4B2PA

Rada c-terminal atpase domain from pyrococcus furiosus bound to gtp
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
229
structure length
216
Chain Sequence
TIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGSVIWIDTENTFRPERIREIAQNRGLDPDEVLKHIYVARAFNSNHQMLLVQQAEDKIKELLNTDRPVKLLIVDSLTSHFRSEYIGRGALAERQQKLAKHLADLHRLANLYDIAVFVTNQVILAHSATLRVYLRKGKGGKRIARLIGEAVFSITEKGIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP Half-Sites in Rada and Rad51 Recombinases Bind Nucleotides
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords DNA REPAIR AND RECOMBINATION PROTEIN RADA
total genus 83
structure length 216
sequence length 229
ec nomenclature
pdb deposition date 2012-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b2pA00
1S1MA 2ZI7A 3A37A 621PA 3LA6A 2B7BA 4UNNA 3GPLA 3CNNA 5DH9A 2QMHA 3AKEA 4EQ6B 1UKZA 1G19A 1N25A 4PZZA 3Q72A 2HYIC 3HPQA 5KSOA 3B8HA 3ZS8A 2GJAA 3U5ZB 3CWZA 4OJKA 4P32A 4DLUA 2CE7A 2BCGY 3BAFA 1EG7A 3TH5A 3CIOA 3K9LA 2NGRA 3VNUA 1DELA 4RD2A 2WWYA 3EPHA 1BOFA 2F1JA 5KDDA 3VFDA 3CONA 3IQXA 4MRSA 4ZIRB 5IK2D 1E2GA 3K09C 2JJ2A 1R0WA 3OEHD 4S35A 2FZ4A 4Q7JB 2GRJA 4N0DA 1G291 5EZ6B 5G40A 3VNVA 2JIZA 3WP1B 2CK3D 3BH6A 1JR6A 1A2KC 2PLFA 3LLUA 1XTSA 1IN4A 2CCJA 2ZRMA 4TQUS 4N3NA 2W6ID 1ZCAA 3KJHA 5CYPA 2AXNA 3U4QB 3SBEA 2DWQA 4NONA 2F55A 1VG1A 3P26A 2C2HA 2IS6A 2AD1A 5L3QA 2O5VA 3U6KA 2QM8A 4RY2A 3O8RA 1KNXA 2JJ8A 4PTLA 3K70D 3TR5A 4XVRA 4CGZA 3NVAA 1D8TA 1E4VA 4JT4A 2X19A 4HAXA 2BM0A 2P67A 3VR4A 4AYXA 1R6BX 4ZI3A 4IOLA 1WE2A 4O2RA 4JS0A 4EKDA 1KI6A 4AY2A 2PJZA 5GJWC 2QG6A 4H1VA 3TK1A 2B8TA 4URVR 4Q1AA 4B74A 1AZTA 2CL0X 4URYR 4ESVA 3SJBA 4OK3A 4AURA 1VCOA 3U6BA 5HR5A 2OLKA 3ZDQA 4MYCA 1I2MA 4DIDA 1JAIA 4JLDA 3RWOA 2WM9B 3W6PA 1Z29A 5FR2A 4A2PA 3OE7D 2QI9C 1U8ZA 3THYA 3FKQA 1SQ5A 2RB4A 1OFHA 1T0HB 3QKUA 4E22A 1DOAA 5EXPA 2CEAA 4QBHA 2HV8A 5AUQA 5BW8A 2D7CA 4RZUA 3B1WA 2KB0A 4KJZA 4KVGA 1P60A 2V6IA 4F92B 2ZJAA 1ZUIA 1ZIPA 1KJWA 2ZI4A 1ZCBA 1L7VC 4HB0A 1I4LD 3RRYA 5FTNA 5DHFA 4A0GA 4M1SA 1RRCA 1Q1QA 2WWXA 4TLCA 4A2WA 3JZMA 2BKEA 1SKQA 5E95A 3WRYC 4LZZA 1XB2A 2RGAA 2EU8A 1Z28A 2ZIAA 4Q1FA 4P3YA 3IKJA 3X2SA 1E79D 3QIAA 3AUXA 4QHSA 2QMEA 3TBKA 2JLVA 1Z6AA 1T5IA 3LXXA 2ZYVX 4JJKA 5D3MA 3DZDA 2JLUA 3Q8XB 1HH4A 2XTZA 3LQRA 2WAYA 3THXB 4LYHA 3H1TA 4ASUA 1M7GA 2YINC 1J8MF 4YXWD 2OCYC 2B21A 4N0EA 2MSDB 4MGKR 2O8DB 3C41J 1E9EA 3U2QA 1D2NA 2Q9AA 2P6NA 3CW2A 4OQXA 5K8LA 1JAHA 1ELOA 3R8CA 4OJQA 3L0PA 2J0SA 2QSYA 2O0HA 1KO8A 2KE5A 5H1YA 1YZUA 3SYKA 4Z1MD 4V03A 3TSOA 3TUJC 3EWAA 4FINA 4KAXA 4Q4JB 2IUSA 2XZLA 2EW1A 1XJQA 2V1UA 4YMSA 3FMOB 4JVLA 1Z0JA 5EE0A 1N6IA 1R5BA 2WAXA 4MKHA 2R6FA 5F3WB 3A1UA 2BCJQ 2ZITA 1LS1A 2GCNA 1A4RA 4LWZA 4KFTA 3PUXA 3TAUA 1IN7A 1WA5A 1R0YA 4ZKDA 1P62B 5J40A 5JHGB 1E9SA 2ZI6A 4XWKA 4TZ0A 3Q9LA 2I3BA 3KB1A 4PX9A 3FMIA 2EFDB 3KQLA 1GL7A 2FFHA 2MMCA 3CNLA 2A7QA 4FCVA 4A9AA 1N6RA 1DO0A 4A0FA 2VTKA 3UMFA 3WXMA 2C9CA 5BQ5A 4OI0A 4JYBA 3CF2A 1NG9A 2RGGA 1R8QA 3ZVRA 1XEXA 3BIFA 4HAYA 2GXUA 1YRBA 4EAQA 1X86B 2QPAA 1IN8A 1G9XA 5AJZA 2QUZA 5C4GB 2A5YB 1HYQA 2Z4SA 3CH4B 4PSVA 4JSTA 1G7RA 1GKUB 3FPAA 4V0ME 5JLJA 3I1FA 3QXHA 4ACAA 4B33A 2W6IA 4BZXA 4FMCF 4RSGA 2OEPA 2CHQA 3EPKA 1E2PA 4Q4HB 2C78A 5FFMA 4L4UA 3R9XA 4IXNA 1CJKC 2NO0A 1SXJA 1H8EA 1MRNA 2YWFA 1CEEA 1K8RA 1Z8FA 4HEJA 5IK2A 1OFUX 1FOEB 1G8GA 1WRBA 3I92A 1YR7A 1HT2E 1N6PA 2ERYA 5FBLB 4C4PA 4M4SA 3WMFA 1CJMA 1HY3A 3BS4A 3DMDA 2I1QA 4GMXA 4EPRA 4GI7A 2OILA 1XTIA 3AP1A 4PHHA 4D6PA 1TEVA 3L2OB 1TU4A 5GVSA 2VP5A 2IA5A 4QJ3A 2D4HA 3LFUA 1CXZA 1II8A 2X2EA 3AGQA 3L0IB 3UIEA 2WWFA 2OBLA 2GJSA 3JVUA 1WQ1R 4D4JA 2F43A 3P4YA 1IY1A 3MSXA 5CM9C 5HKKA 1E32A 3IIMA 1NLFA 2WTUA 1I4TD 3NBZC 3PR1A 1XP8A 1KZ7B 3HR8A 2ODEA 1ZINA 1PV4A 5FBRB 3F5FA 3WNBA 1HE1C 1GKIA 3ICQB 4TSFD 2R65A 1P9WA 1OH7A 3GLGE 2W2XA 1COWD 2H5EA 3VTKA 3BFXA 1FUUA 1ZU5A 5EXXA 5ELXA 1II0A 1XPRA 1R2QA 4IRUB 4AYTA 1ZVQA 1EFRA 1YE8A 4NCNA 4PC6A 4BRWA 4QM6A 2DFLA 2QP4A 5HE9A 4NYJQ 2W0SA 4XJXA 2VEDA 3GEEA 3DZ8A 4HAWA 4LPSA 1YU9A 2O52A 4PQRA 1TUIA 3HYTA 2C9OA 3T1QA 1EFTA 3TJZA 1K5GA 5KNDA 2J0UA 2DFNA 5G3YA 3WYFA 3CF0A 4GZLA 3CO5A 1G3IA 2NZJA 2CCKA 2CJWA 3AUYA 5KTYA 5L3SB 4AIIA 1HV8A 1JEDA 5DGXA 3W9YA 4MRRA 1G3QA 3EC2A 2HF9A 4NBSA 4TL8A 3SFVA 4V0LA 3KTAA 3W8NA 2GZAA 1TF2A 5JWHA 1Z3IX 3SQXA 1LFDB 1IN6A 1T4GA 4KYIB 1MO5A 2J87A 4Q7KA 1KAOA 2VA8A 2YC2C 1N5IA 3FVQA 1XXHE 2ECKA 2GK7A 2QTVB 1XXHA 4Q4JA 2GJ8A 3KKQA 3KQNA 4IEIA 2WPDD 4LC1A 4LGMA 2GILA 3UKDA 2JLQA 2FU5C 121PA 1LV7A 3VKWA 1A5TA 4EPTA 1XRJA 1HQYE 3ONWA 2V1XA 2PZEA 1JXMA 1KDOA 1D6JA 4MDEA 3GJ8A 3QE0A 2C95A 2ZVPX 2V9PA 1D9XA 3FMFA 2BBTA 4HB2A 5TDHA 3UWOA 5DO9A 3VMFA 4QBIA 4D4KA 4OHXA 1G41A 3B1VA 3D3QA 2H16A 5EUMA 4WOPA 2C9YA 5CITA 1OXUA 2OAQ1 2QE7A 3AB3A 1G8FA 3TW4A 2GXSA 2EYQA 4G1UC 4HUQA 4DRZA 3EPJA 2NO7A 1W36C 1E9BA 3AVQA 1E3MA 1G21E 2BEKA 2YOFA 1SULA 3I5YA 3DKPA 1CR2A 4E07A 2XB2A 2ZJ8A 1N6KA 1B23P 2VHUA 5EP1A 5BYJA 2WKRA 3KKPA 4UQOA 2Q6TA 2YZ2A 3HU3A 3PG5A 2CMKA 1YHNA 3LBIA 4M1MA 2JASA 3M6AA 1OIVA 5A4JA 1NN1A 3K0FB 3LNCA 4RD6A 4BUJA 1RZ3A 3R9IA 3U44A 2NMVA 1YZLA 1XD2B 821PA 1UEIA 2ZRKA 1N0WA 3CZPA 4PO9A 3CZQA 4B35A 2OFOA 2FSHA 4PSKA 3T1VA 1AS0A 4XSGA 3SI7A 3TW8B 1E2FA 4JSYA 5SZKB 1UADA 1ZNYA 4M1KA 2PX3A 3I72A 4G5OA 1KNQA 4IOJA 3SN6A 5L3QB 2PJRA 2GVDC 3L82B 3GMTA 1ZP6A 1WP9A 1RKBA 4HB3A 3UMRA 2XXAB 1H8HA 2UZIR 5JWRA 2J0UB 4OK6A 1QBKC 3ZIAA 5JFGA 2YC4C 1GM5A 4F93B 3C5CA 3EIEA 3B6EA 1G7CA 4DCTA 2DCUA 4IOMA 1QVAA 1NBMA 3TQCA 2O8EA 4CEJA 3GP8A 1H8HD 2WOJA 1OFTA 3RANA 4EPYA 1N6NA 5CDFA 1O3YA 1SKYB 1FFHA 1JEEA 1GWNA 3F3YA 2BEJA 1K6MA 3IDQA 3QG5A 1Z0IA 3PEVA 1EFRD 1CRQA 1T91A 3IEUA 1KJZA 3KJIA 4G01B 1KI3A 1GRRA 1X8LA 3G0HA 2ZS8A 1JBKA 1YRAA 4X8HA 1AZSC 4MQBA 2L0XA 2F9MA 4D82A 3A6PC 1KK2A 4FD2A 1ZRHA 5DNYB 1WBBA 3P27A 5LBIA 2W83A 3RHFA 5KNBA 3B1ZA 4OK5A 2SHKA 1NMZA 3IHWA 4D4MA 3ZGXA 3SE0A 1ESMA 3WYGA 3V00A 2D62A 4W5WA 2XTMA 4DCVA 1Z6XA 4MGZR 2GF0A 3KTAB 2FA9A 4NU0A 4A0HA 2YKGA 4QHTA 1F2UA 2ZRCA 4TLEA 2G9NA 2GKSA 1VTKA 4MYUA 3P20A 3AF4A 1XU4A 4CRWB 5J4LA 3JZAA 5AJWA 3PXGA 3LDAA 1C9KA 4B3CA 5KYKA 1P73A 1HTWA 1KIMA 4HZUB 4Q03A 4TWZA 3VKGA 1E0JA 2G88A 2GETA 2J0VA 2QAGA 1PLKA 3M0EA 4QFMA 5L3RA 3BOSA 4U02A 1KJYA 4XIGS 5IRCD 1KO7A 2BC9A 3ZZTA 2FOLA 4B44A 3VR2A 1TL7C 2FSIA 3HDTA 3QG1A 3QOFA 5DI3B 4CT4B 2CK3A 4LV6A 2R2AA 4R71A 5LDDC 2WJVA 1E1QA 3H86A 3NKVA 4C3ZA 4J0QA 5F98A 2YVUA 4WW0A 1LF0A 2D7DA 2QU8A 3VHXA 2V4ZA 3JVVA 421PA 1ESNA 3UG7A 4XVQA 4PZLA 4DVGA 4C7OA 2QBYA 2JAQA 2ZREA 1LTQA 2W6JD 1J8YF 3NEJA 3SC3A 3K53A 4IOKA 1TAGA 3A1WA 1UF9A 2VLIA 4K46A 3T61A 2YNMA 5JECA 3I4LA 5L8VA 4EJSC 2QQ0A 4DKXA 2B8WA 3KDSE 1IXRC 2XZOA 4DC9A 4II7A 4KSCA 4M21A 1FPMA 4YDHB 4B47A 1DEKA 1D2MA 4OQLA 1ZC3A 2IYTA 1DAIA 4KXFB 2XXAA 5FPKA 4WZ6A 4YDSA 2ZRGA 2FPMA 4HZIA 1SGWA 2QQEA 1Q21A 2GAOA 4C2UA 3L43A 4HDCA 3B13B 4JLAA 4MRVA 2J46A 4LV5B 2C99A 3CPJB 2DBYA 2IXGA 4GT1A 4DEYA 1BIFA 2Y8EA 3SNHA 1ZD8A 2R6CA 2JLXA 2JDIA 3TSZA 3GLFA 2NQ2C 1GL6A 1YR8A 1NNEA 2I1VB 1EFUA 3O8BA 2VL7A 1E94E 1P3JA 2Z5FA 1JB1A 1IOZA 3QEJA 1DPFA 2JATA 3OHMA 4LJ9A 4PC7A 1IHUA 1RIFA 3OEED 4PZYA 3GJ4A 2YOHA 3U44B 2JCSA 1HT1E 3EZ9A 4YC7A 3B7GA 5DIFA 5DISB 4O3MA 4D4LA 2ZRFA 1EX7A 1NVVR 2F6RA 3U60B 1XBTA 2A5DA 4TT3A 3GFTA 2IYWA 3BC1A 1KK3A 2XJ4A 4TQ9A 2IX3A 2A30A 5HZHA 4TLAA 3IEVA 3LY5A 2UVQA 1CJTC 1DARA 1GL9B 1Q1ZA 2DYKA 2R8RA 3EA5A 3NDPA 2RMKA 2GAAA 1YZNA 2A3RA 3THXA 4GDFA 3D6TB 3T5DA 4BFYA 2B6HA 5G53C 5JI3E 2FH5B 1HA3A 1S1CA 1QVRA 3NC0C 2ZJ2A 3MJHA 5HZKA 2GHIA 3LWNA 3QNUA 4P4SB 4C0BA 4H1UA 3QEOA 4KSBA 4QGHA 1IXZA 3RLFA 1G4UR 3AKYA 3WNDA 3RSLA 2IXFA 2YJTD 2NO6A 1KO1A 3AQ4A 1E96A 1MR3F 1D2EA 5BN3A 4E09A 1ZM4A 3GLIA 2V7QD 1J2JA 4CF7A 2GCOB 4YONB 3O8CA 5CB8A 1E2QA 1Z6GA 3QPUA 1FX0B 3QKSA 2GK6A 3ZH9B 1SVKA 4ZKEA 2F1IA 3U3MA 3OAAD 1XMJA 3KQHA 3OIVA 3FFAA 1NF3A 3LVQE 2OUKA 3ZVLA 2QT0A 1GP2A 2ZRJA 5JSZA 4MA4A 4ZI2A 2NPIA 5H8WA 4LJ4A 2ZUDA 1NL3A 1ZW6A 1DAFA 1CJVC 2GZDA 2J41A 4M2LA 2Z6VA 2CLSA 4I1VA 3AP2A 3KQKA 4DDVA 2EFHB 2VSXA 3AVPA 2IUUA 5J4KA 2QMOA 1US8B 1UBEA 2FSFA 1VIYA 3WBKA 3TUZC 4PC3A 4LC0A 4JVSB 4MYTA 1MT0A 3I3SR 4Q4HA 2WJJA 1NG1A 4PQYA 3ZS9A 1NLZA 4IW3B 1KSFX 1OPXA 1UKVY 4BPBA 2GCOA 1M34E 1NVXQ 3RRZA 5JEEA 2IC5A 4X8LA 3GQBA 4CT5A 3ADKA 1VIAA 2E1RA 3FDIA 2FSGA 2HLDA 4G5RA 2F43B 3PVSA 1ZMXA 2WSSA 2W58A 1G5PA 1W1WA 3TMKA 1Z0FA 3KUDA 3LXRA 1TTTA 2X77A 4HUTA 3QY0A 1P61B 2ZRNA 3SFZA 2D74A 1U2RA 2PZFA 4FCWA 2ORVA 4WXPA 3NBFA 5EXTA 4B73A 3RVBA 1R0ZA 2G0TA 4QM7A 3BH7A 5FTKA 1YR6A 1T3LA 3SZRA 1NSTA 2C98A 2MSCB 2OXCA 3B1YA 4Q4AB 1E2MA 1OXSC 3I8SA 4CDGA 2X8AA 5EP2A 1IXSB 4MKGA 3ZD7A 2YWGA 2OG2A 3D31A 3UXMA 1JECA 3HR7A 4A36A 4BQSA 2IWHA 3CWQA 1E0KA 1J7KA 1A82A 3NBYC 5JS7A 1ZM7A 2JA1A 2VF8A 5KSPA 4DT1B 4IJMA 3NTUA 4OHWA 2ZROA 3K8YA 3E5HA 4YMUA 1ZUHA 3RS3A 1C1YA 2P5TB 3BB3A 4KBFA 4BFXA 3QXSA 2IWRA 3C7KA 1XEWX 2ZR7A 2V8OA 1JR3A 5AJVB 3DKVA 2BM1A 3L8ZA 2ZSAA 1T3HA 1GAJA 1U94A 3IILA 1W0KA 2AL7A 3GJ0A 4Q9IA 4L9WA 3QUSA 1I4DD 2FNAA 2ZRBA 2IS1A 3PCRB 1TQ2A 2QY9A 5AWFC 2BMFA 4JBXA 2C96A 3EZ2A 1GITA 5EE5B 2ZR9A 1KHTA 5TARA 1EK0A 4DDWA 2GXAA 3RWMB 1CF4A 1E9RA 3KXKA 4LBYA 3DO6A 2ZJZA 2ANBA 2ZJOA 2WIAA 4TLBA 4DLWA 2DY1A 2GF9A 3DOFA 4WXRA 1N5LA 4LJ5A 2ZRHA 4POAA 4A8JC 1OKKA 4HLDA 5LD2C 4UJ3A 2O8BA 3MMPA 5KO2A 3PQCA 1PZNA 2WPDA 1KO5A 1Z5ZA 3AP3A 1J70A 1XX6A 2ZSEA 4US1R 3CRQA 3AVWA 2WKQA 5FPHA 4GRAA 1IJFA 1OYWA 2WWGA 1IBRA 1L4UA 3AF1A 3M4YA 4WBSA 3X1XA 1RRFA 1W2GA 5G3ZA 2NO9A 2ZU0C 1SVIA 3ETLA 2OCPA 5FOWA 1GRQA 2DPXA 3NC1C 1RFLA 2DWOA 4JMPA 4IHQA 4Q66C 4G3XA 2F7SA 2WMNB 5CLQA 5FPSA 5KUTA 3IIKA 5AR1A 3WBJA 1E6CA 3K0EA 2ZYUX 4QL3A 2XNDA 3FKSD 3KUCA 4ZDKA 1NVWQ 2BVNA 4Z1MA 3RRMA 4OQMA 1F60A 2A5JA 4Q02A 3MUFA 4B76A 4EPXA 3EX7C 1WB9A 1Z07A 5FI1B 3ZZ0A 5DYIA 4HDOB 5TB5A 1SKYE 1AA9A 1N5KA 3IO3A 5HCNA 5K8UA 1KGDA 3CX8A 1R5NA 2JJ1A 3TKLA 2IF2A 1GZSA 2RCNA 3ECCA 3PJRA 1BMFA 3VX4A 5JJKA 2J7PA 2ZJBA 1OF1A 1G7SA 1GRNA 4LHYA 3A58B 4B2PA 3PEYA 1KI4A 2ZJYA 3E70C 3EASA 4QGGA 1OHHD 2P0EA 1AS2A 1E79A 3B2EA 3QVUA 2NO1A 4TMWA 1HEIA 1WDTA 1YZKA 4LBWA 3BFVA 3AVXA 1N3BA 2RH5A 4KCGA 5G41A 5IHPA 1ZD1A 1NMYA 3DHWC 3LBHA 3AVYA 1IY0A 1DTSA 4LSGA 2VQSA 2ATXA 4DCUA 2CXXA 3SS8A 3GCGA 4NDZA 1FZQA 1GUAA 4IDQA 3WMGA 2ZRDA 5SZIA 2ZETA 3B78A 2VHTA 4Q1EA 5JI2E 1RJ9A 4CEHB 2N42A 3AKDA 3GEIA 3TE6A 1PVOA 2QAGB 2ODWA 2WJHA 2OLJA 4JVMA 4F7WA 4GP6A 2GEUA 3T12A 5FL7A 4BFTA 2DR3A 1F5NA 1PLLA 2RGDA 4Q48A 3AF3A 2IF0A 2OM2A 1QG4A 3MWKA 4RD0A 3NHAA 2GESA 4LJYA 1D9ZA 1XD9A 2OFWA 1CP2A 3SJCA 2ZUCA 3OESA 3QXXA 4HLCA 2MSEB 2IUTA 2WSMA 3QF4B 5CB6A 1XNJA 2ZXUA 4IDHA 4AWXA 1UBCA 4PHGA 3DDCA 1M8PA 4H9GA 3SU8A 2VO1A 5LPNA 4JLVA 1T8TA 2ZTSA 4RJLA 2ZI3A 4K81B 1XFAA 1BYUA 1BH2A 1TEXA 2W0MA 3K9HA 4IDOA 2IBMA 4PPQA 4PAMA 4AYWA 1QHHB 1G17A 4XD7A 1G3UA 1OXTA 2PX0A 2IK8A 4FMDB 2XSZA 3SYNA 1W0JA 4ZDWA 3FMPB 1CULC 2G83A 3FFBA 3U7HB 2BHRA 1KDRA 1EXMA 1HURA 1VG8A 3UK6A 2ZS9A 1P9RA 4AI6A 1W0KD 1BKDR 4NYMQ 2ZSDA 2ZSFA 1FW6A 2HDNB 4BLOA 4L9SA 2WJIA 4PSAA 2IS2A 3ICEA 4TMXA 1UDWA 4BFVA 3NDBB 1CKEA 1XCGB 4C0QC 4W5HA 4MKFA 5IF9A 3W3AA 2PMDA 2D06A 2MMGA 3U7FB 2GA8A 2QE7D 3K0CC 5H70A 2FPKA 4K8OA 4V0MA 1KI9A 3EG5A 4D2IA 1GNQA 4QBFA 4TTQA 2QORA 1R8SA 4B34A 4GOJA 4M8NE 2PT7A 2QEQA 1E2NA 1W49A 3CNOA 4RVCA 4IVQA 1OKKD 1S3GA 3CKLA 5TMPA 1AKYA 3X1YA 4F91B 2FPLA 2XITA 3B9QA 2D2EA 4G5GA 1E2KA 3N2EA 1QZXA 3HP1A 1E9FA 2BKUA 4UKDA 1R10A 4PC2A 5EUQB 2ZJ5A 1NKTA 5DI3A 1VHTA 1Z08A 1LS6A 2EFGA 5JMTA 5HKKD 4EIWA 5EJEA 3U3JA 2HEIA 2B92A 4JZKA 1W4AA 3PUVA 2W00A 1KSGA 4KLZA 4URXR 2Q9BA 1E1RA 3VR6A 2CBZA 1VCMA 2CL7X 4W7SA 3W90A 2R9VA 4Q21A 1VHLA 4ZCMA 1EX6A 2HJVA 1RYFA 2C04A 4Q18A 3BORA 1JJ7A 4FMDF 2JGNA 3G5UA 4JLJA 3F8TA 2QT1A 2ZRIA 5LB2A 1SXJC 1P7CA 2VPPA 1P2TA 3P4XA 4LYAA 4DSTA 1QF9A 2Z43A 2O0JA 2C03A 4XWAA 2P65A 1XPOA 5F2EA 1IJEA 1KKMA 2I4IA 4JLOA 4KV9A 4P4UA 1ANKA 3Q3JB 2XNDD 3FKSA 3IUYA 2R6AA 4YMWA 4AKEA 2YWHA 4EUNA 4TZ6A 1YZTA 3EIHA 3MGCA 5GJVC 4X8MA 3W8RA 4IKEA 1GSIA 4S2EA 3A1TA 5DN6A 3VX3A 4Q9JA 2J1LA 4LJAA 5FBVB 2NZ8A 2QMUA 4P0TA 1ZC4A 3B1XA 3RYTC 1XTQA 1II9A 4TT3D 3BB1A 3L0OA 4OI4A 2FF7A 1XF9A 1QHHA 3H0KA 2FG5A 2NIPA 2W6JA 2IYXA 1VG9B 4QJ5A 3AF0A 1UBGA 4DCNA 2WWWA 4LRWA 4LYJA 5FBQB 3U3OA 2DFTA 5CJPA 2GCPA 1Z22A 5JSZB 4D0LB 3PEWA 4HYYA 4LPKA 2IEZA 5A5GA 2OESA 3ZQ6A 2REOA 2QGZA 4FI3C 5JEDA 4I1OA 1U0HC 4I99A 3L0SA 2GBLA 4BFUA 3BJIC 1XDBA 4LBVA 1MKYA 4A8JB 5B57C 3I62A 1AS3A 5FOSA 4B6EA 5KHOC 3U4QA 2R6GA 5CK5A 1ZUNB 5KDLA 2IYRA 1TUEA 4DIEA 4P33A 4E03A 721PA 4PQFA 4AKHA 1W0JD 2ZM5A 1GFIA 1OXXK 3NXSA 4GMDA 2ONJA 3RS2A 4JYCA 2WJGA 3THYB 2W2VA 1W48A 2IW3A 4G0NA 3X1DA 1OH8A 1MRSA 5C1BA 1XD2A 3ZLJA 3W34A 4EDHA 2AK2A 1S3SA 5AK0A 4Q9HA 1J90A 1OE0A 1QHIA 4TL9A 3OFNA 4ESHA 3PIRA 4I4LA 4GL2A 4JKYA 4PO1A 2JJ2D 3OEHA 3HYRA 2UKDA 1KI1A 4M53A 2XOKA 4C0HA 2AKAB 1ODFA 3NHBA 1G3MA 5TY0A 1DG3A 3MWYW 4OBEA 5FTMA 4V0KA 4ZPXA 3C15C 3SHWA 2XJ9A 1RPZA 5M04A 4CEIB 1WMSA 1KI8A 1IONA 1NN3A 4Q19A 2G77B 1DBSA 3MG9A 4LHVA 1P72A 1GIAA 1M7HA 4U00A 5LB4A 1X8JA 1X8KA 1Z6TA 2QGNA 1NY6A 5C46F 1NP6A 1AJEA 2IYYA 4DEXA 4LJ8A 2D3WA 2E9SA 3FB4A 3LW8A 1HUQA 1TQ4A 3BFKA 3UMSA 1QDEA 2XB4A 5JRJA 4RCYA 2KBEA 4F4JA 4ARZB 4IFEA 5CYOA 2OO7A 3GLHE 4BASA 1VYVA 1ZU4A 4ZCLA 3I8XA 1F48A 1A7JA 3HWSA 1XJ0A 2H8KA 3BBPA 1KAGA 4C0AC 4QC2A 1OIWA 2Q21A 4TL7A 2AHOA 1TQDA 1HQCA 4NCJA 4TTPA 2PL3A 1KMHB 4Q9KA 5FBWB 4U7DA 1JR3D 4OI1A 1XTJA 2OFXA 1XEWY 2WVJA 2O8BB 1TMKA 1DVRA 4JIMA 4ACBA 5E7MA 1U9IC 5E4FA 2ASEA 3PENA 1CBUA 2QAGC 2WMOB 4OI2A 5BWMA 2C5LA 3KKNA 1EFHA 4DT1A 2GWHA 3W6NA 1TU3A 4LUCA 3RAPR 1P2VA 3B5JA 3FHCB 4NH0A 2OV2A 3QBTA 1G8HA 3T1OA 3U3RA 3A36A 4QNMA 4DBLC 2LWIA 5ANRB 4DUGD 4FWTA 3MWLA 1OW3B 2QP3A 1FMJA 4NYIQ 4LI0A 2HUPA 3GLIB 4OHVA 3OIUA 2Q9CA 2ANCA 1SVMA 1Z2AA 5EP4A 4Q4AA 4TQAA 3AKCA 4Q7MB 1SVWA 4BZQA 1SVLA 3PFIA 1QG2A 2Q3FA 4RD3A 1RW4A 2FJUA 1DAMA 521PA 2A2ZA 4BRUA 2RGXA 4DLRA 3FOZA 5KDOA 4C7OB 3ZVMA 2VP4A 3WRXC 2J9RA 4NCKA 1PJRA 1G16A 5CDFE 1LNZA 4UNPA 2REBA 2HF8A 1KK0A 3O8DA 2GEVA 2DWPA 2AKYA 2IYUA 3K0SA 2VIIA 3E1SA 4PC1A 4RD4A 1E9CA 2Z83A 2ZRAA 1H65A 2AR7A 3ZYCA 4I1SA 4MUBA 3WY9A 3GJ5A 4FW9A 2OCBA 3PUZA 3L8YA 3LBNA 1E69A 4MUAA 2BBWA 2OT3B 5JHHB 3BGWA 1G64A 3X1WA 4A6PA 4C30A 1N6OA 1MO4A 5JS8A 2ERXA 4MYHA 4AG5A 2GXQA 1D5CA 1W47A 1R5OA 3I32A 3SR0A 5J4HA 4D25A 1QHSA 4ILEA 4BEBA 4TMVA 3WHLA 2CE2X 4MGIR 4B3XA 1M74A 3LO5A 3VU9A 3CPEA 5JZVA 1U8AA 3LAWA 3AVVA 3AVOA 3GJ7A 3MLEA 2A9KA 4DSNA 4R2IA 4WIAA 1KSHA 2P3SA 4YMVA 4UNRA 1VKJA 2CLDX 1N6LA 3LD9A 1F2TA 2QA5A 1AM4D 1G8YA 3QKTA 4JLMA 4B3FX 4QBGB 1XMVA 1G5RA 2ZI9A 4GOXA 3NEYA 2RGNA 3FE2A 3SYLA 1QHXA 1G18A 4LJ7A 1NVVQ 1LY1A 1MABA 1YR9A 3IPYA 4IEEA 3KFVA 2G1KA 2WKPA 1OLOA 4JBWA 1TF7A 1RYHA 2HCJB 2YHSA 3EXAA 2BV3A 1XMSA 5FOUA 1KSJA 3BK7A 3CRRA 3H2YA 1UEJA 4KI0A 3GLFB 4U5XA 4B3BA 2AWNA 2F9LA 4C0JA 2WBLC 4QXAA 4Q1CA 1XJCA 3RRNA 1W36B 5JBQA 1E9DA 4Z8YA 1EGAA 5GADl 2ZEJA 1OIXA 2EFEB 2LCFA 4EFLA 1VYTA 3OZXA 4TYWA 4WA7A 2YOGA 2Z0MA 5FL7D 4BLRA 3R7WA 1Q22A 2XZPA 5FUXA 1Q20A 3QSYA 4Q01A 3RNLA 4TN1A 3W3ZB 1IAQA 1W4BA 4KITB 1Z0AA 3GJXC 1Q44A 3KKOA 4GSYA 1FP7A 2QZ4A 3PUYA 1S8FA 1NMXA 1W36D 4EPVA 5BN5A 2O8CB 4PHTA 5FTJA 2CNWD 2HJGA 4OQFA 4EFMA 3T06B 3T5GA 2QBYB 3CRVA 4ARZA 3LX5A 1VPLA 3KXLA 4IVRA 3KJGA 4JLKA 4CEHA 221PA 3KXIA 1UFQA 1NJGA 1PUJA 4C0KA 5IT5A 1Q0UA 4A92A 2ZE7A 2ZRLA 1ETUA 1F3OA 4US2R 2IYSA 1US8A 4PPGA 3RC3A 4DLTA 2XAUA 1X3SA 4LCBA 1DG1G 2VP9A 1U9IA 4NKRA 3I73A 1SHKA 1NSFA 1GNRA 2CDNA 1CJUC 2O0KA 4XTCS 1U8YA 4MH0R 5FH9A 4ABYA 3KL4A 1A2BA 1FNMA 3G82C 4ON9A 3R7WB 4DDTA 3EARA 4KYUA 3KX2A 3K1JA 1H8ED 1GVNB 2JLYA 3ZIAD 3Q85A 1VDZA 4RFSB 1U98A 3HPRA 4LV8B 4URWR 5FPTA 3CRMA 2P6RA 1W46A 5EE9A 2H57A 5AJXA 1KZGB 3CBQA 1II8B 4B48A 3QENA 3SQWA 4DLYA 4DZZA 2DHRA 4R98A 2NPFA 4HAZA 1U0LA 3OE7A 5FUYA 3QBVA 3H84A 5HCIA 4JVNA 3DM5A 2G6BA 1JQJC 3KFXA 4JJZA 1G6OA 4OQNA 3V4RA 1JI0A 1U81A 3DOEA 2VP6A 3HU2A 4TYPA 2GVZC 2G3YA 2ZANA 1JR3E 3CM0A 3OAAA 3U61B 1SXJD 1Z83A 3AM1A 3SJZA 2O8FB 2R62A 3B85A 4UXHA 4A1FA 4BFZA 2XOKD 2OHFA 3MRSA 4EQ6A 1G4AE 2VHCA 4HATA 5DI9A 3IHLA 5SZHB 3QPVA 4I1UA 3WYAA 5KU1A 3WP0A 2QAJA 4O0MA 5DSZA 2VHQA 3U7EB 4GNKA 1FMLA 3MD0A 3AV0B 2IYQA 3IQWA 5FUVA 4Y0AA 1AQUA 2CHGA 2N1BA 4XVUA 5KSZA 5F9FA 3LLMA 3WMEA 4Q4LA 1JPNA 1KMQA 1W5TA 2BOVA 4AG6A 2ORIA 5DLQC 2PCLA 5E7IA 2RHMA 5EE1A 3I5XA 1MH1A 3OIYA 3ASZA 1LVGA 1YKSA 3Q7QA 1ZAKA 4BGDA 5EZ5A 1NY5A 3DPUA 3U7GA 3BXZA 6Q21A 1V43A 4UNQA 3ZZUA 1SXJE 3TVTA 4D0GA 5TVKA 2CCGA 3A1VA 4Q47A 3TNFA 4A82A 4URZR 1G20E 4XH9B 2RGBA 2WWIA 3EZ7A 4HUQB 3LQQA 2KWIA 3CPHA 1XTRA 1E99A 3EA0A 2OE2A 1OT3A 3T15A 1KTVA 2QP9X 2V55B 4BWYA 2JLZA 4MRNA 4B43A 2OZEA 1OB2A 2HT1A 4L16A 3ZD6A 2V54A 3RS7A 1K5DA 4CVNA 3RS4A 3X1ZA 3IGFA 3K0AB 1CR0A 2ZS7A 2ONKA 3W5IA 1HE8B 5B64A 5C18A 3BH0A 3QQ5A 4IVPA 4DUGA 1FNNA 3EWSA 1Q12A 1Q1EA 2IT1A 1N5JA 1W4RA 2FN4A 4DWJA 4PAQA 4F4IA 1KOFA 2IS4A 2OCAA 2VP0A 3TSWA 2FX3A 2ZE6A 3Q5EA 2BJVA 5JJLA 1CR4A 2KBFA 5K8TA 1OSNA 4L15A 2H1LA 3ND8A 3CUEF 1Z0DA 1NKSA 1NN0A 3R8FA 2H92A 1KK1A 4RFSA 2H18A 4ZO4A 1S4QA 2JDID 2VH5R 1B0UA 3RDPA 4DDUA 4YQFA 4Y0VA 1DADA 1TADA 3C5HA 3MJRA 5A0FA 3TIFA 1XZPA 3DM9B 1WXQA 2VF7A 2IXEA 1RE0A 2ZYTX 2P5SA 4YXWA 4V02A 3NH6A 3SBDA 5JJIA 1XD8A 4L5BA 4RFVA 2FDCA 5FUWA 4DJTA 1T9HA 4JL6A 1AKEA 2BMJA 4QHYA 3N70A 2BMEA 4B2IA 4KVAA 1LF5A 2V7QA 1MOZA 3TAHA 5DN6D 3VQTA 1VCNA 3C16C 1DE0A 4MDFA 4LK2A 1QHNA 4GBMA 3CX7A 4RZ2A 1YVDA 3Q5DA 1O87A 4DLVA 2O8EB 3K9GA 1ZD9A 4R7ZA 1RRPA 3A4NA 3K70C 3UANA 4AK9A 2V6JA 5AUPB 4LX0A 4OL0A 5B58C 2FFAA 4CYMA 1OJLA 4DB2A 1TQ6A 2ZI5A 2WWHA 1NIPA 1TX4B 3F0TA 1WF3A 2IEYA 3WHKA 1VCIA 2AFHE 2HYDA 3T34A 1N2CE 3NWJA 4P4TA 3VR5A 4IXMA 4ZV4A 1TNDA 4HZUA 4AD8A 1OYYA 4QGAA 4A0RA 3PV0A 4Z51A 1R7RA 1R4AA 1R0XA 4PANA 4X8OA 2ODBA 3IIJA 4NZYA 4FMBB 3NBXX 2FE4A 4A4DA 1BYIA 3C14C 4UNSA 4D81A 1NBMD 2R44A 4A8JA 2VRWA 3E2IA 4TSFA 2WV9A 3LVRE 3R20A 5H68A 2F3RA 8OHMA 1KKLA 2PMKA 3MAAC 1JJVA 5FI0B 3B9PA 3FWYA 4RD1A 2C77A 4AC9A 3QPWA 1YZQA 1QRAA 4OYHA 5FR1A 2GTPA 3REFA 3SHFA 3OFND 4F4CA 2AFIE 2ORWA 4RZXA 3THOA 3GLFE 1P2SA 5BXQC 3KQUA 4TMKA 2GNOA 1AK2A 2J7PD 2C8VA 3LH5A 2ZR0A 4W5JA 3QF7A 4BLTA 1NI3A 1JQLB 3WNCA 1IQPA 4BLQA 2X1VA 2KSQA 3W6OA 1VECA 3CR8A 4KO8A 2HCBA 2LKCA 1FTSA 4W9MC 1J99A 3N2IA 4RKEA 1JNYA 4GOKA 1G6HA 1CTQA 1KDPA 2QRNA 3SOPA 3QI2A 3I61A 5TV2A 1M6NA 1W44A 4B3GA 4C2TA 3OF5A 1ZBDA 3PITA 2JLWA 4NHOA 4TYQA 3UWKA 1DAKA 2AN9A 3V4FA 2OAP1 2RKOA 1XPUA 1LB1B 1FX0A 2PCJA 2ZUBA 3QKSB 4O25A 4UJ5A 4IFBA 1PUIA 1XMIA 4UXJA 1L2TA 4DHEA 1T0JB 3CX6A 4M1TA 2CVHA 1NN5A 4MITA 3R9WA 1GNPA 2PBRA 3RS5A 5AUNB 1X6VA 5AJYA 3BRWD 3Q7PA 1UJ2A 4TYNA 1NIJA 2EFCB 4JL8A 2NTYC 2REXB 4BLSA 5J47A 2QSZA 1A1VA 5J4YA 4P4SA 5DE3A 3NIBA 4KODA 1BMFD 2J5XA 1N6HA 3S1AB 5LD2B 1FP6A 3KKMA 1VYUA 4M1YA 4NE2A 5CIWA 1SZPA 5DHAA 3OIWA 3THWB 1UKYA 1CU1A 1T8UA 2G0NA 2F3TA 1KY3A 4NPHA 2HLDD 2WZQA 3SJAA 4M9XA 4LBZA 4FMCB 4Q7LA 4EPWA 1E1QD 3KZ1E 3LX8A 3QXJA 3U3KA 1DO2A 2OBMA 1G1MA 4TLDA 2AK3A 4ERNA 2ZSBA 1ONBA 1G3RA 4KBGA 2IHYA 4JLPA 4TYYA 2QL6A 5GVRA 1Z47A 4HB4A 3NH9A 3CF6R 4Z8XA 4B2LA 1E2LA 1GG2A 3ASYA 2Q3MA 1KI2A 4PPNA 1UDXA 4MGYR 5EQTA 1V5WA 3HU1A 3ADDA 2XEXA 1XZQA 4M9ZA 1VMAA 2PH1A 1XWIA 3KJEA 2J45A 1S2MA 2P2LA 4PXAA 1IM2A 2EWWA 1S96A 2VSOA 4HI0E 4MRPA 3QVVA 3A4LA 4HLUA 1UAAA 4LHXA 4BLPA 3GFOA 4KFUA 3LRPA 3AVUA 2ZQ5A 5FPYA 3REGA 1XXHB 4LYFA 4QRHA 1NRJB 4UXIA 4WVFA 5KPJA 4D80A 3A1SA 3V9PA 4B6FA 1ZM3A 4Q5IA 2BWJA 1EWRA 4LY6A 2IYLD 2ZYWX 2IYVA 1ZNWA 1JALA 1KMHA 4TL6A 2VSFA 1RJ9B 2ZPTX 2RAPA 4NYMR 2ODNA 3EC1A 2UZ3A 1FQJA 3VR3A 3P1JA 4GFDA 1RRGA 2XNSA 4M0LA 4QNRA 3FYHA 4LDJA 5D3QA 1F2UB 2QENA 2WSSD 1OHHA 1Y63A 3K0CA 3MCAA 1QHYA 2JLSA 5B30A 5BYKA 3T1TA 3FGNA 1P2UA 1UKEA 3S1AA 2ATVA 1ZM2A 1W7AA 4P31A 3D7MA 3BWDD 2BDTA 4JLBA 2J7KA 1YZGA 4D26A 3TGPA 4EFNA 4ZCIA 3RS0A 2GEDA 3BE4A 3GJ3A 2DB3A 3FHTA 4JLNA 1EFCA 2QTHA 4BZPA 4DLZA 1T3SA 1UBFA 4XSHA 3TQFA 3BERA 2IHBA 5KOYA 1OV4A 2J0QA 2VBCA 4M1WA 4PHFA 2BJWA 4LJ6A 3J81k 4EJSB 3QKRA 3EZ6A 3A8TA 1VG0B 4DB4A 1CIPA 2FZLA 4HLQB 1FUKA 3HJNA 4FCTA 1SHZA 3ADCA 4NYJR 5B2ZA 2WICA 1IY2A 2CNWA 4KFSA 1CLUA 3GLIE 1EESA 3AGPA 1W5SA 4TMZA 3CR7A 2Z4RA 3IBYA 4PPFA 2FEOA 3BD9A 3UATA 2N46A 4DLXA 1GILA 4I81A 3C8UA 4KFRA 2VHJA 3GJ6A 2HXYA 1P5ZB 3SDZA 4DSOA 4TMTA 4QGFA 1G8PA 2FV8A 2A5FA 2CHVA 1FQKA 1OB5A 1KY2A 5IDVA 1RC8A 2ZU6A 1E0SA 1ZIOA 4QKQA 5C4MA 4FN5A 3GFPA 2PZGA 3EPLA 1E1RD 1N0VC 3K70B 4PFSA 1GTVA 2CLCX 5D3MB 2EVWX 2RHDA 2FFBA 4NL4H 1QHGA 1XCMA 3ZQJA 3M1IA 2V3CC 4RZ3A 3GEHA 4BFSA 4B3DA 5CIQA 1E2DA 3CLVA 3QXCA 5JWOA 2FGKA 4BECA 2OXRA 2GDJA 1SVSA 2XX3A 2J59A 5BN4A 1TPZA 1XEXB 5KSYA 3D8BA 3CB4A 4NCIA 4Q1BA 2AXPA 3DEFA 3ZJYA 5CM8B 5J4VA 4CEIA 4YLGA 3IPXA 4XWOA 2GBLC 3VAAA 3LV8A 1OH6A 2NOAA 1JXOA 4WZAE 5FOVA 1PLJA 1E98A 1EWQA 2HXSA 1XTKA 2FEMA 4HAUA 2R6DA 4EJSA 1P6XA 1Q57A 1F6BA 3EAQA 4HLUC 2O8FA 3MWJA 5EP3A 3AVTA 2J3EA 2CVFA 5HE8A 5GJBA 2WHXA 3GLGA 2PT5A 4ITRC 3RSOA 2QPOA 4NYIR 5P21A 1YQTA 4C9BA 3EIQA 2LKDA 3NG1A 4DCSA 5FTLA 1S9HA 3ADBA 2ZVQX 3GLHB 2BBOA 5J5CA 3RC8A 1DS6A 1ZJ6A 2BBSA 4DSUA 1Q3HA 1MO3A 2VP2A 2YV5A 4HAVA 4OHZA 5C2JB 5JCPA 4QOSA 5KNCA 1N0UA 1DAHA 4C0LA 3TR0A 2AX4A 4BE7B 5JRZA 4PR0A 1CR1A 5JCZA 1Z63A 2CJWB 5L3SA 2AD5A 1ZM9A 3N5CA 1FL9A 4GP7A 4M1OA 1P75A 1E2HA 1W2HA 2W2TA 2ZAMA 1AGRA 3ND9A 1M7BA 4ASUD 4CZ2A 4JL5A 3QKRB 2GJ9A 4AKGA 1G7TA 4PAOA 1NJFA 3OEEA 2AWOA 5EXSA 4O2LA 2JIZD 3UG6A 2JLRA 2YWEA 2HT6A 2VYFA 4DLSA 3QF4A 4GZMA 3UPUA 5CLLA 4FIDA 2EQBA 4ZIRA 1Q3TA 2JJ1D 3B60A 1MO6A 4QJ4A 4NMMA 2QNRA 1L4YA 1GKYA 4F38A 1OFIA 1Y3AA 2OSBA 4FXPA 4B32A 4Q1DA 2EWVA 3GD7A 1DAGA 3RABA 1E2IA 3IBGA 5L3VA 1U90A 4NP6A 2RGEA 5EE3A 4B71A 3IO5A 5CJ2A 1GDDA 2B7CA 1Q1BA 2F1RA 2CL6X 2IL1A 3A4MA 3EZFA 1AIPA 4HSEA 1ZNXA 1T6NA 4M22A 2E87A 4XTRA 5E7JA 1FTNA 3K0AA 5HPYB 1GOTA 4LOAA 3VR1A 3FHOA 2EYUA 4GPTA 3C4JA 3DMNA 2A78A 5CK4A 2PEZA 3DVLA 3PUWA 5DYGA 1SXJB 1NVUQ 1L8QA 2X2FA 4E5UA 2BMDA 3B82A 3K09A 1BS1A 4LHWA 5SZJA 3T35A 4Q00A 1RVDA 1UM8A 4AKIA 4CIDA 1KI6B 1G5TA 2QN6A 3TRFA 1M1YE 5HTKA 1E2EA 1T5LA 1E4YA 4NTZA 1MV5A 3P32A 4OHYA 4L8GA 1KI7A 3TLXA 1M2OB 3AH8A 3AF2A 1X1RA 2H7VA 2PEYA 2XSZD 4QG7A 5FOXA 4MKIA 2FGJA 1XCPA 1NLYA 4N1AA 1P4SA 2KI5A 4PO8A 5TXGA 1COWA 4KLNA 2DFKB 2Q3HA 4A2QA 1E9AA 2ZE5A 4IDNA 3K9NA 4V0NA 3QJYA 4CEJB 1ZYUA 1AGPA 4M9SA 1XEFA 4JKIA 2QRZA 1AN0A 1C4OA 1CRPA 2P6UA 4WAUA 1E0AA 1Z0KA 1MABB 3VU9B 4RKFA 1KDTA 2OBNA 1AQYA 3BB4A 3TUIC 4G5SA 2JEOA 5AUOB 2BIFA 2FWRA 3PEUA 4CW7A 4ZDJA 4LHZA 2QROA 2GZHA 1F2TB 2IYZA 4URUR 2XGJA 4Z54A 4US0R 5FOTA 1NBME 1X1SA 2WJYA 3ZVNA 2PLRA 2GJKA 1U0JA 3K0FA 2XTNA 4DXAA 1OXVA 4RCZA 2O8CA 4JBYA 1UPTA 2KJQA 4XD7D 4YMTA 4IDPA 1KO4A 1I2DA 1DAEA 4R2HA 2QM7A 3GLHA 2H17A 4KHZA 3FTQA 2YYZA 1TF5A 2FMXA 2TMKA 1WBDA 1LW7A 4OKSA 4HDQB 4C0SA 4B75A 4WZBE 3CH5A 4NCHA 4V0OA 2RGCA 1W4CA 2F1HA 4D0NA 4TTRA 1KYIA 1IN5A 1SVOA 1YJ5A 4KU4A 1ZNZA 3AEZA 2WOOA 4XOIA 1Z06A 5F9HA 1OH5A 1BO6A 2A5GA 4JT2A 1Z2CA 3H4MA 4R9UC 5K8IA 2ZE8A 1P9NA 3LW7A 3MFYA 2QPTA 5FL3A 1E2JA 3W5JA 4FWIB 5GJCA 2D2FA 4A6XA 5E3HA 2O8DA 1Z6YA 3TVDA 5KPDA 4M9QA 3VHLB 4Q9LA 2G1JA 3DL0A 4BFWA 3VKHA 2NG1A 3THWA 2K5UA 2WIBA 1S9DA 4G5QA 1S0UA 2ZRPA 5UKDA 3O47A 2ZAOA 3GLGB 4BEJA 1CS4C 1WCV1 1U99A 2Q0HA 2RGNC 3KB2A 4A15A 3CRW1 2QTFA 4ZDIA 1JPJA 3SEAA 2FFQA 3EW9A
chains in the Genus database with same CATH superfamily
4HWKA 2ZI7A 5K3FB 5SYAA 4AJHA 1C8LA 1L7NA 1J97A 3DWEX 3VPAA 3W2HA 4UTPA 2B7BA 2RH9B 2GYYA 3CKKA 4LE0A 1ZHHA 4LRQA 3VC3A 2B7LA 3W5HA 1M2NA 3HKBA 4UC0A 1V16A 4CCWA 3KOOA 1G19A 1N25A 1HO3A 2PGDA 2ZWOA 4HTFB 3UHFA 5CXQA 3L8GA 1UK7A 3HPQA 5KSOA 3HC7A 2FP4B 1FTGA 3ZS8A 2GJAA 4RTOA 2D4AA 4TKMA 3MTJA 1UCFA 1VPDA 3CWZA 4P32A 5JD5A 4DLUA 2CE7A 3FA2A 4WKPA 1L6RA 3BAFA 3VYVA 1H0SA 1UBUS 1EG7A 3IULA 4S1PA 1UMBB 2UUOA 3C6YA 3K9LA 2FZKA 4NBWA 2WYIA 4LGYA 3ZWAA 3W7BA 3QW4B 4DAOA 3O8LA 1D09A 1XOIA 1BOFA 4C4AA 5KNCD 5AI9A 3V6MA 4MRSA 4IINA 1UXIA 4PSCA 3DL7A 4V1CB 3IMFA 3OEHD 3PX2A 3HP7A 4NV0A 2XT0A 4HMQA 5KOIA 2G09A 3VNVA 1EUZA 1N9GB 4NZOA 1ZI9A 2JIZA 1U0BB 4UHKA 1W35A 3KTOA 3M89A 1PZEA 3ZE2B 2ZRMA 1IN4A 1AX9A 3EXEA 1QRUA 4XPZA 4KL8S 4ZV7A 4YCNA 4MVCA 3RYHA 3JQRA 3EQZA 4DIFA 1N8TA 1VG1A 3P26A 4HF7A 2W6OA 4MV3A 4BBJA 2IXTA 3QUCA 3IT3A 2IS6A 1XQYA 2AD1A 3ENWA 4UBJA 1ORVA 3OQJA 3D43A 4DV6B 2BSAA 4FX2A 1O6ZA 4KVZA 2JF0A 4GBED 3K70D 1T6ZA 4FJ1A 1L7XA 2PFSA 4X85A 3K5HA 3JQGB 3QWFA 1ONPA 4U2GA 4WMLA 1D8TA 3H11B 2GFQA 4LF5B 4PNHA 2P67A 1HNWB 2RHGB 3LRTA 2FEKA 3AIKA 3VR4A 2EJBA 4QJIA 4QUAA 4B3MB 5I9IA 1EQ2A 4IOLA 4MDYA 4O2RA 1KI6A 2LPMA 2PJZA 5FTWA 1Z5WA 3H5RA 2IIVA 1N33B 2B8TA 5A71A 3V2GA 4RMNA 4B74A 5IKEA 4BQIA 1GR1A 3ZDXB 2PBLA 2WD9A 3DLIA 1FFSA 2CL0X 3AR7A 1T36B 3M1YA 3JQ7B 2EERA 4GO1A 1UBOS 3S29A 1RKUA 4KQ9A 3U6BA 2FKAA 4YV0A 2B82A 2JFUA 2OLKA 3ZDQA 1WCIA 2H4JA 3L1HA 1IXYA 4JQCA 2QV0A 4JB2A 3RWOA 2X0NA 2H6EA 4TQGA 3W6PA 2QTMA 3AFNA 1C1HA 4A2PA 3COSA 2FMIA 3IQFA 4QQNA 1K88A 1VZ3A 2ZIUB 4E5MA 1SQ5A 2RB4A 4ND4A 3JQ6A 4L72A 1T0HB 5CURA 1Y3BE 4EKIA 4GWLA 4Z0PA 1TM3E 5I4CA 1H4SA 4N5LA 4EY5A 4TXMA 4QFDA 2CDAA 4N3BA 5G4KB 4RKYA 4BJ5A 3S28A 4W5RA 5BW8A 1I5OA 2D7CA 3G2NA 3DWFA 2ZJAA 1XRSB 4GRIA 1TGYA 2PAFA 4ABTA 1BEZA 4CUJA 4PM4A 2L18A 1M5RA 1KMCA 3BXOA 1ECPA 2HJHA 2WWXA 3HKCB 1DDGA 5E6UA 3OQ1A 1MN6A 5EA2A 2OHVA 4TLCA 3G2HA 3MZ0A 1DKLA 1SQFA 3IE0A 4FZ5A 3T7DA 4P7BA 3W2IA 1HE2A 5G0VA 3EJWA 3EGVA 3OKFA 1BQEA 1YZYA 2YBEA 3A1DA 4MB2A 4ECEA 1PSWA 3MWDB 2ZIAA 4JI1B 1NR7A 4P3YA 3AOGA 3FXAA 3VOAA 3IKJA 5A1JA 2FRDC 2JHFA 1RLJA 2B1IA 2P1DA 4RS3A 4W6QA 4XWGA 4QXQA 3E7FA 1Z6AA 3GRPA 4XIIA 2JLVA 1VSQA 2YY7A 4MGHA 4RS4A 2I65A 2FR0A 2ZYVX 3BICA 3SZLA 3T6KA 5K9ZA 5CHYA 5ER9A 1UBRS 4J3FA 1MJFA 3NBAA 5CLIA 4AJKA 4PFQA 3H1TA 2HH9A 2I80A 4YXWD 3FRIA 1W0CA 4MGKR 2H0QA 3UFBA 2O8DB 3EHEA 5FO1A 1D2NA 2UZ1B 1N8SA 4GLLA 2P6NA 1Q84A 3LGAA 4XD2A 4OQXA 1JFSA 2V0GA 4QLBA 1JAHA 4IL5A 4KQJA 3R8CA 4OJQA 4RA9B 1BQ3A 2E4UA 3ZOZA 4DV0B 1N78A 1KO8A 1P0MA 2KE5A 2V7GA 1YZUA 2BJHA 3SYKA 4V03A 3TSOA 1HMYA 1OT5A 4Q4JB 2EW1A 4L5YA 1GYQA 2EX4A 1Y6ZA 4GOOD 4TV8B 4YMSA 4JVLA 1TTHA 1PJBA 1UXKA 1R5BA 2WAXA 2ZDQA 3CU5A 1ATZA 1XKXA 3IEIA 4HWTA 4TV9F 5BQOA 3QUTA 2EFYA 2Q5FA 3LWZA 1LS1A 5T4HA 2GCNA 1H9AA 1GSAA 2VWGA 2C4KA 3PUXA 1IN7A 4D3SA 1VMKA 1Q5PA 1ATIA 4HDMA 5DV9A 1P62B 3MGKA 2HHHB 1UPFA 1E9SA 4CIBA 3HO1A 3Q9LA 4HX5A 2QIOA 3EXHB 4PX9A 3CH7A 2EFDB 4HTFA 3KQLA 3LYHA 5HF6A 3ETEA 1N6RA 2YW2A 4YN3A 4O4JA 2GLTA 2VTKA 3PNOA 4DQUA 3PDIB 3L1VA 1NG9A 5IC4A 1QLHA 2RGGA 4HAYA 3KTFA 2OKGA 2ZYDA 3WGTA 1S8NA 5KOJA 2QPAA 5IJZA 2O5CA 2O8VA 2VA9A 5AOAA 4GL4A 3AERB 4LC9A 3IB6A 4M7WA 4U6SA 5AVTA 4PSVA 4JSTA 4KDRA 1G7RA 2ZUVA 2RBEA 1PVDA 5F2OA 5BV0A 3F46A 3MN1A 4ACAA 3MS2A 2OG1A 4RHEA 4B33A 5I9MA 1TEZA 6YASA 1ZO8A 4FYKA 1U4SA 1Z6QA 3R7FA 2QV7A 3KHKA 4K6KA 5JU6A 1SPXA 2YJ6A 3F2VA 4RIGA 5CVUA 4MI1A 1AQIA 4F9GA 1SR8A 2HO5A 1SXJA 4WXMA 1H8EA 2PM8A 2VJMA 2H5LA 2YWFA 4MEBA 1CEEA 4FFPA 1BA2A 5CXXA 3OPVA 5A5DA 4BO0A 1A8QA 4PIPA 4TXJA 1QIJA 2WFAA 5EFOA 5FADA 3VPXA 1H2RS 1YR7A 5FBLB 3TZCA 1SKMA 2Q0XA 4M4SA 4EHHA 1HY3A 1CQIA 3ILVA 5AKZA 3DMDA 3EMVA 3HZZA 3JD2A 4K9NA 4DC1A 2GM5A 4UUPA 4YYZA 5KX5A 5GV7A 2Q50A 3SZ3A 4C20A 3WLEA 1XTIA 3IAM1 4UZFA 3AW8A 1J22A 1TVKA 2DU8A 1LLDA 1HTBA 2HA0A 1UDCA 2QY6A 3NR2A 4LFBB 5GVSA 2D4HA 3IAFA 3LFUA 4RY0A 1ZVKA 3PQ3A 2PH7A 4EUEA 1T3GA 1WQ1R 1YUNA 3KXDA 1C3LA 3L9WA 4O8ZA 1O0SA 3P4YA 4D4JA 5HUQA 4PXYA 2Q2NA 2XF2A 2Q1YA 1ZISA 2X22A 1VMEA 1E32A 3E84A 2EJWA 3MSXA 5CM9C 3IIMA 1NLFA 1Q7TA 2QVBA 3ZHYA 3G2IA 3I01A 3EJ6A 3FPEA 3GG9A 3HR8A 2BEVB 4Q3CA 3RT9A 3EK2A 2EKZA 3RVMA 1PV4A 5KU7A 1ZLYA 1ISPA 4MMZB 4P22A 4JMLA 3VO8A 2VK1A 1JTVA 5M3BA 3STWA 4EUFA 1GJRA 4DMLA 4WJLA 1BW9B 1HYEA 2AT1A 2X6TA 4TSFD 1U4OA 1W6RA 4YV2A 1CY0A 5ECDA 3L0ZA 1NJ2A 1LTHR 3WRYA 1I94B 2X1HA 4IRUB 5D01A 4EO9A 1QO0D 4F3KA 4M86A 3ROZA 4WLEA 1N1GA 1YE8A 2HNBA 2JKYA 5FNZA 5F5NA 2DFLA 2GSWA 3TI9A 5D3KA 1KJ8A 1M8JA 1ECJA 1F6DA 1PT7A 3FBTA 5DYWA 4XJXA 3NX4A 3I45A 4KPEC 4HAWA 2ID4A 2IEBA 2W2KB 3W04A 1AV7A 3GRZA 3O2JA 4BLUA 1A95A 5MN6A 1ML3A 1L5RA 5C35A 3H6HA 3DVAB 2DFNA 4WCFB 1N2GA 2V65A 2G28A 3CF0A 4RA6B 4GZLA 3CO5A 3VJLA 3SDSA 5COAA 4BXOA 2W90A 1Y42X 3ROEA 2RKBA 3BMXA 4DL9A 3W9YA 4NBSA 3O84A 1GGJA 3I05A 3CLKA 3CPSA 1QGOA 1V96A 1VJTA 4GD3Q 6PFKA 1T4GA 3PC8A 3FF4A 3FDJA 1GZ6A 2YC2C 3PFNA 5EMMA 1Z45A 1JKJB 2L82A 4G0MA 4I5DA 1U3FA 1XXHE 1YD7A 2ECKA 3MIZA 1KAMA 1T4CA 1RLIA 1IQRA 3IPLA 2A0XA 4E33A 3EMBA 3SWWA 4HP8A 1DPGA 4UTZA 4IEIA 3ABZA 2WIFA 3GBPA 1U7WA 3LOPA 4CUZA 5KC9A 1G5HA 1NBHA 2ES4A 1SZDA 4J3JA 1E1LA 2A9QA 2CW5A 4MUNA 4X6UA 2L42A 4NPCA 1QF6A 3KQQA 1OCEA 1R6AA 3GJTA 1KDOA 5K8JB 4HNVA 4BB6A 3GJ8A 4UM9D 4Y2JA 1N5OX 4EEKA 2LRHA 3JRWA 1S02A 1PGNA 3VMFA 5A05A 2VZEA 3E9CA 1BXRA 5FBHA 3F78A 1J8DA 1KOLA 1D07A 1NV9A 2CNLA 3B1VA 2H16A 4P82A 4R41A 1VBKA 4NG4A 1P18A 2OAQ1 4DYVA 2R85A 4HUQA 5GGXA 4ER5A 4N03A 2NO7A 3ISTA 1S4MA 3OTHA 1NE2A 4EAAA 3MCWA 4B87A 2B4KA 1E3MA 5AXDA 4R1MA 4YJGB 2HHCA 1Y8ZA 1O9BA 3DKPA 3UAVA 4B4VA 4DDHA 4OYLA 1XZNA 2JVIA 2P90A 2VPWA 3QU2A 3H17A 3ICPA 3DD5A 2YHBA 3HADA 3ND6A 5CFOA 1MAWA 2H7CA 3KDAA 1V7ZA 2AEFA 4UQLA 4Q05A 4ZRDA 3C3MA 3G2LA 2YZ2A 4KB5A 3GH1A 1I0IA 3EE6A 4QPNA 2X3UA 2JASA 1DI0A 2PUTA 1MJNA 1GR0A 1I13A 2NMVA 3MILA 5TNXA 3CUUA 3R9IA 3PHJA 5JCOA 1RPJA 4F06A 1WVIA 1XD2B 8MHTA 3LKVA 2XDQB 4EY4A 1RBZA 2A57A 1N0WA 2ZRKA 3CZPA 4L4SA 4TV8F 5DX8A 1CIVA 4AG3A 1JR4A 2IZ0A 3VHRA 3VU1A 1LSOA 4PSKA 3T1VA 1AXGA 3KJXA 4TXLA 4YXFA 4AWBA 5AKKA 5AESA 3HABA 3ETDA 2JFYA 4QOFA 1LA2A 2AJCA 5SZKB 3H2IA 3UV6A 3SN6A 4M1KA 4UM7A 1P1HA 4WRRA 3HDVA 2GVDC 1DCFA 2PR2A 2DMRA 3GMTA 3HZRA 2JJYA 5KJCA 3HBMA 1T26A 1MAVA 1H8HA 3BE5A 3CT4A 5JWRA 3GOQA 4FDAA 1BDMA 3V1UA 3VNRA 3W05A 3C3CA 3ZIAA 4W7IA 2Z8YA 3IMKA 3L8DA 4DMRA 3C5CA 1O96A 4HKTA 4ZOEA 3B6EA 4UDOA 5FQNA 1O57A 3EQ2A 3IT1A 5DJ5A 3TQCA 3U17A 4CEJA 3C87A 3PEWA 3RANA 1QDLB 2X1MA 3DJYA 3OCWA 4WWHA 4XUCA 1SKYB 2PPLA 1JEEA 5IKMA 2VBFA 2BEJA 2IP4A 1MJGM 1E9VA 1K6MA 1X9GA 1GTMA 3CLTC 3HACA 2C8LA 3IDQA 1EFRD 3KSZO 1CRQA 4OMUA 4PBSA 2CJPA 5ESDA 1QE5A 4C14A 1T91A 4OAPA 1PW5A 3Q41A 4JGBA 4AZWA 2Y0EA 1Z56C 1UIRA 3B1FA 3WGVA 2ZWPA 3TOSA 3EFHA 2FCAA 5KMGA 3EEOA 2ZS8A 3GEPA 1JBKA 3HE3A 2Y1DA 4AJ1A 1AZSC 4DXHA 2QU7A 4C0XA 2OENG 2B98A 2L0XA 4YJ2F 1ZIYA 4D82A 1KK2A 2A1UA 4L4ZA 1YVUA 5DNYB 3I9FA 4NR0A 4LX8A 2PBFA 1MXFA 1T3ZA 2SHKA 5C1IA 3OU6A 5KZMB 1DUIA 3A3NA 3W5VA 1GA4A 2AZTA 4EDFA 2Q49A 2LIPA 2XTMA 4FHGA 4URHA 1Z5OA 3OKCA 3PC6A 1HETA 4MEJA 3P5BA 4GGPA 1RI2A 4NU0A 3VHQA 2YKGA 4Y6GB 3IOEA 1VTKA 2HFKA 3AEYA 5BNIA 1FLAA 1I4EB 2HZBA 4WASA 3WAJA 3GYGA 1V8DA 3DS8A 3JAKB 4MYUA 1DHTA 4D9GA 3I04M 4C4XA 2GYVA 3HXTA 1B0ZA 3LDAA 3PXGA 1M54A 1ODJA 1HTWA 4EYOA 1N36B 3AL2A 1KIMA 3COPA 5TS3A 4DR6B 3NAQA 1M33A 4MXDA 3ZWCA 5BXYA 2BGTA 1E0JA 4HN9A 2MINB 5ES4B 5L3RA 3KVNA 4XIGS 5SY4A 4QT0A 4MV8A 2FOLA 3ZZTA 5B5SA 3QWAA 3HDTA 3MMNA 5DNDA 4CT4B 5JVDF 2YJNA 5BSVA 1IWOA 4DWOA 3SF0A 2P5YA 2E48A 2PKYX 4M76B 3SYRA 4DJAA 2XTAA 3H86A 2ECFA 4C3ZA 1K7EB 3QLVA 4J0QA 2OC4A 2YVUA 4IBOA 2JW5A 2ZYSA 4P4NA 1XE3A 3G2KA 3OIDA 1LF0A 1XLUA 2CMGA 1VLMA 2MDTA 2V6BA 4LTMA 3VHXA 4EKEA 2YZNA 1ESNA 3UG7A 4JB8A 4N5MA 5KYYA 2JGMA 1T1SA 3FCAA 3PDUA 1B41A 4C7OA 2AV6A 3SMVA 1GFZA 4N7RA 3RO7A 2JFWA 3RFVA 2OK8A 3S2IA 1J8YF 1N8NA 5IF3A 1ZRSA 4IOKA 4P84A 2C3YA 3A1WA 3UJDA 4F2PA 1UF9A 3QV1A 3CLRD 2Q5CA 4K46A 3B6ZA 5FP0A 2ZULA 1T9ZA 4G1MB 2QQ0A 1I33A 5TQ0B 4J1SA 1Q3KA 3EG9A 4LOIA 1GV0A 4LNUB 4CQLA 3DBLB 5D1NA 2XZOA 2JGRA 1XV5A 2RI1A 4KSCA 5C7YA 1Q91A 1F06A 1G8SA 1OMOA 3QMVA 2DQZA 4XCVA 1DEKA 1D2MA 4OQLA 4AMZA 1C7EA 2IYAA 1ZC3A 1KYVA 2YNMD 4KXFB 4DLPA 5BOSB 2ZYAA 2X7JA 3FOBA 3VU0A 3WA7A 1M0EA 4RTSA 3BCUA 4HZIA 4NK4A 4P1ZA 5BSTA 3GGOA 1QYXA 2QQEA 2A92A 1CY2A 1PQUA 2GAOA 2YJGA 2H4WA 3I01M 4XDHA 3TZ6A 4YY3B 3JZIA 2JAUA 4JLAA 4MRVA 1T9CA 4A73A 4IX1A 1QUEA 4BQNA 5B3JC 1G2OA 2N1MA 2P4UA 2ZKIA 3GAAA 3IHTA 3PFBA 4GT1A 1ZD8A 2OHJA 3RUHA 3GLFA 1UZMA 2WILA 3MFQA 1GL6A 4RPKA 2FW7A 4FGUA 4G0VA 2VL7A 4JU8A 1ZAYA 4PLFA 3NBKA 3RSZA 2NT4A 2Z5FA 1JB1A 2WIGA 3QEJA 4OL9A 1XELA 2JATA 1EJBA 2PZLA 2NU7A 3D2CA 5B7GA 5L53A 1RIFA 2ADMA 3ZCPA 2PRIA 3VZPA 1X77A 3UJAA 1MLDA 3AZQA 3D7RA 3M2PA 5DIFA 2PRJA 1OZGA 4MUHA 4HQ6A 4CR8A 4D4LA 1WUKS 2F6RA 1NVVR 4TT3A 3WC4A 2MJLA 4P7GA 3DUFA 1QPZA 1I3NA 1WD5A 3LCJA 3PFGA 1KK3A 4IUCS 5CFLA 1K63A 3CJRA 2IX3A 2O1XA 3KOWA 3RRJA 1EYZA 4PNZA 1EQUA 1LDMA 2HLHA 1CJTC 3KAJA 4NBVA 1F20A 3HJFA 1MO2A 1Q1ZA 2G70A 2AI1A 2Y76A 1NF2A 4I9FA 3EA5A 5F77A 4NDNE 1LVHA 1YZNA 3WL7A 4RH1A 4L8FA 3AINA 3EY9A 4V3CA 2LCQA 4TWJA 4C06A 3T5DA 2QN1A 3JVDA 1SXGA 4FJ2A 2QRVB 4P36A 4QDKA 5F1OA 4C43A 2IGBA 3T1YB 4FGZA 5G53C 4BN5A 1DKQA 1EP3B 5KWEA 2VLBA 5F7JA 2PX6A 3ZI4A 2OB1A 1ZJJA 3NC0C 3KKEA 3WIEA 3UH1A 1C50A 3SLKA 1N9KA 5HZKA 3D8SA 1IQ0A 2GHIA 4GKKB 4TS4A 4W8HA 3L8MA 3I30X 3OD5A 4JFRA 1Q1GA 2OD7A 4KSBA 4KP7A 4W8GA 3WX0A 1IXZA 3LDUA 3AKYA 4I08A 4R1TA 2EDCA 4AF6A 3EPRA 2PK3A 3DE2X 2IXFA 4DGQA 2PQ2A 4MW0A 3CVOA 2XCTB 4CF6A 4PAGA 4LRXA 5JC1A 5HMLA 2ZIVB 3M83A 4Z0NA 4BS9A 4FEYA 1Z2EA 3R74A 3ROMA 2BPOA 2V3WA 3WNQA 1VIVA 3JYNA 5I47A 1FRFS 2GGSA 1UWCA 1MEEA 2HWYA 1OBCA 2F1IA 4NJMA 3OAAD 1SIWA 3LOQA 3RI3A 5I7UA 1W4LA 3O95A 4H1HA 2Z08A 2IZ5A 2KPOA 3ZVLA 1JR6A 1GT6A 4RPHA 3RRXA 4EJ6A 3RBZA 4ANFA 3QFHA 4YP9A 1THGA 2XCQA 3R3YA 4ZI2A 4KNYA 1WAMA 1S2LA 2JHAA 4LJ4A 2GEKA 2ZUDA 1ZW6A 3W1EA 4O8CA 3COVA 5LM3A 4I5EA 3OP4A 2P6MA 3ZTTA 1PL6A 3AP2A 3BILA 4LI3X 1P1BA 4F71A 1K4MA 3HZHA 3KQKA 2EFHB 1WZIA 2VSXA 3KK0A 4PE5B 1JI3A 3NTVA 5H3LA 3A32A 1KAQA 1E64A 4IXTA 1Q2XA 1Q0HA 2QMOA 1US8B 5F3RA 4A5SA 1DBVO 4GYJA 2GCIA 4EMSA 4ZJZA 2F67A 4QEZA 5JXWA 2OUIA 4I9UA 1LSJA 4MUEA 3LT1A 3PNLA 1V71A 4LC0A 1KEEB 4AO7A 4RKWA 3VO2A 2HY7A 3TWOA 3WL8A 4CTJA 2C2OA 1POXA 2WTBA 1NLZA 1KSFX 1QYCA 3VYRB 1YONA 3JALB 1GHTA 3GHYA 4XCQA 1C3EA 1YV9A 1M2WA 2HRQA 4HG2A 2VNKA 4OFZA 4X8LA 5T4BA 4O4HF 2I3ZA 1TZMA 5M7EA 3RLIA 4ZZ3A 5CRIA 3HA2A 2E0IA 1I6MA 2XLCA 1L4MA 2HLDA 1AKVA 1KS2A 3MUNA 4XGIA 2J9ZB 4G5RA 1OILA 3TLYA 3LIPA 1LNQA 2W58A 1F6WA 4WSOA 1K7CA 4C3UA 1NOJA 2WZCA 3QU5A 4RYLA 3TMKA 3SK0A 2V8BA 1GL3A 3S4YA 2M6RA 4D4GA 1A9SA 1T3TA 4J6FA 1N1EA 5DXJA 5IC6A 3JS5A 1FP4B 4GOLD 3NBFA 4P34A 1OWPA 5EXTA 1C0EA 1PR0A 4D43A 2Y67A 3LWBA 5FTKA 4CM5A 1YR6A 1NSTA 2MSCB 2POQX 3OI7A 1SBCA 1A0OA 1CUJA 5LQKA 1E2MA 3HUEA 4V0RA 2XE6A 3I8SA 3HRKA 2X8AA 1SHLA 3A31A 3D31A 2P9ZA 1JSXA 4HMPA 1PZMA 4NBTA 3K9BA 3X3HA 2HMVA 2Y1XA 2YXNA 2IWHA 1J7KA 3LT5A 2RG1A 4AX8A 2VF8A 4E3ZA 1C2TA 1X94A 1QZUA 3TTYA 1M8GA 1IRIA 2VEOA 2ZIXB 4YMUA 2D59A 3A7EA 5IJXA 4F1KA 1D0VA 3BB3A 3U4CA 5TT1A 1ONNA 4DTCA 3P2KA 1ZN2A 4BNYA 4CBVA 3FR8A 2TRSB 3ESAA 5K03A 3C7KA 1XEWX 2ZR7A 1JR3A 1MIOA 5MN4A 3L6DA 4MVJI 2FEPA 2HBYA 3BF8A 4LJSA 4C7MA 3EVTA 1U94A 2AFHB 3IILA 4CQMA 1W0KA 5JT1A 3GJ0A 2XIQA 2AJ8A 2AYYA 5MN5A 4L9WA 2IS1A 4GUDA 2V7WA 4BNXA 2DWCA 4W1SA 1SXIA 1KQNA 4Z9BA 3E3NA 3KTDA 4JBXA 5EZYA 5A0TA 1KEVA 4O2BB 1T10A 2NV0A 1C2YA 1EK0A 1WR8A 2BT4A 2CVZA 2XKBA 3D8UA 3K5IA 3PGVA 1ND5A 5H59A 5JXJA 3RWMB 3VU3A 2TMYA 1USKA 1XLVA 4HQ0A 5AM0A 4TS1A 3K1AA 3U7JA 3WFJA 4EG7A 3E4CA 2J6HA 2ZWMA 4DLWA 1UXJA 1L6IA 5IXYA 4LHSA 1I80A 3DOFA 1IIBA 1N5LA 3OMLA 5EKXA 2ZRHA 3VTZA 4A8JC 1XCJA 3SJUA 2JFZA 2O57A 3MMPA 3Q1KA 2O8BA 3OX4A 4L95C 5EJGA 1C3XA 1KO5A 1XA3A 1K06A 1RABA 2EJVA 2W2LA 1J70A 1C7IA 1RRKA 1Z2PX 3AHIA 1W5FA 2J07A 3CSDA 4GRAA 1OYWA 3HZOA 4YASA 2IEGA 1L4UA 2QG4A 5C32A 4F4DA 4GP9A 1EU1A 4R1LA 1W2GA 1WY7A 3WE7A 2NO9A 4NCBA 2ZU0C 3OJWA 3C45A 4OP1A 2VC2B 1SVIA 4P2GA 1YCGA 4TYMA 3ETLA 1T25A 3L8EA 2JZNA 3NQ41 2J3KA 1JDSA 4JMPA 2GNAA 2AJDA 4IHQA 4Q66C 2GHQA 5KUTA 2HR1A 1WB6A 5IPFA 4G5FA 5KINB 1E6CA 4DIBA 3AI7A 1LDNA 4QL3A 2XNDA 1DDIA 3KUCA 1OOEA 1ZR2A 2ZUTA 2J30A 2RGYA 4OQMA 4B6JA 4BN0A 4HTAA 1ISMA 2A5JA 2NADA 3MUFA 1GN8A 5E1OA 3BJMA 3EX7C 1FXUA 2I67A 3H3XA 4E5DA 3SPXA 4ZZ0A 2FCRA 1Z8HA 3Q0EA 3TJRA 2L17A 2Y9MB 1SKYE 4HDOB 1AA9A 5ETJA 5TB5A 3ANMA 1IWPB 1FJ2A 1KGDA 3CX8A 3LZCA 2Z2JA 4A6DA 1AO0A 4QOHA 4GPD1 3KQTA 3PXEA 4GE0A 3ECCA 1RHKA 4KKXB 3PKZA 4OMFG 2J5KA 5JJKA 4Y2HA 4EGFA 5A4FS 1H2FA 5JV5A 1N7JA 2J3IA 1G7SA 4CTMA 2WJ3A 1HF3A 3BF7A 3PSHA 1REQA 3E7XA 4J0DA 4UM5A 1AS2A 4TMWA 2P9QA 1VP3A 1IATA 1HEIA 1YZKA 3A3KA 1IIRA 1C7JA 3BFVA 3KPYA 3O2SB 1N3BA 2RH5A 2G07A 4KCGA 1Z2NX 1PR4A 3OX3A 2DHCA 4FGLA 1L5NA 3AI1A 3DHWC 1RJEA 2AMJA 3B52X 1OXMA 1I36A 4P9NA 1IY0A 5J58A 3ER8A 1E18A 2A3NA 3OLVA 3BZWA 1FJHA 3BGVA 5WRFA 4DCUA 3JWGA 1EA7A 5LLTA 2BI4A 1RYEA 3FYTA 4W9NA 5L7YA 2G5GX 1EZ4A 1O4WA 4EKNB 4N0MA 2HBRA 4Z86A 1CUVA 2ZRDA 1RLOA 4KWIA 4WN9B 2ZETA 5KIAA 3FOEC 5A4IS 4ZYLA 1RJ9A 4CEHB 2N42A 2LCIA 2WJHA 3LFHA 3PXDA 4LWQA 4I5IA 4OMCA 5EWJB 3WLJA 3T12A 4M8LA 5FL7A 1GNTA 3ELBA 4BFTA 2IU6A 5CU7A 2Q7DA 2RGDA 4JFAA 1AQJA 2OM2A 1QG4A 4ZVSA 5IVHA 4EGSA 1M72A 3OC6A 1IUOA 3GD5A 4JJGA 1WY5A 2GESA 2R1TB 4LJYA 1VE3A 2GERA 2CNNA 2UUAB 3E5NA 1W1UA 4F8YA 3QA3E 2X8JB 1T5DX 4CL3A 4HLCA 3BXXA 3IA2A 2WP0A 3ESRA 4ETWA 3BMCA 2WTEA 5DNWA 4Y6PA 1W88A 3UAXA 2ZXUA 1OA1A 2IBSA 3AWIA 1A9YA 3V48A 4H9GA 3SU8A 4RXUA 1H2YA 3N0VA 5I9TA 4D6XA 2I78A 1T8TA 4HH4A 1QAOA 3V8RA 3D4BA 2ZI3A 2XQFA 5EI5A 5EJAA 4HVLA 4NBRA 4C78A 5C7LO 1PJAA 4BNKA 1BYUA 4RABA 4YQYA 4D9NA 2HZ7A 1TEXA 2OTCA 3IXQA 4B46A 2XHEA 3LX6A 5AVKA 3GIDA 3K6KA 4XJTA 1MB3A 2LDXA 4OJYA 1G17A 3BWEA 4XD7A 2BLLA 1H22A 2YFKA 4K1LA 4F46A 4R31A 3RT1A 3G59A 1N32B 4YX9A 1M0WA 3U7HB 2BHRA 5A6SA 3DLPX 1VG8A 1HURA 3FPHA 4RLHA 2VXCA 4O0LA 4AI6A 1PI3A 1W0KD 2WFMA 1BKDR 4NYMQ 2I33A 2ZSDA 5J1SB 2BMWA 1FW6A 4BTEA 5CDGA 4PSAA 2G76A 2IS2A 1B6SA 1UJCA 1E2BA 4L57A 3DBHB 3K8ZA 2Q2VA 4AROA 3DEJA 1EQAA 1LLFA 5EWMB 1N75A 2WIJA 4XB2A 1GQSA 4GC9A 1PNQA 5H70A 1HK7A 2RDMA 3WOHA 1EWVA 2C5BA 2B25A 4DIMA 2Z98A 3AX6A 4KXLA 4TTQA 2W2PA 4X7PA 4YPVA 3F47A 4K9KA 1R8SA 4R4JA 1ZA2A 4B34A 4L50A 2PT7A 1C30A 4B32A 1FSFA 2ECOA 1ZRMA 3PTZA 3ICWA 1K6JA 4RVCA 4XRRA 5E6SA 2FPGB 1Y7TA 5KJEA 1JSRA 4YRNA 2BFEA 1NR1A 5K3FA 3B9QA 1B6GA 5B2FA 3GVXA 2D2EA 3DCYA 3PXCX 2NYUA 3DUFB 4G5GA 4MVJA 1QZXA 4GUAA 4LKRA 1GSHA 1FRQA 3MQ2A 1R10A 4MIKA 4UKDA 3KR9A 1U7XA 3ORSA 4MR7B 4RLSA 3C3PA 3VPFA 2Q41A 3HSYA 1VHTA 3MT9A 3OU2A 5DI3A 1Z08A 1LS6A 1MMFB 1F17A 5JMTA 2R4UA 4AXBA 1X1EA 4TKUA 1RXIA 5G4LA 3B3JA 2B92A 4MJXA 1OBFO 3KZXA 3M82A 1W4AA 3PUVA 2CVOA 4L6CA 1TW3A 1L5GB 4URXR 2BF4A 2C4TA 2Q9BA 3SF8B 4BCCA 1GPDG 1ISHA 1E1RA 1YS7A 2CBZA 1O97D 3M1LA 2CL7X 3FFWA 4DHWA 2FUG1 3EDRA 3UPDA 2PUAA 1YZFA 2HJVA 2C04A 4FXOA 3TO5A 3ZXIA 2A0YA 1AQNA 2B8EA 3ELWA 1UFVA 1MEJA 1JJ7A 1VE6A 1ZOLA 3BORA 4FMDF 4U1RA 1TA4A 1VJDA 4NOMA 4ZTBA 3RU9A 2JGNA 1CVRA 3WB2A 2BGWA 4JLJA 4INZA 3S8MA 1LJUA 3T7EA 3R0ZA 1P7CA 3WGOA 2JIPA 3NYIA 2OECA 4UARA 2Z43A 5KI6A 2XBUA 4XWAA 2V6MA 2I71A 3LY8A 1XPOA 4ALLA 5F2EA 2JARA 2QX6A 1EVYA 4IVNA 3Q7RA 5AI5A 4HEHA 3BWXA 2VJPA 4YMWA 3FKSA 4GPIB 3IUYA 2R6AA 4MV7A 4RW0A 2CFIA 2IIPA 4S3MA 4YRDA 3VDXA 2NU6B 3MGCA 4PYMA 4ZAFA 5GJVC 3IALA 4DYDA 3MJCA 4C4SA 3N05A 4QXRA 4YT8A 5A4AA 2VPYA 3DOOA 2B78A 2PVSA 1NUTA 4L3VA 3RIMA 5T64A 3ZHBA 5FT9A 1SZJG 3N8IA 1UODA 1NVMB 2FX5A 3JQAD 4B1FA 4TT3D 2OYCA 5BT8A 3H1BA 4X44A 4E5SA 3DEKA 3H0KA 3C43A 5LOVB 2CV0A 2W6JA 3FVVA 2PA0A 1YUBA 4QJ5A 1K3UB 1RM3A 2C42A 2P9JA 4R0NA 1BCRB 4IWYA 3AHEA 4B8WA 4IZ6A 1J21A 3KEFA 1JU9A 5EIBC 2GCPA 1Z22A 4RSMA 2C7PA 4LQLA 4CLOA 3E81A 3JZDA 2NVOA 4LPKA 2IEZA 3ISVA 2PL9A 1ZI6A 4IXDA 1YGYA 4WNAA 4R5MA 5B1YA 2P2DA 4I99A 3LI2A 4HDAA 1XDBA 4LBVA 1DV1A 4RPCA 4QOIA 5TQ2B 4R8KA 3SQDA 4Z6KA 3ZLUA 1V7QA 2PLNA 2Q4DA 3NHZA 1WW3A 1BTOA 2D13A 2HDWA 1ZOIA 4P33A 4DIEA 3C1UA 4MV4A 3GIWA 2HPHA 1W0JD 4DN6A 4RKQA 1JDBB 2ZFUA 3E15A 3HXPA 5L9AA 4GU5A 4QE3A 5EXDA 3HFGA 1KOGA 3IBTA 4G0NA 1YT5A 4KR7A 1OH8A 1J1UA 2G82A 3AUUA 4B4KA 1XA0A 3TDKA 1DX9A 3N7UA 2VUHB 5DCYA 5BVGA 3VJMA 4G8BA 3PC7A 3VR2D 2AK2A 5IBQA 1YFLA 3RYFB 5AK0A 1J90A 3R1IA 3E23A 3VJKA 1ENYA 3MINB 4I4LA 4GL2A 4AUEA 1O9GA 4X41A 4UBMA 4ZTZB 3ORHA 3OEHA 3HYRA 3VNQA 1UAGA 2XOKA 2V6GA 1PK9A 4HFNA 4DJDC 1E1CA 1EM6A 3DVQX 4YAGA 2AA3A 3NHBA 5TY0A 3QWHA 3D2AA 1NZFA 1LD3A 3IURA 2UV8A 4OBEA 1OTHA 4QU8A 4ZT7A 3TLAA 4E4RA 5JARA 2AKEA 2CD7A 4XGRA 3UENA 3VYSB 3HL0A 4A03A 4ZRMA 1WMSA 4IUYA 2W5UA 1TVEA 1XUOA 3OQ6A 2CXPA 2CKDA 2XE8A 2XYVA 3MG9A 4LEIA 4ITUA 4J0EA 2WSBA 1YAJA 4EMTA 2QW1A 3WIDA 4RE5A 1X8KA 2E7ZA 4WLNA 1GYPA 3MTGA 5DMXA 1NP6A 4BP9A 5ALGA 3AUKA 3JVIA 2FUG6 1MCZA 3F5SA 3N6VA 3MXTA 4XM1A 5DKFA 4LJ8A 3RK0A 2D3WA 3LW8A 3SLGA 3UMSA 1HUQA 3BFKA 3C3JA 3ZE9A 4CF4A 4YJ3A 4YUVA 5J47A 4F4JA 1P29A 1VP9A 3ENZA 2AFIB 4IFEA 3HA3A 3QRWA 4TKUB 2RK3A 3RADC 2Q8NA 1PR1A 3OLWA 3PGKA 2QB5A 4TT8A 3DYVA 4ZGWA 2ZBDA 3K20A 4FSDA 3E3OA 4H6WA 1XJ0A 5KYTA 4YHHB 1J0CA 2CHEA 3UA3A 2WHRA 3GJZA 1D1QA 4B3TB 3ONNA 1HQCA 1KJNA 3KQWA 3GXBA 1QQ6A 1BE0A 4TTPA 4DPLA 4EJFA 5A1TA 1V3QE 3PWSA 3Q11A 4Q9KA 2C9DA 4X9XA 1SKBA 4U7DA 3TRKA 3VBCA 4RY8A 1S7GA 2WVJA 1I3OA 2ZSJA 13PKA 1TMKA 5DRYA 3BCSA 5IJ9B 1QLWA 1U9IC 1VPVA 3O4IA 3INTA 2C2ZA 5BQ3A 1CBUA 1N2IA 2X3FA 5KYXB 2C5LA 1QGAA 1EFHA 4G1BA 5DPMA 4JX8A 3AUFA 5THKA 4N7MA 4DT1A 1J06A 2SNIE 2RH4A 1TU3A 4KQCA 3ZY3A 1P2VA 3FHCB 1GD1O 4R9VA 3QITA 3DP9A 1Z2DA 2OV2A 3L5OA 2EKPA 4FYYA 2YV1A 2UYYA 2FZVA 2MR6A 3CTPA 3GLKA 4NABA 2CGEA 1G59A 1DQPA 4FWTA 3MWLA 1MJ5A 2VJBA 5F78A 2QP3A 5FULA 4NYIQ 5TMBA 3UAZA 5IYZA 3CVUA 3DJFA 4OHVA 3FYCA 4M83A 2ANCA 4GSKA 1EGHA 4Q4AA 3DOHA 4BMSA 3D8TA 3LYLA 3CUKA 3T52A 3AJEA 1H93A 1S89A 2AOUB 3DWIA 1X39A 2E18A