBDA 5DP3A 2J38A 1KYNA 1Z71A 3HK3B 1EJMA 1RD3B 3SU3A 1AVWA 4K8BA 3P6ZB 1SB1H 4JZDH 1VITF 1CT2E 5CDFE 2HALA 1GJ8B 1NRSH 1GWAA 2CN0H 2F9PA 2WPMS 1OWHA 1BZXE 1QJ7B 2DE8A 1Z8JB 3BSQA 4RI0A 6GCHG 2JH0D 2SFAA 2UUFB 3SGAE 1GCTC 3C1KA 1OWEA 3UY9A 4GLYA 3UOUA 3T28A 3QX5H 1GVLA 3MNCA 2C8ZB 3P8FA 1CSOE 2G4UA 1XUHA 2GJGA 5FPYA 2A4GA 2VVCA 2IJOB 2PGBB 3E0NB 4B71A 3IITA 1AO5A 1GI4A 2FOAA 3A7WA 2FOBA 1RJXB 1A61H 1MKXH 2GMTB 5C94A 1ETRH 1O5EH 1UW7A 1MD8A 1MAYA 1H9HE 1CHGA 4DGJA 1J16A 3S9BA 1V2OT 1IQKA 4D76A 1F5RA 2XRCA 5IYTA 1VGCB 1O2IA 4B2BA 1JIRA 4ABGA 4TY7A 2GMTC 4BAQB 1FAXA 3ZV9A 1DICA 4YTAA 2FOGA 1D6RA 5FX6A 2ZHFH 3VB4A 1DM4B 1KXDA 4ZROA 3STJA 3ZV8A 5C0UA 1P05A 1SBWA 1VGCC 3QDZB 3S7KB 1O34A 1TNJA 1GBMA 4Y10E 5GNDA 2V3MA 5A0BA 1TGSZ 3SHCH 4Y11E 4OS6A 1UCYE 3GY3A 1ZMJA 2YOLA 1NROH 2BOHB 2GZ7A 2C90B 1H8IH 4X2WA 5F53A 2XBXA 4JZ1A 4CHAC 3DSGA 1GG6B 4XBCA 1YWUA 4GHQA 5AVDA 3PMBB 5CMXH 1K22H 3E1XB 1THPB 4ISOA 2BD2A 4Y8XA 1NZQH 1TOMH 3SJKA 3BEFB 4FUFA 3QUMP 1GBIA 4UDWH 4UFDH 1LVMA 3NZIA 3U9AH 1PQAA 3GS9A 3RMMH 1D3PB 1SQTA 2BDIA 1AU8A 1ID5H 4RSPA 3VXFH 4BTUB 1XM1A 1TAWA 2GX4A 2BMGB 3M5LA 3B9FH 4A1TA 1O30A 3OE7D 4TWYA 5JB9S 3AK5A 1L4DA 2ZP0H 1DXPA 1TNHA 2WUCA 1FN8A 4ASUD 2HVXA 2PHBA 3PLBA 3EE7A 4OS7A 3DSOA 4X8TH 2AIQA 3E16B 1SQAA 3RXVA 2QF5A 1KTSB 2UWLA 4A6LA 1A0LA 3A7TA 1CQQA 1EATA 1EFRD 1AB9C 4Y6DA 2V0BA 4X1QU 2J94A 1KXEA 1S85A 2FX6A 1WBGB 1OWIA 4ISNA 1TRYA 1XUIA 4JYVH 3UIRA 1LQEA 2A2XH 2AMDA 4JK6A 5KEDA 1E79D 2FO9A 4E05H 3SBKA 3S0NA 2G5NA 2AYWA 1T7CA 1O3LA 3LJOA 1CA8B 2ZHQH 1KTTB 4NFFA 1JIMA 4X6MA 3SUEA 1HAPH 5T6FA 1EAUA 4JCNA 1LO6A 3OTJE 2FIRH 1UVPA 2RG3A 3UNSA 3BTDE 3MU0A 1BBRE 1WDIA 2WPIS 2A0QB 3IG6B 1Y3YA 4I8HA 2FWWA 2KR7A 1A2CH 1DWDH 1AIXH 1LHDH 1ZGVA 3BTTE 4K3JA 3SJ8A 4MNWA 4DOQA 1LDTT 1MQ6A 1UVOA 4I8GA 3F2FA 3MHWU 2ZGXH 3GY4A 1O5DH 3SV6A 2ZDKA 3RUOA 3F6UH 2AEIH 2OTVA 4AFZA 3GCNA 1EP6A 2ZDAH 1PJPA 3LKWA 3Q77A 2SGFE 1SL3A 2WZQA 2OD3B 1MH0A 2XBYA 2A7HA 2OQUA 1NRNH 1O35A 2OQ5A 3A7ZA 2UUKB 3EE0B 3PV4A 2HOBA 2VINA 2ZDVH 2SNWA 1WU1A 4H42U 4XBDA 4DJZB 3F68H 1QR3E 2P93A 1EPTC 1VCPA 1UTQA 5F6MA 1D4PB 5DP4A 1YPKH 3FKSD 3RC6A 1SC8U 2FOCA 1HJ8A 2P3FH 4MQAA 2QE7D 4FUEA 2BD8A 3LONA 2ZFRH 1P10A 4FVDA 2FDAA 3SNAA 4D9RA 1NFXA
chains in the Genus database with same CATH topology
4TPIZ 1NU7B 1AD8H 5LPRA 3U8RH 5A8XA 3P8NA 4ZXXH 1C1TA 1GBJA 1V2ST 5ESBA 2BD3A 1GI1A 1TA2A 3PLPA 1RXPA 5FPSA 4ASHA 3P70B 1Y5BT 1MQ5A 2EA3A 1QRZA 2ZNKH 2FMJA 4H6TA 1E0FD 1X7AC 1HUTH 2RDLA 3LC5A 1SI5H 5CHAB 5C67A 2V35A 4X1RU 1YCPM 4LZ4B 1QBNA 1K9OE 1P9SA 2Y5FA 2H9HA 3SV7A 2A45B 1UTLM 1J8AA 1WQVH 1MU8B 2Z3CA 1SR5C 3BTME 1ESTA 2BVXH 3LPRA 1HCGA 1QL8A 1ZPBA 1WCZA 2Q6DA 6GCHF 3RXRA 1FXYA 4FUDA 3ZVEA 4B75A 1G9IE 8GCHG 1ELBA 4U2WA 2ZECA 2BOKA 3F9EA 3M36A 1RRKA 3RC5A 3RM0H 3RXOA 4X6NA 1MZDA 2O8MA 4ZHAA 2AMQA 3S7HB 1T4VH 1BMNH 1TYNA 1EB1H 5LH8A 5JBAS 1TGTA 1O31A 5EGMA 5TCCA 1MBMA 1Y3XA 1ZOMA 2PGQB 1BJVA 4X2VA 3RXKA 4ZAEA 1AFQB 3A89A 3HGPA 2ZU3A 4BAKB 1EPTA 1QY6A 1DDJA 1A5GH 2FLRH 4X1PU 3KQBA 1P2OA 4BXWA 2B0FA 3N7OA 1DSUA 3SUDA 1V2WT 1OWKA 3KQEA 1GBBA 4CRCA 1IQEA 1C1WH 1V2VT 3BTHE 3TH3H 7GCHG 2M5TA 1GMDG 2O8TA 4JMYA 4ZH8A 1S84A 1DLEA 1SGYE 2BLQA 5EOKA 3ZZ8A 1ANBA 4BAHB 2H5DA 4FUJA 3M7TA 3UNQA 2P3UB 4OS1A 2F9VA 3KEEA 3SO3A 1P02A 1DXWA 3WY8A 1G3CA 2QGRA 4IGDA 3TGKE 3EA8A 2H9TH 1OP8A 1ZJKA 2LNCA 1AWHB 2F3CE 2GDEH 1JBUH 4AGKA 1BTXA 3MNBA 5GJ4B 2R2WU 5JPMH 2A5KA 4AB8A 2QCYA 1ARBA 1YBWA 1SGIB 4YESB 1F0UA 1YKTA 3NPSA 2ZGBH 1YPMH 3SUFA 4FUIA 1XUKA 2ZU4A 3L6PA 1BB0B 1SG8B 1O2GH 2QF0A 2BXTH 2LPRA 1HV7A 3MNSA 1O3NA 4ZKNU 2GT7A 1GHZA 1C5LH 1NPMA 1VCWA 1AZ8A 1EJNA 4SGBE 1A0HB 5LPFA 3SNCA 4LXBH 1O2SA 2GVFA 1DOJA 5GPIB 5ESTE 1XVOA 1FN6A 2A5AA 2FTMA 2PUQH 3A87A 2B5TB 1GVKB 2H1UA 5DKMA 1ZSJA 4ZKOU 2HWLB 2GCTB 1F5KU 1TQ7B 3SQEE 3T25A 4MPVA 1THSH 2QAAA 1N1LA 2WINI 1ELGA 1NRRH 2XW9A 1P01A 2CMYA 1UTKA 3L3TA 1GI6A 1K28D 1SQOA 3E8LA 1JMOH 1V2JT 2BLWA 3SQHE 1H9IE 1ZHMA 3RXSA 4DVAU 1GI8B 2BD9A 2GCTC 3ZZCA 3LU9B 4AOQA 2A31A 5L30H 1S82A 1O39A 4BAOB 2PKSB 2W26A 1O5CB 2C93B 1O2MA 1O2WA 1TLDA 2AGGX 4CRGA 1J14A 1MD7A 1L0ZA 2NU3E 1GMHG 5C1YA 3E90B 4OS5A 1CT0E 3GY6A 1AQ7A 1RIWC 6CHAC 1BTHH 4BOHA 1DPOA 5T3HA 1D3DB 2TGDA 4ISHH 1TGBA 3TH2H 1YPHE 4Q7XA 1FY8E 4MPXA 3A7YA 2PKSC 2PW8H 1C5ZB 1J15A 1LHCH 3SNEA 1HDTH 2XYAA 2FM2A 3KF2A 1BTUA 1HXEH 1BHXB 3M37A 4X8VH 1ZPZA 4Y0YE 4AZ2B 4I8JA 1FY4A 1TPAE 3QGJA 1JRSA 4AORA 1OYTH 1VZQH 1DWEH 1GHWH 2B8OH 2QXIA 3SU6A 4AFUA 2I6QA 1CGJE 1NFWA 2G8TA 1NT1A 1ZRBA 1HLTH 2P16A 1K2I1 3EA7A 4Q7YA 5DP7A 1NM6A 3U8OH 1CA0B 4HI3A 1UMAH 1SGEE 3DFLA 1UTOA 3HKIB 2Z94A 1ZTJA 3GY5A 1B0EA 5PTPA 2J34A 4JK5A 4K8YA 1QL7A 2ANKH 1PQ7A 1VJAU 4UE7H 1O3EA 1NO9H 1O2NA 4Z0KA 1P04A 5DO4H 5EQQA 3NUMA 1LHGH 2P8OC 1DVAH 1A4WH 1CA0C 2XC0A 3U8TH 1O3OA 4NIVA 4NA8A 4YLQH 3RXPA 3GY2A 4Y8ZA 1CGHA 2IOTA 4ISIH 2V6NA 1IHSH 2R9PA 2ZU2A 1D3QB 1ESAA 3BG8A 1S6HA 3LGTA 4JZFH 3FVFB 1DUAA 1P57B 5GIBA 4YOJA 1TALA 2BZAA 3TJNA 1FPCH 1N6YA 4YT6H 1DWBH 3CS7A 3LH3A 1E37B 4IC5A 2Y81A 2BM2A 2PSXA 4O3UA 1F5LA 4MVNA 1PPFE 2ZC9H 1AN1E 2VNTA 1OPHB 1IQHA 1AFEH 1GBFA 2GV7A 1QJ6B 4GSOA 2QY0B 1FPHH 4E7RG 4AFSA 5L2YH 8GCHF 2ZGHA 1INCA 3RXUA 1NESE 1O3IA 1RTLA 1F0SA 2BY8X 1RFNA 1UVTH 1KXCA 3MH6A 3Q3YA 1QA7A 3SV2H 3M35A 3QN7A 1RTKA 1HJAB 1OX1A 3BIUH 2XC5A 1HAOH 1S5SA 3A8AA 4HTCH 1P2QA 1EOLA 3AAUA 2D26C 4GCHF 1P2JA 1P12E 3DUXH 2F9NA 2H9EH 1YYY1 1A1RA 3UUZA 5DP8A 5C5NA 2VU8E 1P8VC 2NU1E 3QGNB 1QGFA 1HJAC 1HJ9A 1WYKA 4B76A 3NXPA 2OBQA 5F8TA 5E2OA 3RXHA 4GHTA 7GCHF 3DD2H 1GMDF 2ZHDA 3AVZA 1HAIH 1HAXB 1V2RT 7LPRA 2BQWB 3MU1A 3ZVAA 5DJ7A 1P2MA 2V3OH 3T2NA 4X2YA 4O03A 1LCYA 1TBRH 4UFFH 1IQJA 1CE5A 1TNIA 1BTZA 1TNKA 4AFQA 1HAGE 3STIA 1IHTH 2BD5A 9ESTA 1UTPA 2A4QA 1C1VH 3LGIA 1NS3A 3QZQA 3W95A 1KLTA 1P3EA 4NGAH 3TVJB 2G52A 1C2IA 1EASA 1GI9B 1DUEA 1HRTH 4WMDA 2AIPA 3FZZA 1W7GH 1Z1IA 4NCYA 1ZTKA 3NK8A 2TRMA 2FYQA 5HMAA 6LPRA 2ZA5A 2ZFSA 3EA9A 5E0HA 2BDAA 1AWFH 5DG6A 3VB3A 1TNLA 2C8WB 4B73A 8KME2 1Q3XA 1O5GH 1C2EA 2A7JA 1WTGH 1NN6A 1D3TB 3BTWE 1E35B 2F9UA 1GPZA 2ZTXA 1MTUA 2NU4E 3RM2H 2ANYA 3KL6A 1GBCA 3FZDA 4WXVA 1C1MA 5EQRA 1V6DA 1L1GA 5FCKA 1FZZA 1Q2WA 1O3KA 4I32A 3QO6A 2ZFQH 4OS2A 3ZZ4A 1Q31A 4I8KA 4KTSA 3UPEA 2FEQH 1ZHRA 1J9CH 1J17T 1AGJA 1C5QA 3VB6A 4FUBA 1TMUH 3FFGA 1EJAA 1MU6B 3FP8E 1TPOA 4UONA 1Y8TA 2WUBA 1S81A 3DFJA 1ZGIA 1EAIA 1SGNE 1V3XA 2B9LA 3GYLB 5EU8A 4ABFA 3MU5A 2EEKA 3R0FA 2PKAB 1U6QA 4IN2A 3AASA 5A0AE 2A7CA 4A5TS 1GG6C 1C5RA 2J9NA 3F1SB 2ALVA 4ZHMU 4ABIA 1WQSA 3L33A 1SLVB 4Y0ZE 5EW1H 2ZPQA 1P11E 1MCVA 3JZ2B 4X8UH 1O3MA 1ABIH 1L2EA 1O3DA 4X8SH 1W0ZU 2SGEE 5E2PA 1UVUH 1XMNB 2GP9B 1GMHF 1P2NA 3RLWH 1RS0A 3K9XB 4XDEA 1Y3UA 1CO7E 1QQ4A 3K6ZA 3S69A 2IPHA 1JOUB 1LPZB 2AGEX 4Y7BA 5ABWA 4YZUA 2QN5T 1K1IA 1AKSB 1KXAA 5DPAA 1NFUA 5FHTA 2OBOA 1O2UA 4NSYA 1HFDA 1F2SE 2EC9H 1GJ6A 5AFYH 1LPKB 3SU4A 2O8UA 1HIAB 1C5XB 9LPRA 4A1VA 1W2KH 1TQ0B 1O2RA 1W14U 5EXLA 1CGIE 1TB6H 4GAWA 1P2IA 3ZVBA 2ZO3H 1DY8A 3TK6A 1TGCA 2OLGA 1HXFH 4MPWA 3PYHA 3GCHB 1SHHB 1K1LA 3SZNA 2Z9KA 4WJG2 5DK1A 3ZZ7A 3S9CA 1NU9A 3RXBA 2OC1A 4DIHH 4FUCA 4AYYB 2QF3A 2TIOA 5EXNA 2R0KA 4UD9H 5JBTA 2HGTH 3A7VA 1G3BA 2FODA 1XVMA 4JYUH 3Q3XA 1O3HA 3QK1A 2VVUA 2Y82A 1GJDB 2ZHEH 1TE0A 2HRVA 3RXDA 3A83A 2OC7A 4H6SB 1SPJA 5SGAE 2THFB 2SGAA 1B7XB 2UUYA 4Y7AA 2SGPE 1V2TT 1TABE 1ETSH 3TJOA 2WPLS 4KTUA 1MUEB 1YGCH 1LKBA 1XUGA 4CRAA 3GCTG 4RN6A 2F9BH 8LPRA 4IMQA 4WMFA 1K21H 3RXMA 4B1TA 4AG2A 1HAVB 1C2JA 1C1NA 1ZZZA 4ABHA 2HPPH 1VJ9U 1EZSC 3JZ1B 2P3TB 1MTNB 3A80A 3F9FA 3A84A 1W10U 1GMCF 2BXUH 2R0LA 3K2UA 4QT8C 2BX3A 5F8XA 4WXIA 4X1SU 2FYRA 3PTBA 1ABJH 2BX4A 2ZGCA 2AFQB 2Z9LA 1UJ1A 1ELVA 3BEIB 4ABJA 4CRFA 1MAXA 2TBSA 3EAJA 1ARCA 1C5WB 1QFKH 1OOKB 1S0RA 3M61U 4BNRA 1MTNC 5C1XA 1QJ1B 5B6OA 1SHYA 4X6PA 1VITH 2GD4B 1WSSH 1BDAA 1FV9A 2G00A 2EI7A 3U69H 1LKAA 1CHOG 1IQMA 2IN2A 2VWMA 1GHXH 2A1DB 4O9VA 4JYTA 4U30A 1FMGA 5FBIA 3T26A 1HIAA 1O3GA 4K1TA 5HYOA 3GY8A 3GY7A 2G55A 4K1SA 5CHAC 5L6NH 2F91A 1C5MD 1IQFA 4Y79A 1MCTA 3H5CB 4KP0A 1C5NH 2W5EA 1W12U 4VGCB 4WH8A 4D7GA 3VB5A 5E8EH 1OS8A 5F03A 4CH2B 2ZWLH 4O97A 1ZSLA 1AVGH 1OKXA 2OC8A 4M7GA 1V2MT 3QTOH 3NKKA 5TCAA 1O3BA 1UHBB 1O37A 3PB1E 4HFPB 4I31A 1IOEA 3RU4D 4YOGA 1O3AA 2Q6FA 2VIQA 5E0JA 1GBHA 3PM3A 5C1UA 4UEHH 3BF6H 5A8YA 3SV9A 3SGQE 3V7TA 2GZ9A 2ZDNA 1FIZA 4MPUA 1UK4A 2ZU5A 4Y76A 2WPKS 3QWCH 1TA6A 4DY7B 4DG4A 1AFQC 2BB4A 2ZZUH 3ATKA 1Y5AT 3TJUA 1O5BB 1BRUP 2B7DH 4IC6A 1ELFA 3SJOA 4XE4A 1GI7B 1UO6A 2H5CA 3ITIA 1TMTH 1Z6JH 2UUJB 3LGUA 1O38A 2OC0A 3ATIA 2AS9A 1O2QA 1UCYK 4I7YH 1F0TA 1GHVH 3RDZA 5BPEA 4DCDA 2NWNA 1G37A 4FU8A 3P95A 2GT8A 1TRNA 1EAXA 1AVXA 1O5FH 3BTQE 3LJJA 4GPGA 4LOYH 3U1JB 2VGCB 1BT7A 3K65B 1GVZA 1PPZA 1YP9A 1SGDE 4DW2U 1BMLA 2ZQ1A 1S83A 5JYIA 3ATMA 1C2DA 2ZPSA 1O2YA 4KTCA 3MO9A 2QV1A 1DLKB 4WMEA 4JZIA 1YM0A 3Q76A 4INKA 2D2DA 1GJCB 4INLA 5A09A 1XXFA 1MBQA 1GJ5H 3SGBE 3MO6A 1MMJN 1O5AB 3ZZ6A 2VGCC 1C5UA 1DANH 2ZCLP 4K5ZA 2WPHS 3UREA 5T6DA 1KLJH 2RCEA 1OWJA 5DP9A 2FOFA 1K1JA 4ISLA 2KAIB 3D62A 4R8TB 3RC4A 2ZI2H 3VGCB 2YNAA 4IN1A 3GCOA 3PO1B 3E6PH 3SNDA 3B23B 3QTVH 1TFXA 3KGPA 1BOQA 2PUXB 3SORA 1UHBA 2ZQ2A 2FTLE 2BY9X 3G01A 1UTMA 1C5PA 1F0RA 2EI6A 4ZXYH 3IWMA 1LMWB 1V2PT 3VGCC 1UTJA 1C2LA 1DT2A 1KLIH 1C1SA 2CHAB 3MU8A 2C8XB 3I77A 1B5GH 3A81A 2I6SA 1LHEH 4LK4A 4MNVA 3P8GA 2TPIZ 3H7OA 3VB7A 3KN2A 5JB8S 1LVBA 2ZF0H 2FS8A 1ZMNA 5C5OA 2PTCE 2GZ8A 4K69A 4BAMB 5E0GA 6ESTA 3RMOH 2CF8H 3GDVA 1P03A 1BBRK 2BQ7B 3SI3H 2CHAC 1C2GA 4I33A 3ZZ3A 1E38B 1RTFB 1WOFA 4HGCA 1QTFA 2PWXA 1C9PA 3BTKE 2XBWA 3PMHB 1T31A 3D65E 2ZFTA 3BIVH 5TJXA 1QCPA 2ULLA 3FAOA 2ODPA 3H7TA 1GGDB 3P8OA 5GCHG 3ZVDA 2XWAA 1QB6A 3MO3A 2HPQH 4AB9A 4ZHLU 3GCTF 1O0DH 2WV4A 3T62A 1K1MA 1LTOA 2FI3E 5J4QA 2VB0A 2ZGJA 1FONA 3ESTA 5A2MH 1V2NT 5HXFA 2VIOA 1Y5UT 2GKVE 1BMAA 3B8JA 1GDNA 2Q1JA 2GDDA 5HM9A 4WVPE 4CRBA 2TGAA 1PPBH 4NA9H 3GDSA 1EZUC 5JBBS 4IMZA 2VH0A 1V2QT 1GI5A 3RU4T 1ANDA 5EXMA 5GDSH 1O2ZA 3FP7E 1PYTC 2BDGA 1N8OB 1CVWH 1S0QA 2ZTYA 3LT3A 3KNXA 2W7SA 1DE7H 2P94A 1JRTA 3AW0A 2K1QA 3BEUA 3V12A 1AHTH 3PWBA 1C4U2 3ODDA 5JBCS 4ABBA 1THRH 2KAIA 4D7FA 1CHOF 1L1NA 1N6XA 1F92A 2ZCHP 1MTWA 2O8WA 4BXSA 4DT7B 1YPHC 2H6MA 1IQIA 1CBWB 1GI3A 4ZMAH 1VR1H 4A1XA 2FS9A 1O2JA 1JWTA