4B3MF

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3mF00
4DV3F 4DR4F 4LF4F 1XNRF 4YY3F 3T1HF 5LMUF 1N32F 2UUCF 1N36F 4JI5F 4DR7F 4GKKF 4NXMF 1G1XA 2UU9F 5BR8F 4JI3F 3OTOF 4DR3F 4OX9F 3R3TA 1VMBA 4JI8F 4B3RF 1XMQF 1IBMF 4DUZF 4DV7F 1QJHA 1IBKF 4DV6F 2HHHF 2ZM6F 4DR6F 1HNXF 2F4VF 5LMNF 2UUAF 1HR0F 4GKJF 1IJFB 2VQEF 1IBLF 4LF7F 2RJZA 4DV4F 4B3TF 1G7CB 4DR2F 4DUYF 4B3MF 1N33F 2J5AA 4DV0F 4X66F 2B7CB 4LFAF 4DR1F 4LF8F 4JI1F 2BVZA 4AQYF 5IWAF 4LF6F 1I94F 2BXJA 1RISA 5AJ3F 1XNQF 4DV5F 4JI4F 4DV1F 4X62F 2B7BB 4KHPF 4NXNF 1J5EF 2YY3A 3ZZPA 3T1YF 4JI6F 4JI2F 1B64A 1GH8A 4B3SF 4X64F 1HNZF 4DR5F 4JYAF 1XMOF 4K0KF 1LOUA 4JI7F 1HNWF 1IJEB 4LFBF 4X65F 1FKAF 2UXDF 2KJVA 4YHHF 1F60B 2E5LF 4LF9F 1CQNA 4JV5F 2UXBF 4DV2F 1CQMA 1FJGF 4LFCF 2UXCF 1N34F 2KJWA 2UUBF 2VQFF 4LF5F 4JI0F
chains in the Genus database with same CATH superfamily
3A4TA 2Q43A 1OJ4A 3GPAA 4Q8FA 2KZZA 3CCJS 2OPSB 3ENAA 3OR1B 3R27A 4CTAB 3MCSA 4W98A 1WACA 2BV3A 4ZLPA 4WFYA 3Q23A 1MSWD 3GFZA 4RW7A 3AY0A 3DOMB 3GYXB 4GMKA 1RWVB 5F8NA 1EKSA 3D1QA 4Q5VA 1HWJA 3BBBA 4WCEQ 3W5YA 3FCHA 1GAOA 1PSDA 3NOCA 2D3OR 4JI3F 3IR5B 1LFWA 3CMAS 3TARA 3UNGC 5D0HA 5A8KA 3CCLS 4J90A 3BGOP 5EX3A 3EZOA 1WHVA 2FC8A 4M5DA 1FDAA 2YWGA 2R7VA 4BWJA 1QJHA 3GSDA 4G65A 2QYCA 2NSCA 3ENQA 1NPRA 1VQ5S 3H42A 1KDNA 2ERRA 3MFHA 5FD1A 1PGZA 5EHHA 2VG6B 2DRBA 5JJBA 1U0SA 3ZZUA 4ATNA 4LUBA 3AOBA 1FRJA 2RMLA 5IC6B 2C3PA 4N76A 2RT3A 1K44A 3THPA 4GKJF 4J9PA 4J9QA 2JEFA 5LL6d 2KG0A 2JEIA 1RWOB 2CQGA 2W4DA 1SKRA 2C2ZB 3TUZC 1I6JA 2W8LA 3W5XA 1N33F 2M8DB 4RX6A 1YBAA 4NCBA 2BW7A 4DR5J 1U1QA 3VAIA 4H4KA 2BOPA 1YJ7A 1ZPVA 4ED5A 4WZMA 5GAHU 3TQ1A 5C42A 1KQGB 4TLRA 4HEA9 2WVCA 4MH8A 5C24A 5ETMA 4ECQA 1XMOJ 2VOOA 1Y5LB 3JSYA 4FPRA 2RRAA 4DX8H 2OAUA 2R8KA 4I2PB 5DDOC 1MNEA 2D9PA 5LMUF 8AT1B 2JHEA 3CJKB 3TUJC 4DJBA 1RYRA 3C15B 4LIWA 3AJ2A 2ZVIA 3MEDB 1SQEA 1SC3B 3GCWP 4RWXA 5BR8J 1LQ9A 4Y2CA 4LF1A 2FJXA 1HNZJ 5IM0B 4FP9A 1DLOA 2KYXA 4Y28C 4CH1A 4WU3A 4OYBA 1XR7A 2CQ1A 3R1LA 4RNMA 4FKYA 2B4UA 1T0TV 1EX8A 1WEZA 3TUIC 2B6AA 2DEIA 1N5TA 2Z56B 1PG5B 3NGUA 5E2QA 4HDGA 2FUG9 3VGTA 3GP9A 2AU0A 4OV1A 4HR2A 3MMCB 3LP1B 2A10A 5KG0A 2VFRA 2VQFJ 3UR0A 1GMUA 2ZUGA 2EC0A 4NLXA 3CJKA 1LOUA 1CJKB 2IIHA 5A8KB 3QO9B 1QTMA 4OHXA 5LMUJ 4OYWA 1R8CA 5A0YA 1PCAA 2HRTA 3CJ8A 3DI6A 4DZ6A 4DF8A 2CJKA 2JNJA 4FYWB 5K8NA 3MR7A 3Q89A 4CO3A 3EGZA 2H65B 2EC2A 3QQCD 2VBZA 3UD5A 4LSLB 3JSRA 2Z58B 5A6WA 5AE3A 2YVSA 3IAM9 2HFSA 1UA1A 4HACB 4MTPA 5HK4A 2K3KA 3BSCA 3GJSB 1RHKB 3EXYA 2CWKA 3BGRA 4L76A 2HYIB 2PMWA 1U1OA 1VQKS 2HZVA 4P2SA 4LFCF 2Z2YB 4PPZA 2DNZA 2L9DA 1GMVA 2KRRA 3FCVA 4O0NA 2M9KA 1NJZA 3T5KA 3TAMB 2M70A 3CDAA 3ULHA 4I6WA 1NAQA 4NZ6A 2AYMA 1R8AA 2ZD1B 3ILOA 3NGRA 5L9NA 1NJXA 2BMBA 5U47A 4PG6A 3P6YC 3MD3A 1U7LA 2DBBA 3MMAB 1GX5A 3TX8A 5KFPA 3M8QB 1SKUB 3BGFA 4XIUA 2QFIA 3I9ZA 2IDLA 2RQKA 1KOOA 1OS5A 3J7AN 3LOUA 4KHPJ 4JI2J 2NLWA 3OHBA 2DD8S 3W2WA 4OX9J 1NK9A 3LALA 2O3DA 4DR7F 3I0SB 4KR0B 1S12A 1RJJA 4LBPA 1BMQB 2MKSA 2WHOA 3O8WA 4OI2A 2OP5A 2OPPA 1UJ6A 1QM9A 1XIQA 1OQ3A 1KNZA 2DGVA 2QEXS 1JJCB 1FRXA 1SC1B 1F5BA 2DGUA 4DXLA 3CW2C 3UR3C 3N9UC 2LA4A 5BXIA 4YR3A 4QIVA 1WSVA 4FS2A 1FKPB 2NSBA 4JI8F 2XTJP 3NBPB 3TEGA 5AXMA 4FDFA 4F3OA 5HBMA 3MPDA 2R2RA 4ZPBA 1L3KA 3BH7B 1JIHA 4OQJA 1VK8A 2VPZB 5E3RA 4RW8A 1SIZA 2R7WA 4CLKA 5B08A 5G0RA 1VC0A 3UN5A 3EJMA 2WW4A 2PDAA 4PG4A 1UETA 2ZM6J 1CS4B 4B3OB 3OFGA 1T95A 3BV8A 3D3CJ 4G6VB 5IT0A 3PNIA 2DGTA 2FGOA 2MJUA 2GCFA 3RTVA 1NUEA 1U8WA 1OIAA 1N52B 1T9VA 1WI8A 1QE1B 2QLJB 2RJZA 3TAPA 5IWAJ 3ZTSA 1DTQB 3ZZYA 4B3MF 4DI6A 3W62A 3KLGB 1SL2A 4DSJA 4PWDB 1GXUA 2OIHA 4X66F 1C1BA 1OYDA 3MPYA 3P96A 1FXLA 2NZ4A 2Q1LA 5KOXA 3KMSA 1Y11A 4ZJQA 2QC3A 3MUMP 1C0UA 2HKEA 1NLKL 4RU9A 2JVOA 2VG7B 3JTNA 3MEGA 2FHMA 4DHVA 1JLCB 1VBYA 4ETZA 3OTOJ 2WVEA 3KDOA 1S1VB 2CQDA 3NP5A 3RW6A 2Z2LA 1RI7A 2VFSA 1P8GA 1L3VA 3GILA 3G6XA 1P1TA 4NLQA 1YSJA 2P8IA 1E6VA 1WEYA 4NLOA 5KFGA 2FZGB 3TVKA 2UV8G 3VGVA 4DV1J 4X62F 3C19A 5DGBA 2XMKA 3G87A 3IRWP 2KXFA 2G0JA 3R9LA 5T7LB 1Q7YT 2ZNYA 2EFGA 3UQSA 3CF5Q 2MQMA 3O2IA 1HWKA 2FTRA 2IAJA 2VZ9A 4ID8A 3CCQS 1TVRB 4QW8A 1WKJA 2VH7A 1U6BA 1ZBTA 1YJNS 4Y3CA 1B64A 2LA6A 2E66A 1U09A 3E51A 3FMWA 4QQBA 2XSJA 1KLNA 3K17A 2IY5B 4J37A 1VRQC 1S1TA 3NGTA 2CPIA 4YR2A 2ZH9A 2HFVA 2LQJA 1YK9A 4QPXA 2MTLA 3HJFA 2EFPA 2E5JA 2CPXA 4MK8A 4NYOA 2X1AA 3CUNA 4GO5X 5EN1A 1KVJA 5B0EA 4M94A 3BO2A 1BQMB 2HNZA 3CD5A 3D6TB 1EKRA 3F44A 3G6YA 3H7HB 3CCVS 2OMLA 4Q0BA 4X4NA 4X4SA 3QRPA 3L7OA 1TL1A 3LO3A 4LR9A 4ZCLA 3WC0A 4A8SA 2FHOB 3DI6B 4U8VA 2KN4A 2I38A 2I6WA 4B08A 5DLGA 3D1OA 3R5AA 3D0GE 4YB1P 3THVA 1D9DA 4ZDNA 4LF9F 1S7IA 2CQHA 3H2UB 3MUTP 4X4RA 4B3SJ 5E5NA 4DSLA 2EEYA 5K20B 3C14A 4NLPA 4RBUA 4HH0A 3K5OA 1JXEA 1J2VA 1HI0P 1RCOB 1C1CA 1WC0A 4ZKAA 1RBOB 4L3KA 1NXIA 5THWA 2SXLA 2XG8A 2YXLA 1UCNA 1JNZB 3AA8A 4OYIA 4P72A 5IS2A 2OO4A 4F50A 3Q8RB 3AB4B 1VBXA 3KFWX 1IKWB 3N5BA 4OV6A 2IDEA 5KFWA 5HVFA 2PSZA 3MM9A 2XCAA 2UVRA 3TAMA 3WIUA 4WPAA 4ICLB 4LBHA 5HVGA 4LF4F 2BZ2A 1G2EA 1XNRF 1UVLA 2DR5A 2OPSA 3OR1A 1QAYA 2OPRB 1QSLA 1VHIA 3MM7B 5E0OA 2QA1A 1L3TA 4OZ3A 2ATLA 1OSDA 4F0HA 4NI2A 2XHWA 1G6BA 3OT9A 5C2CA 2JLFA 1JXLA 1K47A 4DSKA 1LWEB 5KG2A 4DFMA 2B5JB 2YKOA 3I87A 4W92B 3HVWA 3AD9C 3SCIE 3OTOF 4P6QA 3I0RB 1N34J 1FD2A 2FYXA 3R3TA 4FVCA 4EU0A 1OY9A 1LK7A 3IGVA 3K0JA 2IJFA 1GT8A 2V4JB 2RQ4A 3ZZ0A 2XC9A 1CVJA 2R7TA 2DISA 4ZN3A 1V3SA 3CCUS 1R0AA 3EDRB 2ZDOA 4C97A 1HNXJ 4EBDA 1F3FA 4V1Ak 1WD6A 3NL0A 4C3KA 3CJ5A 2QMUB 3UFCX 1PJ7A 3N5FA 3BJYA 2K1RA 1F1BB 2DT9A 4DUZJ 4DFKA 1N32F 3EVMA 4LF7F 3PKMA 5D0GA 5DGAA 1EAYC 2OJ3A 3PX0A 1TR0A 4WFXA 3IM8A 4U7CA 2J5AA 3U1LA 2BRLA 2Z30B 2C3MA 1R31A 3UN2A 1WKKA 4U8YA 4FF2A 1RTDA 1QSSA 1XJWB 1PBAA 3PW7A 2V50A 2XS7A 2HS3A 2M5YA 3M6XA 3AJDA 5DS7A 5AJ3F 3DLEA 2MQOA 5ITHA 3RUBL 1U02A 2G1DA 2DIVA 3DDNA 3ELHA 4OX6A 1NK7A 3A8IA 2GVZA 1S1XA 2ZH4A 4KH1B 3DLJA 3UDEA 2WBMA 1NRKA 3GG0A 4P2MA 2GW8A 1MU2B 2MQNA 2E5HA 3CO9A 4HHUA 4O44A 4JI0J 5L1JA 2C2RA 2V8HA 1IQTA 1VBKA 2BUNA 4RWWA 4K8RA 1YGYA 4J9UE 2ZH7A 2I5JB 2P9GA 3KG1A 5M2PA 2UVUA 3B4DA 2AEMA 5ETRA 3MWBA 1DHMA 3MMCA 2C2KB 3G82A 1N36F 2O66A 2H54B 2FLLA 1FX4A 2I0XA 1TELA 1XWLA 2HNDB 1BWEA 2YKPA 4OLPA 2C22A 4CYUA 1KN6A 2AT1B 2KVIA 3FFIA 2NYHA 4B3TJ 2WZ1A 2HHXA 4M5LA 3UCUP 2PI5A 4MIWA 2CJBA 5HP1A 4IRCA 3V4IA 4CO1A 3N0VA 4LQ3A 4NEYA 5CZVA 3R6LB 3IXQA 3NCRA 5M2RA 2BJ8A 4ZCKA 5KFHA 1AW0A 4DR6J 4ECTA 4OHZA 3KJFB 2K7JA 2NXEA 1B7YB 2RDIA 1JKHA 3Q86A 3SFUA 1WDTA 3AQOA 3Q0AA 3RAMA 2DY1A 1UTAA 2I1RA 2UXCJ 1FWKA 3VAKA 1UVIA 2IC3A 1TL5A 2P2CB 1T9XA 3FBEA 2PIIA 1XQIA 1HBMA 3MZIA 3HK2A 3M4XA 2DRAA 2B51A 1JWWA 5KFCA 1FE4A 3BR9A 3NG8A 1GMWD 3ZC4A 2XZDB 3D7SB 2GHPA 4ZPTR 2VASA 3QLHA 3M8RA 2R8IA 1J5OB 1EETA 2BJ7A 2F1FA 2EW9A 4WFBQ 1VR6A 2OD4A 4UOFA 4O3QA 4LSNA 2FVRA 2LXFA 2GFFA 4DN0A 2CJAA 4I69A 3NNAA 1K1QA 4K5SA 5H1SV 1S99A 3MR6A 2Z0GA 3EGVA 3HLUA 4OI4A 2JJ4D 2XLJA 4JV0A 1LW0A 1YJVA 3BBFA 4Y2KA 3UCGA 4EFAC 3MUVP 3BF4A 4NXMF 2OELA 2ZH6A 5IZHA 4EZ6A 1VJQA 2DGOA 4TU8A 3W64A 3SQGA 3KXDA 2R2TA 5KAKA 3NWGA 2DXEA 1IR2A 3HSZA 1HMVA 4DR3F 1X5PA 5C5JA 1FK9A 4LIRA 4EO6A 2H5IB 4YS2A 2DPIA 1RHMB 1WC6A 2MKYA 2Z4PA 5GADI 3DRSA 5F8GA 2JL9A 3VZHA 2AGQA 1I94J 3PEJA 1CG2A 2Z8QA 1IWAA 1XMBA 4N8OA 1FXRA 4DCPB 1RTHA 4Y65A 1C1CB 2L9NA 2K1RB 4LFAJ 2ZWPA 3BKTA 3JQMA 1N5QA 3EVOA 3TJ9A 4I4BA 1NK4A 1HBUA 3R7SB 3A8KA 4FZVA 1CJUB 4NCGA 4X4PA 1G7CB 2G13A 3M8YA 2QL7B 1RP5A 4G1QA 4TY8B 5HROA 1KFDA 3BN7A 2LQ8A 4ED3A 2HLTA 1N6QA 2W01A 3MMBB 2C2DA 2NQPA 5HANA 3DOKA 5DO2A 2BVZA 3AOAA 3OTBA 3PW4A 4GKKJ 4K0KJ 4LQ9A 1TAQA 1IBCB 1RISA 2DNLA 3U1NA 1VQ4S 1TK5A 3L7UA 5AE2A 2MSTA 3PXGa 2VJVA 4PQAA 1IKXA 1RT1B 2ZC4A 2RD5C 5C25B 3CEDA 4IYQA 3P3DA 4PABA 2MYFA 3QSIA 4Y00A 5KFKA 3I0RA 2XYHB 3HHEA 3ILIA 3OUYB 4B02A 3ET6A 3GIKA 4WU2A 4QWEA 5LOQA 3RR7A 3KLFA 5CD4H 2DNYA 3PRDA 4IUFA 3CB4A 4LF5J 4NXNF 5CA5A 2D69A 1JB0C 3GE9A 1S6UA 2MZ1A 4Z37A 4ZPDA 1ICEB 4EI2A 4M5GA 3BR8A 4GO7X 3KG4A 4OJHA 1X5TA 2PMZD 4JI6F 2PFDA 3H5SA 5DQHA 4WFNQ 1WDDA 3QT7A 2GQ2A 3K58A 4EK2A 3CCSS 1UZHA 1V3RA 2QL5B 3H8YA 3JYTB 3W66A 1S10A 1ACMB 1SVDA 3MM6B 2BJ9A 2HNDA 3I5CA 4WFZA 2F8EX 3CC4S 2HIYA 4JYAF 4PWWA 1IKXB 1XMOF 4ZPVR 3C14B 2OEKA 1JLQB 3OLAA 4WKRA 1JJHA 2ZWOA 1V5IB 2W9BA 5DDPC 4DL6A 3M8PA 4J9RA 1ZETA 1DY3A 1DBDA 1N33J 4OJ1A 1IUJA 1HNIB 2EFOA 2E5GA 1UEKA 1YJRA 3P49B 3MDFA 2DNNA 3LPYA 4LFBJ 2Q3PA 3RB4A 1YDLA 2HIQA 2VG6A 1YJWS 3MM8B 2FLNA 1Y10A 4RPFA 5FDLA 2ASJA 1FNXH 3FK4A 4OJ3A 4IRDA 3CXCR 4GVBB 4A8QA 2ZBQA 4F4XA 3GG1A 1Q16B 4Y6IA 1S1XB 1RT4A 5IOLA 4QIGA 2COLA 1Q8BA 2NXCA 3O3LA 4K2JA 4K4UA 1P9QC 2I2YA 2DO4A 4RW9A 1MU2A 4OX7A 5GAEI 5L46A 3EYZA 2UUBF 1EQMA 1R43A 1WC3A 5A8WB 1U25A 4WJBA 3LGMA 2IC3B 4CNZA 2DXDA 4OZ1A 4WKYA 2FHKA 3DFEA 3HFKA 4LVOP 2CJ9A 4K4TA 1AXQA 3SEOA 2FVSA 4A8MP 2YNFB 1RT2A 3BSAA 3L7PA 5M2UA 3T1HF 3U1MA 2CFXA 3Q83A 4QIWD 1VIOA 2QSWA 2JRSA 2A18A 1S57A 3EXCX 2AHOB 4LRBA 4USUA 4PG8A 4YDDB 6FDRA 3JSMB 1D8ZA 3M1VB 3CDEA 1JK9B 2KO1A 3MEEB 1Q4RA 5HP1B 1S0NA 2BE7D 2M0GB 2HZCA 3TVYA 2LQ5A 2CRLA 3GLJA 4DR1J 5F0UA 2W7OA 2BACA 2E1CA 4NLTA 2DTJA 3TUPA 1UZDA 2MY8A 2YH0A 4AE5A 7FD1A 4ED7A 4DV4J 1UAWA 3IBCB 4ITSA 5HAOA 3CIZA 4DSEA 2H3EB 1Q8KA 5BJRA 4DV7F 3OXGA 2DNMA 1IKYB 1IKVA 4IFYA 3T41A 1SJ1A 2AJ2A 4QPTA 3X1LB 1DFDA 1JLQA 4C8LA 1JNRB 2RHQB 2CDRB 1AB8A 5EUHA 5KFFA 4X4QA 1Y4ZB 1QVFR 5K9FA 5HATA 2AF6A 2L41A 3W3SA 4H4KC 2HWIA 4J9SA 5J1NA 3E01B 4UTGA 4I2QA 2J9DA 5D0RA 2V9WA 3TRGA 1Z2LA 3A3OB 2V8DA 3MR3A 4UOCA 2EG1A 3LP0A 1FKOA 4DV0F 2FY8A 2RU3A 3NRBA 3CC7S 4F2SA 4K7QA 4OI3A 3I31A 4DUTA 4JI1F 4L6V3 1YQHA 3T19A 4CT9A 1S6PB 2H1YA 5IWAF 3G71S 2KT2A 4PKDB 2PE8A 2YWFA 3HD1A 3HP6A 2BDPA 3Q8PB 1BE4A 1I1GA 1EARA 4P2FA 1XNQF 1JLBA 1RAEB 2MB0B 3VAHA 2GHWA 3SCLE 3OUYA 4JI4F 2VFTA 1T03B 3GZ7A 1AFJA 1WG1A 1M5PC 3N01A 4KO0B 2HBZB 3VR1A 1ITPA 5KT4A 1VC6A 4CLTA 2CZVC 3JAMU 1VDHA 2CG8A 3AHPA 5KFOA 1R27B 4USVA 1IQZA 3MHYA 3QBCA 3I5BA 2FD2A 4DG1A 4ELTA 1WKLA 1O5JA 4S0MA 2LXIA 2WRMA 3TA0A 5IT9Y 5IM0A 3NGSA 1HPZA 1EJ7L 1Q53A 3QRQA 2AKWB 4M5DB 3IAS9 4N5SA 1WHYA 3WZ0A 3FZ2A 1Y0HA 4KV8A 3O1LA 3IWLA 3DRRB 1FVSA 1GNKA 2DCLA 3BB5A 5CQGA 5J2PA 4KFBB 1VJWA 1AFIA 3O44A 4RW6A 4LF2A 1XBWA 3CCZA 4J7CA 4KO0A 4B9VA 1M5OC 1S77D 2J0SD 4EBCA 2H4YB 2LVWA 2YKNB 2QA4S 3QAEA 4PR6A 3M8SA 2XY6A 5D77A 1F60B 1NZAA 4U96A 3PTWA 1NJYA 3PO4A 4QWCA 2JVRA 3OTEA 2OEMA 5A6PA 2VBWA 2RDDA 1RT1A 2CNNB 4A46A 3NGDA 3W8GA 2UXBF 1JLEB 2JDJA 5D4OA 1M1GA 3G96A 3E2EA 1EQ0A 2EK6A 3ZZOA 2X3GA 4HT7A 2UXBJ 1RAIB 4O4GB 4LF6F 2XM3A 4NASA 1NSKL 5KFXA 3LWMA 4H4OB 1RKJA 5HQ8A 5D8HB 4I7FA 1X0FA 2PI4A 2PN6A 2E7VA 1UL3A 4F3MA 1N36J 3RAXA 2NUHA 3KLGA 4BDPA 4FS1A 2Q66A 2P6TA 2LLZA 1F2GA 3D6HB 2XY5A 4OYZA 2DCUB 2H51B 5CYJA 1X9MA 1TK8A 5GAHI 1WWHA 1C0UB 2WVBA 3CMQA 3HJVA 3IO1A 1F0XA 4KGZB 5ETQA 3F0NA 4CO5A 3VV2B 4YMEA 2J0QD 2Y9HA 3CE8A 2PEBA 2NPIA 3B54A 3RBZA 2VHGA 3MM8A 2RAQA 3L9ZA 4ECYA 1KFSA 3UCZP 2HQDA 2ZOFA 1GXTA 1UKUA 4WE1A 4A8XA 1R0BG 3DRXA 4ZLJA 3V6HA 1VQPS 4H4OA 1FDBA 3H59A 2BQRA 2W7AA 4P75A 2IJNA 3CDBA 1HHTP 5F0WA 3I82A 1OWXA 1JX4A 4CO0A 1CS4A 3V6JA 1SUQA 2DHXA 5KFVA 1KR4A 5KFNA 1ULRA 4L74A 2ROGA 1S9EA 4ZJLA 3M30A 4NLWA 1KP6A 1VC5A 5C25A 2XS2A 2KZMA 4OI6A 2PD1A 5DQGA 1FFSB 3C46A 1EHWA 5CYMA 4HHHA 3FKBA 1VRTA 3ZNUA 4NLYA 4DL0C 3OVSA 4AQYJ 4OHYA 2B8QA 1TMJA 3T9ZA 2OSQA 2LMIA 3IFEA 1U1NA 4IG0B 5F9NA 2BABA 1SIWB 2QLBB 1U2RA 4GC6A 4OI0A 1FJCA 3DM2B 1FTCA 3GJQB 3I5AA 4IO1A 3NCPA 2DPJA 5GADU 3M8QA 2YPYA 3SQOP 2DHHA 4NL5A 2MY7A 3A12A 1D1UA 4TY8A 3MPWA 1AT1B 2HVZA 5CZXA 3KLIA 3M9NB 3HKWA 4C8MA 2PA8D 2QZ8A 3BGLA 1D3WA 4FN5A 3SBMA 1NSAA 1SH0A 3PJ9A 4DPXA 2JEJA 3NS7B 4DFPA 2Y1JA 4FBTA 3I0SA 4USIA 3UN3A 2XHCA 3GCXP 4WXOA 3G8TA 5A2QY 2BYCA 2APOA 2GJFA 3D54A 1KVKA 5HI7A 3C6UB 1IR0A 4XTTA 4C2MA 4CNYA 1AYEA 2XBPA 3LUYA 2ZH3A 4DV3J 2HVHA 4EBEA 1UWBA 3L09A 2CZ4A 3M8ZA 1Z1ZA 2FQQB 3CIMA 3M8PB 4I56A 5LJ3Y 1S79A 1S59A 3H98A 3KK3A 2ZZTA 3FSXA 1VQOS 1X9WA 4MIBA 2YY3A 4MKVA 4RBVA 1X4AA 4ZMMA 2MKCA 2ZITA 3MCOA 1N5YA 1S7HA 3KK1A 3T6JA 3Q8QB 2R7QA 1TTHB 1N5VA 1UW4A 2CVEA 3JYTA 4DX7A 3BSOA 4HKQA 4ALZA 1FRKA 2F7VA 4CLYA 1RCXB 3IC1A 5ETVA 2H4WB 2YX4A 2EG2A 2MLYA 3W65A 2W9CB 4OLOA 3ITHB 2D9OA 1B3TA 3H5XA 1HBNB 2PA3A 3LP0B 4X4UA 3ZFVA 5AXNA 2FY1A 4G3IA 5A8WA 2AJQA 4PXBA 4CIOA 2UP1A 3KUHA 2RU9A 2VOPA 4NOHA 1KQFB 2RB7A 2E7XA 5L38A 2IM0A 1AZSB 1S4EA 3BKUA 3D3BJ 4DL7A 3BPDA 2IRUA 3UO0A 1UFKA 3KHHA 5LMNJ 4ECXA 3UDVA 3OVAA 2H5JB 3W1YC 4CLSA 3VVUA 1JLFA 1CJVB 2DB1A 2YWKA 3G4SS 3IG1B 4P73A 1ZM3A 2VBXA 4Z7CA 4DV6J 1VQMS 1T03A 2XZTB 2XLKA 4LF7J 2GQCA 1RT6B 5J2QA 1H38A 3PIOQ 1KS2A 3GSIA 3DGPB 1NHKL 4NPOA 5ETOA 1T94A 1YRTA 1BQNA 3HSDA 4PCQA 1D0EA 4OJGA 1FX2A 3M2UA 3OQ2A 3B78A 5J1EB 1U1RA 4IR9A 3OR2A 2F9DA 3IBFB 4C4WA 2DK2A 4FF4A 3QJLA 5HBMB 1HBOB 1RK8A 1RACB 1GFWB 1T8EA 4R8UB 4FVMA 1AUDA 5AJ3J 3MM9B 1T02A 2YKNA 5G0RB 4DSFA 2MGZA 1N0VC 3QT8A 4JI4J 1O8BA 2DR9A 1G1XA 3G6ES 4FPIA 3FQLA 1NSPA 1Q79A 1RSCA 2D3ZA 1ELOA 2MMYA 2DXFA 1RT5B 3HCXA 4ED6A 3FBFA 3K8WA 3FCWA 2CZ9A 1B0PA 1FWPA 1MWYA 3QYYA 1F9FA 4QYZK 2L9WA 1X5OA 2V34A 3MMAA 3NLCA 4USHA 1UPMB 2UUTA 4RU2A 4A8OA 2K06A 2C42A 4OI1A 2IFXA 2L3MA 1IBKF 2HBRB 3TO8A 1CJTA 4B17A 1RLCL 2GO8A 3HXMA 1YHQS 1HNXF 1ZTTA 2LU1A 4RUBA 2ZVSA 2F4VF 1OYEA 4ZCMA 3DOKB 3W8PA 4GKJJ 3M2VA 1BC6A 2GAGC 5E3AA 1YBUA 3NS5A 4YB6A 5B0GA 4DCOB 4ZIWA 4A8WA 1CEZA 2HMIA 5H9EJ 2QTWA 3PG9A 3N79A 1PBUA 5BYQA 3WBZA 1QAJA 3UW1A 4UQGA 1KD1T 5CD4A 1A9NB 5T7LA 2XMVA 4ILRA 2VPXB 4RKUC 3M9MB 1X4DA 2G0CA 2EI5A 2HQFA 3MD1A 3OPKA 3R8YA 1YG0A 2MQQA 1S5ZA 1VYAA 3GFHA 4ENOA 1TVRA 1YBTA 2CQIA 1E6YB 2F3JA 2V8GA 4OZ2A 1U0HB 2B8PA 4ECRA 5J2QB 1T3NA 2NPFA 1UPPA 4Q43A 2KB2A 3DMJB 3VAGA 4QJVA 2NREA 1FKOB 4USMA 2CQCA 2L48A 2UVVA 4NXNJ 1F3VA 3IWXA 3I55S 1SL1A 4FF1A 2HHVA 1M0SA 4NE9C 1TL3B 1WTFA 5IT9U 1W26A 2DH9A 3OSPA 2UVWA 3PYGA 3M8WA 4I6YA 2CADA 2MQLA 1F6TA 2AMCB 4F2RA 1FERA 4LJMA 1WC4A 2W25A 4UOHA 3JQKA 4BC7A 4EO8A 2BA9A 5H9FK 3IMQJ 4FYXB 1QDUB 1ZM2A 2HS4A 4WWSA 4ANCA 3T5LA 4RNOA 2OEJA 3CJQA 3T1HJ 1FNOA 3FDSA 5GAGU 1LW2A 2XB2D 2FJAB 2VKZG 3BQ0A 4U95A 4IFVB 2UUBJ 5HL7Q 1FRIA 1HNWF 1IJEB 3VGUA 3KK1B 3GFYA 4KYZA 1RHJB 3TA2A 1XNRJ 2HK3A 1N4LA 1RAGB 3P45B 2CAJA 5KT5A 4X66J 4B9NA 4NMLA 4ZK7M 1FD8A 2QRRA 3FBCA 3HZGA 4M5JA 1Q86T 2BKPA 5DLFA 5ETPA 2KJVA 2J7WA 5GVQA 2Z57B 1NZ8A 4CM0A 1PC5A 2UV8A 1NK5A 2R7XA 2E1RA 5B0AA 3TWZA 3WQPA 2G1HA 1TU0B 1FJ7A 4DV2F 5KFEA 2QA2A 1PYOB 1TL4A 3GV7B 2Y1LB 2X1BA 4EUVA 2QE5A 1N34F 2UXCF 3W9HA 4TU9A 1TK0A 1MROA 4N47A 3K57A 4N77A 4RNHA 3HSJA 3M2UB 1X4CA 2J76E 4YFUA 2RS2A 4DQIA 1JXVA 2RUSA 4ZVRB 2LCWA 4TQRA 1TMMA 1S49A 4NX9A 4LR8A 1VRUA 1FRMA 4DV3F 2CNOB 3P8BB 5E7OB 4C8OA 3ADAC 1LWXA 4DV7J 2BE9B 4PXDA 3QZ8A 1B70B 3T3FA 3C8YA 2O01C 4ZIVA 1N0UA 2QIFA 5HMXA 2P5VA 1FA0A 5KFZA 2A2DA 1R89A 2VC1A 1EB0A 2N7CA 3TZXA 3J81j 3MAQA 3TZWA 1VQNS 1Y3KA 2MLXA 4DR7J 2HQ3A 2IBKA 3K7RA 2N3OA 2UUCJ 4HHJA 4AXIA 2KU7A 4WZQA 1SH3A 3NWRA 1RYSA 3BH6B 2GQQA 1MROB 2QL9B 3V2UC 2A2CA 4MMOA 1Q95G 5I3QA 3US5A 2NXJA 1BY9A 3TZZA 2VICA 4O4RA 3MAHA 3SV3A 1RTHB 2MHEA 4PPDA 3I56S 1FRHA 2XQCA 2CPZA 4NWBA 8RUCA 4LF9J 3BO4A 3LGNA 3NNCA 3OFHA 1H7XA 1S9EB 1T9TA 2D1CA 2C2OB 3H2LA 3VQSA 2ZM6F 3M6UA 2AD9A 3EDQB 2MZQA 2YX7A 1OY8A 1VIXA 2JZ5A 4EYIB 3Q8UA 3RU0A 1WEXA 3RBEA 2ADCA 5LMNF 2RVJA 4CLLA 1RAFB 1HA1A 5DRKA 3RAQA 1X9SA 2UUAF 1M5SA 2VG7A 4OZLA 1A0OB 3GIJA 4CT8A 1G3OA 2VQEF 1IBLF 3D28A 4L3NA 5KT3A 3HVRA 1CJKA 4B3TF 1SCJB 1S1VA 3UWTA 2VQEJ 3FNNA 3MECB 2R7RA 5FJ4A 2YNHB 3DLGA 4DU8A 6AT1B 4DL3A 2MHNA 1OSCA 4DR1F 3IN5A 2V4QA 2FJDB 2GIFA 5KFMA 1HNIA 2ALYB 4FYDA 2P9CA 2JEGA 4KHRA 2GVDA 2IRXA 4O3NA 5IQ6A 4FNIA 1NDCA 4ECSA 3H5UA 3DHXA 2J8SA 3G2XA 2JC1A 3HVAA 2HQGA 1YX2A 1T9WA 2JLEA 3DU6A 4WP9A 2ZBIA 2R8GA 5CXTA 1U0HA 4DV1F 1WG5A 2C3YA 2BM0A 4QR2A 4E98A 3EMTA 3GQCA 2W9CA 2RSQA 4ZPCA 2J6UA 1YJ9S 4OHWA 5D4PA 1TZ0A 3H0PA 4RW4A 4PWDA 4RR5A 2YNFA 1JLAB 4DOZA 2F8HA 3D5MA 1LNQA 1TKXA 2G2ZA 5F3ZA 2FLPA 4JI6J 4K5RA 4I0WA 4F3QA 1FJGJ 1YTYA 2J8AA 1DJ0A 1UFWA 2FZCB 3IRXB 2QSFA 3M2VB 3RW7A 4CI0B 2J0XA 3TA1A 7FDRA 8ATCB 5L8RC 5KG7A 3PVXA 2LKZA 3HDSA 1LFPA 4KTQA 4BBYA 3M9OB 2HSEB 5HO4A 3FZBA 4H54A 4BWMA 3T1AA 3HHDA 4I1TA 2WBRA 3R5DA 5FDLB 2ZE2B 4EMDA 3VAMA 5F9LA 4DUYJ 2N4DA 1SKSA 1VLOA 3G82B 2UXDF 2XWXA 3JB9k 4L72B 5DDQC 4EZ9A 2NYIA 3AXKA 1U2CA 1J5OA 1R8PA 3OSNA 4Y2IA 4Y0FA 1RTJB 3QJPA 2FHJA 1CQNA 1RWXB 3FMBA 1FNMA 3SDEB 1PAUB 5F41A 2KFYA 5CCMA 3CCTA 1GEHA 2PO4A 1DURA 3VAJA 1FJGF 1VFJA 3IWNC 1SV5A 4F7VA 1H74A 2ROPA 3N6MA 4OZ0A 2XO6A 2B9WA 2IYGA 2KDOA 1T05B 5GMEA 2F8MA 2Q79A 5T41A 4C6AA 3GU0A 2V5HG 5KT2A 4Q44A 2HHUA 3QATA 4DPTA 4OYAA 1UW9A 1WOOA 2KG1A 1MMLA 3ZTOA 2Y1IA 2LEAA 5DM6Q 2B9XA 4F4KA 1NO8A 3KYLA 1JKHB 1VRTB 3J7YI 1FEEA 2N7YA 3EVWA 3MTKA 3AQPA 3UNYA 1A7GE 1PJ5A 3DGVA 2B4PA 1GQEA 3K2YA 3Q2SC 4KQZA 4W4MA 4C9DA 1OPZA 3OR2B 4ZPAA 2XGPA 3NBPA 2QG9B 2O67A 1RB0A 3FSYA 2AGOA 4CLUA 2VJUA 1NKCA 4DN9A 2KXNB 1UVMA 4LFCJ 2IM1A 2HHQA 1QAXA 1C0TB 1RA7A 1XMQF 5K5MA 2GC8A 1S6OA 3K8VA 1I5OB 3MMBA 3HPOA 1NNDA 4ER8A 3EX7B 2RDJA 3G9CA 4MK9A 2CNKB 2XNQA 3D4JA 2EBGA 2N3LA 1S9GB 2IVFB 1RT3A 4ED1A 2CVIA 3W60A 4RL1A 4ECZA 3PYDA 1TKZA 4IQMA 5E3QA 4ERDA 3OV7A 3MR5A 3QIPA 3R7NB 2E9ZA 4ILLA 2CJYB 1C1BB 2BX6A 5ETNA 2HHWA 1RHRB 3KJVB 4DV4F 3T6BA 2AQ4A 2UXDJ 2HNYB 3BQ1A 1CULA 3PYFA 1DLOB 3BBCA 3W2VA 4KRWA 2LDIA 2OI2A 5F8HA 1Y9OA 2XWYA 2ZBCA 4R5PB 4OMFG 3LPEA 1H7WA 1RWKB 2AZ1A 4OYPA 1D9AA 1BUXA 4P7TA 5D4LA 1N8RT 1S1TB 2LFVA 3CD7A 1RTDB 1QSYA 2D3UA 1FJEB 1S4FA 4ANEA 3LH2S 4F36A 4P52A 1KLMA 3EPIA 2CQ0A 2I9SA 1C4AA 3M1VA 1Z2ZA 1FWLA 3NMRA 4TXSA 5MLCV 2BW2A 3KLHA 3RBDA 1I3OB 2YX1A 3H90A 4K4SA 4UUWA 3U27A 3SYZA 1L3UA 3KJVA 4B9SA 4CZCA 1Z4UA 2RUGA 4ED2A 2WCXA 4USKA 3NKYA 2J9DE 3Q24A 9RUBA 2HFOA 4M5KA 2DJWA 5KTQA 4QYZJ 1N88A 2J0WA 3H20A 5CHCB 2QJ3A 5GMDA 4LRDA 1SQGA 4HI2A 2GGPA 1M5KC 2BQ3A 2KKHA 2V94A 1XNQJ 4DEZA 1TQLA 2RKIB 3HFZB 4RLEA 3VVTA 2YH1A 4O3SA 2MZSA 4ZN1A 1IKVB 1IKYA 1WI6A 4IFYB 4K59A 3GIMA 3PJXA 1Q5VA 2GMHA 2GA7A 4E0DA 4LFBF 1UJ5A 3WX8A 1U1PA 4DDFA 5I42A 2IMOA 4CQ1A 4XDCA 3B82A 4K4ZA 1W25A 4LSZB 3NXZA 1FKAF 2JFKA 2RF2B 4ZVSB 4X2BA 3JAMY 2DGWA 2W2MP 3U7JA 3OXFA 4F67A 3W5ZA 3LP2A 3TANA 4DL4A 1SKWA 2H48B 4F4AA 4J5OA 4F02A 1NCLA 2MZJA 2KFNA 1P1LA 3M2RB 3HT3A 4A8YA 1SUQB 3FBBA 2CPYA 2V8VA 2Q6CA 2ZJPQ 1UEUA 4N56A 2ZH5A 3RB3A 2MXYA 1IBMJ 2VA3A 1KHVA 1C4CA 3MM5A 4IH5A 3B4MA 5F8MA 5IV3A 1IKWA 1YWXA 1CBKA 5IV4A 4URSA 3SFGA 4MIAA 4USTA 1WC1A 2JX2A 3SMZA 4C0BA 5HMWA 3E8OA 4TKTA 2R7OA 1NEEA 1TKXB 4LF5F 4CWBA 1KTQA 2YKMA 4ZVPB 2CG4A 1BGXT 2KYZA 2OD6A 2ZEJA 3HVTA 4JI0F 5CABA 2YQ3A 3KDNA 1NDPA 4NA1A 3PIPQ 1S6QB 2B9YA 3IR7B 3CJ3A 2K8GA 3Q8VA 4HVZA 5HJXA 3OLBA 4DQRA 1NPPA 3O6QA 4ECWA 2FPHX 3ZXWA 3OHAA 1FFWB 3LTOA 1MG7A 2HEKA 3T9NA 2OMOA 2MSSA 2MPUA 4ID5B 4MT1A 1RA6A 1VRUB 5KFIA 1S9FA 2UU9F 2HK2A 3MTJA 5EGYA 2XNRA 1FESA 2AP6A 3IM9A 2DH7A 3CPWR 2ZD1A 3AD8C 2E1MC 3DRYA 3QWPA 2WOMA 3JSMA 2NCKL 1TV6A 3DYAB 3MECA 3P5BP 4MFBB 4DF4A 1N5YB 1M1KT 4WP8A 4MKBA 4QU7A 1V9OA 4DUZF 1HIYA 1CJUA 1Q5YA 4NCGB 3E3XA 4QIEA 5KG6A 3HHKA 3I4PA 2R7UA 1RKIA 1X4BA 2HS0A 3EPGA 1SQFA 1WC5A 1Q0NA 5L1LA 4USWA 1DRZA 1WHWA 4K4VA 2HAIA 3EE3A 4PZVA 1SV5B 4WFAQ 1U1MA 3F41A 4UY85 3H2VE 1JLAA 1K1SA 4ED4A 2JOQA 5L39A 2AEJA 2LP4A 4DV0J 3R2CJ 2XGQA 4W90B 3JXOA 2CPDA 1RWUA 2RIJA 2G2YA 4KGKA 5B0CA 4UZCA 1H98A 3ILJA 3CD0A 2GAHC 2QYGA 4DUYF 1NHVA 3KK2B 5B0BA 5JVGQ 1LW0B 2AGPA 4JYAJ 4EWTA 5LM7E 3AFGA 3SQGB 2OKQA 4AQYF 1RWNB 1T05A 4JI8J 3Q2TC 3C6UA 4UOGA 1REGX 2M52A 4A8FA 1PO6A 4JB8B 2ZKTA 3IP0A 4R0JA 3N28A 2J9CA 2WSCC 2YWWA 3DOLA 3PHEA 2M2BA 4M5HA 3KLHB 5K14A 3KJQB 1VQ7S 2F63A 3IR6B 4U6PA 4DV5F 1XR5A 1KLMB 2HFNA 3HSGA 1S6PA 1A6LA 1T9YA 1XC9A 1VQ6S 3JTPA 1Y5NB 4KHPF 1HL6A 3GIIA 3KNGA 3OD2A 2GZOA 3C15A 5KT6A 4FF3A 1KHWA 3M30B 1HHQA 2DGSA 4LR7A 3TEHB 1S72S 1CULB 5D0EA 1RT7B 3V6DA 3OJSA 4X4TA 1GH8A 1HQEB 4LRFA 3U02A 5DM7Q 4GVLA 2OLWA 4NZ0A 2ALZA 2IJRA 4DR5F 2AZ3A 4AL6A 2POKA 5E41A 2Q6BA 1K0TA 5I3PA 2F65A 4LF6J 2HNYA 2QV6A 3SZ2A 3KLEA 3FFIB 2EKNA 3MOZA 2VL1A 1OO0B 3LP2B 3G8QA 3M7VA 3M32B 1KTVA 4YN3B 3A8JA 4QWDA 1WUUA 2AYBA 3IG1A 2JSXA 3VQTA 2HGNA 2DNGA 1VLYA 4MKAA 4Q7AA 4WK3A 4YB7A 2YNGB 3S6EA 1IBLJ 1CQMA 2XMMA 4PUOA 4F0KA 1FTRA 3C6TB 4RNFA 2ZDPA 3MEDA 3J80U 1HW8A 3FQKA 1T11A 3PCOB 2U1AA 4H4MA 2DNHA 2Y3YA 5ETLA 3V81A 4ILMA 3SSSA 3NCQA 2J7UA 3OXLA 2BANB 3GYNA 3WX4A 3F73A 2VQFF 3NNHA 3EWGA 5FLXY 3KLEB 3LWLA 4HI1A 1IR1A 4RBTA 4NLDA 2WTFA 5H9EK 2DYAA 1BD6A 1E6YA 2PMHA 1B0TA 2FIUA 4JV2A 2ASLA 4YB5A 3AB2B 4XDDA 1GTEA 1X7VA 1RADB 2V67A 4TNOA 2HQIA 3GMGA 4ZVTB 2HRUA 2CQ4A 1KQKA 1RAJA 3ILLA 3ZTPA 1J27A 4M1KA 4Q45A 2RQMA 4F26A 4AD6A 1WSRA 3NY0A 2OPQB 1ZAXA 5AXKA 3TJAA 4GVBA 2FVQA 2KT3A 3S8SA 4CO4A 5BR8F 1V5VA 3ISNC 2WVDA 3R5BA 2WOMB 3QMQA 2MEWA 2CJXB 4ED8A 2G4BA 1H6KX 4OX9F 2XMTA 2CXEA 4ELUA 3QT5A 4QYRA 1VMBA 3RYLA 3J7YU 1XERA 1XK8A 3BSNA 4OZNA 3KLVA 1REVA 2VDHA 4QCLA 4KY3A 3KG0A 3VHQA 2O5DA 3CJRA 2XCPA 4DR6F 4DV2J 1RWPB 2YNIA 4DR2J 3K89A 2M4MA 1RGVA 1FF2A 1RT3B 3FEZA 4A4JA 1QUPA 1R0CB 1FDDA 3MM6A 1Q81T 1MN7A 4DQQA 3M32A 1HI1A 3J80Y 4NLGA 1G4CA 3CULA 2HQCA 1FT8A 1RWWB 3HVTB 1YRUA 2RRBA 3PHTA 1WF1A 4N41A 2ZHBA 2UUAJ 3TP2A 3W2VB 1FHTA 2CWXA 3S7RA 5EWGA 5D6GA 4B3RJ 4HLBA 1FDNA 3RG6A 1I94F 3PM9A 1UJ4A 4ELVA 1OY6A 3CDWA 2HHPA 3SV4A 2FJBB 4AXJA 1RTIB 3JQJA 2RF2A 1H2VZ 2FJEB 3KLFB 3CCRS 4I2QB 3LAMA 4R8UA 2HG4A 3R1HA 4F8RA 4Y2MA 2A0FB 1U6ZA 2YQ1A 3MPUB 5GMKa 3MR2A 1O51A 1OMSA 2EFQA 3AT1B 3FRZA 3MURP 4NXMJ 5B7WA 2R9LA 4WK1A 3DRPA 3QT6A 3IA0A 2AW0A 1QUVA 5H9FJ 1GX6A 2GVDB 3ZZPA 3MAAB 1DTQA 4DV5J 1F9EB 1JMTA 2BR0A 3LQVA 3GYGA 4OYXA 4R25A 3P4UB 1UFLA 3UDCA 4B3SF 2W1BA 2V6AA 4NEZA 3GWCA 4ZS6A 3ETMA 5KFLA 3ZZRA 3HM9A 3RRHA 1ZZNA 4O3PA 2HMIB 1Q8IA 4P10A 2LEBA 4C3MA 4TYAA 4QIFA 3KK2A 1DQ8A 3KHGA 2HBYB 4CLWA 1EIYB 4WIIA 1Q78A 4ZVUB 1WJ9A 1YI2S 5HMZA 2ZZMA 4KE5A 4XPCA 4LREA 3K5LA 3KTQA 3BO3A 4OYOA 1PC4A 3D68A 4KIAA 2MKJA 3CT9A 3ENVA 4M5MA 1TL7A 4PEOA 2IM3A 1HQ2A 4UW2A 4F25A 1FO1A 5E3CA 1RWMB 2CYYA 4WTOB 3FUYA 5EX0A 3PKYA 3CWJA 1ZS6A 3CVKA 3JSBA 5F8IA 3PFEA 4JV5F 4JUZA 3CD6S 2WK4A 1SL0A 2F4VJ 3SIPB 1NKEA 1PIEA 4UF4A 4ZOSA 1TV6B 3DYAA 4MFBA 4UUXA 1MW7A 4DU7A 4KC5A 4LVNP 9ATCB 2CNLB 1EP4B 1KOHA 1M1HA 4PUOB 1U8SA 1SJ4P 2R7SA 2W2OP 4J91A 2ILYA 4DZDA 1OPIA 2RNEA 2V69A 5KFSA 4WIQA 3QIDA 3DRRA 4TQSA 1HHSA 2VBYA 2DR6A 5IC4B 1JQGA 2IBOA 5B09A 6FD1A 4CLPA 1XN9A 2D74B 2KHCA 2ZBPA 1K8AT 4ZCIA 1PAEX 3UI3A 4RUCA 3SDEA 3M6WA 3SCKE 1VOMA 2E1PA 2VC0A 1SI9A 2QO3A 3VWSA 4C8ZA 1IM6A 2OPQA 2NXUA 3QJJA 3QNWB 1HBUB 3OL7A 2E9TA 4ZLNA 3SXLA 2BM1A 4NLSA 5HQMA 4IG3A 4RO0A 1KWMA 1YVFA 2ZHOA 5KG3A 2XMAA 4Q0BB 2RS8A 4WYLA 3DLKA 1AROP 1U1LA 3BQ2A 1WF2A 3PR5B 2B43A 2GJ2A 3R6GB 3R5CA 1VK3A 4I68A 4ZA1A 2E44A 1U2FA 3GR0A 4IOAQ 2IM2A 3FRYA 4ZVOB 3ISND 4JV5J 5AXLA 2ACYA 3DM2A 2ZFHA 3MCMA 2IVMA 3PRVA 2VUGA 4ZVFA 3GJTB 2KRBA 2OPPB 2XO7A 4WXWA 2HHHF 3C2PA 1U1KA 4CYUB 5EWFA 2KFZA 3A13A 1ZTWA 3J81U 1VBZA 2AJ0A 4PXEA 5GAGI 1NMEB 4WE1B 1SC4B 1X4HA 5HN0A 2Y8WA 1SJRA 2LDYA 4KAIA 2I8EA 4IG3B 5DDRC 2NR0A 2AJ1A 1Q1KA 2QMWA 2NXNA 3BS9A 3GONA 4KFBA 3D0IE 3CJ4A 3IGNA 4NA3A 4C0HA 4ZITA 1KC8T 2B7CB 4YUDA 4ZP7A 2Y0SD 3RB6A 4TYBA 2ZH2A 4IDKB 4QZVB 2MQPA 2LQ9A 1DZ5A 4YOEA 1S9GA 1R7IA 2YKQA 2CQ3A 1HKAA 2ZNZA 3PDNA 2XZWA 1PYSB 3QFWA 3AH6A 3N6LA 3DLLQ 1NU4A 2IVYA 2Z2ZA 2IPOB 5AT1B 4C48A 3H40A 3A3PB 4DR3J 2CQPA 2QN6B 1IXKA 1TL1B 3I6PA 3ONQA 4QR1A 1R8HA 1RLDA 1BHNA 3NAIA 2ROEA 3DHWC 3R5JB 4NLVA 4CCHA 1NHUA 1R8BA 4X64J 2X1GA 1Q8LA 2E1AA 1T7PA 3IRXA 4Q8EA 1MWZA 1LK5A 2VPWB 4ZP6A 2V9KA 2FHJD 3L3CA 1KONA 4DS4A 3BREA 2MZTA 3FJ2A 2VV5A 1K73T 3QZ7A 3PRBA 1JLGA 3HHLC 3VALA 2MKHA 5KG1A 2BANA 3PW5A 1HNZF 5ETSA 1B0VA 1YRXA 2ZOMA 1U26A 3AXMA 4DFJA 2OHDA 2RHSB 3LGHA 5IQQA 4U67Q 2IA6A 3J81Y 1QLNA 3C6TA 1N32J 1UWAA 1APSA 4HH1A 4ZVGA 2ABYA 2W4CA 3CDUA 2C3UA 1WG4A 3MEKA 2XEXA 1V6HA 3HI9A 4PG7A 5F8LA 5J2PB 4RNNA 4EYHB 1S1WB 5KFYA 1LKZA 1B7FA 3TOQA 4E8UA 5J2MB 4YP3A 2JH3A 1QY7A 1AZSA 2F4FA 5KFJA 4N7TA 2QT7A 2GGPB 1K9MT 1RABB 1VQYA 5KFTA 3TNVA 3ZZZA 4Z2XA 1TP7A 4J9VA 2BJ1A 3IBWA 3ZZTA 4DLEA 5CYQA 2B5JA 2YQ0A 2YKMB 3BZQA 4OX8A 5IT4A 2A1BA 3CJTA 1NK8A 3CJ2A 1LW2B 3HD2A 4R0EA 3HMJG 1ROFA 2V63A 3T1YJ 1QVGR 4MJKA 1KRPA 3MGJA 4K2XA 1PKUA 1LWEA 3PACA 4J9NA 2DHGA 1F2HA 4X65J 3ZTRA 4CTAA 2FJVA 1CLFA 4ZVEA 3VGSA 7AT1B 4F0MA 2MGZB 2K2PA 5D3GA 4JBCA 2KTQA 5CYMB 3KMQA 3OL9A 2QGFB 1HBMB 5KOWA 2ZUAA 4DR4F 5LXYA 3H5YA 4FNHA 1XTZA 1HBOA 3W63A 3TI0A 1VISA 4DPOA 1X8DA 2JC0A 3DC2A 5KFAA 2ASDA 3BGRB 4BC9A 3CNQP 3X3UA 4NLRA 3OL6A 1M5HA 3HHLD 3A1YG 1YKWA 2YPZA 3E01A 2A6MA 3HT0A 2GJIA 4M63A 5DETA 4F4ZA 2VG5A 2G2OA 4DMZA 5F8JA 1HYSA 5T14A 5HSPA 3A8EA 3NOGA 4C8NA 1X60A 3BEGB 4P7VA 4ZLLA 2JLGA 4DS5A 4L75A 3GJRB 2D3O1 4B3RF 1U47A 1ZH5A 3EICA 1RTJA 2BE2B 3AJ1A 4KGXB 2VKRA 4OYMA 5A8RA 2JWNA 3R7BB 2DGQA 2DITA 4KH0B 1F5AA 4NYPA 1HWIA 2VB6A 4M5NA 1UVNA 1U49A 5J1PA 1WHXA 1FEHA 2R2SA 2LEPA 2E9RX 2WVFA 4NYZA 3WHIA 1RE1B 2HPUA 4NZ7A 1EP4A 4HTJA 5CCLA 5DG7A 2OH2A 2GVZB 3R5GA 5MAOA 4OZ5A 2HURA 4G1QB 4WYWA 1R3NA 1WF0A 1LWCB 1FCAA 5BYRA 4O44B 2UZAA 3PX6A 2EBEA 2GS8A 4I64A 4YDXA 1S97A 3MI7X 3HHNB 3PZPA 5IFMA 3ETOA 4LBIA 1WNEA 5HMYA 4RW7B 2HW3A 2LXUA 4AL7A 3CCWA 5DZ6A 3BM7A 3P5TL 1HMVB 2HLUA 4A48A 4CH7A 2DR7A 2BXJA 1SBRA 4FYYB 1M5VC 2R2UA 1B99A 4ZJOA 3UD3P 4HACA 5E33A 2DVIA 4WP3A 2IAJB 3CCES 4KV8B 4DL2A 5F3TA 2ZJRQ 2WB4A 2OFHX 3QWUA 5KFUA 2EXUA 4CDIA 3BYRA 1R6YA 1X4GA 3NAHA 3POTB 5L9XA 3QSYB 2F5GA 4TVAB 3PFOA 3TR5A 4D3HA 1QTNB 1KKHA 2IHR1 1DTTA 1YJUA 4N8NA 4PXCA 4C7QA 1H3DA 2AV5A 5ADZA 3T1YF 2X1FA 4XPEA 2GHVC 2W2PP 4Y34A 2AJ4A 4JI2F 2DHAA 1YJTA 1RBLA 3C66A 3ITHA 3GV5B 2B0GA 3BKFA 5L1IA 2BJEA 4X64F 1HW9A 4B9MA 1WELA 2K7KA 2B9EA 4KBIA 4C11A 3IS9B 5J2NA 4K0KF 4J9KA 3QLHB 1GXLA 1JLGB 2DIUA 3EZUA 4F04B 3ZTQA 1NJWA 1RHQB 5FIIA 4ANDA 1URNA 2BBEA 3CMES 1C2PA 4IG0A 4JI1J 4QBUA 3M2RA 2HZAA 1HR0J 1HD1A 3GIRA 2DKOB 4ECUA 4PRFA 1T9UA 3ICLA 3SSQA 5EDWA 3D2WA 1IN0A 2QLXA 3SCJE 2MLZA 4YHHF 2J6TA 1UEVA 1RT6A 4I2PA 1VQ8S 4PYDA 3RB0A 1MWQA 1IWGA 1WORA 2P9EA 3ENWA 3QGGA 3ISZA 4DX5A 4LRCA 4X4OA 4NRUA 3FGVA 3DLKB 1FE0A 5A76A 3KUEA 1VGYA 2GX8A 5C24B 3FVYA 2KJWA 2VONA 2V2VA 2YBVA 4BCAA 3LF0A 4HDHA 2F40A 3FEYB 2EK1A 4BS2A 4KKOA 3WDOA 1P6TA 5D3GB 2UU9J 4J9OA 2JFDA 1DQAA 3MEGB 2V0NA 1CJTB 3DLBA 2ATCB 1TKDA 1KBRA 1NB2A 2KHDA 1RQ0A 2OSRA 3DNCA 4EEYA 1SC6A 1AA1B 4YY3F 1S0MA 2GIRA 4DWIA 1SJFA 4TU7A 1IM4A 2YNIB 2C2NA 3D1HA 1FFGB 1XEZA 3GR1A 1NH8A 2FGCA 2UUCF 3A3NB 1D09B 1RXOB 1JLEA 1R6VA 1X0PA 1Y00A 3DDIA 3V6KA 1N6QB 4CH0S 2HVIA 2DNQA 3THTA 2ZJQQ 1RU1A 1N54B 3M6VA 1VQLS 2GO9A 4CLZA 4KHMA 5J2MA 4QOTA 2ZH8A 5GAEU 4MK7A 3OVBA 4OZJA 1TUWA 3MF5A 4IKAA 5LXRA 5HROB 4UZBA 3PY8A 2ZC3A 4J9LA 2R3VA 3DN9A 3UDLA 1IBMF 4AT1B 4R5PA 3PV8A 4ZVQB 2MKKA 4CLFA 2E5LJ 1RUSA 2V2KA 2HAFA 2W24A 3CJSA 3BYPA 2RQCA 4A8KA 3QRRA 2QX0A 2V68A 1GTHA 1TFYA 1HFEL 4RW9B 1K0VA 1NB7A 1TAUA 1HR0F 3GV8B 4QWAA 2C2EA 1UMJA 2AWZA 3D9BA 5E3PA 5KFBA 4B9TA 4PG5A 1TKTA 2DGXA 5CH7B 1SXLA 3EUNA 2R8JA 4X4VA 4K4YA 4DR2F 2B4VA 4JI7J 3OFFA 2YNHA 3DLGB 1FRLA 3QPIA 5HVHA 1JLCA 3B8HA 2VF3A 3TJ8A 5JMNA 2V8PA 2MKIA 5SZTA 4LF8J 4KB7A 1D8YA 1C0TA 3GFXA 5K8MA 4DX6A 1L3SA 1V3ZA 3BDPA 4LMZA 1HNWJ 4ECVA 4WTYA 2AYGA 2B6AB 2HBQB 1DARA 4O4GA 4P9SA 5IXUA 1S0VA 2V2ZA 1JLBB 5KT7A 2HGMA 3J7ZT 3LANA 3TQEA 3RBXA 3TW0A 4GRSA 3VTIA 2MZRA 3PJWA 3TZYA 3G6VA 4F4WA 5C42B 1BQXA 4URGA 4JI3J 5KFQA 3G8SA 1FKPA 3JS9A 4V19J 4AL5A 1WOSA 4CO2A 2HHTA 1NH7A 2HRYA 2OFGX 2HVDA 4AUKA 1HQEA 1TFWA 4PWUA 2DNPA 4DCJB 5KFRA 2MQ8A 1IVZA 2MJNA 2QLWA 5ETKA 4L73A 2HWHA 3NMAA 2W2NP 2R8HA 4KJIA 4QU6A 2E5IA 2CPEA 1RU2A 2VFUA 2YKAA 2EWHA 4ZHRA 4IO9Q 4HYKA 4I6AA 3CTRA 4ZP9A 1HPZB 3RRKA 4YEAA 2B4OA 1LWCA 1NK6A 1BQNB 1X31C 2GMLA 2KVQE 2PC6A 2W9AA 3LP1A 1H72C 2M3DA 3D66A 3IS9A 3QAUA 5J2NB 1NK0A 3UVJB 4C8KA 5D78A 3NGKA 2RILA 1HARA 4WBFA 5K8OA 2QA4G 2VODA 4IRKA 1N5SA 2R4FA 3UD4P 1LXNA 1BQMA 2E7WA 2H5EA 2HNZB 1ZZFA 1ZPWX 3BGUA 4ZVHA 5K14B 2ZBRA 3DXBA 1WTBA 2AJFE 1VS3A 5CYQB 3WIVA 1UA0A 1TKTB 2W2QP 2XI2A 3AA9A 3OL8A 1H73A 3K5PA 4YR0A 1QAIA 4KGVB 1NDKA 2CQBA 1P9YA 1RDRA 4TY9A 4ZHRB 1YZ6A 1H2UX 3EM1A 3POTA 2KL8A 1PYTA 2XYGB 4KKOB 3Q22A 1U4BA 3MEEA 2BOAA 3DMJA 3LAKA 4YQWA 4HL9A 3R97A 2VG5B 4AYBD 2W7PA 3LA0A 4X62J 4GC7A 2CIMA 2FDNA 5I4MA 5DQIA 2DNOA 1MMDA 3EGNA 3MM5B 4JI5J 2WW8A 2ZHAA 4C3LA 4QWBA 3Q8SB 4LSLA 3ZO7A 3M05A 4EGLA 3UE2A 1OQ6A 2DEJA 5B0FA 2KXHA 2G9OA 4O23A 4P74A 1FK9B 2EFNA 2GIQA 1RAAB 3QGIA 4TLQA 1ZOTA 1NDLA 2XMJA 3I9V9 4IH7A 1H0HB 1HD0A 1F9HA 1X4FA 2X51A 4ZP8A 5LT5A 1NKBA 4JV1A 2GMJA 4PAAA 1Y7PA 2U2FA 5CAAA 2VA2A 4B9UA 2BRKA 4HT5A 2CA9A 4ES3A 2FVPA 2XYPB 3W61A 4LRAA 3Q8YA 3TX0A 2M7SA 3KOAA 1VQSA 3C3LA 1ZM9A 1S1UB 4LF4J 3HZEA 3SSRA 2M8HA 1MLAA 3GTYX 1KQSR 4UY8T 4QR0A 2XSFA 2YNGA 4J9MA 4LSNB 2V2QA 2DO0A 2L08A 2XMWA 2M88A 4NMXA 2Y8YA 2J9EA 3DRPB 2IA0A 4PQUA 4DV6F 2EVZA 2PT0A 5JXSA 1SH2A 3DDKA 1ZM4A 1TKZB 1HYSB 4ES1A 3ZNJ1 3V4MA 4TN2A 2W8KA 2FB0A 2X7IA 1ZA2B 2YTCA 1I51B 4GKKF 4FKXA 1F5CA 1TL3A 1VCTA 1TUVA 2N4CA 2VD3A 3KJNB 2FVCA 1HNVB 2IYIA 1WOPA 4RW8B 3MPVA 1W7WA 5LJ5Y 4IH6A 3TAQA 1TUGB 1YZ7A 2LQBA 4DQPA 3N4WA 2DHSA 2O1PA 4LFAF 3DLEB 2PEHA 2DNKA 3GB0A 4CRJA 4YHHJ 2WAQD 2RH3A 3AODA 3KHLA 2F9JA 3MM7A 3K59A 3MXHP 2FC9A 3ET6B 4KSEB 2K3IA 4BLGA 2XMUA 3CCMS 5I3UB 1LXJA 1KSPA 1RHUB 3OBIA 5C2GA 4ICLA 4URQU 2G0IA 2CUYA 4O0IA 4Q2LA 3DGPA 3L95X 3HHLB 4YY3J 4M5IA 5G4DA 3C16A 3HF5A 5HLFB 4C11B 2CDQA 3S1TA 2V4RA 2CPHA 3CGIA 3F56A 3OW2R 4MYUA 1HQUB 2GV1A 2HGLA 4MKYA 1J5EJ 1RAOA 4OIXA 4P2XA 2B7BB 2I5JA 5EWEA 2MDAA 3KKFA 3QIPB 4RW6B 1PILA 2BKNA 2DH8A 5DZ7A 4KT0C 1J5EF 1KVIA 4RZRA 1REVB 2Y0BB 2DR8A 5ETTA 4FXVA 1YITS 4DR4J 2RE1A 1MN9A 2BQUA 2W9BB 2YWHA 3N6NA 2AEFA 3MOJB 4E2FB 5A2QU 5K8PA 3QGPA 1Q82T 2V4JA 4KPCA 3RRGA 1RT4B 4C0OC 5BYSA 1U45A 2W4PA 1UVKA 1NBEB 1Q7LB 2ZE2A 3OTCA 1RT5A 1HLWA 1VHFA 2EPIA 2FJWA 3MMJA 4RUHA 1L5UA 4NA2A 3OFEA 2N82B 4X65F 1RT7A 3V6DB 4UQTA 1M90T 3UVJA 2XSJB 3D6MB 2D41A 4DPUA 1O0PA 4JP8A 1S48A 5JUMA 3J7Z5 4USJC 1ZYQA 4F4YA 4XK8C 3W9JA 3HX9A 1T3OA 1RTIA 2AX0A 3SI8A 3FSIA 1XR6A 3PEHA 4ED0A 1UVJA 3AAWB 2YWEA 2XS5A 1LWFA 4DBQA 1YLXA 3G86A 4ES2A 2HFZA 1NSQA 2NS1B 2QMXA 2ZH1A 1NPKA 2C1EB 3FEXB 3I32A 2WSEC 2ZKUA 2KT5A 2EKYA 2AYEA 1CJVA 1JLFB 2WONA 2X3DA 3AD7C 1B4SA 1ZA1B 2CPFA 2ZOGA 4DPYA 4DPWA 5KG5A 2C2MB 2DRDA 4XO0A 3QO9A 2BKOA 3D6FB 4CM2A 2XLIA 3VZIA 5HJYA 1HWUA 3EGWB 3V81B 2AIRB 3JTOA 4IOCQ 1FVQA 2H9ZA 3W2WB 2B56A 2ADBA 4DSIA 4IDKA 3PR4A 2DY9A 2LYVA 2QFJA 4M95A 4RJVA 3FC9A 5DJBA 2ZZNA 3MAAA 1DAXA 4OL8A 3UPFA 3RJMB 1LWFB 1KEKA 1HBNA 2C28A 4JI5F 2B3TB 4NCAA 1NJIT 2P6SA 2QLFB 3OJUA 3J7A1 3D0HE 5B0DA 3S01A 3PYEA 3DRSB 1S1UA 2WONB 4OHVA 2OPRA 4A47A 3NEKA 4B3OA 1CPZA 3EZ5A 4NRTA 4FXWA 4Q2MA 1GMWA 2E29A 2KH9A 2HHSA 1P27B 4UT4A 3MFIA 2VIHA 1U24A 3V4IB 1QE1A 3O5TB 4Y2AA 4D3GA 1VQ9S 1RZMA 1QD1A 4B9LA 2J7KA 1CC7A 2OTJS 1X4EA 2OGUA 3D67A 1BLUA 3HULA 2KM8B 1Y3JA 2RRNA 1O6XA 1UWBB 4ID5A 5FLXU 3CC2S 2R42A 4DLGA 2BEFA 3W9IA 2LU2A 3L4BC 1RAHB 3T5HA 4IOBA 2PFFB 1IJFB 4PQUB 3KWMA 4U7UD 2Z2MA 5AE1A 2ASYA 2HVEA 1BWVA 3CO0P 4FBUA 3KHRA 3DOLB 2WB1D 1R0AB 1VI7A 5LSRA 4O3RA 4HTIA 1EETB 3AOCA 5A0YB 3KUGA 5DG8A 2J6SA 3BN4A 1ZAWA 1H2TZ 2BE2A 5A8RB 3K5MA 3WC2A 1RBAA 4LF8F 4C8YA 2HWTA 3H4DA 4CP5A 1PJ6A 3KLIB 1ZAVA 3BPSP 3CSKA 1LEOA 3KNAA 3HFVA 1SJQA 1U6FA 2CJQA 5LSLA 1GK8A 2FZKB 3C16B 2VFVA 5HLFA 4ZPWR 5I42B 5L1KA 4DL5A 2XULA 2GNKA 3CJ0A 4P71A 4DG1B 5HQLA 2VDIA 1SJ3P 2IRYA 1S0OA 1LV5A 4IR1A 1HQUA 3TVZA 2A3JA 4O3OA 2CKWA 5I3UA 5D15A 3DOMA 2CQ2A 2DNRA 3DU5A 4M8LA 5C7PA 4U9RA 3V5RA 4JOUA 3QFHA 3K5NA 3VAFA 5LSOA 2UUWA 4WF9Q 3HHLA 3PW0A 2WSFC 3PW2A 2VPYB 3VCDA 3HKZD 1YIJS 2A6OA 2HFUA 1MMNA 3H4BA 5RUBA 1N48A 3MCNA 1BXNA 2NZCA 3KK3B 4XAKA 4FYVB 3RR8A 1HNVA 2VU5A 4I67A 1W2IA 1D9FA 4G1IA 4IQXA 3B6BA 4G1PA 3VF0B 1CC8A 1TL7B 2KM8C 3PX4A 3T5JA 2FLOA 3R2DJ 1RT2B 3DLHA 4V19X 4Z7YA 4MYTA 1SB6A 3DCAA 5KFDA 1N56A 1X5SA 2RKIA 1S76D 1CSJA 3OTDA 2EFVA 3I4HX 4K4WA 1E6VB 5J1EA 4JI7F 3RZAA 4FXDA 1DQ9A 3HO1A 3QGHA 3TYTA 3RGIA 4AFFA 1JJ4A 5D4NA 1HWLA 1RTZA 4NLUA 4K50A 4RW4B 4IFVA 1DTTB 4B3MJ 3PO5A 1AUSL 4OFZA 5DG9A 5JVHQ 4H4MB 4PYAA 2XY7A 4K4XA 3LW5C 2OUGA 5SUHA 1IBKJ 1URRA 4KGMA 2D7SA 1S1WA 4C98A 4DQSA 1U48A 2E5LF 2XI3A 2BJDA 3DXSX 2CPJA 4MAKA 4I7FB 4LT6A 1FI4A 4QW9A 2IMWP 4KPYA 1Y5IB 2AX1A 3H25A 2NUUG 3I96A 4X84A 2Y1RI 1EZZB 2BJ3A 2C3OA 4U7UK 3NS6A 5KG4A 2ILZA 1W2BR 4ETXA 4BHQA 1S6QA 2ACMA 1UP1A 1FXDA 1HI8A 1SPBP 4RUAA 2LECA 3W7BA 2OTLS 1NM2A 3BDEA 2PGCA 1JJ2R 1XMQJ 3DKDA 4NI2B 2KI2A 2HHHJ
chains in the Genus database with same CATH topology
2Q43A 4Q8FA 2KZZA 3CCJS 2OPSB 3OR1B 3R27A 4CTAB 3MCSA 4ZLPA 1WACA 2BV3A 3Q23A 4WFYA 1MSWD 3GFZA 4RW7A 3AY0A 3GYXB 4GMKA 5F8NA 3D1QA 4Q5VA 1HWJA 4WCEQ 3FCHA 1GAOA 1PSDA 2D3OR 4JI3F 3IR5B 1LFWA 3CMAS 3TARA 3UNGC 5A8KA 3CCLS 5EX3A 1WHVA 2FC8A 4M5DA 1FDAA 2YWGA 2R7VA 4BWJA 1QJHA 3GSDA 2QYCA 2NSCA 3ENQA 1VQ5S 2ERRA 3MFHA 5FD1A 1PGZA 5EHHA 2VG6B 5JJBA 3ZZUA 4ATNA 4LUBA 4N76A 1FRJA 2RMLA 2C3PA 2RT3A 3THPA 4GKJF 4J9PA 4J9QA 2JEFA 5LL6d 2KG0A 2JEIA 2CQGA 2W4DA 1SKRA 3TUZC 1I6JA 2W8LA 1N33F 2M8DB 4RX6A 1YBAA 4NCBA 1U1QA 3VAIA 4H4KA 2BOPA 1ZPVA 4ED5A 4WZMA 5GAHU 3TQ1A 5C42A 1KQGB 4TLRA 4HEA9 4MH8A 5C24A 4ECQA 2VOOA 1Y5LB 3JSYA 4FPRA 2RRAA 4DX8H 2OAUA 2R8KA 4I2PB 5DDOC 1MNEA 2D9PA 2JHEA 3CJKB 3TUJC 4DJBA 1RYRA 4LIWA 3AJ2A 3MEDB 1SQEA 4RWXA 1LQ9A 4Y2CA 2FJXA 5IM0B 4FP9A 1DLOA 2KYXA 4Y28C 4CH1A 4WU3A 1XR7A 2CQ1A 3R1LA 4RNMA 2B4UA 1WEZA 3TUIC 2B6AA 1N5TA 5E2QA 4HDGA 2FUG9 2AU0A 4OV1A 3MMCB 3LP1B 2A10A 5KG0A 2VFRA 3UR0A 2ZUGA 2EC0A 4NLXA 3CJKA 1LOUA 5A8KB 1QTMA 3QO9B 4OHXA 1R8CA 5A0YA 3DI6A 4DF8A 2CJKA 5K8NA 4CO3A 3EGZA 2VBZA 4LSLB 3JSRA 5A6WA 5AE3A 2YVSA 3IAM9 1UA1A 4MTPA 2K3KA 3BSCA 3EXYA 3BGRA 2HYIB 1U1OA 1VQKS 4LFCF 4P2SA 4PPZA 2DNZA 2L9DA 2KRRA 2M9KA 1NJZA 3T5KA 3TAMB 2M70A 3CDAA 3ULHA 4I6WA 1NAQA 4NZ6A 2AYMA 1R8AA 2ZD1B 5L9NA 1NJXA 5U47A 4PG6A 3MD3A 1U7LA 2DBBA 3MMAB 1GX5A 3TX8A 5KFPA 3M8QB 3BGFA 4XIUA 3I9ZA 2RQKA 1KOOA 1OS5A 3LOUA 2NLWA 3OHBA 2DD8S 3W2WA 3LALA 2O3DA 4DR7F 3I0SB 4KR0B 1RJJA 2MKSA 3O8WA 2WHOA 4OI2A 1KNZA 2OP5A 2OPPA 1UJ6A 1QM9A 1OQ3A 2DGVA 2QEXS 1FRXA 1F5BA 2DGUA 3UR3C 3N9UC 2LA4A 4YR3A 4FS2A 4QIVA 1TK5A 1FKPB 2NSBA 4JI8F 3NBPB 4F3OA 5AXMA 5HBMA 2R2RA 4ZPBA 1L3KA 1JIHA 4OQJA 1VK8A 2VPZB 5E3RA 4RW8A 1SIZA 2R7WA 1VC0A 5B08A 5G0RA 2PDAA 4PG4A 1UETA 4B3OB 3OFGA 1T95A 4G6VB 5IT0A 3PNIA 2DGTA 2MJUA 2FGOA 2GCFA 3RTVA 1WI8A 1OIAA 1N52B 2RJZA 1QE1B 3TAPA 1DTQB 3ZZYA 4B3MF 3KLGB 4DSJA 1SL2A 4PWDB 1JWWA 1GXUA 2OIHA 4X66F 1C1BA 3MPYA 3P96A 1FXLA 2NZ4A 2Q1LA 5KOXA 3MUMP 1C0UA 4RU9A 2JVOA 2VG7B 3JTNA 3MEGA 2FHMA 4DHVA 1JLCB 1VBYA 4ETZA 1S1VB 2CQDA 3NP5A 3RW6A 2Z2LA 1RI7A 2VFSA 1P8GA 1L3VA 3GILA 3G6XA 1P1TA 4NLQA 1YSJA 1E6VA 1WEYA 4NLOA 5KFGA 3TVKA 2DR7A 2UV8G 2DRBA 4X62F 3IRWP 5DGBA 2XMKA 2KXFA 5T7LB 1Q7YT 2ZNYA 2EFGA 3UQSA 3CF5Q 2MQMA 3O2IA 1HWKA 2FTRA 2IAJA 2VZ9A 4ID8A 3CCQS 1TVRB 4QW8A 2VH7A 1U6BA 1ZBTA 1YJNS 4Y3CA 1B64A 2LA6A 2E66A 1U09A 3E51A 3FMWA 4QQBA 2XSJA 1KLNA 4J37A 1S1TA 2CPIA 4YR2A 2ZH9A 2LQJA 4QPXA 3HJFA 2EFPA 2E5JA 2CPXA 4MK8A 4NYOA 3CUNA 4GO5X 5EN1A 1KVJA 5B0EA 4M94A 3BO2A 1BQMB 2HNZA 3CD5A 3G6YA 3CCVS 3F44A 1T05A 4X4NA 2OMLA 4Q0BA 4X4SA 3L7OA 1TL1A 3LO3A 4ZCLA 3WC0A 4A8SA 1S72S 2FHOB 3DI6B 3OVBA 2KN4A 2I38A 4B08A 5DLGA 4YB1P 3D1OA 3R5AA 3D0GE 3THVA 1D9DA 4ZDNA 4LF9F 2CQHA 3MUTP 3H2UB 4X4RA 5E5NA 4DSLA 4NLPA 4RBUA 4HH0A 3K5OA 1JXEA 1J2VA 1HI0P 1C1CA 4ZKAA 5THWA 2SXLA 2XG8A 1JNZB 3AA8A 5IS2A 4F50A 1VBXA 2OO4A 3Q8RB 3AB4B 3KFWX 1IKWB 3N5BA 5KFWA 2PSZA 3MM9A 2XCAA 2UVRA 3TAMA 4ICLB 1G2EA 4LF4F 2BZ2A 1XNRF 1UVLA 2DR5A 2OPSA 3OR1A 1QAYA 2OPRB 1QSLA 3MM7B 5E0OA 2QA1A 1L3TA 2ATLA 1OSDA 2XHWA 1G6BA 2JLFA 1JXLA 4DSKA 1LWEB 5KG2A 4DFMA 2B5JB 2YKOA 3I87A 4W92B 3HVWA 3SCIE 3OTOF 4P6QA 3I0RB 1FD2A 3R3TA 4FVCA 4EU0A 1LK7A 3IGVA 3K0JA 2IJFA 1GT8A 2V4JB 2RQ4A 3ZZ0A 2XC9A 1CVJA 2R7TA 2DISA 3CCUS 1V3SA 1R0AA 2ZDOA 4C97A 4EBDA 1WD6A 3NL0A 4C3KA 3CJ5A 3UFCX 3N5FA 3BJYA 2K1RA 2DT9A 4DFKA 4LF7F 3PKMA 5DGAA 2OJ3A 3PX0A 1TR0A 4WFXA 4U7CA 2J5AA 3U1LA 2BRLA 2C3MA 1R31A 4FF2A 1RTDA 1QSSA 3PW7A 2XS7A 2HS3A 2M5YA 3M6XA 5DS7A 5AJ3F 3DLEA 2MQOA 5ITHA 2G1DA 2DIVA 3DDNA 4OX6A 1NK7A 1S1XA 2ZH4A 3DLJA 2WBMA 1NRKA 3GG0A 2GW8A 1MU2B 2MQNA 2E5HA 3CO9A 4O44A 5L1JA 2C2RA 2V8HA 1IQTA 2BUNA 4RWWA 1YGYA 2ZH7A 2I5JB 2P9GA 3KG1A 5M2PA 2UVUA 3B4DA 3MWBA 1DHMA 3MMCA 2O66A 2FLLA 2I0XA 1XWLA 2HNDB 2YKPA 4OLPA 2C22A 1KN6A 3FFIA 2KVIA 2HHXA 3UCUP 2PI5A 4MIWA 2CJBA 5HP1A 4IRCA 3V4IA 4CO1A 3N0VA 4LQ3A 5CZVA 3IXQA 3NCRA 5M2RA 5KFHA 4ZCKA 1AW0A 4ECTA 4OHZA 2K7JA 2RDIA 1JKHA 3SFUA 3AQOA 3Q0AA 3RAMA 2I1RA 3VAKA 1UVIA 2IC3A 1TL5A 2PIIA 1HBMA 3MZIA 3HK2A 3M4XA 2DRAA 2B51A 5KFCA 1FE4A 3BR9A 3NG8A 3ZC4A 2GHPA 4ZPTR 2VASA 3QLHA 3M8RA 2R8IA 1J5OB 1EETA 2F1FA 2EW9A 4WFBQ 2OD4A 4O3QA 4LSNA 2FVRA 2LXFA 2GFFA 4DN0A 2CJAA 4I69A 3NNAA 1K1QA 4K5SA 5H1SV 1S99A 3MR6A 2Z0GA 3HLUA 4OI4A 2JJ4D 2XLJA 4JV0A 1LW0A 1YJVA 4Y2KA 3UCGA 4EFAC 3MUVP 4NXMF 3BF4A 4EZ6A 2ZH6A 5IZHA 2DGOA 4TU8A 3SQGA 2R2TA 5KAKA 3NWGA 1HMVA 4DR3F 1X5PA 5C5JA 1FK9A 4LIRA 4EO6A 2DPIA 2Z4PA 5GADI 3DRSA 5F8GA 2JL9A 3VZHA 2AGQA 3PEJA 1CG2A 2Z8QA 1XMBA 4N8OA 1FXRA 1RTHA 4Y65A 1C1CB 2L9NA 2K1RB 1N5QA 1NK4A 4I4BA 1HBUA 4FZVA 4NCGA 4X4PA 1G7CB 2G13A 1RP5A 4G1QA 4TY8B 5HROA 1KFDA 3BN7A 4ED3A 1N6QA 2HLTA 3MMBB 2C2DA 2NQPA 3DOKA 5DO2A 2BVZA 3OTBA 3PW4A 4LQ9A 1TAQA 1RISA 2DNLA 3U1NA 1VQ4S 5AE2A 2MSTA 3PXGa 4PQAA 1IKXA 1RT1B 2ZC4A 2RD5C 5C25B 3CEDA 4IYQA 3P3DA 5KFKA 2MYFA 1QVFR 4Y00A 3I0RA 3HHEA 3OUYB 3GIKA 4B02A 4WU2A 4QWEA 3RR7A 3KLFA 5CD4H 2DNYA 3PRDA 4IUFA 3CB4A 4NXNF 5CA5A 1JB0C 3GE9A 1S6UA 2MZ1A 4Z37A 4ZPDA 3BR8A 4GO7X 3KG4A 4OJHA 1X5TA 2PMZD 4JI6F 5DQHA 3H5SA 4WFNQ 3K58A 3CCSS 4DQQA 2GQ2A 3JYTB 1V3RA 3H8YA 1S10A 3MM6B 2HNDA 3I5CA 4WFZA 2F8EX 3CC4S 4JYAF 1XMOF 1IKXB 4ZPVR 1JLQB 3OLAA 4WKRA 1JJHA 2W9BA 5DDPC 4DL6A 3M8PA 4J9RA 1ZETA 1DBDA 4OJ1A 1IUJA 1HNIB 2EFOA 2E5GA 1YJRA 3P49B 3MDFA 2DNNA 3LPYA 2Q3PA 3RB4A 2VG6A 2HIQA 1YJWS 3MM8B 2FLNA 2ASJA 5FDLA 1FNXH 4OJ3A 4IRDA 3CXCR 4A8QA 4F4XA 3GG1A 1Q16B 4Y6IA 1S1XB 1RT4A 4QIGA 2COLA 1Q8BA 3O3LA 4K4UA 1P9QC 2I2YA 2DO4A 4RW9A 1MU2A 4OX7A 5GAEI 3EYZA 2UUBF 1R43A 5A8WB 1U25A 4WJBA 3LGMA 2IC3B 4CNZA 4OZ1A 4WKYA 2FHKA 3DFEA 3HFKA 4LVOP 2CJ9A 4K4TA 1AXQA 3SEOA 2FVSA 4A8MP 2YNFB 1RT2A 3BSAA 3L7PA 5M2UA 3T1HF 3U1MA 2CFXA 4QIWD 1VIOA 2QSWA 2JRSA 2A18A 3EXCX 4PG8A 4YDDB 6FDRA 3JSMB 2UVVA 1D8ZA 3M1VB 3CDEA 1JK9B 2KO1A 3MEEB 1Q4RA 5HP1B 1S0NA 2M0GB 3TVYA 2HZCA 2E1CA 2LQ5A 2CRLA 2OH2A 4PQUB 5F0UA 2W7OA 2BACA 4NLTA 2DTJA 2MY8A 4AE5A 2YH0A 7FD1A 4ED7A 4DSEA 1UAWA 4ITSA 3CIZA 5BJRA 4DV7F 3OXGA 2DNMA 1IKYB 1IKVA 4IFYA 1SJ1A 4QPTA 3X1LB 1DFDA 1JLQA 4C8LA 1JNRB 4X4QA 5EUHA 5KFFA 1Y4ZB 5K9FA 2L41A 2AF6A 3W3SA 4H4KC 2HWIA 4J9SA 5J1NA 3E01B 4I2QA 2J9DA 2V9WA 3TRGA 1Z2LA 3MR3A 2V8DA 4UOCA 2EG1A 3LP0A 1FKOA 4DV0F 2RU3A 3NRBA 3CC7S 4F2SA 4OI3A 3I31A 4JI1F 4L6V3 1YQHA 3T19A 4CT9A 1S6PB 5IWAF 3G71S 2KT2A 4PKDB 2PE8A 2YWFA 3HP6A 2BDPA 3Q8PB 1I1GA 1XNQF 1JLBA 2MB0B 3VAHA 2GHWA 3SCLE 3OUYA 4JI4F 2VFTA 1T03B 3GZ7A 1AFJA 1WG1A 1M5PC 3N01A 4KO0B 3VR1A 5KT4A 1VC6A 2CZVC 3AHPA 5KFOA 3DLHA 1R27B 1IQZA 3MHYA 4DG1A 3I5BA 2FD2A 4ELTA 1O5JA 5IT9Y 2LXIA 2WRMA 3TA0A 5IM0A 1HPZA 1Q53A 4M5DB 3IAS9 4N5SA 1WHYA 3WZ0A 3FZ2A 1Y0HA 4KV8A 3O1LA 3IWLA 3DRRB 1FVSA 1GNKA 2DCLA 3BB5A 5CQGA 5J2PA 4KFBB 1VJWA 1AFIA 3O44A 4RW6A 1XBWA 3CCZA 4KO0A 4B9VA 1M5OC 1S77D 4EBCA 2LVWA 2YKNB 2QA4S 3QAEA 4PR6A 3M8SA 2XY6A 5D77A 1F60B 1NZAA 1NJYA 3PO4A 4QWCA 2JVRA 3OTEA 5A6PA 2VBWA 2UXBF 1RT1A 4A46A 3NGDA 1JLEB 2JDJA 5D4OA 3G96A 3E2EA 2EK6A 3ZZOA 2X3GA 4HT7A 4O4GB 5KFXA 3LWMA 4H4OB 1RKJA 5HQ8A 5D8HB 4I7FA 1X0FA 2PI4A 2PN6A 1UL3A 4F3MA 3RAXA 2NUHA 3KLGA 4BDPA 4FS1A 2Q66A 2P6TA 2LLZA 1F2GA 2XY5A 2DCUB 1X9MA 5CYJA 1TK8A 5GAHI 1WWHA 1C0UB 3IO1A 4CO5A 5LMUF 2J0QD 1F0XA 4YMEA 3CE8A 2NPIA 3MM8A 4ECYA 1KFSA 3UCZP 2ZOFA 1GXTA 1UKUA 4WE1A 4A8XA 3V6HA 3DRXA 1VQPS 4H4OA 1FDBA 3H59A 2BQRA 2W7AA 2IJNA 3CDBA 1HHTP 5F0WA 3I82A 1OWXA 1JX4A 4CO0A 3V6JA 1SUQA 2DHXA 5KFVA 1KR4A 5KFNA 1ULRA 2ROGA 1S9EA 3M30A 4NLWA 1VC5A 2XS2A 5C25A 2KZMA 4OI6A 2PD1A 5DQGA 3C46A 5CYMA 1VRTA 4NLYA 4DL0C 3OVSA 4OHYA 3T9ZA 2OSQA 2LMIA 3IFEA 1U1NA 4IG0B 5F9NA 2BABA 1SIWB 1U2RA 4GC6A 4OI0A 1FJCA 3DM2B 1FTCA 3I5AA 4IO1A 3NCPA 2DPJA 5GADU 3M8QA 4NL5A 2MY7A 1D1UA 4TY8A 3MPWA 2HVZA 5CZXA 3KLIA 3M9NB 3HKWA 4C8MA 2PA8D 2QZ8A 3BGLA 1D3WA 4FN5A 1SH0A 2JEJA 4DFPA 2Y1JA 4FBTA 3I0SA 4USIA 4WXOA 3G8TA 5A2QY 2BYCA 2APOA 3D54A 5HI7A 3C6UB 1IR0A 4C2MA 4CNYA 2XBPA 3LUYA 2ZH3A 2HVHA 4EBEA 1UWBA 3L09A 2CZ4A 1Z1ZA