4B3MF

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3mF00
1GH8A 4DR7F 2KJVA 1CQMA 4GKKF 2B7CB 4AQYF 4LF6F 4DR6F 4B3MF 4YHHF 1XNRF 1RISA 3R3TA 4DV5F 4DR4F 1XMQF 4B3RF 1HR0F 4JI7F 1I94F 1IBLF 1IJFB 4X65F 4X64F 4B3SF 1XNQF 5AJ3F 2KJWA 4JI3F 5LMUF 3OTOF 2RJZA 4DV4F 2ZM6F 4JI4F 1FKAF 1LOUA 4LF8F 2UXCF 4KHPF 4LFAF 1N32F 2HHHF 4JI5F 2VQFF 4DV2F 4JI6F 1QJHA 2B7BB 4DV0F 1N36F 4YY3F 2J5AA 4OX9F 2VQEF 1F60B 4NXMF 2UXBF 4LF4F 2F4VF 4LFCF 2UUCF 4JI8F 4DR5F 4JI1F 3T1YF 4LFBF 4X66F 2UUAF 4DV6F 2E5LF 1IJEB 4DR1F 1B64A 4GKJF 1J5EF 1G1XA 1IBKF 1HNWF 4DR3F 4X62F 1FJGF 2UUBF 4K0KF 5BR8F 4DV1F 4JYAF 4LF5F 3T1HF 1G7CB 4DUYF 1HNZF 1CQNA 4LF9F 5IWAF 4DV7F 1N34F 2UXDF 2YY3A 2BVZA 3ZZPA 5LMNF 1HNXF 1XMOF 1IBMF 4NXNF 2BXJA 4JV5F 4JI2F 4DV3F 1VMBA 4DR2F 4JI0F 4B3TF 4LF7F 1N33F 2UU9F 4DUZF
chains in the Genus database with same CATH superfamily
5H9FJ 2XG8A 1RT4A 1U8SA 2W2OP 2GO9A 3VVTA 2AD9A 2V2VA 3CJSA 4MYUA 2QE5A 3KLFA 4WFZA 3L7PA 3HHDA 3M05A 4WK3A 2B5JB 2WONA 3OTEA 4LF2A 1F5BA 2WOMA 4WP9A 2XI2A 3ZFVA 3MOZA 3CCJS 1R0CB 3TJAA 4U6PA 2OPQA 3MGJA 4JI1J 4ED7A 1SQFA 2ACMA 5KFSA 1VQ9S 3QYYA 1FFGB 2NS1B 4OLPA 5KFIA 2QA4G 5D4OA 5GVQA 4E98A 3C15A 3NG8A 5IS2A 4ECTA 4F36A 5FLXY 3BKUA 1NRKA 4B9VA 1HBNA 1N5QA 5KTQA 3PNIA 3QAEA 2GIRA 2PI5A 1AROP 2FY1A 1AW0A 1FX4A 1TR0A 3M8WA 5K9FA 1LK5A 2N3OA 2DNRA 1TKXA 1SQGA 1WF1A 2DYAA 2HBZB 4OZNA 5D78A 1VFJA 4IFYA 1VC5A 2FLLA 4J9NA 1G2EA 3IBWA 2HNZA 1VLOA 2BE2B 2WSEC 1FNXH 1KRPA 3H4BA 4FYYB 3KG1A 2BQUA 2QMUB 3EVMA 1J27A 3NWGA 3U02A 3TJ8A 4TNOA 4EK2A 4CT8A 3Q24A 5K8PA 3KNAA 1VQKS 1R0AA 2VOPA 5IC4B 1KQSR 1NAQA 2XLKA 1WDDA 2UUBJ 2OSRA 3TX0A 4O4RA 4UUXA 4C48A 1IXKA 4X4RA 1KC8T 1RT7B 1S4EA 3P96A 2XY7A 2FVRA 1QTNB 3FCHA 1CS4A 4YB1P 1FK9B 3FFIB 3AJ2A 4DV2F 2WRMA 2HVEA 3PW7A 5KFMA 4ZLNA 1SJFA 5IZHA 1JXLA 3FZBA 4LJMA 1H72C 4MIWA 2XQCA 2VQEF 3CEDA 1FRLA 3MPYA 3SXLA 5KFWA 4DPOA 4FS2A 1T05B 5A2QU 1PCAA 1X4GA 3DRSA 3G86A 2E66A 2BACA 2GVZB 2DY1A 1RHMB 3ELHA 3ETMA 4O0NA 5KG5A 4J9SA 2NYHA 4OHWA 1HQEA 3VWSA 3L3CA 2XMJA 2IA0A 4TVAB 1MU2B 2LP4A 3BO3A 3FSYA 1A0OB 3CJ3A 3GG0A 4IG0A 3NOGA 1VIXA 3DLGB 4DR5F 4K2XA 3QT7A 4F4WA 2XMUA 3LQVA 4DR1F 3KK2B 2KXHA 1YHQS 3ADAC 1XNRJ 5KFKA 1YK9A 1S1UA 1U1OA 2EK1A 2QC3A 3DGVA 2JOQA 1Y11A 2QG9B 3EVOA 2E7VA 3G82B 3LUYA 4QIFA 4URQU 5F8GA 4F4XA 1DJ0A 1IM6A 4WE1A 1BQNB 1UCNA 2F8EX 2XGPA 3HSJA 1S1TB 3JAMU 4JI4J 4LT6A 2XO7A 2MQLA 2KL8A 4OI4A 4K4TA 1JMTA 5FJ4A 2G2OA 2FB0A 3NOCA 1YWXA 4OYIA 4I2PA 4G1QA 3WQPA 4KH0B 1PSDA 1RBOB 5DG7A 1U1MA 3KMSA 4LSLB 1LK7A 1HD1A 3BN7A 1HWUA 3MZIA 4NRUA 4WTYA 5D77A 4YP3A 2GW8A 2OUGA 3IRXA 2LXIA 1S48A 2KT5A 1RWKB 3RZAA 1NO8A 3IMQJ 3LW5C 1CBKA 2FD2A 1KLMA 2KDOA 3BSAA 4L74A 3SFUA 4KR0B 3WDOA 1CSJA 1TVRA 3MEDB 4PPDA 2EKYA 2DBBA 5EWGA 4YR2A 4LFCJ 4JV5F 2ZH3A 3TAPA 4DX7A 2Z2LA 2ZUAA 2C2DA 4DR2F 3TA0A 1RGVA 2QLJB 4IH7A 2FVSA 2PSZA 2ZWPA 3BPDA 3M1VA 4N41A 2UV8G 3T5HA 2J0QD 4PXBA 5EGYA 4ETXA 2GGPB 2YKMA 3CJQA 2HHXA 1L3TA 2YNIA 4N7TA 3VAKA 4A8SA 4DLGA 1IBCB 4NYPA 4RUHA 4UOHA 2XMMA 7FD1A 1IWGA 4H4OA 1C1CB 1C1BB 3E01A 3TWZA 5F3TA 1HQEB 2HK2A 2Q43A 3VGVA 3C3LA 2QYGA 3VZHA 3MFIA 1FJGJ 2I0XA 5T41A 1XMQF 2BJDA 2YKNA 2LVWA 4J91A 2CQPA 2MQOA 5BXIA 3GP9A 4JV5J 1IBLF 1ZZNA 2X1FA 4KGVB 4WP3A 3H5UA 4I2QB 4A48A 2LEBA 4QIWD 2GV1A 4QWBA 1S0VA 1JLGB 2AJ2A 4URSA 3T6BA 4DN9A 5C25B 4IYQA 3G71S 3DDKA 4NWBA 2CPYA 3IM8A 1PBUA 1JWWA 1RT7A 2YKNB 1DAXA 2GVDB 3BN4A 3N0VA 5LMUF 4NA3A 3RAXA 4KYZA 4C3LA 1FEEA 3N6LA 2YTCA 2EFNA 2R7OA 2DH8A 2L9NA 2VV5A 3LP1B 3MM7A 3ZZ0A 1XR7A 2IM3A 1TV6A 4JI4F 3CDWA 2ZE2A 2PN6A 1X5PA 4N56A 4UW2A 1OQ3A 3RB6A 3D0GE 3RBEA 3MMAB 5DG9A 4K4UA 4TY8A 3AT1B 3L7UA 4HR2A 4HI1A 4CYUA 1NMEB 4UY8T 2YWGA 2HWIA 3A12A 4B3RJ 1ITPA 3C16B 4ECQA 1KD1T 2XY6A 3TYTA 4HEA9 2XGQA 4F4AA 2L9WA 1OIAA 3RUBL 1HHQA 2MZTA 4FBTA 4FNHA 2E9ZA 2CPIA 1X4EA 3D1HA 3R2DJ 3QJJA 4ID8A 2EG2A 1GMUA 4MK8A 3LGMA 3OBIA 2OPQB 1SQEA 4NA1A 1YIJS 1V6HA 3LANA 1U7LA 1PC4A 2RDJA 1VQNS 2R7TA 3MECA 1D9DA 2UUAF 3CGIA 2E5LF 1QDUB 2MQNA 4ES3A 5ETLA 2R7XA 3Q89A 4B9LA 1RHKB 4HACA 4AUKA 4QR2A 2K3KA 1RAJA 2HVDA 4DR2J 1UJ5A 5HMWA 4U95A 4ELTA 2J0SD 2PT0A 1P27B 4HDGA 2CG4A 3D1OA 3IXQA 2EC0A 1WOOA 2HHSA 2UUWA 2IBKA 2IM0A 1CJTA 2HK3A 3GSDA 3RG6A 3QSIA 1FJEB 1EJ7L 4OX6A 4Q0BA 1RAIB 1FCAA 3ISND 3MTKA 1HNZF 1UKUA 3ZTPA 1N0VC 5MLCV 4H4KA 1U4BA 3PHTA 1Z4UA 2MSTA 4DV1J 2FJWA 4C4WA 4NLRA 2CIMA 3GR0A 5J2NA 2GGPA 4KV8A 4KTQA 1QE1A 1VQSA 1R6YA 4OIXA 1CC7A 2P8IA 3M1VB 2IJNA 5EDWA 3H20A 2RRAA 2HHHJ 1UJ4A 1RBLA 3DLEB 3W61A 1CJTB 3CB4A 4N77A 2COLA 4ZPBA 4AYBD 4WFYA 2BXJA 2KVIA 5HN0A 3PX6A 1J2VA 3HHEA 2L3MA 3CW2C 3PFEA 4NZ7A 4HI2A 5GMDA 4F04B 1MWZA 1TVRB 3FBFA 3MEDA 3G8SA 2ATLA 1FJ7A 2BKNA 2YH0A 4IQXA 4O3RA 1ZOTA 1KR4A 1RT6B 4L3NA 1ZM2A 1UZDA 3KLEA 5E7OB 4YN3B 4E2FB 2F1FA 2MZ1A 1L3UA 3J7A1 4DSKA 3V4IA 4DR7F 1FK9A 1QAYA 4JI8J 2DIVA 1KSPA 3PW2A 5IC6B 3GTYX 1M1KT 2Y8WA 2E1PA 2QTWA 3V6JA 3Q86A 4DUZJ 4K7QA 3GYNA 2M88A 3TZZA 2XCAA 2Z2MA 3EE3A 1R0AB 1NHUA 2HBQB 3FUYA 3W1YC 1RADB 1NZ8A 3DYAA 4LIWA 4LBIA 3ULHA 2AJ0A 1JLEA 1LWXA 5DO2A 2E1AA 2PA3A 3C14A 4HDHA 4OYOA 1OSCA 2W7AA 1TAUA 1SJ1A 3VGTA 2GNKA 4M94A 1WHXA 1JLFB 2ZC3A 4QR1A 2AJ4A 4H4MB 2H3EB 3ISNC 4MIAA 3K2YA 4DCJB 3JTOA 4RLEA 1C4CA 2C28A 1Y00A 3W63A 2HRUA 3EUNA 5GAHI 4X64J 3QIPA 2LA6A 3DLGA 2GHPA 3QBCA 2ZE2B 4JI3F 1EX8A 3R1HA 1NB7A 2CQHA 1DARA 1NSKL 3MD1A 4Q45A 2WVFA 3SQOP 3P8BB 3W2VB 4RZRA 3JSRA 5I42A 1B0TA 5E3CA 1SL0A 4X4UA 1ACMB 2HQ3A 1G3OA 2FPHX 4DQQA 5J1EA 5KFOA 3RTVA 5CH7B 2YQ1A 2YKQA 3Q8VA 4ATNA 3DOKA 3UDLA 2FQQB 1WC6A 1ZAVA 1IQTA 5DDQC 3UR0A 4JI6F 2Y1RI 4ANDA 2YWFA 3DRRB 2E7XA 1WEXA 2D3ZA 2XS7A 2HHPA 3K89A 1U24A 1X9WA 2RUGA 1JB0C 4JBCA 3KK3B 1ZPVA 5KFGA 1SPBP 1GXTA 2OLWA 2BKPA 2M2BA 3CIMA 5E5NA 1VQ7S 3MAHA 4OHZA 1YITS 3CCTA 2BBEA 4KQZA 2NPIA 3AAWB 3IWNC 1JK9B 2ZDPA 3OR1B 5DDPC 3CJ4A 2CZ9A 5DS7A 3UCGA 4IFYB 3D2WA 4A8FA 1LW0B 1T8EA 1M5HA 3DRYA 2VOOA 4KGMA 2Q1LA 4DV6F 1B64A 5C24A 4KY3A 3NWRA 4EZ9A 1U1LA 4IRCA 5M2RA 1S6PB 3O3LA 2GCFA 2OPRA 1QVGR 1KHVA 4ELVA 2HPUA 2B4UA 4J5OA 4LFBJ 3C15B 3K0JA 4O44B 3I32A 4OV6A 4DDFA 2UV8A 3W60A 2ASLA 1N52B 1OS5A 4LF5F 1CG2A 3O5TB 1CJVA 1UFKA 1OMSA 1YRXA 2ZHAA 4ECRA 3CJTA 4ZPTR 2AYEA 2DGTA 1KEKA 3OTDA 2LXFA 4KRWA 1SKSA 3GV5B 1HARA 1NB2A 3NCPA 3KHRA 1SVDA 1H7XA 1U1RA 1Q95G 1ZAXA 5IXUA 4ZVQB 1D1UA 1IVZA 1XIQA 3KG0A 4DWIA 4F3OA 2VPYB 3GB0A 3IM9A 3N5BA 1FKPA 2VG7B 4KKOA 4B9NA 3KLGA 1JKHA 3C19A 1HWKA 2YVSA 1FTRA 1WEYA 2IAJB 3NP5A 5SUHA 4J9RA 3J7AN 1VMBA 4LQ3A 4ERDA 2UUAJ 4YS2A 2RU9A 5CD4H 4PCQA 4IDKA 3Q2TC 3VQSA 1Y10A 3M8PB 3D54A 2IVFB 2JX2A 1MLAA 3TI0A 3MXHP 4Y34A 2OPPA 3Q83A 3R5CA 4ZCKA 1NDLA 1XERA 5ETOA 3M2RB 2PMZD 5IV3A 5KT3A 4Y2AA 2UZAA 4CZCA 4IG0B 3TARA 2PFDA 2GQQA 3M2RA 3QIPB 1IBLJ 4Y2IA 2RF2B 1LWEB 2IAJA 3H25A 1HR0J 1UVJA 2DHSA 3ISZA 4ANCA 1CVJA 3M8PA 2HURA 1TMMA 5IT9Y 3J81U 3J81j 1N48A 4NYZA 2DGWA 1S99A 2HNDB 4FXDA 2UU9J 1AUSL 3NEKA 4S0MA 2ZH8A 2FTRA 1FVQA 1S49A 2DGUA 2F8MA 3C6TA 1Q16B 2F4FA 4M5LA 5JXSA 4QW9A 1NJIT 4B08A 3EZUA 4O3QA 2YQ0A 3G6YA 5C7PA 1DTTB 1RTHB 6FDRA 2JLFA 4G1IA 3LWLA 1Q1KA 2QN6B 5LMUJ 1E6VB 2O66A 3E2EA 4AD6A 2Z0GA 3MFHA 1UZHA 3CJ5A 2DCUB 4MTPA 1MMNA 2ZBCA 2CVEA 1MMLA 1XWLA 3EPGA 2XZWA 1EZZB 3CDEA 3EDQB 3QT8A 1G6BA 1R8HA 5L9XA 4LVNP 3ZNJ1 1FRHA 4L6V3 4ZP6A 3CMAS 4CH1A 1SJ4P 4PG6A 2VDIA 2FVCA 5U47A 4DFPA 1TKTA 3PW4A 3W66A 1QM9A 1GK8A 4OX8A 4RBTA 1M5OC 2HYIB 2EFPA 4C0HA 1LV5A 3MEEA 2BJ9A 4K50A 3GFYA 2EBGA 2E5IA 3KNGA 2XS2A 1HHSA 3QGHA 1CJUB 2IC3A 2V8PA 3M8ZA 3THTA 3OJUA 2ZD1B 3QGIA 4HVZA 3KJFB 2MQPA 3G6XA 1S1XB 4WIQA 1QTMA 3KK1B 3EZOA 2OJ3A 1FWPA 5BYSA 5J2MA 3SCJE 1RWPB 4XAKA 4CLKA 2M5YA 1U26A 1SC3B 1LW0A 4DSLA 1AZSB 1DQ8A 3U1LA 1RXOB 4J9QA 2KM8B 3NNCA 2RUSA 2MY7A 5HQMA 1NHKL 2W2PP 2Q66A 3OXGA 2WBMA 4IKAA 3FKBA 4MAKA 3D7SB 4KE5A 2CPEA 3KYLA 2E9RX 2W4CA 2NQPA 1FXDA 2OTJS 4LF4F 2MEWA 1N32J 3LAMA 1IKXA 2DNOA 2G1HA 2DITA 1V3RA 2HKEA 5I3UA 4C8ZA 4CIOA 3PG9A 4DV3J 3US5A 3VQTA 1IR1A 3NRBA 2KFZA 2CPHA 1P9YA 3DC2A 3R7NB 2J9EA 2L9DA 3JQJA 3HPOA 1RT3B 2QSWA 4RJVA 4YHHJ 3QLHB 4ITSA 4ZKAA 2YWHA 2DJWA 4PWUA 4ZVFA 2Y1JA 2C2OB 2CPDA 4DX5A 1BMQB 1WF2A 3AOAA 3D68A 4C7QA 4DPWA 2WZ1A 3F44A 4UT4A 5H1SV 4CO2A 1X5TA 3GYGA 4X2BA 3QZ8A 3SZ2A 2FJVA 2UUCJ 4QYZJ 1FI4A 2QA4S 3IN5A 5L39A 4PQUA 3EGVA 1RJJA 4B9UA 2HS0A 1H0HB 2VG6B 3KUGA 4EZ6A 4BC7A 1H2VZ 4M5NA 3M6VA 2O1PA 3I0SB 4LRFA 5FLXU 8AT1B 3VAIA 1TTHB 1JLFA 3MR2A 1WI6A 2C3MA 1VK8A 3C16A 2EFQA 5LMNF 2QZ8A 5IQQA 1S1WB 3Q8RB 2FIUA 1UW4A 2WW4A 4P74A 2EI5A 1RI7A 5KG4A 2VBWA 3A13A 3CSKA 3ENQA 4NOHA 4TN2A 1LNQA 1SKWA 3HFZB 4P2FA 1KTVA 2BZ2A 3CCVS 4ZJQA 4DR6J 2DNGA 2NZ4A 1S9GA 2HFNA 5L38A 4WK1A 2ADCA 4OI2A 4P2SA 4MKYA 1NSQA 5ETMA 1UEUA 3A8KA 2D1CA 1N33F 4P2XA 1SBRA 3LP1A 5BR8J 2KU7A 3EICA 1S6QB 3PHEA 1WG5A 3V81B 4KBIA 1RA7A 2DB1A 4USHA 1Y5IB 3OFHA 1KN6A 1I51B 4N8NA 2MQ8A 5G0RB 1U2RA 2RQCA 1JLGA 4JUZA 1G4CA 3B8HA 5HATA 1CJKB 2V4JB 4F26A 2IMOA 5ETPA 3IS9A 1UETA 4QYZK 5KFVA 2AQ4A 1RISA 2LDYA 2PO4A 4YY3J 1B4SA 1XN9A 1Q79A 1DQAA 1UMJA 3VALA 2D9PA 2DEJA 4JI7F 1ZM9A 4CO0A 4QIEA 3E01B 1N4LA 4Y2MA 2BE9B 3ZZZA 1LXNA 4H4OB 2DGVA 4PQAA 1HA1A 1K44A 4B02A 4NEYA 2N4DA 3G96A 2FDNA 3BGOP 2GJFA 4BC9A 1YJUA 2DGOA 4ZA1A 1VISA 1XK8A 4CLYA 5KT5A 5EWEA 1KFSA 4DFJA 3UR3C 2GQCA 1FVSA 2W4PA 2R2TA 2RJZA 1M90T 1W25A 3D9BA 3HXMA 2W2MP 4JB8B 3ENWA 1MWQA 4LRAA 2J9DA 7FDRA 3H5XA 3TR5A 1J5OA 4ILMA 4CNYA 1SKRA 1X4BA 4NASA 1SJQA 4HYKA 1JQGA 2HHVA 2YNFB 3QIDA 4JYAJ 4A8YA 4WKRA 5ETKA 1REVA 2BOPA 4NLYA 2LXUA 3V6DA 2FZCB 2CZ4A 3RW7A 1SL2A 3BB5A 1RZMA 4F4YA 1NHVA 2HHUA 4F50A 1RTIA 2P9EA 3DRPA 4EWTA 4ILLA 4H54A 4GVBB 5B0EA 3TZXA 1NJWA 2D3UA 1FRXA 5ETRA 4O4GB 3JSMB 3DI6A 2IYGA 3BR8A 2PEHA 4QW8A 3CJRA 2XTJP 1BD6A 1IR2A 4AQYJ 3R6GB 1YJNS 3OL9A 1IQZA 1R89A 1GMWD 3CJ0A 2OTLS 1NSPA 1HBMA 1LWFB 4ZHRA 2IHR1 1AXQA 2AEFA 4GKJJ 1HI1A 1YRTA 3LP0A 4KPCA 1S10A 2DHHA 1O51A 5GAEI 4TKTA 4CTAA 5CCMA 4RU9A 2HMIB 1DHMA 1F9FA 1L3KA 3MMAA 1YG0A 2ZDOA 3QGPA 1VQOS 1FT8A 4YEAA 4KO0A 2VF3A 2XMAA 1ZYQA 2NLWA 1D8YA 1UL3A 3VGUA 2XWXA 4ZHRB 2DGSA 2VIHA 2KM8C 2CUYA 1BWEA 3D3BJ 2UUBF 5BR8F 1JJ4A 2GVDA 2NSBA 1R8BA 2VASA 2VFSA 2Z30B 3Q22A 4I56A 4K4YA 1O8BA 5HMZA 4IOAQ 1JXEA 1JNRB 2I1RA 2LEAA 4NLUA 2XBPA 2V9KA 3F56A 2I8EA 4RX6A 4C11B 4ZPVR 3SEOA 2C2RA 1HIYA 3PIPQ 1R0BG 5IWAF 4LF6J 4LF9F 3OTBA 2N7CA 2PC6A 3HX9A 5HSPA 2C3UA 1RT3A 1BE4A 2F40A 2YNGA 3CO0P 3HVAA 3QWUA 3UFCX 4A46A 1KHWA 1UA0A 2VFVA 5HVGA 4LBHA 5KOWA 2MKYA 1BQMB 2ZH2A 2JFDA 1HNXF 1XMOF 3HHNB 3JTNA 1AUDA 1X0PA 2BUNA 2C2MB 3THVA 1SV5A 1IBMF 4LF1A 2IVMA 3LPYA 1NKCA 2OD6A 3P45B 4P7TA 3NGSA 2AEJA 4WFXA 2DEIA 1JX4A 2IIHA 3M6XA 2BEFA 2DRAA 5L1LA 2AEMA 1H3DA 1V3ZA 2V0NA 2UU9F 3AD8C 3DDIA 1GH8A 3OVSA 1U0HA 3VAHA 3X1LB 2FUG9 2RHQB 5EN1A 4QCLA 2C3YA 2ZD1A 5IT4A 2IC3B 4TQSA 1UJ6A 4P73A 2XI3A 4LF6F 5HL7Q 4Y2CA 2B0GA 3MEEB 1X8DA 1XTZA 2CJAA 2CNNB 3RYLA 2QFJA 3PX4A 2Z4PA 3D6MB 4HHHA 1Y5LB 2BJEA 3CCZA 1TKTB 4FN5A 4CRJA 3HJFA 2HS4A 4PWWA 3IS9B 3DI6B 4DV5F 3R5DA 4ZDNA 2C22A 2J7KA 4TY9A 1HBOB 3AA9A 2AWZA 2MY8A 3WHIA 1RWXB 3DRPB 4TU7A 4RNOA 2IRUA 3DRXA 2BA9A 3MPDA 3V6DB 2LMIA 2MYFA 2Q6BA 5CABA 2WONB 4ECUA 4KAIA 4B3SF 4UOFA 2HG4A 1FKOA 3T1HJ 1S9GB 1RKIA 1J5OB 1PC5A 2WVDA 4WZMA 4ZPWR 3OTOF 3HVTA 3QATA 4M5HA 4IR1A 3FBEA 4UZBA 3QMQA 3BH6B 2CQCA 4EBEA 1MNEA 2J0XA 3BSNA 2QIFA 2QLBB 3HHLB 5KFHA 1LW2B 4OZ3A 3KDNA 1WKLA 1DY3A 1BQXA 3LGHA 1S1UB 4IRDA 2XNRA 1HQUB 1LOUA 1PAEX 3TAMA 3BV8A 5C2CA 2KG1A 2HGLA 3U7JA 3DLBA 3HZEA 1LWEA 3CT9A 3M8YA 3OUYB 1RYRA 3ILJA 1VLYA 4FPIA 3FEXB 3OFFA 3SQGB 1BY9A 4DI6A 4JV1A 3BBCA 2R7UA 4QIGA 1RA6A 1MU2A 4FZVA 5KT4A 2ZKUA 4OI3A 1EKRA 1RABB 2B7BB 5K8MA 1HYSB 2RRBA 1K1SA 3DLJA 3H0PA 3GJQB 4AXJA 4CLPA 1WC0A 1JJCB 3HVRA 4X66J 2D9OA 3DU5A 4DLEA 3ZTRA 2ZHBA 3OW2R 3KDOA 5D4NA 1JKHB 1PYSB 2LLZA 4ZN3A 2GVZA 1N36J 2VC1A 4K5SA 2PIIA 3DRSB 4P10A 5CYQA 2JSXA 2DNNA 5E0OA 4ES1A 4RW9B 1APSA 1U6ZA 1GMVA 2KXFA 3KMQA 1JLBB 3CE8A 4L75A 3VAFA 2JEJA 1RT1A 3QRPA 2V2QA 2RILA 1V5IB 3GV8B 1LQ9A 3FK4A 3KUEA 2CKWA 2H4YB 3OHBA 1VYAA 3NBPA 1G1XA 5JMNA 4OHYA 4FF3A 1MROB 2B9EA 5DJBA 3MM9A 1DZ5A 1EIYB 3CC4S 5J1PA 5AXLA 2YPZA 4DCOB 5F8JA 1BUXA 2VPWB 1PYOB 4I69A 4ZPCA 5CYMB 3D1QA 4EUVA 4C8OA 1Q5YA 1P6TA 3GCWP 1NH8A 3NCQA 4IG3A 3QAUA 4ZOSA 4DG1A 4JYAF 4DR4J 2KYZA 2VG5A 3KKFA 4A47A 3V6HA 3PEJA 2CJYB 4HH1A 5B0DA 4F0HA 3NKYA 4YB5A 3BQ0A 1RHQB 3KJVB 1YVFA 1S1XA 1FDBA 2Q6CA 4R25A 3QJPA 5F0WA 5D0EA 1T9WA 3DGPB 3C8YA 3DXSX 3O6QA 4A8MP 4U67Q 1KVJA 4V1Ak 3VAGA 1YQHA 1TKZB 4NI2B 2MZJA 4N5SA 4DS4A 4P71A 1YBAA 2KH9A 3H2VE 4KB7A 3Q2SC 3TP2A 2U2FA 2VBZA 1URRA 1JLQA 1Q7LB 3DNCA 2JZ5A 1WACA 3GG1A 3QO9B 1JXVA 4PYAA 1EQMA 1WJ9A 4EYHB 1FJCA 2H4WB 2HZVA 1WSRA 2GJ2A 4PG7A 1RHUB 2VODA 5KFTA 4AXIA 3HD1A 4ZCLA 3KLFB 4WF9Q 2C2NA 1KKHA 5CYMA 5IM0A 3PV8A 4NPOA 4LF7F 4F25A 2GMJA 2O01C 3QT6A 1UPMB 1H73A 2FHJD 2W2NP 3GONA 3E8OA 3MEGB 1C0UA 2OSQA 5I3UB 5KG6A 1PBAA 3IP0A 3C66A 3IR6B 2JVRA 5IOLA 4NLOA 2BRLA 4PYDA 1Y4ZB 5HANA 2OMOA 2XCPA 1UAWA 3BQ2A 2BW2A 3UPFA 1EP4B 5IM0B 3IR7B 5AT1B 1GXLA 4PUOB 1XNRF 3NNHA 3IGNA 4P6QA 2MMYA 5LMNJ 1OO0B 4UY85 3N9UC 3R5GA 3IRWP 2UP1A 3BSCA 3NGTA 4KFBA 5C42A 2RKIA 2R8GA 1JLQB 2MJUA 4O0IA 2ROGA 4B3MJ 2KZMA 5K14B 4MK7A 4OZLA 4NCGB 3W64A 3NGRA 3RR8A 5BYRA 2EVZA 2QGFB 2VKRA 1NKBA 3GJSB 4IDKB 2AP6A 4DQSA 4DMZA 5AXKA 1N33J 5A8KA 4ED5A 1KTQA 3FRZA 1X4CA 4MYTA 5L8RC 4DV4F 4NCAA 3DYAB 4NRTA 2ZITA 4L72B 2K8GA 1QD1A 2KHDA 1KDNA 2BJ1A 3NAIA 1S72S 2EK6A 1FERA 3O1LA 3HHLA 4IG3B 3K5PA 5D0HA 1WC1A 2UXCF 3EDRB 3PTWA 4LFAF 1RHRB 1B0PA 1MG7A 3FQKA 3BDPA 1JNZB 2DNQA 1P1LA 2LQBA 2OPSB 1I5OB 2VPZB 3D6HB 3GYXB 3KUHA 4J9UE 5EX0A 4ZVRB 3NGDA 3K8VA 4DS5A 3RRGA 4JI5F 2AJQA 1NCLA 2K2PA 3CD5A 3JSBA 2CPJA 1RT6A 3KHGA 2GFFA 1OPIA 3ZZYA 1WTBA 5LSLA 1DFDA 3NS5A 1P8GA 2PE8A 4X4PA 1RAGB 1KOHA 1FWLA 2W9BA 2RE1A 3JYTB 2UXBF 2ZH6A 3PEHA 5ETNA 5D4LA 2F4VF 1WG4A 2M52A 2B8QA 3SCLE 4I4BA 2HLTA 4B3OA 2AJFE 1I1GA 2V50A 3BKTA 2OD4A 4DFMA 1X7VA 4L3KA 2RB7A 5T7LA 1ELOA 1SIZA 5F3ZA 1H98A 1PKUA 2DR9A 4ED3A 1XMQJ 3MM6B 1YBTA 2UVUA 2K1RA 1HPZB 4PKDB 3DDNA 2ZWOA 3AJDA 2DKOB 4A8XA 1U45A 1H38A 2A2CA 4GKKJ 3MCNA 1U0HB 2IDEA 2ZOFA 2I6WA 3U1NA 3J80U 4AL7A 2LQ5A 6FD1A 3V5RA 4MH8A 1IR0A 4RW6A 3HI9A 1HBUA 5DDOC 4Q5VA 3HMJG 3OL7A 5A6PA 3TUPA 2DO0A 2IYIA 1JJHA 1AYEA 1CQNA 2VBYA 3Q8UA 4LREA 4OZ2A 3IG1A 2R9LA 3KOAA 3K5MA 3F0NA 2YBVA 5LM7E 1IKYB 4M5DB 1CEZA 3IC1A 4RW7A 1N5YB 1UP1A 3CD0A 1C0UB 3RU0A 4MK9A 2IVYA 5KFQA 1F2HA 3DN9A 3S7RA 3B6BA 2J9DE 3OHAA 1VQLS 4R5PB 5DQIA 4BCAA 1VC0A 5ETVA 3UCZP 4ELUA 3EPIA 5I42B 4M63A 1YKWA 4U9RA 2CNOB 4JI2F 4GO7X 1ICEB 3RBZA 4X4QA 1Y3JA 4I67A 2KFNA 2OPRB 2RS2A 2YKPA 2ALYB 4OHVA 4JI0F 2IA6A 3A4TA 4YFUA 4MKVA 2OO4A 4XPEA 1S59A 1U2CA 4P9SA 5EUHA 1AT1B 4P75A 4Y28C 1Y0HA 1Z2LA 4BWMA 5JVGQ 4DV4J 2KVQE 1KQKA 4GC7A 3LO3A 1QUVA 2AGOA 3CXCR 2B7CB 1NK6A 3UW1A 2HLUA 4LF5J 4K4SA 2VJUA 1FD2A 1CLFA 1S6UA 4ZVEA 1UFLA 2BABA 2QL7B 4ID5A 2ZBQA 4K2JA 1X9SA 1D09B 3PYEA 1VRTB 3ZZOA 4MFBB 2IY5B 1Q8LA 2V9WA 4USTA 3MAAB 1RT5A 2RQMA 3ZTQA 2Y1IA 2IRXA 3AH6A 1S9FA 4TLRA 1IUJA 1PAUB 1WTFA 5IQ6A 3V4IB 2IM1A 4MMOA 3IWLA 5J1NA 4X65F 1Z1ZA 4UQGA 1PO6A 4P2MA 3MOJB 1WF0A 5LT5A 2UXBJ 2XSFA 5J1EB 1XNQF 1H74A 1CULA 5H9EK 1TAQA 4XPCA 3ICLA 3SDEA 3I31A 3I55S 4ER8A 2OEJA 2HNYA 1SUQB 5A8RB 1F0XA 3DFEA 4WP8A 3GMGA 3TUIC 3T5KA 3NXZA 2ZM6F 1ZAWA 1C1CA 1T3NA 3BH7B 2YKAA 2YWWA 4M8LA 4LF8F 3CCRS 3CWJA 4ZJOA 3LP2B 2MSSA 5K8NA 4G65A 5EHHA 3OJSA 3TEGA 3G8TA 2FVQA 2CQ2A 3VAMA 2YKMB 2R4FA 2DHAA 1YJVA 5B0AA 4OJ3A 2MZSA 1FWKA 5B09A 4UZCA 1QJHA 5E2QA 3OUYA 1U1NA 1JLEB 4ES2A 4QJVA 3HP6A 3BGRB 4UOGA 3GZ7A 4NLPA 4DR7J 2DO4A 4USUA 1NKEA 2NXCA 4WFBQ 5C5JA 4LIRA 4RUCA 5L1IA 2AGPA 4DL6A 3MM5B 5HROB 3DCAA 4ZS6A 2BR0A 2RU3A 1SC6A 5GAGI 2CG8A 1MW7A 3C46A 2AJ1A 4FVMA 3FZ2A 2YXLA 1FXLA 1SXLA 1QY7A 2VDHA 3T1YF 3D67A 1CJKA 2V4JA 4BHQA 5IFMA 3IA0A 2DGQA 1U8WA 2YKOA 1RWNB 5G0RA 4ICLA 3SCKE 4AT1B 3KJNB 1OPZA 2O5DA 3P3DA 3V6KA 3SSSA 2HGMA 1GXUA 4Y3CA 1HNWF 1M5KC 4KC5A 5HMYA 1X4HA 3AOBA 4IH5A 3PR4A 1VR6A 1ZM3A 2DNPA 2M9KA 3BYPA 3MM5A 5KG7A 4J9PA 2ASJA 4OI0A 4DV1F 4K0KF 1A9NB 1VDHA 2E5HA 2WW8A 5CZXA 3IAM9 2ZNYA 2BDPA 1B70B 3HHLC 3TQ1A 4OX9J 4YUDA 2MLYA 3VGSA 3MPWA 4DV7F 1N34F 1U6BA 1RU2A 1IKVA 2HSEB 2YQ3A 3C6UB 4I7FA 1Q78A 1XMOJ 1H6KX 1O5JA 2XSJA 4QU6A 1S1WA 3WIUA 2RDIA 1IBMJ 2JEGA 1X5OA 3DHXA 5A0YA 1RAHB 1T7PA 2KN4A 3M6UA 4FPRA 1IM4A 2C2KB 5GAEU 2J8SA 4CLFA 3TZYA 2MTLA 3D4JA 2GMLA 3CJKA 2DNLA 3FGVA 1UVLA 2M8DB 3QJLA 5DG8A 2QLFB 1YGYA 2WSFC 3EYZA 2IRYA 2LYVA 4DV3F 2VG6A 1R6VA 2LQJA 3EWGA 2K7JA 4Q43A 4TU8A 3PZPA 2VONA 1ZH5A 2FC9A 2W25A 3BPSP 2V4RA 4PR6A 3PXGa 1NPPA 4QPTA 5KFYA 2DGXA 2KJVA 4TXSA 3DLKB 2Z2ZA 5KFPA 3I0RB 3DM2B 3T19A 3FCVA 1MWYA 4QIVA 3L9ZA 2JL9A 1K0TA 2ROEA 3LAKA 3OXLA 3LTOA 4YQWA 2FYXA 4OJHA 3UI3A 4NMLA 2G0CA 1PJ7A 2OI2A 1HFEL 1E6YA 3DU6A 4ETZA 1T94A 1IKWA 2ZOGA 4ID5B 2RHSB 2LQ9A 2OHDA 2DXEA 3N6NA 3VZIA 3PDNA 1WEZA 1NBEB 1U1QA 4FF1A 3OVBA 1OY6A 2YNIB 4TYBA 1L3VA 2UVVA 2D7SA 1RTZA 2A18A 2D41A 2B4OA 2C1EB 4K5RA 1AZSA 4QR0A 4USMA 3OV7A 3GIMA 5KFLA 3BS9A 4R8UB 5AXNA 5KT6A 2KO1A 3KFWX 3P4UB 4NLTA 2D3OR 3RR7A 2JLEA 2X3GA 4OLOA 2OMLA 2DRBA 1CJUA 2XMTA 1TL7B 2ZKTA 3B78A 3EM1A 1I94J 4M5GA 1KVKA 1TV6B 2JH3A 3UNYA 2LEPA 3H5YA 2OELA 1QAIA 4N8OA 4NLVA 4RW8A 1S7HA 3L09A 2XY5A 2CJKA 1U0SA 4YB6A 2F9DA 4OZJA 2BKOA 2KT3A 2DH9A 4RWXA 1DLOB 3I9V9 1RTIB 4LF4J 1N32F 2HHHF 1HI0P 4ZVUB 4ED2A 2NUUG 5AJ3J 1AFJA 4U7UK 1T02A 1S76D 5CCLA 2HWTA 3IG1B 1YBUA 2HEKA 1RKJA 2RQKA 4WJBA 4YY3F 4OX9F 2ZUGA 4DSJA 4YOEA 2BQ3A 2P2CB 4RKUC 4DV7J 1N34J 4NXMF 5E3AA 4ZPDA 4WYLA 4PZVA 1VRQC 3MMBA 4F0MA 4JI7J 3AHPA 1HWLA 2ABYA 3NAHA 2H5IB 1M5SA 1GX6A 1N5TA 1ZPWX 2M0GB 3BGFA 2UUCF 4JI8F 4RW4B 3CMES 4JI1F 2CZVC 3MDFA 5F8IA 2GIFA 3KK2A 4Z7YA 3DOLA 3DMJB 5DM7Q 2VC0A 4O3PA 4UOCA 1VQYA 1Y9OA 4KJIA 3OVAA 4B3OB 2HQCA 2WSCC 4WZQA 4CLTA 1TUWA 3GSIA 4XTTA 2H1YA 3D0HE 1O6XA 1SC4B 2BM1A 5L46A 4PABA 1WC3A 2JEFA 1DQ9A 2XC9A 2Y8YA 1CULB 2K7KA 4KT0C 2KB2A 5BYQA 1BGXT 3JYTA 4OHXA 5CD4A 2JRSA 1TUGB 3POTA 1GAOA 2I38A 3CDBA 3SCIE 4P72A 2JVOA 2QT7A 2VFUA 3UD5A 1SH3A 4LSLA 3MAAA 1NDCA 3DOMA 4P7VA 5FD1A 4ZITA 5IT9U 3QQCD 5KT2A 1FF2A 3K8WA 2O67A 3FBBA 3BYRA 3AY0A 2F9JA 2PA8D 2QMXA 1VRTA 1KQGB 2KRRA 2MKHA 2QL5B 2Y3YA 1NPKA 3E51A 4ZK7M 2POKA 4QPXA 1FDAA 3OTCA 1LWCB 1U6FA 2FJBB 3CCWA 3DLLQ 4NXNF 4C9DA 4F7VA 4I0WA 2V8GA 1M1GA 1Q53A 2GC8A 2YH1A 2AGQA 2MXYA 1NK7A 3QRRA 2ROPA 2CAJA 2OEMA 3TANA 4RBUA 5D4PA 4ZVSB 2HFUA 3SFGA 3QWPA 4DUZF 2ZNZA 5J2QA 3J7ZT 2N7YA 3TJ9A 3HCXA 1S57A 4K0KJ 3BR9A 3PKYA 4USWA 2EEYA 4OI6A 4WBFA 2A6OA 2C2EA 3DLHA 2DVIA 4X65J 4E0DA 1AB8A 1RU1A 2MKIA 3ITHA 2VQFJ 4QU7A 1H2TZ 3OT9A 3G9CA 2H5EA 2L41A 4PQUB 1PJ5A 1ZA1B 1FRKA 9RUBA 4ECWA 3P49B 4Y00A 2R8IA 4CH0S 3TEHB 1FFSB 3MMBB 4C3KA 3ZXWA 2MKJA 2OEKA 2ZVSA 4DL0C 4CWBA 2W8LA 1QLNA 2J6SA 1H7WA 2J76E 2MLZA 3SI8A 2P9GA 3PIOQ 4NXNJ 2LKZA 3AB2B 2QLXA 1IJFB 3QRQA 3MCMA 4Y2KA 3W7BA 5KOXA 3B54A 1U49A 2B9XA 2ACYA 1HBUB 4EU0A 2AW0A 2C42A 3MEGA 4Q44A 2KJWA 3OD2A 3HJVA 1Y5NB 4C8NA 3FMBA 2BJ7A 4OYBA 1NK0A 2ZH4A 2XHCA 2B4VA 1FXRA 1TELA 2P5VA 3BKFA 2EFVA 2EG1A 5CZVA 1RAEB 4ZJLA 1TKZA 4NI2A 4RL1A 4XDCA 2B43A 4IFVB 3SBMA 4ZPAA 4H4KC 2W9CA 4A8OA 1RB0A 1BXNA 3M30A 3ZNUA 4OYXA 2DR5A 1FE4A 1TL3A 2AYMA 2EBEA 2MPUA 2F5GA 3ET6A 3M32B 3MCSA 3DKDA 1V5VA 2CA9A 4DJBA 4X4OA 4F02A 3QFHA 3UVJB 3WIVA 4ED1A 3JQKA 4AE5A 2ZZTA 2D3O1 1TK0A 4HT7A 3T5JA 1KONA 4C3MA 3I4PA 2DPIA 4ILRA 4J90A 4KPYA 2AIRB 2B3TB 3EGNA 5LXRA 3PW0A 1RACB 3PM9A 2VICA 5DZ7A 1VQ5S 2R7SA 1SJ3P 3MM9B 1SI9A 1R7IA 2I9SA 2JWNA 1D3WA 2A6MA 3NCRA 4KGXB 3LOUA 5A8WA 5F8MA 4X4TA 2CPXA 4C8YA 4LFBF 4FKYA 1R3NA 3A8EA 1WC5A 3D5MA 3DOMB 1TK8A 1RT4B 4Y0FA 3RB4A 1QSYA 1JLBA 3I0RA 5D8HB 5IV4A 3G4SS 1F6TA 1D9AA 1Q8KA 2X1GA 3EZ5A 1KP6A 1XMBA 3MF5A 3MR5A 2B6AA 3CTRA 2AX0A 1GEHA 2BW7A 5F0UA 4ZLJA 2DK2A 4HL9A 2E7WA 4LR9A 2MZQA 5HI7A 3FJ2A 2FY8A 3TVKA 2DRDA 5HK4A 1NDPA 4B9SA 4W90B 2RQ4A 3W2VA 3AA8A 1MMDA 2MGZB 4I6YA 4E8UA 4DL5A 2OAUA 1U09A 4IUFA 2ZZMA 3M2VA 3MM8B 1HNVA 4U8VA 3B82A 3BZQA 4RPFA 4Q8EA 4F4ZA 3X3UA 2BVZA 2BANB 2OPPB 5GAHU 2AKWB 3IWXA 1IN0A 1S0MA 1QE1B 2AX1A 3HK2A 1RYSA 5J2NB 1GQEA 4W4MA 3T1YJ 4W98A 2FJDB 5K8OA 2LCWA 2NXEA 3IO1A 1Q8BA 4CNZA 3EXCX 1B0VA 1VQPS 3FC9A 3ILOA 3J7Z5 1XQIA 2ZH1A 4USVA 2UXDJ 1S0NA 1PJ6A 4F8RA 1FEHA 1LW2A 2VFRA 1ROFA 3UD4P 2KRBA 4IQMA 3RBXA 2CQDA 4C8KA 3FBCA 3RGIA 1I3OB 3MR6A 4DSFA 1ZS6A 3T9ZA 3F73A 2DPJA 2QFIA 1QVFR 5LSRA 1UVNA 2ZVIA 3KG4A 4DFKA 3PRDA 2HFZA 4FF4A 5AE3A 4K4WA 3VF0B 4F67A 2GHVC 5LSOA 4DZ6A 3R5JB 4MJKA 4C8MA 4B3MF 2HHTA 1X0FA 3OPKA 2XEXA 4EO6A 2DCLA 3PO5A 4ECXA 3IFEA 4DL7A 2KZZA 3R3TA 1KQFB 3S1TA 2W7PA 3NMRA 2SXLA 3SIPB 3VTIA 2HQGA 5CHCB 2N82B 2RIJA 3OLBA 2R8JA 3UE2A 3Q8YA 4QWDA 3M32A 3UDVA 1Q4RA 2ZBPA 1HI8A 2V34A 2HRYA 7AT1B 1SH0A 1KBRA 1RWUA 1WSVA 2ALZA 4I1TA 4LR7A 2NXJA 2XNQA 1NPRA 3DOLB 3M2UB 3OXFA 4KV8B 3CPWR 2XHWA 2AF6A 2L08A 1N56A 1RT2B 1SH2A 2DIUA 3N79A 4NEZA 4TY8B 5DLGA 5AJ3F 1PG5B 1OQ6A 3QPIA 2APOA 2MHEA 2YNHA 4F3MA 4MIBA 4WCEQ 3M8RA 2MKSA 1TKDA 3N4WA 3EGWB 4LF7J 3D6TB 3D0IE 4NZ0A 4JI5J 4IH6A 4K4VA 1HNIB 1ZTWA 4GO5X 4Q0BB 2GZOA 2Q79A 1E6YB 2RS8A 4R0JA 1BQMA 4C2MA 3H2LA 3MM7B 4YR0A 2CPZA 1J5EJ 1SUQA 4YDXA 5A8RA 2Y0SD 1Q8IA 2V5HG 3BGLA 3D28A 4DR3J 1R8CA 3MR7A 3CUNA 1UTAA 1UEKA 1TMJA 3BBBA 2PMHA 3GU0A 3DM2A 2GJIA 2W4DA 5D3GA 3GV7B 2VQFF 1VQ6S 4HACB 2DNYA 4I6WA 4WFNQ 3L95X 4EFAC 3KLHB 1EB0A 3MHYA 3CO9A 2MB0B 4PG8A 3KTQA 2J5AA 1M5VC 1RCXB 2DR7A 3HZGA 1OYEA 4EI2A 1KVIA 4RO0A 4K4ZA 2JJ4D 3N28A 2V94A 3A3PB 2DNZA 1XNQJ 4C11A 2DHGA 1YDLA 1VHFA 4IOBA 2CQ4A 2RD5C 5L9NA 1X60A 4A8QA 1HQ2A 1N6QA 1A7GE 1HLWA 2WB4A 4JOUA 4UTGA 5K5MA 3SQGA 2OKQA 4OX7A 2V8DA 1WHYA 4LSNA 4ANEA 2NUHA 4CLUA 3QZ7A 5HP1A 5HVHA 2V63A 2VH7A 4OQJA 2G2ZA 2XSJB 3GFZA 2EKNA 3ZZTA 3Q23A 1J5EF 1VHIA 2G1DA 3GLJA 5F8HA 1IBKF 4DR3F 1R43A 1JLCA 2D74B 2HS3A 5LL6d 1FJGF 5IWAJ 3UDEA 3GR1A 2ATCB 3G2XA 5HP1B 4DPYA 4PWDA 1GNKA 4DL3A 1FKOB 2HBYB 4FYVB 3FSIA 1N6QB 3MUMP 1U25A 2MQQA 5GAGU 2IPOB 2FHOB 2BX6A 4OFZA 1N8RT 2CQBA 4J9LA 2LA4A 3HHLD 4U7UD 2R3VA 3RAMA 2CRLA 4NLQA 5HLFB 2OIHA 3W62A 4QZVB 2E5JA 1XJWB 3HT0A 2BRKA 2IM2A 4O4GA 2H51B 2ZBIA 3QGGA 3R9LA 3VVUA 1Q0NA 2YX7A 4DXLA 4WWSA 4F3QA 2YNFA 4J9MA 5JVHQ 5CYJA 4I2QA 3KLEB 5HMXA 3I5AA 2Y9HA 3S6EA 4CH7A 5ADZA 2J8AA 4O3SA 5ETQA 5M2PA 3GQCA 2X7IA 3EX7B 4ED0A 2R7RA 3ILLA 4DL4A 4F2RA 3PACA 2CXEA 4DOZA 2XYHB 4XDDA 4EMDA 3A3NB 1DTQA 1WUUA 3BEGB 3R5BA 1HNWJ 5E3RA 1U48A 2G4BA 2CDRB 2NYIA 3CJKB 1HD0A 1V9OA 3UN3A 4CLZA 3MUVP 2J6TA 3CDAA 2HHQA 4M5IA 1YJ9S 1NUEA 3BBFA 2WTFA 3P6YC 2HFVA 2FLNA 2GA7A 1RT2A 2PI4A 2LDIA 2I5JA 2QV6A 3H8YA 3I6PA 4OZ1A 3W65A 2BYCA 5GMEA 1RWOB 3N5FA 3LPEA 5F41A 3JAMY 2ZJPQ 4IO9Q 4RU2A 2E5LJ 1HMVB 1SKUB 2V67A 3AFGA 1N5VA 2M70A 3S01A 4XO0A 4Q8FA 2AMCB 2J0WA 4ECYA 3MMCA 5KFEA 2B9YA 2CJQA 4HLBA 3G6VA 5KFUA 1NK4A 4DR4F 1WHWA 2XYGB 3SDEB 4ZP7A 1XR6A 4ZP8A 5L1JA 1T05A 4X4VA 3P5BP 3H90A 4DPTA 2NREA 4RWWA 1N0UA 1YLXA 3IRXB 1DLOA 4UF4A 2P6TA 3V81A 4DSEA 1U2FA 5AXMA 2AYGA 3W3SA 1TL1A 1OY8A 2O3DA 2XMWA 4RNFA 3FEYB 1VQMS 3CJ8A 1LEOA 3PRVA 1HKAA 4GRSA 4C0OC 2G0IA 2KKHA 4RW8B 2GS8A 3R8YA 4EBCA 1QAXA 4Q7AA 2XB2D 2PD1A 2BJ3A 4G1QB 1NZAA 1RSCA 2EC2A 4MFBA 3SYZA 3PW5A 2Z8QA 5KFCA 4CT9A 2FLPA 2DISA 2JNJA 1NK8A 1TL7A 2VKZG 4Z37A 1X31C 1FKAF 1HNXJ 2BV3A 3AODA 4UUWA 2BQRA 2VD3A 3HD2A 1BQNA 2HQDA 3J80Y 1S5ZA 2FGCA 3OFGA 4I6AA 4ALZA 2HMIA 1YRUA 2CNLB 4R8UA 1UWBB 2VZ9A 2F4VJ 2E9TA 2AT1B 1EETB 2RAQA 2ZFHA 1A6LA 2AHOB 4KGKA 4DUTA 2V8VA 4FS1A 1Q7YT 3PO4A 2NR0A 3EGZA 1S1VA 3LALA 1KFDA 4NLSA 4OJ1A 2A2DA 1C0TB 4U8YA 3L4BC 4EO8A 5B08A 1N36F 4ZLPA 3V2UC 3J7YU 1IKWB 2F65A 1M0SA 1F60B 4O3OA 1R31A 2C3PA 3ZTSA 2X1AA 4A8KA 2ZHOA 4JI6J 1LFWA 3I4HX 2VHGA 1OSDA 3HF5A 5JUMA 1F9HA 1PIEA 3B4MA 2IBOA 5D0GA 2HVZA 1EP4A 3E3XA 4CLSA 1IWAA 2A0FB 5SZTA 4JV0A 2VL1A 2XWYA 3EVWA 3DLKA 1RTDA 2A10A 3JSYA 5C25A 1NU4A 5A6WA 5DGBA 1Q86T 3KLHA 4LBPA 4BLGA 2LECA 3DXBA 4NE9C 5BJRA 1R8PA 3GFXA 3FFIA 1OWXA 4EGLA 1IKYA 4M5DA 2CQGA 5GADU 3LH2S 4FXWA 5THWA 1DBDA 4RNNA 2AZ3A 4DF4A 2CJ9A 2CNKB 3CDUA 4ZVPB 2FHJA 2QO3A 5ETTA 4YDDB 3AB4B 1W2BR 2NXNA 4O3NA 3TVYA 4DPXA 1FE0A 5E3PA 1UEVA 2HBRB 1L3SA 1TFYA 2VA3A 2FLOA 2EFGA 3OFEA 3PRBA 4I64A 4D3HA 4B9MA 2QJ3A 2G2YA 1B7YB 2G13A 1EKSA 3B4DA 4JI2J 3NGKA 4NXMJ 1HWIA 1WWHA 4V19X 3JQMA 5A0YB 4CCHA 1NLKL 4OZ0A 3C6UA 3J7YI 3CULA 4NLXA 3ZZPA 4RR5A 3K5NA 1VK3A 4PWDB 3H2UB 4DU7A 1WORA 2Z56B 5AE1A 3VAJA 1XC9A 1F9EB 1QSLA 2KHCA 4KSEB 3R2CJ 1SJRA 1T9UA 4CLWA 1HBNB 1TU0B 2EWHA 2F63A 1T9XA 2V68A 3CIZA 1WKKA 3OR2B 4USKA 5KG3A 2MDAA 4EEYA 3HDSA 1QUPA 2XLIA 4DG1B 3AJ1A 3RBDA 1KLMB 2YWKA 3FNNA 2ZH5A 3HKZD 4A8WA 4B3TF 2N4CA 3M4XA 3WZ0A 2R42A 3GJTB 2QRRA 4K4XA 1X4FA 1URNA 1OJ4A 2W7OA 3EMTA 1RCOB 3IAS9 2WK4A 3NBPB 4CDIA 4FVCA 3UCUP 1Q81T 3K7RA 1K9MT 3N6MA 1T3OA 2AV5A 3OLAA 3C6TB 3I56S 1WDTA 4DV6J 3T5LA 1U1KA 4M95A 5IT0A 1WKJA 5HROA 1T03B 2Y0BB 3HO1A 3BQ1A 3AOCA 4X84A 3ZC4A 1FHTA 3Q8QB 5HJYA 4FKXA 1VI7A 1S1TA 4NYOA 4DEZA 3PYGA 1Q82T 3M9MB 2PFFB 4DCPB 2XMVA 3H5SA 3V4MA 4ZCMA 3T1AA 3RRKA 3LWMA 1S9EB 1YJ7A 3G82A 1VQ8S 2R2RA 2RVJA 2ZBRA 2Z57B 3G87A 3ITHB 4M5MA 3I5CA 4NL5A 4USIA 4CQ1A 2MGZA 1P1TA 1RLCL 4OYMA 1TZ0A 2HWHA 2RF2A 4ECZA 4QQBA 2HVHA 2QX0A 3FCWA 4B17A 2ZJRQ 1F1BB 1HNVB 3R6LB 5B7WA 2KXNB 3AXMA 4KHRA 4QWAA 3LA0A 3A8JA 3I96A 1YZ7A 1HQUA 2W9BB 2HNYB 2GAHC 1VRUA 2IDLA 3CD7A 3WC0A 5KG0A 1NK5A 1WHVA 3TO8A 2VFTA 4HHJA 3QLHA 1S79A 4DU8A 4FP9A 2B6AB 4N76A 3GIRA 4YB7A 4NLDA 3U27A 4DQRA 1TL4A 1ZETA 5A8WB 2CQ1A 3IR5B 2IFXA 3KLIA 4G1PA 4DX6A 1CS4B 1LFPA 3MWBA 4X4SA 2W9AA 2J7WA 4DV0F 1FD8A 3BO4A 4V19J 5KT7A 2KYXA 1UVKA 6AT1B 2OH2A 1CC8A 4HT5A 3POTB 3VR1A 1HBOA 2P9CA 2ZH7A 2RRNA 3UVJA 1C2PA 1RTJA 2MZRA 3ET6B 2BE2A 4LFCF 5CQGA 3NGUA 3I87A 2OP5A 2E1MC 3Q0AA 3W2WB 2M3DA 2HZCA 5E3QA 4FYXB 4Y6IA 4IFVA 4R0EA 5CAAA 1IJEB 3W2WA 1T9YA 2HVIA 1N54B 5F8NA 4XIUA 1TL3B 1NK9A 3PYDA 4DSIA 4OYPA 5KFNA 3HT3A 1RP5A 4DV5J 1HL6A 1EQ0A 1K47A 2W9CB 1W26A 1RTJB 1FTCA 1VBZA 3HVWA 3TA1A 2DNHA 3A3OB 4KFBB 2W2QP 3EXYA 2IJFA 4ED8A 1FRJA 3M8QA 3ONQA 1VBYA 2UVRA 1WOPA 2W1BA 2WVCA 4ECSA 2QEXS 1G7CB 4J7CA 3HLUA 3ZZUA 4B9TA 3PJWA 2H48B 1MN7A 2V6AA 2DR6A 3DRRA 4JP8A 2FJEB 2WOMB 4F0KA 4OJGA 1VC6A 2B5JA 4F2SA 2NPFA 4ZLLA 3M9OB 3PYFA 1O0PA 4LRBA 3PR5B 3ILIA 3KK3A 3OTOJ 2JHEA 3A1YG 4X4NA 2IJRA 1FO1A 4QYRA 1RT1B 3FQLA 2MKKA 2KT2A 3THPA 1HW8A 2BE7D 1T11A 4DHVA 2YNGB 4HH0A 5CA5A 1S0OA 2Y1LB 3T41A 1DRZA 3NLCA 4JI0J 1JLAB 2EFOA 2WHOA 5B0GA 2VBXA 1VRUB 1REGX 3M8QB 1X5SA 3BF4A 1RWWB 2HIYA 4FBUA 4ZVHA 4RNMA 3UQSA 1RLDA 2R7QA 3BDEA 4USJC 4DN0A 2VJVA 2BM0A 1F3FA 3HKWA 3QNWB 3PJ9A 2OFHX 2B4PA 2KFYA 2EPIA 2E5GA 5G4DA 1K73T 3ENVA 2FHMA 5CXTA 1S1VB 2CPFA 1XBWA 1ZA2B 2CQ3A 3NNAA 3FRYA 2BOAA 3F41A 3NS7B 5J2QB 4LSZB 1UWBA 4CM0A 1S9EA 4WU3A 2JDJA 5KFRA 1RK8A 3MMJA 3KJVA 2W8KA 2CQ0A 1CPZA 1T0TV 1LWCA 4PAAA 2R2SA 3TUZC 2E29A 1BLUA 3MPVA 4YHHF 1RE1B 2VG5B 3M9NB 2QL9B 1NDKA 4OV1A 4ZCIA 5E41A 4O23A 3FDSA 3MAQA 3CCLS 5J2PA 2AYBA 3C14B 3KHLA 3P5TL 4CLLA 2OGUA 2D69A 2ZC4A 3HVTB 3MEKA 4C98A 4LUBA 4J9VA 4HHUA 4LVOP 1MROA 2HGNA 3GJRB 4GKKF 3KLIB 1RDRA 4WXOA 4EBDA 2H65B 1PGZA 2CYYA 2DXFA 4C0BA 4X64F 3M6WA 2B51A 2ZM6J 2E1CA 1EAYC 5LJ3Y 2N3LA 2XZDB 2VB6A 2RH3A 4WPAA 5A2QY 2HHWA 5KFJA 4J9OA 4WIIA 5CYQB 5T14A 1AFIA 4WTOB 1NXIA 4CO5A 1VBKA 1S6PA 4OL8A 2VUGA 5A8KB 4DR1J 2V69A 3RRHA 1JIHA 1M1HA 3HSGA 4TYAA 3CCES 2B8PA 2DNKA 1K1QA 2B56A 2HRTA 3UDCA 3DLEA 3OQ2A 1FA0A 4NCGA 3GILA 5K14A 3H7HB 2F7VA 3HHKA 4OYAA 4OZ5A 5RUBA 2EXUA 3GIJA 3T3FA 2HIQA 1UWAA 5KG2A 4HTJA 2K3IA 2W01A 2PGCA 3LGNA 4MT1A 5A76A 5HO4A 3EJMA 3KLVA 3TAMB 2K06A 3PKMA 3R97A 1VJQA 4ZP9A 1IKVB 1GT8A 2WB1D 4I7FB 3UWTA 2YX4A 2KTQA 4ZVTB 3UD3P 2R8KA 2HAIA 2ZEJA 2G0JA 4OYWA 3IGVA 3QFWA 1MN9A 2MHNA 2RSQA 4IO1A 5HBMA 3WX4A 5JJBA 3W9JA 1FESA 2XULA 4Z2XA 3C2PA 1IBKJ 5F8LA 3FEZA 4FDFA 1GFWB 1NSAA 1VCTA 3O8WA 5C2GA 3HFVA 1ZM4A 3SSRA 4NCBA 2GAGC 1B7FA 4ZVOB 5B0FA 3R5AA 1OY9A 2HAFA 2RT3A 3Q8PB 1S77D 4DR5J 1RAFB 1S6QA 4JV2A 1RQ0A 1Y3KA 1P9QC 2AZ1A 2DY9A 4HTIA 3HM9A 3RAQA 1M5PC 1HW9A 3PFOA 4CM2A 2C2ZB 5I3QA 2LU2A 3TVZA 3D6FB 3W9HA 3T1HF 3R7SB 2V4QA 1OYDA 1C0TA 4DUYF 4IOCQ 1WG1A 1HHTP 2CJBA 3BGUA 4DZDA 4TQRA 1S12A 4BS2A 3CVKA 3LF0A 4H4MA 4LRDA 5ETSA 3TX8A 3JB9k 1EETA 2DNMA 3VHQA 2YY3A 3DGPA 4PEOA 2VA2A 3K58A 2RMLA 3TOQA 4X62J 4LF8J 5KFZA 2QMWA 2XO6A 4LR8A 5DRKA 2XLJA 2Z2YB 3PY8A 2Z58B 3AD7C 2QYCA 2IMWP 2RNEA 3LP0B 4CYUB 3RW6A 5L1KA 1LXJA 1RWMB 3JTPA 5F9LA 1X4DA 4F4KA 2JC1A 1N88A 1SB6A 2PEBA 4M1KA 1F5CA 2LQ8A 1WELA 3BSOA 1SV5B 4RNHA 1VQ4S 4C8LA 2OFGX 4CP5A 4FYWB 3JSMA 1L5UA 1MSWD 2R7VA 3BM7A 4BDPA 4DBQA 3I5BA 1N5SA 3K5OA 1BHNA 5KFXA 3R1LA 4BWJA 1F5AA 1YJTA 4GMKA 3MUTP 3H4DA 4MKBA 2FC8A 1CQMA 4DL2A 3TA2A 4DUYJ 4ZMMA 1K8AT 4K8RA 1RTDB 1REVB 4MKAA 3K5LA 4AQYF 2DTJA 4RW9A 1T9TA 1X4AA 2CWKA 2U1AA 3CJ2A 4QBUA 3CCUS 2R7WA 3TNVA 1EARA 1WD6A 2H5JB 2ILYA 3HULA 3N01A 1VGYA 4ZVGA 4FXVA 2CWXA 1BC6A 1IKXB 3NS6A 5GADI 1SCJB 5DETA 4Q2LA 5HBMB 2QSFA 1XR5A 1RT5B 4ZIVA 4ECVA 1KWMA 2DD8S 1PYTA 1FNOA 2FHKA 5B0CA 5HQLA 1Y7PA 2H9ZA 2XZTB 2I5JB 2CQIA 2XYPB 5E33A 3WBZA 4Z7CA 3RB3A 1U47A 4IRKA 1HYSA 2JLGA 1WOSA 2NCKL 5KFFA 2DHXA 2VQEJ 3M2UA 2VU5A 4KIAA 2E44A 2ADBA 2GHWA 4PXCA 8RUCA 3ETOA 4WYWA 1UVMA 1GX5A 2L48A 2NSCA 2GX8A 3J81Y 3MI7X 4KH1B 4ZN1A 2J7UA 3HSZA 2KI2A 1FFWB 3GFHA 2G9OA 1VIOA 5AE2A 2FZGB 4AL5A 3ENAA 5GMKa 2FJXA 1DTQB 3CF5Q 3JXOA 1HBMB 1LWFA 3TQEA 3K57A 4YMEA 3BJYA 1KNZA 3TUJC 2ASDA 3T6JA 1GTEA 2ZZNA 4NLGA 1W2IA 3GIIA 4AL6A 1TL1B 4QWEA 4HKQA 4ENOA 3MECB 4EYIB 1RWVB 2V2ZA 3KJQB 2P6SA 4FNIA 5FDLA 1LKZA 3O2IA 3OSPA 4J9KA 5FDLB 5F9NA 2AU0A 2MQMA 4ICLB 4WKYA 1E6VA 5EWFA 4GVLA 1DTTA 1RTHA 2FZKB 1W7WA 5DM6Q 3OL8A 1PILA 3SV4A 2HFOA 2QA2A 3MMCB 4JI3J 2J9CA 1TP7A 2A3JA 3IBCB 3D66A 3O44A 3UN5A 2MJNA 5ITHA 4WFAQ 5DZ6A 1HMVA 3FVYA 3RJMB 5I4MA 4FF2A 4I2PB 4ZIWA 3G6ES 2HNDA 1YTYA 1KOOA 1WC4A 2X51A 4NZ6A 4QWCA 1FDDA 2WBRA 4DV2J 1YZ6A 2F8HA 2HZAA 4Q2MA 5LOQA 3BGRA 5DDRC 3R7BB 4X66F 4RUBA 1F3VA 3LP2A 4WE1B 3TW0A 2R8HA 2BANA 1BWVA 4LSNB 3GPAA 5DGAA 1WNEA 3S8SA 4GKJF 4XK8C 1EHWA 4PG5A 2PDAA 1NEEA 2K1RB 2PMWA 4LQ9A 3WX8A 5KFBA 4KGZB 1FRIA 3OL6A 1YI2S 2B9WA 2RDDA 1X9MA 2E1RA 4BBYA 4M5KA 2V2KA 3DHWC 2WCXA 3UNGC 5DQGA 3FMWA 3TZWA 1KLNA 4DV0J 2V8HA 3GWCA 2VPXB 2CDQA 1NJZA 3H59A 2VG7A 4KKOB 2X3DA 1FKPB 1QAJA 4PUOA 5D0RA 1TQLA 3I9ZA 2UXDF 3JS9A 2DR8A 5LJ5Y 2M4MA 3HFKA 2WVBA 5HLFA 4NA2A 4OMFG 1KS2A 1HNZJ 3W5XA 1B99A 3TAQA 3CMQA 2X1BA 2WVEA 1C1BA 3SMZA 1HNIA 1F2GA 3NY0A 1VJWA 1CJVB 1VOMA 4UQTA 3UO0A 5D6GA 1JLCB 3MTJA 2XS5A 4TLQA 2J6UA 1S7IA 3G8QA 4WXWA 1TFWA 2HFSA 4KO0B 4O44A 3GIKA 3D3CJ 1D0EA 1YSJA 1RAAB 2XMKA 3H40A 4OYZA 4C6AA 1R27B 2HW3A 1T9VA 2FGOA 3L7OA 3M30B 4CTAB 4LRCA 4AFFA 4FYDA 3MPUB 1RUSA 5C24B 2H54B 3MURP 4PXDA 1VBXA 3BREA 2LFVA 3VV2B 3KWMA 2ERRA 1NJXA 4DR6F 2I2YA 2GQ2A 1HWJA 5M2UA 3ZTOA 4CO4A 4ED4A 3FSXA 2CADA 1U1PA 3GCXP 3OSNA 4A4JA 1SC1B 1D9FA 4R5PA 4G3IA 4CO1A 2NZCA 1ULRA 5KAKA 4GVBA 4CO3A 4B3RF 2MKCA 1TUVA 1HR0F 2QA1A 3M7VA 2C3OA 1I94F 2YPYA 5KFAA 1JLAA 2Q3PA 4M5JA 4P52A 5H9EJ 5D3GB 3NMAA 1NH7A 1SIWB 2CJXB 3KXDA 1JJ2R 2DT9A 2ZOMA 1DURA 3W9IA 4NMXA 3SV3A 1K0VA 3SSQA 2GMHA 3DOKB 1AA1B 4RW7B 2DXDA 1S97A 1N5YA 2HQFA 1UVIA 2YWEA 9ATCB 3Q8SB 3PVXA 3CCSS 3RB0A 1ZZFA 4KHMA 3HSDA 3U1MA 5HQ8A 2WAQD 1YX2A 4PG4A 2CFXA 3CCQS 1UA1A 2JC0A 2NXUA 2YNHB 4RBVA 5B0BA 3W8PA 1GMWA 3PCOB 5D15A 4IR9A 5MAOA 3NL0A 4RW6B 4DQIA 3MM6A 4D3GA 4KHPF 1S6OA 3GE9A 2JEIA 1RHJB 3QO9A 5HAOA 1H2UX 1RBAA 2GIQA 4G6VB 5T7LB 5J2MB 1WI8A 5KFDA 1QSSA 3KK1A 3M2VB 3MM8A 4WU2A 2ZJQQ 1HPZA 5HVFA 2ZH9A 2FVPA 2UVWA 1VS3A 1Z2ZA 3CC7S 3WC2A 4DX8H 4GC6A 3KHHA 2QLWA 2UXCJ 4U96A 4ED6A 2KG0A 1FNMA 4PPZA 4I68A 1RAOA 1NJYA 2A1BA 4U7CA 3IBFB 3AD9C 1UFWA 3CNQP 3MCOA 3BO2A 1ZBTA 3MR3A 3AQOA 4C97A 5I3PA 2FJAB 4NX9A 3H42A 2OPSA 8ATCB 1B3TA 5H9FK 3ZO7A 1NM2A 3QSYB 5KG1A 4N47A 2M7SA 3H98A 5DQHA 2GO8A 2MLXA 3R27A 4J37A 3TRGA 4CI0B 4W92B 1UW9A 4KHPJ 1YJWS 2F3JA 1U02A 5EX3A 3CCMS 2HQIA 1NNDA 4X62F 4RUAA 4PXEA 3PJXA 2BMBA 2CVIA 1TK5A 2YX1A 2HNZB 1I6JA 3M8SA 1Q5VA 3W8GA 1SL1A 3CD6S 5J2PB 3K59A 5HJXA 3OR2A 1TKXB 3AXKA 4NLWA 3MD3A 3W5YA 3CC2S 4B3SJ 2ASYA 1YJRA 1FRMA 2LU1A 2W24A 4PRFA 3VCDA 4LMZA 3A8IA 4DF8A 1C4AA 3ZZRA 3I0SA 1XEZA 2R2UA 2RKIB 3DMJA 1FDNA 4QOTA 2ILZA 4DPUA 4DQPA 1TL5A 3K17A 4L73A 4OI1A 3UN2A 4RW4A 4TU9A 4B3TJ 4L76A 2M8HA 3OR1A 3T9NA 4URGA 2JFKA 2BJ8A 4LFAJ 2EW9A 4Y65A 3W5ZA 1S4FA 4LF9J 5FIIA 5C42B 4YR3A 2XM3A 1T95A 1UPPA 2UUTA 2DH7A 3AQPA 1R8AA 4K59A 1V3SA 3KLGB 1D8ZA 1GTHA 3QT5A 5LXYA 5K20B 1FX2A 5DLFA 1ZTTA 3I82A 1T03A 3PX0A
chains in the Genus database with same CATH topology
5H9FJ 2XG8A 1RT4A 1U8SA 2GO9A 2AD9A 4MYUA 2QE5A 3KLFA 4WFZA 3L7PA 3HHDA 3M05A 4WK3A 2B5JB 2WONA 3OTEA 3ZFVA 1F5BA 2WOMA 2XI2A 3CCJS 3MOZA 4U6PA 2OPQA 3MGJA 4ED7A 5KFSA 1VQ9S 3QYYA 2NS1B 4OLPA 5KFIA 2QA4G 5D4OA 5GVQA 4E98A 3NG8A 4ECTA 5IS2A 5FLXY 1NRKA 4B9VA 1HBNA 1N5QA 5KTQA 3PNIA 3QAEA 2GIRA 2PI5A 1AROP 2FY1A 1AW0A 1TR0A 5K9FA 2N3OA 1LK5A 2DNRA 1TKXA 1WF1A 4OZNA 5D78A 1VFJA 4IFYA 1VC5A 2FLLA 4J9NA 1G2EA 3IBWA 2HNZA 1FNXH 2BE2B 2WSEC 1KRPA 3H4BA 2BQUA 3KG1A 1QSYA 3U02A 3NWGA 3KNAA 4TNOA 4CT8A 3Q24A 5K8PA 2VOPA 1R0AA 1KQSR 1NAQA 2XLKA 2OSRA 4O4RA 4UUXA 1IXKA 4X4RA 1KC8T 1RT7B 3P96A 2XY7A 3FCHA 4YB1P 1FK9B 3FFIB 3AJ2A 4DV2F 2WRMA 3PW7A 5KFMA 1SJFA 5IZHA 1JXLA 3FZBA 4LJMA 4MIWA 2VQEF 3CEDA 1FRLA 3MPYA 3SXLA 5KFWA 4DPOA 4FS2A 1T05B 1X4GA 3DRSA 3G86A 2E66A 2BACA 4J9SA 5KG5A 4OHWA 1HQEA 3VWSA 3L3CA 2XMJA 2IA0A 1MU2B 3BO3A 3FSYA 3GG0A 3CJ3A 4DR5F 4IG0A 1VIXA 3DLGB 4K2XA 4F4WA 2XMUA 3LQVA 4DR1F 3KK2B 2KXHA 1YHQS 5KFKA 1S1UA 1U1OA 2EK1A 3LUYA 4QIFA 2JOQA 5F8GA 4URQU 4F4XA 1DJ0A 4WE1A 1BQNB 2F8EX 2XGPA 1S1TB 4LT6A 2XO7A 2MQLA 4OI4A 4K4TA 1JMTA 2FB0A 1YWXA 1U1MA 4I2PA 4G1QA 5DG7A 1PSDA 3KMSA 4LSLB 1LK7A 1HD1A 3BN7A 1HWUA 3MZIA 4NRUA 4WTYA 5D77A 4YP3A 2GW8A 3IRXA 2LXIA 1S48A 2KT5A 3RZAA 1NO8A 3LW5C 3SFUA 4DSLA 2FD2A 3BSAA 1KLMA 2KDOA 3WDOA 5EWGA 4KR0B 4A8QA 1CSJA 1TVRA 3MEDB 4PPDA 2EKYA 2DBBA 4YR2A 4JV5F 2ZH3A 3TAPA 2Z2LA 2C2DA 4DR2F 3TA0A 1RGVA 4IH7A 2FVSA 2PSZA 3M1VA 4N41A 2UV8G 3T5HA 2J0QD 4PXBA 5EGYA 4ETXA 2GGPB 2YKMA 2HHXA 1L3TA 2YNIA 3VAKA 4A8SA 4DLGA 4NYPA 4RUHA 7FD1A 2XMMA 4H4OA 1C1CB 1C1BB 3E01A 5F3TA 1HQEB 2Q43A 3C3LA 3VZHA 3MFIA 2I0XA 5T41A 1XMQF 2BJDA 2YKNA 2LVWA 2CQPA 2MQOA 1IBLF 1ZZNA 2X1FA 3H5UA 4I2QB 4A48A 2LEBA 4QIWD 2GV1A 4QWBA 1S0VA 1JLGB 4URSA 3T6BA 4DN9A 5C25B 4IYQA 3G71S 3DDKA 4NWBA 2CPYA 1JWWA 1RT7A 2YKNB 1DAXA 3BN4A 3N0VA 5LMUF 4NA3A 3RAXA 4C3LA 1FEEA 3N6LA 2YTCA 2EFNA 2R7OA 2DH8A 2L9NA 2VV5A 3LP1B 3MM7A 3ZZ0A 1XR7A 2IM3A 1TV6A 4JI4F 3CDWA 2ZE2A 2PN6A 1X5PA 4N56A 4UW2A 1OQ3A 3RB6A 3D0GE 3RBEA 3MMAB 5DG9A 4K4UA 4TY8A 4HI1A 4UY8T 2YWGA 2HWIA 4ECQA 1KD1T 2XY6A 3TYTA 4HEA9 2XGQA 2L9WA 1OIAA 2MZTA 4FBTA 4FNHA 2E9ZA 2CPIA 1X4EA 3D1HA 3QJJA 4ID8A 2EG2A 4MK8A 3LGMA 3OBIA 2OPQB 1SQEA 4NA1A 1YIJS 1V6HA 3LANA 1U7LA 1PC4A 2RDJA 1VQNS 2R7TA 3MECA 1D9DA 2UUAF 3CGIA 2E5LF 2MQNA 4ES3A 2R7XA 4AUKA 4QR2A 2K3KA 1RAJA 4ELTA 1UJ5A 5HMWA 2J0SD 2PT0A 1P27B 4HDGA 3D1OA 2CG4A 3IXQA 2EC0A 2HHSA 2UUWA 2IBKA 2IM0A 3GSDA 1FJEB 4OX6A 4Q0BA 1FCAA 3ISND 3MTKA 1HNZF 1UKUA 1N0VC 5MLCV 4H4KA 1U4BA 2FJWA 1Z4UA 2MSTA 4C4WA 4NLRA 2CIMA 3GR0A 5J2NA 2GGPA 4KV8A 4KTQA 1QE1A 1VQSA 1R6YA 4OIXA 1CC7A 3M1VB 2IJNA 5EDWA 3H20A 2RRAA 1UJ4A 3DLEB 3CB4A 4N77A 2COLA 4ZPBA 4AYBD 4WFYA 2BXJA 2KVIA 5HN0A 3PX6A 1J2VA 3HHEA 2L3MA 3PFEA 4ECRA 4NZ7A 4HI2A 3G8SA 1L3SA 1MWZA 1TVRB 3MEDA 1FJ7A 2ATLA 2YH0A 4IQXA 4O3RA 1ZOTA 1KR4A 1RT6B 4L3NA 1ZM2A 3KLEA 5E7OB 2MZ1A 1L3UA 2F1FA 3J7A1 4DR7F 4DSKA 3V4IA 1FK9A 1QAYA 2DIVA 1KSPA 3PW2A 1M1KT 3V6JA 3GYNA 2M88A 2XCAA 2Z2MA 1R0AB 1NHUA 3DYAA 4LIWA 3ULHA 2AJ0A 1JLEA 5DO2A 2E1AA 2PA3A 4HDHA 1TAUA 1OSCA 2W7AA 1SJ1A 4M94A 2GNKA 1WHXA 1JLFB 2ZC3A 4QR1A 2AJ4A 4H4MB 3ISNC 4MIAA 3K2YA 3JTOA 4RLEA 1C4CA 2C28A 1Y00A 2HRUA 3EUNA 5GAHI 3QIPA 2LA6A 3DLGA 2GHPA 2ZE2B 4JI3F 3R1HA 1NB7A 2CQHA 1DARA 4Q45A 3MD1A 4RZRA 3W2VB 5I42A 3JSRA 1B0TA 5E3CA 1SL0A 4X4UA 2HQ3A 1G3OA 2FPHX 4DQQA 5J1EA 5KFOA 3RTVA 5CH7B 2YKQA 4ATNA 3DOKA 3UDLA 1ZAVA 1IQTA 5DDQC 3UR0A 4JI6F 2Y1RI 2YWFA 3DRRB 2E7XA 1WEXA 2D3ZA 2HHPA 1U24A 1X9WA 2RUGA 1JB0C 4JBCA 3KK3B 1ZPVA 5KFGA 1GXTA 2OLWA 3CIMA 2M2BA 1VQ7S 5E5NA 1YITS 3MAHA 4OHZA 3CCTA 2BBEA 4KQZA 2NPIA 3AAWB 3IWNC 1JK9B 2ZDPA 3OR1B 5DDPC 3CJ4A 5DS7A 3UCGA 4IFYB 3D2WA 4A8FA 1LW0B 1T8EA 1M5HA 3DRYA 2VOOA 4KGMA 2Q1LA 4DV6F 1B64A 5C24A 4EZ9A 1U1LA 4IRCA 5M2RA 1S6PB 3O3LA 2GCFA 2OPRA 1QVGR 1KHVA 4ELVA 2HPUA 2B4UA 4J5OA 3K0JA 4O44B 3I32A 4DDFA 2UV8A 2ASLA 1N52B 1OS5A 4LF5F 1CG2A 3O5TB 1YRXA 2ZHAA 4ZPTR 2AYEA 2DGTA 1KEKA 3OTDA 2LXFA 4KRWA 1SKSA 3GV5B 1HARA 3NCPA 3KHRA 1H7XA 1U1RA 1ZAXA 5IXUA 1D1UA 3KG0A 4DWIA 4F3OA 2VPYB 3GB0A 3N5BA 1FKPA 2VG7B 4KKOA 4B9NA 3KLGA 1JKHA 1HWKA 2YVSA 1FTRA 1WEYA 2IAJB 3NP5A 5SUHA 4J9RA 1VMBA 4LQ3A 4ERDA 2RU9A 5CD4H 4PCQA 4IDKA 3Q2TC 3VQSA 3M8PB 3D54A 2IVFB 2JX2A 3TI0A 3MXHP 4Y34A 2OPPA 4ZCKA 3R5CA 2PMZD 3CD6S 1XERA 5KT3A 3M2RB 4GKKF 4Y2AA 2UZAA 4CZCA 4IG0B 3TARA 2GQQA 3M2RA 3QIPB 4Y2IA 2RF2B 1LWEB 2IAJA 3H25A 2DHSA 3ISZA 1CVJA 3M8PA 5IT9Y 1N48A 4NYZA 2DGWA 1S99A 2HNDB 4FXDA 2ZH8A 2FTRA 1FVQA 3C6TA 1S49A 2DGUA 2F8MA 1Q16B 5JXSA 4QW9A 1NJIT 4B08A 3EZUA 4O3QA 3G6YA 1DTTB 1RTHB 6FDRA 2JLFA 4G1IA 3LWLA 1Q1KA 1E6VB 2O66A 3E2EA 2Z0GA 3MFHA 3CJ5A 2DCUB 4MTPA 1MMNA 2ZBCA 2CVEA 1MMLA 1XWLA 3EPGA 2XZWA 5L9XA 3CDEA 1G6BA 1R8HA 4IRKA 4LVNP 1FRHA 4L6V3 4ZP6A 3CMAS 4CH1A 1SJ4P 4PG6A 5U47A 2FVCA 4DFPA 3PW4A 1TKTA 1QM9A 4OX8A 4RBTA 1M5OC 2HYIB 2EFPA 4C0HA 1LV5A 3MEEA 4K50A 3GFYA 2EBGA 2E5IA 3KNGA 2XS2A 1HHSA 3QGHA 2IC3A 3OJUA 3THTA 2ZD1B 3QGIA 4HVZA 2MQPA 3G6XA 1K0VA 1S1XB 1QTMA 3KK1B 2OJ3A 5BYSA 5J2MA 3SCJE 4XAKA 2M5YA 1U26A 1LW0A 1DQ8A 3U1LA 4J9QA 2KM8B 3NNCA 2MY7A 2Q66A 3OXGA 2WBMA 4IKAA 3KYLA 4MAKA 4KE5A 2CPEA 2E9RX 2W4CA 2NQPA 1FXDA 2OTJS 4LF4F 3LAMA 1IKXA 2DNOA 2DITA 1V3RA 5I3UA 4C8ZA 4CIOA 3US5A 3VQTA 3NRBA 2KFZA 2CPHA 3DC2A 2J9EA 2L9DA 3HPOA 1RT3B 2QSWA 3QLHB 4ITSA 4ZKAA 2YWHA 2DJWA 4PWUA 4ZVFA 2Y1JA 2CPDA 1WF2A 5H1SV 4C7QA 3F44A 4CO2A 1X5TA 4X2BA 3QZ8A 3SZ2A 2FJVA 4QYZJ 2QA4S 3IN5A 5L39A 4PQUA 4EZ6A 1RJJA 4B9UA 2HS0A 1H0HB 2VG6B 4BC7A 1H2VZ 3M6VA 2O1PA 3I0SB 3VAIA 1JLFA 3MR2A 1WI6A 2C3MA 1VK8A 2EFQA 5LMNF 2QZ8A 5IQQA 1S1WB 3Q8RB 2FIUA 1UW4A 2EI5A 1RI7A 5KG4A 2VBWA 3CSKA 3ENQA 4NOHA 1SKWA 4TN2A 1KTVA 2BZ2A 3CCVS 2DNGA 2NZ4A 1S9GA 2HFNA 5L38A 4WK1A 2ADCA 4OI2A 4P2SA 4MKYA 1UEUA 1N33F 2D1CA 1SBRA 3LP1A 2KU7A 3V81B 1S6QB 3PHEA 1WG5A 4KBIA 1RA7A 2DB1A 4USHA 1Y5IB 3OFHA 1KN6A 4N8NA 5G0RB 1U2RA 2RQCA 1JLGA 4JUZA 3B8HA 4F26A 2V4JB 2IMOA 3IS9A 1UETA 5KFVA 2AQ4A 1RISA 2LDYA 2PO4A 1XN9A 1Q79A 1DQAA 1UMJA 3VALA 2D9PA 4JI7F 1ZM9A 4CO0A 4QIEA 3E01B 1N4LA 4Y2MA 3ZZZA 1LXNA 4H4OB 2DGVA 4B02A 1HA1A 2N4DA 3G96A 2FDNA 4BC9A 1YJUA 2DGOA 4ZA1A 5KT5A 1XK8A 1KFSA 5EWEA 4DFJA 3UR3C 2GQCA 1FVSA 2W4PA 2R2TA 2RJZA 1M90T 1W25A 3HXMA 3ENWA 2J9DA 7FDRA 3H5XA 3TR5A 1J5OA 4ILMA 4CNYA 1SKRA 1X4BA 4HYKA 1SJQA 2HHVA 2YNFB 3QIDA 4A8YA 4WKRA 1REVA 2BOPA 4NLYA 2LXUA 3V6DA 2CZ4A 3RW7A 1SL2A 3BB5A 4F4YA 1NHVA 2HHUA 4F50A 1RTIA 2P9EA 3DRPA 4EWTA 4ILLA 4H54A 5B0EA 1NJWA 2D3UA 1FRXA 3JSMB 4O4GB 3DI6A 2IYGA 3BR8A 2PEHA 4QW8A 1YJNS 1BD6A 3OL9A 1IQZA 1R89A 3CJ0A 2OTLS 1HBMA 1LWFB 4ZHRA 2IHR1 1AXQA 1HI1A 1YRTA 3LP0A 1S10A 5CCMA 1O51A 5GAEI 4TKTA 4CTAA 4RU9A 2HMIB 1UVJA 1DHMA 1F9FA 1L3KA 3MMAA 1YG0A 2ZDOA 3QGPA 1VQOS 1FT8A 4YEAA 4KO0A 1ZYQA 2NLWA 1D8YA 1UL3A 2XWXA 4ZHRB 2DGSA 2KM8C 1BWEA 2UUBF 5BR8F 1JJ4A 2NSBA 1R8BA 2VASA 2VFSA 3Q22A 4I56A 4K4YA 1O8BA 5HMZA 4IOAQ 1JNRB 1JXEA 2I1RA 2LEAA 4NLUA 2XBPA 2V9KA 3F56A 2I8EA 4RX6A 4C11B 4ZPVR 3SEOA 2C2RA 4LF9F 3PIPQ 5IWAF 3OTBA 2N7CA 2PC6A 3HX9A 2C3UA 1RT3A 2F40A 2YNGA 3HVAA 3QWUA 4A46A 3UFCX 1KHWA 1UA0A 2VFVA 5KOWA 1BQMB 2ZH2A 2JFDA 1HNXF 1XMOF 3HHNB 3JTNA 1AUDA 1X0PA 2BUNA 3THVA 1SV5A 1IBMF 1NKCA 2IVMA 3LPYA 2OD6A 4P7TA 4WFXA 1JX4A 3M6XA 2DRAA 5L1LA 2V0NA 1H3DA 1V3ZA 2UU9F 1GH8A 3VAHA 3X1LB 2FUG9 5EN1A 4QCLA 2C3YA 2ZD1A 5IT4A 2IC3B 4TQSA 1UJ6A 4LF6F 2XI3A 5HL7Q 4Y2CA 2B0GA 3MEEB 1X8DA 1XTZA 2CJAA 3RYLA 3PX4A 2QFJA 4X4VA 2Z4PA 1Y5LB 2BJEA 3CCZA 1TKTB 4FN5A 3HJFA 2HS4A 3IS9B 3DI6B 4DV5F 3R5DA 4ZDNA 2C22A 2J7KA 4TY9A 1HBOB 3AA9A 2AWZA 2MY8A 3DRPB 4TU7A 4RNOA 2IRUA 3DRXA 2BA9A 3V6DB 2LMIA 2MYFA 2Q6BA 2WONB 4ECUA 4KAIA 4B3SF 2HG4A 1FKOA 1S9GB 1RKIA 1J5OB 1PC5A 4WZMA 4ZPWR 3OTOF 3HVTA 4EBEA 3QMQA 2CQCA 1MNEA 2J0XA 3BSNA 2QIFA 3HHLB 5KFHA 1LW2B 4IRDA 1BQXA 2XNRA 1S1UB 1HQUB 1LOUA 3TAMA 2KG1A 2HGLA 3U7JA 3DLBA 3HZEA 1LWEA 3CT9A 3OUYB 1RYRA 4JV1A 1VLYA 2R7UA 3FEXB 3OFFA 3SQGB 1BY9A 4QIGA 1RA6A 1MU2A 4FZVA 5KT4A 2ZKUA 4OI3A