4B2PA

Rada c-terminal atpase domain from pyrococcus furiosus bound to gtp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
229
structure length
216
Chain Sequence
b'TIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGSVIWIDTENTFRPERIREIAQNRGLDPDEVLKHIYVARAFNSNHQMLLVQQAEDKIKELLNTDRPVKLLIVDSLTSHFRSEYIGRGALAERQQKLAKHLADLHRLANLYDIAVFVTNQVILAHSATLRVYLRKGKGGKRIARLIGEAVFSITEKGIED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA REPAIR AND RECOMBINATION PROTEIN RADA
publication title ATP Half-Sites in Rada and Rad51 Recombinases Bind Nucleotides
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 83
structure length 216
sequence length 229
ec nomenclature
pdb deposition date 2012-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b2pA00
4KV9A 5DHAA 4KLNA 1PUJA 1W0KA 3CNOA 2X77A 4HAWA 2MSDB 3IIMA 3BB4A 4HB3A 3KUDA 3BE4A 4NHOA 4P4UA 3GLIA 1GITA 3KFVA 5AUOB 5HKKD 3FPAA 3K8YA 2QAGC 4JLKA 5DIFA 1GFIA 2FA9A 5G3YA 3L43A 3S1AB 1MR3F 2ZXUA 4NPHA 3AVXA 2FZLA 4TMTA 1ZUHA 4V02A 2VP5A 4WW0A 3R9IA 1R0WA 2GF0A 4W5HA 2GETA 2R6FA 1DAMA 1D2NA 4AK9A 1ZINA 4Y0VA 3QKSA 4FMDF 4JLVA 3RABA 3B1VA 3AF1A 1QHHA 3GP8A 4YXWD 3TUIC 3RS2A 3BC1A 4PPGA 4I1OA 1PZNA 1CR4A 1SHZA 2AL7A 1ZC4A 1CEEA 4RZ3A 1LNZA 2VSOA 1U0JA 3EIHA 1KDTA 4PAQA 2YINC 5JWHA 1SXJE 1TL7C 3VKHA 1CXZA 5B30A 4DHEA 2FWRA 1A2BA 1SVWA 5L3QA 1TEXA 4Q21A 2J1LA 3AKCA 4ZI3A 2ZR7A 2EFHB 3IEUA 2ANBA 2QPTA 4PQYA 3P20A 4HI0E 4QBGB 4WVFA 1J2JA 5CJPA 4MYUA 4IEIA 4PX9A 5E3HA 3EC1A 4RKFA 5AUQA 3GMTA 4C3ZA 2P65A 1P9NA 2O8EB 3SU8A 1T3LA 2REBA 3Q8XB 2ZIAA 1U98A 2GZDA 2VQSA 3QVUA 4M4SA 4ZDWA 1XX6A 5EE3A 4KJZA 5IHPA 1LS1A 2I1VB 2C77A 1G17A 1U2RA 2OLKA 4YMTA 2H16A 1G8HA 2OSBA 4RSGA 3KJGA 1KYIA 4K8OA 1DBSA 1MOZA 2ZRDA 1G4AE 4IEEA 3HP1A 3QEJA 3QF7A 3C7KA 5FTJA 5D3MA 4LYFA 2ZRGA 4QNRA 5EXPA 4URXR 2BKUA 1YRBA 4YMWA 3BD9A 1G18A 3RS7A 4EFMA 2JLXA 2WWHA 4AURA 2JDIA 4KO8A 1KNXA 3WNBA 1TTTA 1EFCA 3W6NA 4NMMA 3ADKA 2QEQA 1MV5A 4OQMA 2GJ8A 3RC8A 4UNSA 1TQ2A 2GCNA 3IO5A 2JJ2D 4EPVA 3E70C 3B9PA 4BRUA 3U44A 1KO1A 2YKGA 4P3YA 3U3OA 5L3VA 2F7SA 4D4MA 2XTMA 2ATXA 4IVQA 1ETUA 1Q21A 4LBWA 2X8AA 3VR3A 3WYGA 4URVR 1G5PA 4IVPA 2A2ZA 2D2FA 3CF2A 5FBWB 4B73A 4ESVA 5HTKA 4WXRA 1N5IA 1JQJC 1NN5A 2ATVA 2CJWA 4M21A 2JCSA 1N6OA 4QM7A 3ZZ0A 1N5KA 5DH9A 4QRHA 2QQ0A 4KBFA 1NRJB 4PC2A 4F38A 1FNMA 2W0SA 4LJAA 2GK7A 2FMXA 3I8SA 4TT3D 4BFXA 2H1LA 4BFYA 4I1SA 1D5CA 2O8FA 4RCZA 4HLUA 3AVPA 3FHTA 2IUSA 3QG1A 1GNPA 3V9PA 1L4UA 1U8AA 1FTSA 3EIQA 4TYQA 2D7DA 2B7BA 3TUJC 3L0IB 2QM7A 5LD2B 1KSJA 4TZ0A 4JVSB 2XB4A 3B1ZA 1LY1A 1YU9A 1R5OA 1NN0A 4IJMA 3Q3JB 2RCNA 4JLDA 3WRYC 3G82C 4MUAA 2RGGA 1CLUA 4RKEA 4UNQA 1ZM9A 4DDUA 4Q66C 1GIAA 1UADA 2H5EA 3CR7A 2O0JA 3SN6A 3UG7A 4YQFA 1XEWY 4OYHA 1P62B 2FE4A 1UPTA 3SBDA 2BJVA 3K0FB 1Z22A 1E2NA 2GCOB 1RRCA 4HLQB 2YV5A 3EA5A 1P2TA 2OT3B 4E22A 4RCYA 2QT0A 3NC0C 3VNVA 4RD0A 2PL3A 2HYIC 4RFVA 1E9CA 1UDWA 2GILA 4OQLA 2WSMA 1GKYA 4NE2A 1J7KA 2DFLA 4LSGA 2ZJOA 3IDQA 4KI0A 2W00A 1LV7A 2AWOA 3AF0A 4JYBA 2GJKA 3X1ZA 2GXSA 4US2R 4M1WA 3W5IA 2WAYA 1IJEA 4OKSA 2IYXA 4Q19A 5BN4A 3UMSA 4PC3A 2XXAB 2WWYA 4GL2A 3C16C 3KTAB 4NYJR 4AKGA 1YR6A 5K8IA 1Z47A 4Q1FA 4Q7KA 1KI3A 1T3HA 3KKMA 1E32A 4KFTA 4UQOA 4KAXA 2ZRCA 1E0JA 3KQUA 1TUEA 1E0KA 4HAYA 3GJXC 1P61B 1BKDR 1KKMA 2PT7A 3ECCA 4FN5A 3Q72A 2CCGA 4UJ5A 3TNFA 4KSCA 1BYIA 2E9SA 4P32A 3LQRA 1H8HA 2IWHA 3WNCA 2Z4RA 2ZU0C 1GP2A 4CEJB 2CNWA 1ZRHA 3N5CA 5BN3A 1CTQA 1RKBA 4RVCA 2ZM5A 2IYVA 3AUYA 1LFDB 1UEIA 4R2HA 2TMKA 2IW3A 2BMJA 1OYYA 1CR2A 2A30A 1WBDA 3A6PC 4TTQA 1GILA 2ORIA 1NVWQ 2KSQA 1KI9A 3A4MA 4JBWA 1SQ5A 2P5SA 4RD3A 4E09A 5JWOA 1W36D 4DXAA 1KSHA 4A0GA 4Q4HA 4MYHA 3I72A 2XZPA 5FL3A 3WRXC 2ZROA 4PZYA 5EP1A 1COWD 3TK1A 1US8B 3B6EA 1J8YF 2W58A 3CBQA 4IOLA 1JNYA 2GJ9A 1VYUA 2IHYA 3ONWA 1L8QA 1E4VA 1YKSA 2C2HA 3SYLA 3QKRB 4M8NE 4A15A 3EARA 3AUXA 3QOFA 5FUWA 4BLQA 3PITA 4OJKA 3BRWD 5H70A 2PZGA 2FSIA 3KX2A 5J4HA 3A4LA 1OFTA 1XCMA 4DT1A 5FOSA 5HZKA 3GJ8A 2PX3A 2OFXA 1N0VC 3KKOA 5E4FA 1YQTA 4LBVA 5AUPB 4FWIB 2R8RA 3KKPA 1MT0A 2ODWA 3VX4A 5HE8A 2Z4SA 4TLDA 3TUZC 1RRGA 5JZVA 4Q02A 3U3RA 3O8CA 2QAGB 1TU3A 1F5NA 4JLNA 2H18A 1EX6A 5CB6A 3U4QB 1BMFD 1LB1B 3MJHA 2DBYA 4GOJA 1HV8A 3C8UA 4IDHA 4Q4LA 5LBIA 4HLUC 1G64A 3TE6A 1UKZA 5HCNA 2WWGA 3TSZA 1DS6A 5CIQA 3GLFA 1NJFA 2JIZD 3K09A 1MABA 5E95A 2VL7A 2ZU6A 3EAQA 3LBNA 4GRAA 1NIPA 3OEHA 2NPFA 3W8RA 4AYXA 2WAXA 5J4YA 2C96A 2OXCA 1PJRA 4CYMA 1UAAA 1JR6A 3K9GA 2D3WA 1W48A 2DY1A 2VF8A 3OHMA 4XD7A 3SJAA 3UK6A 4ZO4A 2RB4A 4DSOA 3CF6R 5FBRB 1TNDA 4DRZA 1G5TA 2JLRA 3T1OA 2AFIE 2P6RA 2V6IA 5HPYB 4DLTA 4B75A 2BV3A 2VHUA 4MKHA 3K0EA 2WICA 4ZPXA 2CE7A 5DSZA 5JHHB 4DDVA 1MRSA 2A5GA 2Z5FA 2CK3A 3BORA 5FR2A 1G7TA 1G3RA 1QZXA 3TVTA 5FFMA 1ODFA 4BLPA 4NCNA 1OHHA 2CE2X 1WDTA 4W7SA 3BS4A 4M1KA 3OE7D 2GVDC 5CLLA 4UXIA 1XRJA 2QMEA 3L0PA 5BW8A 4WZAE 2IEYA 3KQNA 2G88A 2GA8A 3P32A 5GVRA 3LFUA 4G5SA 4LJ5A 2C9CA 3KXLA 2P6UA 2XITA 3I4LA 4V0NA 1GNQA 3L8YA 521PA 3R20A 5JLJA 3D6TB 4M1YA 2WWXA 2WM9B 4JVLA 4L5BA 3SC3A 4DB2A 1Q3HA 3CIOA 4HAVA 3UKDA 2WKPA 4AYTA 1XP8A 1S3GA 1W7AA 1RW4A 1JALA 4Y0AA 1G8YA 3N2EA 1Z2CA 1Q12A 4MYCA 3B1YA 5GJWC 3HJNA 3RC3A 2XTZA 3U3KA 1I4DD 1YVDA 2Q3HA 3SR0A 2CLSA 2EQBA 1T5LA 3GFOA 3CPEA 1W2HA 1NVUQ 3UWOA 4EAQA 4DC9A 1CU1A 1UFQA 2GJSA 2V7QD 2ZJBA 3GLHA 2NO9A 5C18A 4Q4AA 1T4GA 2JLVA 3K0AA 2RGXA 3GEEA 4AG5A 2ZITA 2KWIA 2HF8A 4DCTA 3U6KA 4P4TA 1VCOA 3KQLA 2ZS7A 2UZ3A 2BM1A 2VP2A 2FFQA 2QM8A 1NMXA 4LHVA 1KSFX 1NLZA 4BUJA 4PSAA 1AGRA 2Z43A 1U99A 3K9LA 4CZ2A 5KDDA 4LRWA 3QE0A 4D4JA 3LXXA 4X8HA 5TDHA 1RPZA 2O8DA 2ZJ8A 3X2SA 4DBLC 2KBFA 1E79D 1ANKA 2F3RA 4HYYA 3TR5A 1KI6A 1T8UA 5C1BA 1DELA 1CR1A 4KCGA 3GJ3A 2XNDA 1AS2A 4LK2A 1FW6A 1ZCBA 4LJ6A 4TLEA 2BOVA 2KI5A 4YONB 3W34A 1ZUIA 2WBLC 2ZYUX 3GLIB 2IS6A 1Z0IA 4OQNA 4XTCS 2G3YA 1E94E 3LQQA 2GXQA 4Q1EA 2GNOA 3WY9A 1E1RA 5IRCD 4XVRA 1TADA 3EWSA 2WPDA 1T0HB 4LGMA 5IDVA 3I3SR 4GFDA 3FMFA 5EP4A 3TH5A 4M9SA 2PBRA 3L82B 4OK6A 1OH8A 3I62A 2J45A 5E7IA 3SJCA 1NL3A 1X86B 2B7CA 2BEKA 4BZXA 1NY5A 3QKSB 5EZ6B 4EKDA 2ZREA 3K09C 2ZPTX 2VO1A 2VP6A 2BIFA 3RWOA 1QHHB 3QY0A 4C7OA 5FL7D 1QHYA 4KODA 5FOUA 4ZKDA 1DG3A 1PLJA 5JCPA 1GRQA 4MH0R 5DI9A 2QSZA 3GJ5A 4J0QA 1OKKD 3OEEA 3SQWA 4R7ZA 2OM2A 4B3FX 2B21A 2EFGA 4C0QC 5L3QB 4URZR 4V0ME 4DCNA 3O8RA 4C30A 1E9FA 4FMCB 221PA 2C9YA 3I8XA 5FUVA 4ESHA 5BWMA 1Z6TA 1FX0A 2EYQA 3SQXA 3QUSA 2G9NA 5FI1B 5JRZA 1VECA 1C4OA 2CL6X 3IQXA 3CWQA 3QKTA 4F93B 5HR5A 4I1VA 1XPRA 1US8A 1WP9A 3D7MA 4A4DA 5EUMA 2AX4A 2GCPA 2ZSEA 1SVIA 3T12A 4QXAA 2FPMA 4QHTA 4DSTA 4TYYA 1UDXA 1XPUA 2VSFA 2OG2A 3I61A 4MGYR 1SXJD 2HDNB 3TAUA 1DG1G 1ESNA 3NBZC 4M53A 1OXXK 4A2PA 1ZVQA 4CDGA 1P2VA 4POAA 4LHXA 2O0KA 5F2EA 3AVVA 4UNPA 2G83A 4JYCA 4PC1A 5FPKA 3EWAA 4BEBA 5JWRA 1U9IA 4KU4A 3IHWA 2ZRHA 5D3MB 5IK2A 3TSWA 1LF0A 3U7EB 1NBMD 1R0ZA 3AV0B 4XWAA 1JJVA 4D81A 3EX7C 3K9HA 1Y63A 3DM9B 3FFAA 1N0UA 1Z28A 1IXRC 3A37A 1KAGA 5B58C 1TMKA 1VCIA 2DHRA 4GI7A 1JR3A 3TVDA 1E2PA 1HYQA 4AWXA 4CW7A 3PUVA 4JLOA 1OFIA 5CK5A 1PV4A 2IYZA 4JT2A 4XJXA 4DEYA 3RYTC 3BB1A 1XXHE 1A82A 1Z06A 3U44B 1NN1A 1IXSB 1LF5A 1LW7A 1JXMA 1PLKA 2GEVA 1R2QA 3A1UA 3AKYA 3NC1C 5D3QA 4AKEA 4C0JA 4DKXA 3N2IA 4UNNA 3OAAD 3EG5A 1GTVA 4GMDA 3A8TA 1VG9B 2NPIA 1XTRA 2GRJA 2OBLA 4R98A 2VHTA 2ZS9A 1E1QD 1SVOA 1OB2A 5JFGA 4EIWA 3R7WA 4G5QA 2CJWB 2QY9A 2YOFA 4KITB 3IIKA 5BYKA 3W8NA 3IKJA 2AKAB 2JLZA 4RZXA 2CL0X 4EDHA 1GG2A 3FMOB 1K8RA 1SVMA 1NJGA 2O8FB 4OBEA 1CIPA 5FOWA 4IFBA 1EFHA 5TB5A 5EXXA 2ZRMA 3B2EA 2QBYA 1RRPA 4BASA 3JVUA 2QMHA 3C4JA 4JJKA 1QHGA 3BIFA 4QBIA 2ZANA 1PUIA 3LX5A 2PZFA 4B3GA 1JI0A 5J5CA 2D2EA 5IT5A 1IBRA 1UBEA 2XSZD 3N70A 4TL8A 3V4RA 3BH7A 5DHFA 1O87A 1KO5A 4IFEA 4XWOA 3LRPA 1SVLA 2NOAA 3NG1A 4OHWA 4W5WA 3NVAA 1FQJA 3KJEA 1ZIPA 2QP4A 2ERYA 1UEJA 4TTRA 1E2DA 4R71A 4MKIA 1WRBA 2BBWA 1P2SA 2GAOA 4HB0A 5A4JA 3IIJA 2NQ2C 5CDFE 5TMPA 2VP9A 1QDEA 1ZU5A 4RY2A 4EFNA 4TSFA 1H65A 2G0NA 5G40A 4PQRA 1A5TA 3QXJA 4D4KA 4BQSA 3H84A 4JSTA 2B8TA 3WMFA 1L2TA 3PCRB 3CNNA 3JZMA 4PO1A 3SYKA 1F3OA 2ZR9A 5AJXA 5JS7A 2ZRJA 2IBMA 2ZVQX 3OIYA 5HZHA 2GHIA 4KHZA 3K0CA 3VFDA 4OHXA 1X8LA 4URWR 4JL8A 4LJ8A 4HATA 4RFSA 1NSTA 5JJIA 4OI4A 3B8HA 4NCIA 1HY3A 4M9QA 1VYTA 1R5NA 4KYUA 3IBGA 3NEYA 1M6NA 2OEPA 3FMPB 2ZUDA 4C2TA 4CF7A 1ZNZA 3T1VA 1OT3A 5DYGA 2VHJA 4NCJA 4NYIQ 3ZD7A 2CXXA 3Q7PA 2J46A 4G5RA 4MGZR 2V55B 2WVJA 3CRMA 1BIFA 1QRAA 2PLRA 3OIWA 4V0KA 3ZS8A 2DFTA 1NVVR 1U94A 3EPHA 3LLUA 2KB0A 1VCNA 1X8JA 4HZUA 1HQYE 2A7QA 2FGKA 2FEMA 2IYTA 1XTJA 4DWJA 1U9IC 4F4JA 2A5FA 2E87A 2BBOA 2V3CC 1OE0A 4I81A 2VTKA 1M7HA 2KJQA 3NH6A 5AJYA 2BM0A 1J99A 5F3WB 2RGAA 1DAKA 1KGDA 1L4YA 3NBXX 3PUWA 4XSGA 1F48A 1JECA 2BCJQ 2CVFA 3ZVLA 3R8FA 2QMUA 3GJ7A 4AY2A 1EWQA 4Q4HB 2QPOA 2H7VA 2NO6A 1MKYA 4LC1A 3A58B 4HDOB 3QG5A 1UBFA 4JBXA 1NP6A 4Z1MD 2OUKA 2GVZC 4NL4H 4TL6A 5KYKA 2AHOA 1R8QA 1KK2A 2HEIA 3DHWC 2A5JA 1LVGA 4JVMA 1M1YE 4GOXA 1TF2A 4M1TA 3LO5A 2J41A 3EC2A 2FJUA 4DT1B 5F9HA 5CK4A 4MRSA 1Q3TA 2QE7A 1WB9A 3FB4A 3RANA 2EW1A 2ZI6A 3BB3A 1P73A 3ZYCA 2BJWA 2ZETA 4N0EA 2EWWA 1NBME 3A1WA 3UIEA 3X1YA 1E69A 1G6HA 3U7HB 4AG6A 1H8EA 4OHZA 3K9NA 4JT4A 2FX3A 4TL9A 5FBLB 3VMFA 2BMDA 3VR1A 2R6DA 2WJHA 2YJTD 4M1MA 3ASZA 4PZZA 2HV8A 2RH5A 4Q47A 1M2OB 3QBTA 2VYFA 5JMTA 3BERA 1ZNWA 1KO4A 2R2AA 1CJMA 1P2UA 1P6XA 2JASA 3C15C 5TY0A 2Q6TA 3SS8A 3GLFB 3MLEA 1Z8FA 3CRQA 4C0AC 4A1FA 1Z0JA 3KZ1E 4B3CA 1MABB 5K8TA 3CWZA 3T35A 4DLSA 1AKEA 3M4YA 3THOA 5KSPA 1OB5A 4OL0A 2MSEB 2IYWA 3GPLA 1Z0KA 4OI1A 5CIWA 4LBYA 1M74A 2OXRA 1K5DA 1ELOA 1M7GA 1QHNA 5SZKB 1UJ2A 3G5UA 1GKIA 4LHZA 1T0JB 2GEDA 2GEUA 3LH5A 1EFRD 5ELXA 4QJ5A 3IPYA 3EPLA 1GSIA 3RRYA 3AVQA 3L8ZA 4ACBA 3SNHA 2PMDA 1Q1BA 4OK5A 2JLUA 4L9WA 3TRFA 4DSNA 5JCZA 3DZDA 2HLDD 1Q44A 2ZRNA 2ZRIA 3LW7A 1F2TA 4DEXA 2W6IA 2Q3FA 4HLCA 4G01B 4DVGA 4GPTA 3K70D 4XIGS 3ZIAA 1VG8A 3PIRA 3BXZA 3MAAC 5EJEA 1W46A 3P4YA 3B5JA 3UPUA 1EWRA 3K0CC 2RMKA 1J8MF 4L15A 5JEDA 1FUKA 3DZ8A 1KY3A 5FPHA 1AS0A 3TAHA 4B71A 1XMIA 1KDOA 4NZYA 4OHVA 4EPRA 2PJZA 1G7RA 2LCFA 4NTZA 4HEJA 3QKUA 4TQ9A 3MD0A 1N6RA 2JAQA 5JS8A 2XOKA 1KMHA 2F1JA 4GOKA 3TKLA 1XCPA 3ZH9B 2O0HA 2UKDA 1WBBA 3THWA 2V4ZA 5FTNA 1GM5A 2ZSFA 3CW2A 1B23P 4DLUA 4PZLA 2YC2C 5AR1A 3W6OA 4H9GA 4QFMA 3QPWA 1W0JA 2XTNA 2YWEA 2V54A 2PJRA 4D4LA 1G3IA 2HXSA 4NP6A 2I1QA 2F1IA 2OAQ1 4PHTA 3GLHB 1IY1A 3PVSA 5M04A 1U0HC 4Q4AB 4N3NA 4ARZA 1GAJA 2FH5B 3K0AB 3KJHA 1Z0AA 2I4IA 1HEIA 3F8TA 4TYNA 3WYAA 4EPXA 1TU4A 2JJ1A 3HPRA 2RGEA 1ZP6A 1KKLA 3TGPA 1D9XA 3DM5A 4OK3A 5KTYA 2O8DB 4OQXA 2IXFA 3K1JA 4PO8A 2EFEB 5TXGA 1WCV1 5B64A 1JAIA 2Y8EA 1VMAA 2IYSA 3VTKA 1KI6B 3GEIA 1W0KD 2HCBA 2ZVPX 2F1HA 3AVUA 4U5XA 5EE9A 3RRZA 3MFYA 1GL9B 4M9XA 4WBSA 2W6JA 4NCKA 3SDZA 2G1JA 3HYRA 1P4SA 5LPNA 3FDIA 3FOZA 1QVRA 1XTQA 2N46A 4BZPA 3K0SA 4FWTA 3QNUA 3FKSA 3VKGA 4WIAA 4Q1AA 4LBZA 1C1YA 1ZYUA 1JPJA 4TMXA 4BFTA 2DWOA 4F4CA 4Q9HA 3I32A 2WHXA 3GEHA 3O47A 4YMSA 4NYIR 5FUYA 4Q1DA 2EWVA 3ADBA 1WF3A 4HAUA 2HCJB 3DKVA 1VG0B 1SVSA 4JJZA 4C7OB 3AQ4A 1N3BA 1R7RA 3AF2A 3QVVA 3RSLA 1XEXA 2FG5A 4GZLA 3LLMA 3GLGA 1CR0A 1YZKA 4H1UA 5E7MA 2OCAA 1E79A 2DFNA 2ZEJA 4TL7A 1FX0B 4A6PA 1KI7A 4I1UA 2ORWA 5FBVB 3PEUA 1HE8B 1DPFA 2PMKA 1T91A 2IYYA 1AQYA 1XDBA 2NO1A 2IF2A 4QGFA 3EW9A 1T9HA 2WKRA 2IYRA 5JJLA 2F1RA 1DOAA 2KBEA 2P3SA 4QNMA 3CB4A 1OYWA 3RS3A 2D7CA 4KYIB 2D4HA 1KJYA 2L0XA 4QGGA 4PPQA 1EXMA 5DO9A 2ZJZA 4QHSA 3UMFA 4B43A 3VNUA 1S9HA 3IQWA 1G8FA 1R10A 3FVQA 4CEHA 2Z83A 3HDTA 1X6VA 1HURA 1R0YA 4N1AA 2JDID 1JQLB 5EUQB 3QXSA 1EESA 1R6BX 4RD4A 3EIEA 3NTUA 5KHOC 5L3SA 1VHLA 1DO0A 5CJ2A 2RHMA 3Q85A 4A2WA 3BH0A 3QXHA 1TQ4A 1QHSA 2ZS8A 4GSYA 1Q0UA 3B78A 2F43A 1E9BA 1G4UR 3DPUA 3Q9LA 4IW3B 4IXNA 4JVNA 4Q4JA 3TW4A 3T5GA 1OW3B 2J7KA 2HYDA 1V43A 5F9FA 2DYKA 5DN6D 4WAUA 2A3RA 3BFKA 1R0XA 5KDLA 4GNKA 3AKEA 1Z6AA 3EASA 4C4PA 4MRRA 4Q1CA 4V03A 3MWKA 2QGZA 3LWNA 1HT2E 4L9SA 4DSUA 3SE0A 821PA 2EVWX 1NG1A 2YWHA 1RYFA 3R7WB 3L0OA 4JLPA 1GDDA 4JS0A 2G0TA 2CLCX 1X8KA 2J0UA 3H0KA 4BGDA 1KOFA 1MH1A 4UXJA 1XTSA 1RE0A 1SXJA 1OSNA 1XJCA 1CJVC 3DMDA 1OXSC 3PQCA 3LVRE 3VQTA 4B35A 1WXQA 2ZSDA 4D26A 2IC5A 1HQCA 5JBQA 1KI1A 1HH4A 1UKYA 2ZSBA 4X8MA 4W9MC 1QHXA 1FL9A 1CULC 2C9OA 2QBYB 1KK1A 2K5UA 3EA0A 1XBTA 1CP2A 1SKYB 2MSCB 2V8OA 4ZCMA 1VHTA 3CRRA 5LB4A 1DARA 4EJSA 3OIVA 5JRJA 1TF5A 4UXHA 4ON9A 4FCTA 3AVTA 4PHFA 2WOJA 1GNRA 4P0TA 3TQFA 421PA 3EZ6A 5B57C 1M8PA 5FR1A 4G5OA 5B2ZA 4PANA 4QL3A 3T34A 5KNBA 3CZQA 3E2IA 2IUTA 2AXNA 1S1MA 4NH0A 3Q7QA 3HWSA 4QHYA 4A92A 2WMNB 2J7PA 5DLQC 3VAAA 2FZ4A 2AFHE 1GOTA 4O3MA 3WNDA 3LVQE 3I1FA 3U7GA 1TX4B 1E2HA 2WJVA 4MYTA 2C8VA 3B1XA 1KO8A 2GDJA 2QN6A 2GXUA 1E1QA 4IXMA 4AKIA 3KL4A 4BLSA 4XOIA 2QP9X 1QBKC 3GLIE 1NNEA 2FOLA 1UBGA 4HLDA 2ZI9A 2RGBA 1OJLA 2IT1A 3RS0A 2G77B 1NF3A 3I5YA 2HJGA 4JLAA 1D8TA 2OCBA 4RFSB 3T5DA 1NG9A 1XPOA 3NBFA 5CLQA 1I2DA 4N0DA 4DDWA 4B32A 1FFHA 1N6PA 1YHNA 1A1VA 2XAUA 1LS6A 2GBLA 2WWWA 2HT6A 1H8HD 2ZE7A 1P9RA 2DR3A 3QIAA 3CF0A 1P75A 1DAEA 2PX0A 3KB1A 3NHBA 3EZ7A 2EFCB 4V0LA 1KTVA 2CNWD 1NVVQ 4BZQA 4DB4A 4TMKA 4HZUB 1NSFA 3ZVRA 3SZRA 1VCMA 2QTHA 4Q9JA 3DKPA 2YYZA 4C0LA 6Q21A 2R44A 3IHLA 4QGAA 1ZBDA 4Q9IA 3OESA 5JSZA 1N6HA 3MMPA 1EG7A 4DCVA 2P6NA 2ZYWX 2AK3A 2WKQA 2BEJA 4D0LB 2A5DA 3T1TA 1R4AA 3NIBA 2F6RA 1XU4A 2H57A 2ZE8A 4S2EA 4WXPA 3FFBA 2VLIA 4HB4A 2DWQA 3GFTA 3EPJA 2E1RA 4RZ2A 2ZSAA 2C99A 4BFZA 1XNJA 1VPLA 1S96A 3GD7A 4LYAA 1RJ9A 3W3ZB 4A6XA 3A1VA 3WMEA 2I3BA 1NKTA 3O8DA 1D9ZA 3CH4B 2IEZA 3OFNA 5FTKA 2LKCA 3TSOA 2P5TB 4BPBA 1FP7A 4LZZA 5BQ5A 3E5HA 2VRWA 1CJKC 3KB2A 2QTVB 4P33A 4WOPA 3SJZA 2IS2A 3TW8B 3ZJYA 1PLLA 2Q9CA 4UJ3A 3I92A 3REFA 1L7VC 1VIAA 4KVAA 3W6PA 3RVBA 4US1R 3U60B 4GP6A 2OHFA 1ZNYA 1C9KA 2HF9A 2J87A 4G1UC 2VA8A 4MRVA 1SXJC 4LJ4A 4ZCIA 3L2OB 4M1SA 1KNQA 2ZAMA 2CHGA 1OH7A 1FQKA 3LBIA 3U3MA 5AJZA 4A8JA 1KAOA 5DI3A 1ZC3A 4B6EA 4Q01A 2REXB 3LAWA 1KDRA 4TN1A 3VR4A 3OEHD 4EJSC 1I4TD 1DTSA 4RD2A 1IN7A 3IUYA 2AKYA 4XD7D 3LD9A 3TR0A 3TMKA 1V5WA 1ZM4A 4Q5IA 4JLMA 1MO4A 4BEJA 3PEWA 4ERNA 2ECKA 2O5VA 4PR0A 3A1SA 3M6AA 1DO2A 1VKJA 2XGJA 5CM8B 3OIUA 5KSYA 4YXWA 2FEOA 1N6IA 1NKSA 4NBSA 5FI0B 4QJ4A 3KKNA 1CKEA 1KI4A 2CLDX 3ND9A 2H8KA 1P3JA 4BECA 4F92B 1E9DA 3C5HA 2IYUA 1E9EA 1YJ5A 2NMVA 4F7WA 4R9UC 2CK3D 4ASUD 2J3EA 1OPXA 4D0GA 1F2TB 3C14C 4MUBA 1XFAA 1FPMA 2QG6A 1U90A 2YNMA 3EXAA 4LYJA 2ZRBA 3ICQB 4JZKA 4UNRA 1DAFA 2QZ4A 4MKFA 3LX8A 1IY0A 1KZGB 2PH1A 3ADCA 4U00A 4YMUA 3ICEA 4MQBA 2P67A 3D8BA 3A4NA 2C03A 5DE3A 3BH6A 1E2EA 2FSFA 4B3BA 4G5GA 2YWFA 4M22A 1SHKA 1XWIA 2F9MA 2GBLC 1HA3A 4PTLA 1QG4A 5HE9A 3KQKA 2BBSA 3SBEA 2B6HA 1KMHB 3HR8A 4Q1BA 4OI2A 2CEAA 2WOOA 2IS4A 3THWB 4TMZA 2W2VA 3U7FB 2R62A 3MUFA 1G3UA 1YR7A 2PT5A 3UANA 3AM1A 1G41A 1W47A 1CRQA 2VP0A 3KQHA 1JPNA 2NG1A 2WZQA 4B3DA 4LHWA 4AC9A 4FW9A 4DIDA 1EFRA 1OFHA 4HUQA 1AGPA 4Q7JB 1W5SA 3A1TA 2OCPA 1P7CA 2WSSD 4FCWA 4TLAA 4BFWA 2RKOA 4LV6A 1SKQA 4ARZB 5A0FA 1K5GA 1IONA 4ZCLA 3SYNA 3T61A 2JJ2A 3TIFA 2ODBA 2R9VA 2ZJYA 4HDQB 2ZJ2A 1CF4A 2WTUA 1XD2A 4B6FA 2QENA 4L16A 3RHFA 3X1WA 4BLOA 5JHGB 4D25A 3OF5A 3BFVA 2W0MA 4F91B 1VYVA 1TPZA 2GTPA 2QSYA 2X1VA 2PZEA 4NYMR 1OXTA 3B7GA 3NDPA 2FN4A 3TBKA 2IHBA 4PAMA 2OILA 3O8BA 3FKQA 2BWJA 4RJLA 2XNDD 4IVRA 1FUUA 2ZYTX 3ZQJA 1JAHA 1G8PA 5GJBA 1G7SA 2QPAA 3QPUA 4ITRC 2GKSA 3B85A 1W4RA 1UM8A 1D2EA 1G5RA 1E1RD 1E2IA 3CH5A 1JBKA 1OV4A 1VG1A 4LI0A 2XJ4A 3Q5DA 1S4QA 2WPDD 1QG2A 3M0EA 4TT3A 5C4GB 3VR5A 1KY2A 4XVQA 4AIIA 1IN5A 1F60A 4GP7A 4RD1A 2ZR0A 1UKEA 3MRSA 4DIEA 3FE2A 4GT1A 5TVKA 3WXMA 1JXOA 4FD2A 4DUGD 1VIYA 4A8JC 3LXRA 4C0SA 4L4UA 2Q9AA 3UG6A 1G3MA 2QP3A 5DGXA 5FOXA 3VX3A 4OI0A 5FPSA 4NONA 4A82A 5ANRB 3B9QA 3CO5A 3KKQA 3ZS9A 1XEWX 3RSOA 3ND8A 2YVUA 4A36A 2IF0A 4LV5B 2F9LA 5AK0A 4CEIA 3OEED 1NVXQ 4D82A 3IEVA 1XEXB 2ZUCA 4MITA 4B34A 1O3YA 2B8WA 2C95A 3NEJA 1OLOA 5LB2A 1W44A 2OFOA 4IDPA 4DCSA 2EFDB 2D74A 3CX7A 3LW8A 3VR2A 3GLGB 1A7JA 3IGFA 2ZJ5A 4B47A 1AZSC 5EXTA 1IOZA 1IM2A 5SZJA 3U61B 3MSXA 4D80A 5KO2A 4JKIA 1NLFA 1ZIOA 5BN5A 4PC6A 4PPFA 5CB8A 1MRNA 1S8FA 1Z0DA 2H92A 1Q1QA 4HDCA 4NCHA 4QG7A 1A4RA 3EZ9A 4D2IA 4O0MA 4PSKA 3RRMA 3GLFE 2QI9C 3NDBB 3BAFA 2BKEA 4DLVA 4LJ9A 2GJAA 1Q22A 1TQDA 4DLWA 1ZUNB 2QUZA 3UMRA 1FP6A 1T6NA 3G0HA 1RRFA 1TQ6A 1WE2A 1KSGA 1G3QA 2A5YB 2ODNA 2JLWA 4Q7LA 1ZM2A 3CX6A 4LHYA 1E2LA 5IK2D 1CJUC 3V00A 5K8LA 1EX7A 2WJJA 1XD9A 4CEHB 1HE1C 3A36A 3QXCA 5UKDA 4M0LA 3ZZUA 2V1UA 1KO7A 1JR3D 4QJ3A 1U0LA 5SZIA 3F0TA 1SVKA 5L3SB 3GJ4A 5EXSA 3SEAA 1XZQA 1YR9A 1E6CA 2ZI4A 2Q9BA 2ANCA 1UF9A 3U6BA 1Q57A 3DEFA 2VP4A 3KXKA 3T15A 3VHXA 1S1CA 3HU1A 2F43B 3AGPA 4IOJA 4H1VA 4LY6A 4Q4JB 4YMVA 1KDPA 1EK0A 2V1XA 4P31A 5G3ZA 4LUCA 2NO7A 4EPTA 3ZLJA 1N6KA 3P1JA 2G1KA 4KSBA 4Q18A 4TMWA 4Q7MB 5BXQC 1DE0A 1FZQA 2XB2A 2X2EA 3THXA 1S3SA 2EU8A 5JJKA 3MWYW 1COWA 4BFVA 2WV9A 721PA 5KPJA 2GZHA 1AJEA 2BDTA 1RIFA 3P4XA 4JL5A 4M2LA 4E03A 3K70C 1P72A 3HYTA 1FMLA 4TMVA 4A0RA 3KDSE 2J0UB 1N6LA 2VSXA 2X19A 2ZTSA 3NKVA 4BFSA 1KI2A 1SXJB 2QU8A 4R2IA 2FNAA 1N0WA 4LJ7A 1D6JA 2D06A 2O8BA 4DLRA 3THYA 2PCJA 1EFUA 4P4SA 4BRWA 4V0MA 1J90A 2NZ8A 2Z6VA 3DVLA 3RAPR 5SZHB 4ZIRA 2J59A 4K81B 4FXPA 2AN9A 5AJWA 4B44A 1E3MA 4O2RA 4HSEA 1E0AA 4EJSB 1YRAA 3MWJA 2O8CA 1XB2A 3GLHE 1BMFA 2VIIA 3WHKA 3AVWA 2OE2A 2ONJA 2CHVA 4PXAA 4JKYA 2BHRA 2IYQA 2ASEA 2JIZA 1E9RA 5HKKA 3AF4A 5DN6A 1AZTA 2GF9A 2OZEA 2XEXA 3SHFA 2W2TA 4TSFD 5LDDC 1II8A 1IHUA 1YZGA 1DVRA 4IDOA 4W5JA 5C46F 1Q20A 4PSVA 4X8LA 1D2MA 1A2KC 3BFXA 4QBHA 2YHSA 4FINA 2N1BA 3BGWA 2JA1A 1GUAA 3KUCA 2R6AA 4DCUA 4HB2A 4DDTA 3IILA 3VU9A 5DNYB 3FYHA 4JSYA 4QM6A 2VHQA 2LWIA 3SFVA 2NTYC 4BFUA 2FV8A 2HJVA 3QF4A 2VF7A 4ZDJA 1GRRA 2RHDA 1P60A 5GVSA 1XXHA 4OQFA 3LDAA 3WBKA 1GWNA 4GMXA 3EZ2A 2J0QA 4JIMA 5KSZA 1KJZA 1SZPA 2BVNA 2CDNA 1TEVA 2KE5A 3QENA 4LV8B 2P2LA 4QOSA 2OCYC 3CR8A 3FHCB 3R8CA 3OE7A 1S9DA 3NHAA 2FFAA 2YOHA 1BH2A 2JLSA 2CBZA 3PENA 3ZD6A 4JBYA 1F2UA 1CRPA 1R8SA 4KFRA 3SJBA 1FMJA 2GAAA 5P21A 1AIPA 1X3SA 3KJIA 4Q00A 4QKQA 3ADDA 1E2MA 2AD1A 2B92A 4EFLA 5K8UA 1RC8A 1OXUA 5JSZB 1W4BA 1T8TA 3B1WA 2CMKA 5AWFC 2FFBA 3AVOA 5FH9A 1QVAA 3GFPA 4LX0A 1I2MA 3QQ5A 3BJIC 3RNLA 2C04A 1AKYA 1G19A 1PVOA 1YZTA 2P0EA 1G291 1XZPA 4ACAA 5CYOA 1IXZA 1UBCA 2IXEA 1W1WA 1X1RA 4QGHA 5H1YA 2FPKA 4RD6A 4TLBA 2SHKA 1XTIA 4KLZA 2V7QA 4G0NA 3TQCA 2DFKB 1RJ9B 3WYFA 4ZKEA 1K6MA 4EQ6A 3I73A 2FPLA 1DADA 2MMCA 1E2FA 1MO3A 3RDPA 4B2PA 4ZDKA 3GJ6A 1ZW6A 4LWZA 1W36C 2QL6A 1XMSA 5FPTA 2O52A 2OV2A 1II0A 4HAXA 3ZQ6A 4E07A 1W5TA 2QE7D 2ZAOA 3CKLA 1AS3A 3VR6A 2J0VA 3GCGA 2X2FA 2IYLD 4TWZA 5HCIA 2JEOA 5FTMA 5CDFA 2IK8A 3FGNA 1H8ED 5J4KA 1E99A 5CITA 3AKDA 1E9SA 5GJVC 2QQEA 3TJZA 1E2GA 1OIWA 1JR3E 4IHQA 2ZRFA 3LY5A 3QXXA 1DAGA 5JI3E 2QRZA 3P27A 3FHOA 3L0SA 3Q5EA 2MMGA 2NIPA 2WMOB 1ONBA 4A8JB 4LPSA 1W4CA 5FUXA 1Z6XA 1Z3IX 5DI3B 3S1AA 4A0FA 4B48A 3BWDD 3UXMA 2QORA 4US0R 2R65A 3LBHA 4B33A 5EQTA 2HXYA 3CRW1 3U2QA 1AA9A 1ZD8A 3ZGXA 4JLJA 3TLXA 1XD8A 2ZI5A 1DAIA 1TUIA 4MRPA 1Z5ZA 1ZM3A 2UVQA 4OJQA 2FSGA 4Q9KA 2BC9A 1WA5A 1VTKA 3IO3A 1Z29A 3CNLA 1II9A 2V9PA 2W2XA 2XZOA 2NZJA 4AD8A 4QC2A 2ZRPA 3ZVMA 2ZJAA 4A0HA 4I4LA 5IF9A 4MDFA 5FL7A 4II7A 4BLTA 1RZ3A 1KJWA 3KFXA 3R9WA 3AP2A 1T3SA 1ZNXA 1CS4C 1IN4A 1OKKA 1U8YA 1JEEA 4IRUB 2W6ID 3WP0A 3ZIAD 1NMYA 3CPHA 1VDZA 1SKYE 2AK2A 4X8OA 1LTQA 3ETLA 1IQPA 1XCGB 3CUEF 4K46A 1G1MA 4Z8YA 5EZ5A 3PR1A 5C2JB 3QEOA 3MJRA 3ZZTA 1I4LD 2FDCA 4C0HA 2O8EA 5TARA 4HZIA 4IDQA 5JI2E 4LC0A 3BBPA 4Z51A 2IA5A 1FNNA 4KFUA 1OFUX 3DOFA 2WIAA 1ZCAA 3MCAA 2RGNA 4KVGA 2CHQA 4LOAA 1YZLA 2XOKD 2YZ2A 1XMVA 3B82A 2HT1A 2Z0MA 3CRVA 2DWPA 2OO7A 1DAHA 4HAZA 2OFWA 2QROA 3QBVA 1N5JA 2XJ9A 1X1SA 1W0JD 2ZRKA 1N25A 4URUR 2PCLA 4PHHA 1E4YA 4Q03A 1NN3A 2YC4C 1NBMA 4D6PA 1HTWA 1KHTA 4IDNA 5TV2A 3PXGA 4HUTA 2GZAA 1E2JA 2REOA 5J4LA 5KPDA 2YWGA 4CIDA 4YDHB 4XH9B 1IAQA 3NBYC 3J81k 2A78A 1KK3A 1G9XA 2ERXA 2XX3A 4CT4B 4ZDIA 4HUQB 3FWYA 3PUZA 2FU5C 4KXFB 4WA7A 2AWNA 5KNDA 1E98A 1OH5A 3SI7A 3CONA 3BK7A 1ZJ6A 3UWKA 1ZU4A 2QT1A 4ASUA 4Q48A 3LA6A 5FPYA 2JJ1D 2ZRLA 1Z63A 1XD2B 3DDCA 3F5FA 4O2LA 3OAAA 2JGNA 3K70B 3T1QA 2BBTA 5F98A 3CX8A 4BE7B 5KU1A 4NKRA 3PG5A 2C78A 3W9YA 2ZI3A 4NYMQ 3QSYA 2BMEA 2DPXA 1ZAKA 5FBQB 4MDEA 3AEZA 1S2MA 4A2QA 1MO6A 3CLVA 2N42A 1EFTA 3SHWA 2W6JD 3H2YA 1WMSA 2ZQ5A 4F4IA 5FTLA 3RS4A 4TQAA 1QF9A 3NH9A 1YR8A 2G6BA 3I5XA 3FKSD 5A5GA 3PJRA 3WHLA 1N5LA 4LDJA 1TF7A 4XVUA 1NMZA 2NGRA 4MKGA 4DLZA 4CRWB 1E2KA 2ONKA 2C5LA 4PFSA 2ZE5A 4TYWA 2IXGA 5FOVA 4LJYA 4CVNA 4S35A 3DOEA 1GRNA 4TZ6A 2VPPA 1R5BA 2XSZA 2J9RA 2PLFA 2NO0A 1GVNB 4A9AA 3F3YA 4BLRA 4FCVA 2WSSA 3RLFA 2CVHA 1S0UA 2OBNA 3H4MA 1ZMXA 3LNCA 5BYJA 4DZZA 1MO5A 4CEIB 1NLYA 2Q3MA 3IBYA 4C2UA 1Z2AA 3K0FA 3QI2A 4U02A 5JECA 2GCOA 3NXSA 3HPQA 4EUNA 2R6CA 2WJYA 5L3RA 4AKHA 5J47A 3M1IA 2J0SA 3UATA 1JEDA 5FOTA 2DCUA 4AYWA 5H8WA 4NU0A 4FMBB 4XTRA 3VHLB 1SULA 3WMGA 2BMFA 1E9AA 2D62A 3CZPA 5GADl 4QBFA 1G21E 1RFLA 4PO9A 1IN6A 1XTKA 3U5ZB 2AD5A 1P9WA 1RVDA 4YDSA 5EP2A 1Z08A 1GL7A 1M7BA 2WWIA 2XXAA 3FTQA 3WP1B 4Z54A 3EPKA 3KTAA 3W5JA 2IUUA 1NI3A 2GXAA 4B74A 3DO6A 2QTFA 4BWYA 2BCGY 3X1DA 4XSHA 4UKDA 3EZFA 2FSHA 1BO6A 3H1TA 3HR7A 1AN0A 4GDFA 3QPVA 3FMIA 4LYHA 5AUNB 4DUGA 2RGNC 4JLBA 1E96A 5DYIA 5KOYA 3AF3A 2JLYA 4CEJA 1KMQA 2W83A 4L8GA 4GZMA 3OZXA 1XJQA 2QRNA 5L8VA 1AK2A 1P5ZB 2V6JA 4U7DA 3U3JA 3D31A 5H68A 1TAGA 2Q21A 1Z07A 2VBCA 3H86A 3P26A 2IL1A 3ASYA 3DL0A 1OIXA 2JATA 4DJTA 4C0BA 3JZAA 2VH5R 1W36B 3PEVA 3PUYA 3KXIA 1AQUA 2FFHA 3THXB 4C9BA 3AP3A 3BOSA 2RGCA 3C41J 4D0NA 1N6NA 1IN8A 3D3QA 2ZE6A 3QKRA 1KK0A 1OXVA 2OBMA 2ORVA 1FTNA 4M1OA 1QHIA 2C98A 4DLXA 4Z1MA 3WBJA 2RGDA 4MGKR 1G6OA 2ZRAA 4MGIR 2FGJA 1HT1E 5J40A 3RS5A 2VEDA 1M34E 2WIBA 4WZBE 1GKUB 3DMNA 2JJ8A 2OLJA 1CBUA 1EGAA 3SOPA 2O8BB 3MG9A 3THYB 2OESA 4P4SB 1YZQA 4YLGA 5GJCA 4JMPA 1OHHD 2ZUBA 3LV8A 1E2QA 2QAGA 1G16A 2F3TA 1G8GA 1Z6GA 3B13B 3X1XA 1Z6YA 1DEKA 1T5IA 1B0UA 3ZDQA 4ZIRB 4ZV4A 3ZVNA 3PV0A 3HU2A 1CJTC 4TLCA 1Z0FA 5CM9C 1U81A 5E7JA 3U4QA 3AB3A 5CYPA 3W3AA 2O8CB 4MA4A 1ZM7A 1BS1A 4TYPA 2GWHA 3C5CA 2IWRA 4B3XA 4TQUS 5G41A 2H17A 1XF9A 5EE5B 4KFSA 1IJFA 5LD2C 4ILEA 2F55A 2JLQA 1HUQA 5EP3A 2PEZA 2J7PD 5KSOA 4ZI2A 1BOFA 1G7CA 3AP1A 1J70A 2CL7X 4EPWA 3PUXA 2IX3A 3VKWA 1II8B 5KUTA 2ZI7A 4B2IA 8OHMA 4PAOA 1KZ7B 2LKDA 1OIVA 1YE8A 2UZIR 1OF1A 2ZYVX 5EE0A 2XNSA 4LPKA 1ZD1A 4FI3C 3VU9B 1JB1A 4GBMA 4JL6A 4EPYA 4PHGA 3REGA 4FMCF 1XEFA 4G3XA 3QF4B 1XMJA 2J5XA 2PEYA 4DLYA 4B76A 2A9KA 5AJVB 5KDOA 2QGNA 1XXHB 2HLDA 3RWMB 1UKVY 1ZD9A 4CT5A 1XJ0A 1IY2A 4PPNA 2GESA 3AH8A 4IKEA 2IS1A 3CPJB 1FOEB 2QAJA 1W4AA 3NWJA 1Q1ZA 2R6GA 1KI8A 1NY6A 1YZUA 5G53C 1Q1EA 2RAPA 3E1SA 4FMDB 4LCBA 3SFZA 2ODEA 4B2LA 3R9XA 2DB3A 1F2UB 1OH6A 3B60A 4WZ6A 1W2GA 4PC7A 1Y3AA 2QNRA 2VHCA 4O25A 2QA5A 5J4VA 1N2CE 1GZSA 3PEYA 4V0OA 4KBGA 4OHYA 3CM0A 5JEEA 3GLGE 5EE1A 3AGQA 4Z8XA 4PQFA 1Z83A 3V4FA 4NDZA 4C0KA 1G20E 4I99A 3T06B 4Q9LA 1U8ZA 2Q0HA 3MGCA 1BYUA 621PA 3QJYA 2FF7A 3HU3A 2XZLA 2CCJA 2QMOA 3MWLA 4MRNA 2WWFA 2AXPA 2OAP1 2WJGA 121PA 2EYUA 4ABYA 3AVYA 5DISB 4FIDA 3IPXA 3W90A 4NYJQ 1E0SA 1WQ1R 4RZUA 4EQ6B 2GK6A 3OFND 2HUPA 4IOMA 1SGWA 2YOGA 4IOKA 1YZNA 4TTPA 4E5UA 4XWKA 1GL6A 4CGZA 4URYR 2WJIA 1ESMA 2AR7A 3GQBA 3RRNA 1RYHA 4YC7A 4AI6A 2CCKA 5KNCA 4M9ZA 3K53A 3GJ0A 3PFIA 1W49A 5C4MA 1AM4D 1F6BA 3JVVA 1KIMA 1NIJA 1JJ7A
chains in the Genus database with same CATH superfamily
4KV9A 4C4ZA 4KLNA 5CFZA 5KC9A 2UYQA 1M0SA 3FRIA 3ZJ4A 3ZQKA 3O4FA 1CX9B 3CNOA 2X77A 1UXIA 3IR6A 2MSDB 3IIMA 4NHOA 3V48A 3BE4A 1AV6A 4EO7A 4FB5A 1YA6A 1T36A 4GC5A 3T0IA 1RR6A 1ZS9A 4PN3A 3FPAA 4EB3A 5ITSA 1ZRSA 2HA6A 3W2EA 1KU0A 1UJ4A 2BZSA 2R96A 1GFIA 1BW9B 2FA9A 3PA8A 4RFLA 4JB8A 3AMVA 3D9QX 3DE1X 3HCWA 5IJ0B 4OX9B 2R5WA 3ENNA 1PFKA 2FZLA 3OOYA 1QH1A 4TMTA 3EA4A 1O0CA 2WUEA 1LDEA 4BVAA 5CHYA 2C61A 2X9NA 1QPGA 1WD5A 2X5OA 3INTA 1WIWA 4AN1A 1YS7A 2PA0A 1R0WA 2FP3A 1NNUA 2GETA 5AW5A 5LYJA 4FDTA 4FZJA 2JGEA 1D2NA 1U0RA 4WDQA 1XA3A 2XT9A 2BFDB 3QKSA 3O1LA 4JLVA 4AK9A 1IY9A 1OFVA 1UBTS 3IKVA 3BD6A 4OA5A 2IZ6A 3H9UA 3GFFA 4ENPA 3BWVA 3GUCA 1B8OA 3CGGA 4P93A 3WMWA 1EUDB 3A27A 1ZC4A 2HQRA 1YT5A 4RZ3A 1HNXB 1A7UA 1T25A 1U0JA 2B69A 2VK4A 1KEVA 4I6JA 4K9KA 4PAQA 2C5AA 3OQMA 2PX6A 2XGOA 3AR9A 4E14A 1TQHA 2H59A 3HN6A 2VRCA 4BX9A 2FUG6 4XDHA 2AUMA 1BRTA 3W79A 4QUJA 1L1EA 2IJGX 2YNMD 2ZR7A 3BF8A 4GVPA 2ANBA 2H00A 2CMGA 4OA8A 4L8LA 1VPTA 1HGXA 2FQ1A 1A7KA 1D1QA 2FW1A 3EC1A 3PJDA 4ZYVA 5G4KA 4EY6A 5AUQA 4WESA 4C3ZA 1YQ9A 4EKYA 1B74A 1P9NA 3FZEA 2X4GA 1QV6A 3K72B 1KBQA 2J6HA 2YH2A 3CR3C 1U98A 2C94A 2GZDA 3VYRB 2F9FA 2A4KA 5HNKA 3KVNA 2O2ZA 4MQ6A 5B3JC 2A5LA 3EMVA 3B6KA 5IHPA 1XNHA 5K9ZA 2CT8A 5LLTA 2H16A 1DKNA 2OSBA 1KYIA 3H42B 2CSUA 1GR1A 3G2MA 1CUVA 2CDCA 5ALQA 1MOZA 1O08A 2JC3A 1Z5VA 4RTQA 4LMRA 4P98A 4PIVA 1ORVA 4DJJA 1X94A 1VHDA 4R2KA 4JU8A 4ZI5A 2A0YA 2RHHA 4JI7B 1IHDA 3CCFA 2OWDA 3I0ZA 1L7OA 2I22A 2G1AA 4ZD6A 4AN4A 3BD9A 5DM70 5DX1A 5IT4A 2JLXA 2WWHA 4BNIA 2YHIB 2WHPA 3EXHB 5KNBH 4XQCA 4FZVA 4MNTA 4W1QA 1B8VA 3ELYA 3D5EA 1X14A 3ADKA 3B7PA 2QEQA 4IYJA 3VC1A 1MV5A 1SCNE 3W2IA 4E5PA 4UOEA 4UNSA 1MEOA 1TQ2A 4HRVA 2Q49A 3IO5A 4GHWA 2O0LA 3E70C 2AN3A 2HLPA 4RHUA 4O4HA 1WZEA 3USCS 2F3UA 4A23A 4JLWA 2JI7A 1KIFA 4XARA 3R2JA 2IX9A 5JFTA 1RAIA 4FFBB 4DIBA 3S1SA 1CFZA 5EEHA 3ZU6A 3A1FA 2XE6A 2RONA 2FW0A 2J3JA 1GQFA 1DDOA 1GD1O 3VR3A 2X8LA 4URVR 1G5PA 3MFQA 2WHEA 2RJNA 3MQ4A 4CMCA 2A2ZA 4WL0A 4Y98A 3QBJA 4B73A 1DT3A 2L82A 3I9KA 3OZAA 4OP2A 5HTKA 3ZDZB 4HHEA 3GT4A 1HE4A 2VT3A 4B6QA 5KTSA 2X9VA 1QOZA 2YZGA 2ZJ4A 2JCSA 1O4WA 3LS2A 4TQGA 4J3JA 5AI0A 1CERA 1P29A 4HC4A 2O2IA 3O95A 4P82A 3DS8A 3L1KA 3ZZ0A 4OBWA 1TVEA 4Z4CA 5E6SA 4BTVA 1JAZA 1FNMA 3AEQB 1U2GC 3M83A 4H0NA 2GK7A 3OT4A 4Q3CA 2DECA 4LQCA 4YJ3B 2PE5A 3RV4A 3DUFB 2H1LA 4BFYA 4I1SA 3VR5D 4IJKA 4TWRA 3HBFA 4KK4A 3HACA 1GNPA 1OQAA 2Y6UA 3ZG6A 1L4UA 3EIQA 1CRLA 1FSFA 1YRYE 1YO6A 1P17A 2SKDA 4JN6B 1T1IA 1KSJA 4JVSB 3B1ZA 4YAEA 3L8CA 3NQ41 1VBMA 4J94A 1ZH4A 5BPHA 4JLDA 2RBEA 3G82C 4PZCA 1UPAA 4MUAA 4QPJC 4BGUA 4EY4A 2PR2A 2RGGA 1MW8X 2GBIA 3LPLA 4Q66C 1QGUB 3EVFA 1GIAA 3CR7A 2IGBA 2O0JA 3UG7A 1YZVA 1WU8A 3Q12A 2EC5A 4R31A 3S2ZA 2AR9A 2FE4A 4ZVPA 1Y0BA 2BJVA 2VNAA 1LPBB 1E2NA 1SIBE 1LU9A 2GCOB 4HLQB 3QKIA 2YV5A 3FVTA 4YI3A 5HIMA 3RI3A 2GS9A 4X97A 1P2TA 1LK7A 2OT3B 4E22A 2QT0A 3FLAA 4BLVA 2DEUA 3I3OA 2BP7B 4RD0A 3RAFC 3JD3A 2IIPA 4M0CA 8GPBA 4AP6A 4R6XA 1GV0A 1PX2A 2WSMA 3P9YA 1GKYA 4NE2A 2UUBB 2W37A 1LX7A 2DFLA 4PCUA 2ZJOA 3IDQA 1UXOA 3HC7A 3FYDA 4MJ7A 1JKMA 1TW3A 4EEKA 4U6SA 1XSEA 2A9QA 3X1ZA 1LRKA 4LE0A 3DGEC 3DE7X 3FGPA 4QD3A 3EDOA 2FMUA 4J8PA 4HTFB 2PPVA 4OKSA 4Q19A 2DBVO 2P9HA 3MAGA 4REMA 5K8IA 1Z47A 4Q1FA 4QYMA 1KI3A 1T3HA 1Z34A 1E32A 4EY8A 1CNFA 4KFTA 4KAXA 2ZRCA 3HEBA 1H2XA 3FNIA 1XQYA 2C7GA 1E0KA 4RESA 3X1MA 1WV0A 5C0OE 3IURA 1KKMA 4ZO7A 1UJMA 5J59A 1AKRA 1G2PA 5AM1A 3JARA 3WL7A 1KWGA 3HO8A 1FMFA 1EX9A 3DHVA 4PGFA 5CEEA 3EGOA 2E9SA 5HRAA 1PT8A 3M7IA 4DLAA 2QY6A 3ZTWA 5CT8A 4YR9A 3QQPA 1WSDA 2YVKA 2IWHA 2HJWA 1JXQA 3QBEA 4I2NA 1ZLXA 5AKJA 5EVCA 3WNCA 4N5MA 3GUHA 2VOEA 2X23A 3GFQA 2WB2A 5TIIA 3KSZO 4UM5A 5ETJA 5BQPA 3OCXA 3EWIA 4HX5A 4QO8A 1JBEA 4RLSA 1Z7WA 4R2HA 2CLKB 4ZYZA 2X6TA 3FCOA 2I78A 1EDZA 2BMJA 2IW3A 1KVSA 2B9EA 2XCOA 4JDPA 1R18A 2JFFA 3BWBA 2ICAA 4NQZA 3QUBA 3A6PC 3LY8A 2JRLA 2C7OA 4EJ0A 1ZISA 5T64A 1M0EA 4GE0A 1NKVA 3A4MA 3TZKA 2R3SA 4CE6A 2P5SA 4KIFA 1SVUA 5JWOA 3AG5A 4DXAA 3M8KA 1KSHA 4XDYA 4MYHA 4DV7B 4JBHA 3WRXC 3QU7A 2PNJA 3UJ8A 3IUPA 4DA8A 2E5LB 3UC9A 1CY6A 2QN7A 3B5IA 2O9JA 5HVNA 3SEQA 3ZU5A 3CBQA 1JNYA 4Z51A 4PICA 2GJ9A 1L8QA 2OORA 2ZIUB 1YKSA 5DNUA 3AXTA 1A5SB 4JP2A 5A0VA 4M8NE 2OZKA 3WGJA 4F97A 2I4RA 2C8LA 1J56A 2VHWA 3PITA 3P94A 1P5RA 3SCZA 3A9RA 4DLLA 5J4HA 2EP7A 1OFTA 3EZYA 4DT1A 4PLZA 1T8RA 3GJ8A 4FOTA 4CMIB 3AY6A 1X7HA 2H65A 1W75A 2EKQA 2QD1A 1N0VC 3E9NA 1ZN7A 4QUHA 1PWZA 2GFHA 2GN4A 4FJ0A 1XDUA 3KKPA 3KWJA 4LBVA 1B7GO 1E8NA 4TZTA 3H9BA 2Z4SA 5GGXA 1MVNA 4AL4A 4RXMA 3EMDA 4Q02A 5JZVA 2QAGB 1TU3A 3F4LA 4IH1A 3BMQA 5EGNA 3RAJA 4Q05A 2BLNA 4AO7A 2C2MA 2BSAA 4FR2A 3DLIA 1Z4NA 3DMHA 1F14A 3EHDA 4UBOA 2FPIB 5CB6A 1K4YA 1IBCA 3RSHA 2FZWA 1BMFD 3KZMA 1TAUA 2DZDA 1NF2A 2Y1LA 3IOYA 1N7HA 4Q4LA 1G64A 5ED0A 5EJIA 2GMWA 3IKLA 4H6PA 5HCNA 3DWGA 3OCVA 3NRBA 4FONA 5K3AA 1E4EB 3TSZA 2XA2A 1WDMA 4EI8A 3W1WA 4HNSA 2DQKA 2SBTA 3IKTA 1O0BA 1JIIA 1PR9A 5BOSB 2I87A 1W0CA 2JIZD 3HB4X 1WDWB 3P0EA 3FYCA 5TC4A 5KJFA 3SNKA 5F3DA 1M1YA 1QYWA 2G9UA 2NPFA 4AYXA 3OEHA 4WBNB 3PFHA 3CUTA 2QW1A 3EF0A 2IPOA 4BKPA 1BMDA 2YL2A 7YASA 1FTWA 2CNBA 3OHMA 4XD7A 5CBPA 1TA4A 2I2FA 1N34B 2FUNB 4ZO4A 1XF1A 2JS7A 1DQZA 1LW6E 5FBRB 4IWYA 4DRZA 5JYCA 2VJAA 3X43A 2JLRA 1JU4A 3AWDA 4WCVA 1Y8QA 3SQNA 1RAAA 3D6NB 4KMRA 3CEAA 1Y1TA 1DJQA 3RIXA 1LBQA 1V5GA 1KOJA 1YAJA 1XZNA 2WICA 3K0EA 3NAQA 3TTUA 4GECA 2ONYA 2P7HA 3AF5A 4BBZA 5DSZA 1CUFA 4U1RA 4F5WA 5JHHB 1DINA 1XROA 2JGKA 3RVSA 1MRSA 1R0BA 2QJWA 3WQQA 4AUKA 2CK3A 3UHFA 4GYJA 4OHOA 1P9OA 1ORDA 3UKJA 1G7TA 1ZH0A 1ZMBA 2B4QA 2GSWA 3WC4A 3TVTA 5KYWA 4BLPA 2JNWA 4NCNA 1OHHA 4NESA 1GAEO 2CE2X 2BEVA 3VNSA 1EEHA 1WDTA 2WAMA 3F6CA 1PK8A 3I45A 3QEMA 3BS4A 1J2TA 1CY4A 1M2WA 2D1RA 1E64A 2G5PA 3WJ7A 4N3GA 4KPFC 3UV6A 1EFLA 3L0PA 3GCXA 4EA9A 4ZHQA 3A6JA 3C6MA 1GPH1 5KC8A 2IEYA 1B3RA 2QQ5A 4FEEA 5A9TA 3VR5H 3ID6C 3LFUA 5B1HA 3BMCA 4LJ5A 2C9CA 5B55A 2XMPA 1XZDA 2B61A 2Q2OA 1TVMA 3SQOA 3K20A 5JAMA 2WLTA 2JD2A 1R50A 2X4IA 3L7JA 1KDVA 4KO4S 1HOTA 1JBQA 4L5BA 1NXPA 5TQ2B 1Q3HA 4UPVA 4OJNA 4I9NA 4E7OA 3QV2A 5IMBA 1RW4A 1OZFA 1JHXA 3N2EA 4ZQCB 3AUKA 1NR7A 4HPWA 2FR8C 3B1YA 3IDOA 5GJWC 3RC3A 2Y4OA 1WMBA 3U3KA 2AVDA 3GFSA 1PJAA 5IT9A 2EQBA 4FYJA 4AS1A 3CPEA 1OFGA 1FLDA 1XNGA 5AKKA 4DC9A 1QP7A 3ZJTA 5KNLA 3DDUA 4JQZA 2DC1A 2JFPA 1JA9A 3GLHA 3PQ8A 4J29A 4DV2B 1X7XA 3LYAA 1T4GA 2WMDA 4HL6A 3PHHA 4BNVA 4AY6A 1KYTA 1GXSB 3GEEA 1PCXA 2ZITA 4JOCA 3P9CA 2HF8A 4C7MA 3U6KA 2ZYSA 1VCOA 4LXTA 1LNQA 1SKUA 3IP3A 4KWEA 2ZS7A 3VPHA 4BMPB 1BWPA 1NMXA 1XIVA 3AB8A 4GWLA 4PYIA 5K7SA 3ZBQA 2WJ3A 3L6RA 1J4AA 2Z5LA 1AGRA 4YUWA 1U99A 4EBFA 1W581 4LRWA 5ESRA 1Q11A 3LXXA 5TDHA 3ZV6A 2ZJ8A 3X2SA 4DBLC 3T5PA 1UODA 1E62A 2F3RA 3BXPA 5EZYF 2X13A 1QNFA 3HV2A 3C3MA 1DELA 1B4DA 5IF3A 2PN1A 3D7SA 3JQ8B 1ISMA 1JUDA 3HY4A 4LJ6A 3TNDA 4DIOA 3HABA 1IB0A 1WUIS 2GUWA 4YONB 3W34A 4G0WA 2XWQA 3IV9A 2OGUA 4QPPA 2GD2A 3TJMA 4PYMA 4M9RA 1E94E 4C4AA 4Q1EA 3A6DA 1E1RA 4YRLA 2XKKA 1DIAA 4XVRA 1ZWLA 2WYHA 3OVMA 1D1TA 2CYCA 1QH1B 3T9FA 4WERA 4L50A 4OHUA 1Z13A 2PGNA 4DV1B 5ESDA 1VP3A 2FQYA 2J3IA 2A0KA 3VXKA 1NDUA 2I6XA 1PR0A 1R37A 2BEKA 5FPQA 5LYJB 2FDRA 1KRXA 5H80A 2ID8A 3QKSB 5EZ6B 2XXBA 4EKDA 5TPZD 2ZREA 3TPFA 3WL3A 4BX3A 2VO1A 3RWOA 2B99A 3QY0A 3ZCXA 1GG8A 3ABRB 4LCJA 1XE3A 3U4HA 4C7OA 2QL9A 3PS9A 3KEFA 1QHYA 3C8HA 3O84A 4TWIA 1C9DB 1DG3A 1PLJA 4Z9XA 5LDHA 4ND6A 3ER8A 4MH0R 5IJAA 4RNDB 1WZNA 3DTYA 4J0QA 5BR1A 1T2CA 1Y6JA 4C29A 2C29D 3L9XA 4B3FX 2B21A 1QU2A 4BX2A 2QVYX 4BP8A 1QLJA 3FR7A 2VG8A 4URZR 3KLNA 4TWJA 3I34X 4V0ME 1QQ5A 2PKQP 4FMCB 1R9GA 1YVUA 1DAPA 3IXLA 2FRXA 1O6ZA 2J9YB 3EDCA 3NOQA 2VT6A 3GX1A 2C97A 3PEFA 3PJFA 2HIHA 2EYQA 1FTQA 1KQPA 4HWTA 4XJTA 1RRMA 2WI8A 1VECA 3E9RA 4GI2A 4CG1A 4INZA 4F93B 2CYBA 4BOYA 4IX1A 1JJ7A 5IHXA 3ND5A 1QS0A 1L8OA 4MLPA 4WESB 1HLFA 5EUMA 1VI5A 3NFYA 5G4KB 4DF3A 4R1PA 2GCPA 2SCUA 1SVIA 3PWSA 3U4GA 3T12A 4QXAA 2FPMA 4DSTA 3UMYA 1JQ5A 5AM4A 1UDXA 3QFFA 3MWFA 1L5RA 2VSFA 2OG2A 4PYKA 1K6JA 3I61A 4CMEC 1XPUA 5JNSA 5F73A 3V8NA 3L49A 3RVJA 2B20A 1ODLA 1NW5A 3AVVA 2FX5A 2LNDA 4QXRA 2G83A 1NE7A 4J07A 5CNKA 1X2EA 1NHGA 1Y9JA 3ABIA 3EWAA 3PRKE 3QH4A 3OZCA 3SLRA 4RQTA 5JWRA 5K0FA 5F5LA 2ZRHA 4MS4A 4QU5A 3TSWA 4IIJF 1EQ2A 3AV0B 4KVFA 1RZRA 1Z6QA 2UV8A 5JY1A 3FYUA 4U9HS 1GYRA 2NV0A 3HKDA 5HG0A 4AJOA 3OZGA 4MVJF 4NLLA 3N8KA 1H85A 1IXRC 4UEJA 5B58C 2WHPB 3HKCA 3OQJA 4GI7A 3TW0A 1E2PA 1QF7A 3KD2A 2VPTA 3DOJA 3PUVA 4WLEA 3FTDA 4JLOA 1PBTA 3FN4A 4AB1A 4KR6A 1OFIA 4TV8A 1OYOA 1YXMA 3E18A 5CLFA 4TZKA 3V42A 1CUSA 3ZHRA 5I7WA 1XXHE 3RSGA 4O4HB 3KAKA 5U4QA 1C7FA 1Z06A 2VXCA 2FAXA 1L1QA 4E5YA 3B5EA 4TROA 1LW7A 2GEVA 5D7BA 5AHWA 1KRHA 4EYQA 1KXJA 2RK6A 3C45A 4IHJA 4FYVA 3ZD8A 5TGZA 4BZWA 4CU5A 3AL0C 3A8TA 4MJXA 2DXIA 1NQ5A 1B3BA 2GRJA 2Q2QA 4KQCA 4W9NC 1UBMS 4ECEA 2ZS9A 3EGDA 3NT4A 1E1QD 3ODPA 3T5MA 3T9EA 1OB2A 3IEMA 3LLSA 2Q1TA 4NJMA 1ISGA 1YBFA 4F21A 2O19A 5EIHA 3IFSA 3KBOA 3IIKA 3W8NA 1U0OC 2AKAB 1NUAA 3KZVA 4NZOA 1KU6A 4PNPA 2GO7A 5E6SB 3A1EA 5AXAA 2AC7A 3D8NA 4EKIA 5IJ9B 1GG2A 5K20A 2WINI 4K6GA 1PYDA 3MD9A 1K8RA 1W30A 1SVMA 1NJGA 1Y34E 3HSYA 4OBEA 1VSQA 1CIPA 4NG4A 5FOWA 3UTCA 1RWNA 3DKRA 4IFBA 4OJTA 5TB5A 3UK0A 3AR5A 3HDGA 3WWPA 1OJ7A 3FA2A 3UHOA 2AOXA 3JVUA 3N2LA 4L51A 1X8XA 4PLGA 3A9CA 1WPXA 1TRKA 4D41A 4KQFA 5CA0F 2Y1KA 5JD6A 3MJEA 3M2PA 3GEGA 4EATA 2XSZD 1UBEA 3G5MA 1GSAA 3TRDA 3VMMA 4AKHA 3BH7A 1AQIA 4F6CA 5B4UA 5AKZA 2HRCA 1FYXA 4B17A 2BL4A 4OSEA 4QU9A 1PZHA 4XGNA 5A05A 1EWYA 3TWOA 1R5JA 2YUTA 1J8QA 2YZNA 4NOLA 1JHZA 3NG1A 2IU6A 2C2KA 3D1LA 3V7UA 4YBZA 1SQ6A 1FQJA 1G5QA 1PW7A 3KJEA 1ZIPA 2WTAA 2XCIA 2JFNA 4HDMA 4IF6A 3IVAA 4KE9A 1EGVB 3DL7A 3BGSA 4K9QA 1UEJA 2B34A 2JB9A 5ALEA 1ZCFA 5BSMA 3VTZA 1WRBA 2BBWA 2EZ8A 4GYWA 1QRRA 3MOSA 4HB0A 4JROA 3SR4A 2BSQA 4EFNA 1N8SA 1GUFA 1QB8A 1MJHA 1Z4QA 1EQUA 2Q5LA 2NU6A 3BK1A 3DZBA 1R0CA 1SC6A 1YJBA 4NU5A 4RHXA 2BE9A 1A5TA 2EGUA 3IMEA 1BE1A 3V2UA 2B8TA 2VPQA 4OH1A 1U7ZA 3M49A 4BBJA 3U5TA 4Z86A 5A7HA 1PWHA 2CC2A 3SYKA 1F3OA 4ZVRA 3ZU4A 2IBMA 3A25A 1IEQA 3G85A 5L3ZA 1JAYA 4DWVA 2O3QA 3BK2A 4DILA 3KTFA 1H9BA 3SZUA 3ESRA 3UF0A 3O94A 4XUGB 3S81A 1ZA1A 4OHCA 1HY3A 2WD9A 4OIMA 4PVDA 1TECE 4L2IA 4XUEA 4KYUA 4FGUA 5JLAA 4R7TA 3FMPB 2ZUDA 3RFCA 4C2TA 3HNPA 4KAAA 1BKSB 4C22A 1XLTA 1DIGA 3ZHTA 2P7IA 3JARB 4KYTA 1QFMA 2VHJA 4K9PA 1GQ2A 5BNIA 4NYIQ 1VLMA 2CXXA 3ZD7A 4QGBA 4IP0A 2V55B 4YX9A 3BCSA 1QH0A 4I5GA 2AXQA 4RVUA 2O0MA 3QYPA 3AW9A 3RUPA 5C4IA 2WG0A 1LVUA 3P19A 2Q3JA 4MUMA 4IWXA 1D3AA 9ATCA 1GN9A 3DAPA 5JMOA 4OJYA 2V3VA 2W2PA 4KZKA 4KH0A 2DQYA 3GOHA 3EBPA 4JR1A 3PNQA 4UHEA 1ISSA 2EP5A 2V7EA 4RMIA 4DMRA 5K0EA 1QAQA 2A5FA 4F4JA 1EVQA 4ARCA 4OYRA 2R60A 1H2BA 1YQUA 1VFNA 9LDTA 4QPNA 1WOYA 1VRVA 1YRQA 4QNNA 2RGAA 1DAKA 1KGDA 2Q41A 1G8JA 1M3SA 3NBXX 3WBFA 2Q3EA 2UYHA 1YDWA 1EI9A 4I8IA 3R8FA 5COAA 1YC5A 1T5HX 2Q1WA 1C8KA 1B0ZA 5ALKA 2EARA 1J0AA 1MKYA 2HPAA 2V97A 5L6LB 2C2BA 3Q7TA 3ZHBA 3K6JA 3C6QA 3KYBA 5EQFA 2QE6A 5CFQA 3RC9A 4HDOB 5JISA 5C53B 1IU9A 3H5NA 1H5UA 1E3LA 2E5WA 1UCFA 5KYKA 2II6A 2MTBA 1P45A 1ZN2A 2HEIA 2HUNA 2VUHB 3CCCA 3PFBA 4JVMA 2AQKA 1M1YE 2W6ZA 4C7VA 5WRFA 4TTIA 2JHFA 3EC2A 1F4PA 4DT1B 5B4TA 3OCWA 5CK4A 4TUYA 3SQLA 4BRZA 1GT6A 2BFBA 3QXGA 4EGJA 1PUXA 4ZJZA 1U3WA 1YOVA 3B9BA 2ZI6A 3RANA 1LPNA 3G0DA 1QV7A 1N8KA 1XR3A 2OMEA 5CM2Z 1NBME 3A1WA 4Z7NB 1JKJA 5AKYA 2D8MA 4HGQA 3ZWCA 5FADA 4OHZA 3BMQB 4EL0A 3VMFA 3GU3A 1XRMA 1Z45A 3W3AD 2YJTD 5FULA 4M1MA 4PZZA 3WAJA 1QG0A 1GPLA 3SM9A 4TRMA 1PT7A 3K16A 4K0KB 1Q74A 3C3CA 1TIBA 1CUHA 1EP1B 2QW8A 3RTEA 4CM6A 1T9BA 2R2AA 3L4BC 1X1CA 1P6XA 2BHSA 2N9UA 3R09A 5TY0A 2Q6TA 5AVWA 3PNSA 1GLNA 3MLEA 1D1PA 2CGEA 1CDEA 1IXYA 4L6AA 1ZGCA 3HFGA 3I4FA 1HORA 4B3CA 1M1YB 3CWZA 2PFKA 4R8MA 2M6LA 1J25A 3T35A 1AKEA 5AD1A 4A91A 5LQAA 1RHKA 3M4YA 3HLKA 1KFBB 3C39A 2IYWA 3GPLA 4OI1A 3BA1A 5CIWA 3D43A 4R51A 5CBPB 3DMTA 4AUMA 4DIUA 1ELOA 3MS4A 1L3BA 5SZKB 2X9LA 4D5EA 4K2AA 2BDEA 4LY3A 4JVOA 2GEUA 2OCDA 1EFRD 4QJ5A 5ENDA 4W1PA 3UH0A 2QNIA 3MWEA 1TEHA 1NFFA 1GSIA 1Y8QB 4IJWA 4X7BA 3RRYA 4E30A 6YASA 4BNGA 3H1GA 4P4LA 4ACBA 4CL8A 2JLUA 4QQRA 1K66A 3KAPA 4ZVUA 4ZZ0A 4M1QA 1NBWB 1O4VA 4PLPA 5TEWA 1EA5A 2HDHA 2V65A 3U31A 4DLBA 3FOWA 4DN6A 3LUCA 2ZRNA 2AX3A 1O9GA 3LW7A 1F2TA 1XC7A 2JAOA 4J0KA 1RU3A 3QMVA 1OX6A 4HLCA 4DEXA 4L6CA 3BE5A 4GPTA 3VU9A 5DPMA 4F9GA 4K26A 3ZIAA 1P2FA 4NIMA 5KYWB 1VG8A 3DBLB 2I5PO 3BXZA 3DSRA 5MGBA 5EJEA 1W46A 2BEVB 3EY9A 4GQAA 1O57A 3JQBA 1R4NA 3UPUA 3QEMB 4YV2A 1TEZA 3EFBA 3DBHA 2DBZA 3DZ8A 1KY3A 3DC7A 3H13A 3TAHA 3FTNA 2PZBA 1SUEA 4ZHQB 1XMIA 3GV0A 3D4IA 1I0IA 4YV1A 3GA5A 3DE0X 4R54A 3DW3X 2LCFA 1C81A 3BMCB 4DIMA 4HEJA 4DMGA 4TQ9A 1Z5GA 1QCDA 1IB6A 1AZWA 1YQEA 1FSZA 2N47A 2F1JA 3B48A 5K5EA 1W6UA 4B83A 1WBBA 2AC4A 2UKDA 3THWA 1UJBA 4W8HA 1WKCA 1ZVKA 4UMFA 3MTGA 1NVGA 3BXXA 4H9GA 4LYGA 3SC2A 4C1BA 2XTNA 2YWEA 2V5VA 2FSUA 3BGDA 4ZZIA 2V54A 1S02A 4W5NA 3PGXA 3QI7A 1R66A 4KIJA 2P6OA 3PXDA 2OK7A 2NYUA 4NE7A 3AOEA 2BZ0A 4FVTA 4PHTA 3VNBA 3GLHB 3PVSA 5C81A 1X7XB 3W4KA 4ARZA 2G08A 2ECPA 2WU8A 1H6BA 4LF7B 4YRIA 1HEIA 1MJGM 1N2XA 2ZRQA 1VKHA 3Q3HA 1K6IA 2W22A 1N7GA 3DVSX 4P5EA 3S40A 4B3MB 1TU4A 3CLRD 1ZK2A 4UEOA 1GPUA 1L4EA 1TZCA 2JJ1A 2XUFA 3CRZA 4L1KA 4Y8VA 5KNCD 1XYGA 1KKLA 2GAJA 4OK3A 1XZHA 5KTYA 3NDJA 4XIFA 2B9VA 2EFEB 1MORA 2VYND 3BILA 3ZY6A 3JVIA 1RWWA 2AMLA 2IYSA 5LIRA 2HFJA 3VTKA 1DHTA 3DPIA 1ZIXA 2HCBA 2CBXA 1VE6A 3L7YA 2R1TA 3OA2A 1SQSA 2ZCVA 3AVUA 1SAYA 3BZWA 2HLNA 1NJ1A 3MFYA 1BHO1 1JE0A 1NYTA 3A7DA 4FDMA 4E13A 4OYYA 1KOLA 1NBHA 1K2VN 4WBSA 4EYGA 4UU0A 3DNPA 3DLBA 2ZBPA 3NU1A 3FD8A 3SDZA 3B89A 3QWBA 3WRVA 5A4AA 3JWPA 3I05A 1QFZA 1JG2A 3DC2A 3R3YA 4NSNA 4A03A 5IDQA 3FOZA 1QVRA 2XR1A 1T2FA 3QNUA 4Q3NA 4X5OA 4XIYA 2E4AA 3H9GA 3DOUA 3F3KA 2WHYA 3GLVA 3IUQA 3P9QA 4TN5A 5ELMA 4MMZB 3OD1A 3H2SA 4S1PA 1GZHB 5JQWA 1ZYUA 4LSZA 1JPJA 2QN8A 4MHOA 2HTEA 4QUBA 2YHAA 4TMXA 1CUZA 2AH5A 4Q9HA 3VNRA 3ZEIA 4LEIA 3Q8LA 3ELDA 5BO5A 3F9CA 2WHXA 3GEHA 3I32A 4YMSA 2OPHA 2D1SA 3JYNA 4HGPA 1U1EA 3TL3A 4YCMA 2O2YA 3RR2A 4FGWA 5ERYA 2BN4A 2F90A 5DK6A 4JJZA 3ROMA 1PSZA 5L7TA 4C7OB 1DC5A 4WXHA 1O97D 1VA5A 4X63A 5ECYA 3ZX5A 3GRZA 4AVYA 3HGMA 1CQWA 1R8YA 1WS6A 1ECBA 1SXHA 3CMMA 3A1NA 1JHYA 1H23A 5CXXA 1I3MA 3FWPA 1HT0A 4GMKA 5DGCA 2AV6A 1M2NA 1XDWA 3NHJA 2C4NA 1U28C 2GD6A 4XGKA 4CLEA 2GB4A 3M70A 4RUKA 1N5DA 4OMCA 4UVIA 1UWLA 4I1UA 4C4XA 3UENA 1PL7A 3PEUA 1DPFA 1Y33E 1T91A 1NULA 1QS0B 4IJVA 4NFHA 1AQYA 1KAMA 2PU7A 3TRHA 1XDBA 3C3DA 4NPAA 3PJEA 3DV2A 1PWXA 3D5QA 5CB4A 4QGFA 3EW9A 1T9HA 4WI1A 3UJHA 4IBOA 2YJZA 5BNTA 2GKGA 2F1RA 5JXHA 5LQRA 2B83A 4KDFA 3OZIA 1OYWA 3AJRA 3KQSA 4NBKA 3SP1A 5KTRA 2ASVA 2E55A 8AT1A 2D4HA 1VIMA 3PRYA 3AEUA 4PPQA 3ZE8A 3OQNA 1Z39A 5DO9A 4PZPA 1EDOA 2ZJZA 4QHSA 5CGQB 4B43A 4GYYA 2I2AA 1S9HA 3IQWA 3W3AH 1CRZA 2QTGA 5EJ8A 2HMSA 1BTOA 4MS4B 3HDTA 3VDRA 2ADMA 3VTFA 1SUSA 1HURA 3PDJA 4DGQA 5KOIA 3AQIA 1ZJ4A 4FK8A 4MA5A 3N74A 4AZSA 3FYUB 3HKDB 5AW2A 2FMKA 4RD4A 1FDIA 3NTUA 3SAJA 3HKCB 3JQ9A 4RK4A 2Z2YA 4ND7A 1IQ0A 4Y2SA 5G02A 3OZDA 1OILA 4H1TA 1N57A 3ODGA 2BR5A 3AUUA 4TV8B 4I46A 1SB9A 3BH0A 3QXHA 1TQ4A 4NH4A 5J2TA 1QHSA 2ZS8A 2I8CA 1JFLA 1Q0UA 3H1PA 1ICEA 3CXUA 1VLZA 2VK1A 4Q4JA 1ZJZA 3T5GA 3FUUA 1O1YA 1U3CA 1V43A 3SJUA 2PRSA 4GKJB 1JHPA 4OQZA 4RJJA 3RTGA 2A3RA 1ZEMA 3D8RA 1EEXB 4MCIA 3UC5A 5EKUA 2IVZA 3THRA 4IHJB 4LTNA 5AI5A 5E2AA 3E9CA 5AOVA 3PXEA 3G0BA 3TNJA 1GGFA 3ZY5A 3HDYA 4KE8A 2VDNB 1K0UA 4Q1CA 1U3GA 4JSRA 1M8KA 2Q6KA 1QF6A 1T2EA 2EVWX 2JZNA 4C2BA 1RYFA 3I30X 2WU1A 4NJMB 4PGGA 1V5EA 3OE4A 1MOQA 2YICA 3H16A 1GDDA 2G0TA 1SIOA 3MB5A 2J0UA 3H0KA 3DVAA 4YQZA 4H3SA 3RFUA 4UXJA 1TT7A 3KG2A 1RLIA 1TJ3A 1TK9A 1XJCA 1RAGA 4XQ0A 5FX2A 5KCZA 1OXSC 3IJ5A 3LVRE 3PQCA 1WXQA 2N3ZA 2PKQO 4D26A 2B98A 2IC5A 1V8PA 3R0VA 4ZTUB 3EOAI 1HH4A 3EFHA 3WRYA 4B5LA 4X8MA 5L4NA 1H3NA 2ATEA 1CULC 2GGSA 2ETXA 3FSGA 1QC5A 4H7EA 2DJIA 4B9AA 5JBIA 1J33A 3ZQUA 4DG5A 1VHTA 1YA4A 2OZVA 3M1LA 1DARA 1ULHA 5H02A 4ZCMA 1O95A 2M98A 3VO8A 4EJSA 4UXHA 3L6CA 4GR4A 3GAFA 4PHFA 5CYFA 4E1AA 1GNRA 3ZWKA 1U31A 3Q6IA 3DKIA 3TQFA 421PA 2BGTA 1TZ2A 2EKDA 4L5IA 3ZBUA 1B6RA 3MPOA 2D4AA 3ZWPA 1H6DA 5JBNA 4JD5A 3FNBA 4MUGA 3DXXA 3Q8WA 4GPEA 4NH0A 4HDMB 4W6QA 4DV5B 4QHYA 3FROA 2WMNB 2J7PA 3DDNA 5DLQC 5L4SA 2AFHE 5DT9A 5LZ8A 2UUOA 1XP5A 3WNDA 1E2HA 2Q6LA 2WJVA 3L8GA 4HN4B 1KO8A 2WMYA 3RVPA 1BVHA 2NU6B 4UCQA 3NNNA 4JA2A 2GDJA 3TTTA 4KG7A 3SYTA 1ZO8A 1DU4A 5I5GA 1E1QA 3WTCA 5DNAA 2COEA 1QBKC 4WUTA 5CFNA 2EFYA 2VDWA 3B1JA 5GM1A 3S3TA 3WK7A 3WWOA 5I48A 3GLIE 1CNMA 5FJJA 3V2GA 4HLDA 5HZMA 2YJ4A 2ZI9A 3HSSA 3M1AA 5IH7A 1WCXA 2G77B 3I5YA 3CNEA 1RC1A 5JTUA 1YB4A 3S2YA 4IV0A 2BT4A 4JLAA 2FCRA 4AICA 2Z3ZA 1U1CA 1CHDA 3OZUA 2G67A 1YKGA 5IAJA 2PV0A 4E94A 4D42A 4KTVE 1DC4A 4L2IB 1VL6A 1XMXA 2LP4Y 4WEQA 1FFHA 5SY9A 4QDUA 1A1VA 2XAUA 3DEZA 3KJQA 2Q7XA 1PEKE 2OGWA 2P9JA 1RYEA 3TM4A 4RMNA 4XYMA 2IPXA 2J9XB 4I4TA 5CG2A 1HSOA 2H4XA 5K0LA 4L0MA 3BIJA 4D9JA 4RTMA 2IH2A 1DAEA 4UHHA 1UOEA 2Q5FA 5I9MA 3TQRA 2EFCB 2GM4A 3OJXA 1KYYA 5LUBA 1XDZA 3GGDA 3LMKA 4JUBA 1C7JA 4DB4A 4UDYX 4PAWA 2BZ1A 4Q12A 3VVMA 4BVKA 1RLOA 5C8ZA 3H5RA 3ZVRA 2GPAA 1QZZA 1LI4A 1CUGA 1GTG1 1XQ6A 5TQ0A 3G2IA 2YYZA 4WPGA 4MW2A 2BYTA 3MF4A 1VJ1A 4QGAA 4MHTA 1ZBDA 4EITA 1D6NA 3WR5A 4G24A 5I7AA 2C1XA 2YXLA 4UM8B 2F6RA 1DHRA 1XU4A 2QUHA 2O59A 4FP9A 2BGWA 1KEKA 3FFBA 2AJBA 4HB4A 2DWQA 5CX1A 3IR7A 4MAAA 3S5JA 1B41A 3IA7A 4XPIA 3U48A 4LFBB 3NZEA 2C99A 3QLTA 4BFZA 4KGZA 4C0XA 1VPLA 1GTMA 2CXQA 3BE8A 1S96A 4JX8A 4A6XA 1A2QA 4WKBA 5CLIA 4HVTA 5HIIA 2TMDA 4FOOA 4WTOA 4C14A 1QRUA 2G9RA 4WJZA 4UVHA 3SHVA 1V3TA 2LKCA 2Z04A 3TSOA 1GFZA 4N8DA 2P9QA 5BQ5A 4DSZA 3ILSA 4BPBA 3KB2A 4WOPA 4P33A 2YDYA 4TUYB 1J49A 2IS2A 2Y1FA 3U4IA 4YRNA 3ZJYA 1M6YA 4P36A 3A6GA 1PLLA 2CSXA 3VAYA 2J8ZA 4PEVA 4UHKA 3SDSA 1YOVB 7REQB 4A16A 2WUVA 3GNSA 1RCFA 3HYCA 3RVBA 1JWLA 1V71A 3U60B 1JKJB 1PZFA 5U4XA 4OQQA 1W5EA 2OHFA 1C9KA 3LCCA 3KOYA 2XCRB 2D5IA