4B3MF

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3mF00
4JI5F 4LF8F 1HNXF 1B64A 4LF9F 4DR4F 1IJEB 4DR1F 2UXDF 1F60B 1N36F 1J5EF 2ZM6F 4JI8F 4GKJF 2UU9F 4NXNF 2HHHF 1XNRF 4DR5F 4JI7F 4DV0F 1I94F 5BR8F 1HNZF 4X65F 1IBLF 4JI3F 4DV5F 4AQYF 1HR0F 1LOUA 4DV6F 2E5LF 1CQNA 4JI2F 4JI1F 4YHHF 4DR2F 5LMUF 4KHPF 2KJVA 2VQFF 4X62F 1FJGF 4DUZF 4DV4F 4JI0F 4DR6F 1IJFB 2BXJA 4YY3F 2KJWA 4DR7F 3T1YF 4JI6F 4DV2F 1N34F 4DV7F 4NXMF 4JV5F 2UXCF 2F4VF 4B3SF 1N32F 4LFCF 2YY3A 4JYAF 4DUYF 1XNQF 1GH8A 2VQEF 1IBKF 4LF5F 2RJZA 3OTOF 2UUCF 4OX9F 1HNWF 1RISA 4GKKF 5LMNF 4DR3F 5AJ3F 1G7CB 1N33F 1CQMA 3ZZPA 2B7CB 4B3MF 1IBMF 2BVZA 4LF6F 4DV3F 4B3RF 1XMOF 4X66F 3T1HF 4B3TF 2UUBF 4DV1F 1QJHA 4LFBF 2J5AA 2B7BB 4LFAF 4LF4F 4X64F 2UXBF 1VMBA 3R3TA 4LF7F 4K0KF 5IWAF 1XMQF 1FKAF 1G1XA 4JI4F 2UUAF
chains in the Genus database with same CATH superfamily
5F3TA 4F7VA 2RS2A 3P4UB 1M5SA 1VQ8S 1RT7B 3MZIA 3FBEA 2AEMA 4ES2A 3LAKA 4A8SA 3KHLA 4K4TA 2OEKA 1T3OA 3CGIA 3DN9A 3W65A 4X4TA 4PUOA 4LIWA 2H51B 5IT9Y 3SDEB 3C2PA 5C24B 4YN3B 3W2WB 3MOJB 2J7WA 2ALYB 1TL7A 3GP9A 4WFXA 2ZH1A 1Y10A 3FVYA 1RHQB 3E3XA 5DJBA 2XLJA 4TVAB 4K4UA 3UNYA 1IKXB 2ZUGA 3D1QA 1N36J 1J5EJ 1ZPVA 1ICEB 3C6UB 1C0TB 3T1HF 5I3UA 1OPZA 2HZAA 1XNRJ 3D67A 5IT0A 4LREA 3DOKB 4J9NA 2AYMA 3BYRA 4OI6A 2BA9A 3NS5A 4NI2B 5C42B 1UJ6A 1IKYB 2DGOA 3A8KA 4EBCA 4ZHRA 3T5KA 4YB5A 1F2HA 2IDLA 2CUYA 4GKJF 2WSEC 1IBLJ 4J9MA 4KBIA 2X1FA 2KG0A 3CJKB 2H4WB 2DGTA 1X8DA 2H1YA 5D0GA 1RCXB 1WKLA 3TEGA 4DI6A 3CEDA 1Q53A 2NLWA 3MHYA 2DGQA 3UDVA 4QWBA 4LF2A 2HVIA 1HBNA 4ELVA 2IAJB 5HLFB 5A6PA 5FD1A 2EXUA 3D68A 3TVZA 4J9QA 4RBVA 3OUYB 2BJEA 1R8BA 4G1QA 1NXIA 3PXGa 5CA5A 2RDJA 5HP1B 1H38A 4G3IA 3Q23A 2DYAA 5DQIA 4RNFA 3ZXWA 5DG8A 4X4RA 4DSFA 3FNNA 3KNAA 2DH8A 3AXKA 1PYSB 2K8GA 2PA8D 4NRUA 2AU0A 1R0AA 1N36F 1J5EF 4P72A 3IM8A 3G8TA 2G0IA 4P2SA 4Y34A 4DL2A 1XNRF 3LUYA 1KNZA 5KFOA 3H20A 4L74A 2XMVA 5E33A 4AD6A 1VQOS 5E3RA 2W7OA 3ISND 1O5JA 1JLGB 2PGCA 3GQCA 3MMBA 4B9TA 4XAKA 2BOAA 3QSIA 3C16A 1VC6A 3MR3A 3BV8A 4DSKA 1KQGB 2J9DA 4FXDA 3CCSS 3P96A 2QL5B 1BQMB 1WC5A 1U45A 3C66A 2MKYA 1JX4A 4ELTA 2BVZA 3M6VA 4ZPDA 3SCKE 2HQIA 3FZ2A 4PRFA 3V4MA 4NPOA 2MXYA 4RJVA 1DFDA 1C4AA 4FN5A 3D0IE 2ZH3A 3W1YC 5MLCV 1K1QA 1TP7A 5GAEU 3TA0A 2RT3A 1HWUA 4MJKA 3J7YI 3OT9A 4B9UA 2IA0A 1G2EA 4I69A 2OPQB 3K5PA 2VBWA 1NJXA 5CHCB 1F2GA 1GAOA 4F67A 2OPRA 1NSKL 1Q86T 2GHPA 1ZAXA 1LWFA 2J8SA 2OMOA 2BANA 3DOMA 4NLGA 1TKXA 4F4WA 1NKBA 1WC1A 4MK9A 5IT4A 3D3BJ 4A48A 1F9FA 3A13A 3JSMA 2OKQA 5AXMA 4X64J 4NLYA 4Z2XA 2MEWA 2OPSA 1Z1ZA 1X5TA 3FFIB 5I3QA 1BC6A 1U0HB 1E6YA 4UOGA 3RRGA 1S5ZA 3FQKA 1K0TA 1X4EA 4EYHB 1JLCA 1K1SA 5BYRA 2HQDA 2FHJD 5A2QY 1T0TV 5LM7E 1Q82T 1AROP 4HACB 5A8WB 4Y00A 2MQQA 3PYEA 1QY7A 3PW5A 5CXTA 4JI1J 2HBQB 4W92B 4L73A 5I3PA 4HEA9 4QOTA 4F0HA 4I7FA 2EPIA 4DR6J 3BSOA 1AZSA 4WE1B 1BWVA 1SJ1A 1WACA 3IWLA 1L3SA 4OYBA 2XGPA 3QIPA 4IH6A 2GAGC 4PWDA 2AWZA 4QYZJ 3CNQP 3GYNA 2D3OR 3N4WA 3ILLA 4ZJOA 2PO4A 4RW7B 4M5LA 1A0OB 2RQMA 5B7WA 1OY8A 2B6AB 1TL5A 1FJ7A 1YJVA 3D9BA 1M1KT 3X1LB 3OLAA 2ZOMA 4PG7A 1MWYA 3WX4A 2DIUA 2HK2A 4PR6A 3JQJA 4MAKA 4X64F 4OI1A 3IA0A 1EZZB 3TUIC 5D4OA 1QAIA 3N79A 1AB8A 1G3OA 4A8QA 1QUPA 4P74A 2E1CA 2E9TA 3R2DJ 4TY8A 2RMLA 4DSJA 4B3SJ 1T9YA 4TQRA 3ZNUA 2ZE2A 3DRSA 4JI1F 2HW3A 3CCTA 2HFOA 1O8BA 1KKHA 1WSVA 3AB4B 3CC4S 1S4FA 4IDKB 1VHFA 4DR6F 2DXEA 4YY3J 3BPDA 3AD8C 4CLSA 1UEKA 4ICLB 4LRDA 3I0SB 3GILA 4DSIA 5LSRA 4NYPA 4NASA 3CJ2A 2JSXA 3B82A 4KC5A 4ALZA 4ECTA 1U1LA 1R8PA 2P6SA 3RBZA 3CJRA 2RVJA 2KZMA 7FD1A 3BEGB 2IMWP 3K0JA 4ZPVR 2XZTB 1B0PA 1T02A 1UPMB 4PAAA 5H1SV 3FGVA 4AL7A 3J80U 3SFUA 4U7UK 2V5HG 2RE1A 3HKZD 4OI3A 1YZ6A 1QE1B 2W24A 4DLEA 1C1CB 3N6MA 2JRSA 3IR6B 4X84A 3GU0A 4X4UA 4HHUA 2HHPA 4AUKA 1LW0B 3EMTA 1FNMA 2CNOB 3B4DA 3SSRA 3PVXA 5DLGA 3SZ2A 1LFWA 1T05B 4HH0A 1OO0B 5F8GA 3OVSA 4DQPA 2VF3A 5KFHA 4I56A 2Y0SD 3TA2A 2XNRA 4G65A 2ZNYA 4B3SF 1HYSB 2RF2B 2YNGB 3CJ4A 4ZN3A 2V6AA 4MIWA 4K8RA 4RL1A 3E01A 3HHKA 2AW0A 3EUNA 3VV2B 3QGIA 2CWKA 1V5IB 2OLWA 3PEHA 4Y0FA 3BO2A 4WIQA 4I2QB 4IOBA 4ID8A 4K50A 4E98A 4L6V3 3ZZPA 4LF6J 3A8EA 1HI8A 1NK9A 3KKFA 1R0BG 1RT6B 2DR5A 3OR2A 3I5AA 3NLCA 3J7AN 2K7JA 2BV3A 1RBLA 3UW1A 2KG1A 2VJUA 3OL7A 1F5BA 3M32B 3WDOA 3RR8A 4C8KA 3BPSP 4DF8A 3RU0A 1U09A 1I51B 3QSYB 2XI2A 1RAEB 5C2CA 3HHLD 3SCLE 2X1AA 1UA0A 3AA8A 4BLGA 2LXUA 5D4LA 3CIMA 3ZTRA 3QAEA 4CH1A 3BB5A 4QWAA 4KO0B 1REGX 2OD6A 1NH8A 2ZOFA 5JUMA 2E5IA 4BHQA 2GZOA 1XMOJ 3V81B 4X4QA 1T9VA 3HFZB 5CYQB 2AV5A 3MOZA 2KXNB 1YQHA 2B8QA 4OV6A 2ACMA 2N3LA 3G9CA 4DJBA 4F4XA 2APOA 2C3MA 1CQMA 2AJ2A 2VG6A 4IYQA 4W98A 3NWRA 4LBHA 3UDLA 3DRXA 3GMGA 4DV0J 4C8YA 2J9CA 5KG0A 3MURP 5IC6B 1N56A 1B4SA 1KN6A 4KE5A 1FE4A 2W2NP 3DMJA 5SZTA 1Y0HA 4P75A 5LL6d 2CPZA 4LRBA 3QFWA 1PC5A 1ITPA 2D3O1 2Q66A 1Q5YA 2UXCJ 1HLWA 3K5MA 1IQTA 2GW8A 4R5PA 3H4DA 3T3FA 5BXIA 3J80Y 2VG5A 4C6AA 1SKWA 5E7OB 1BQNA 2ZJPQ 2CDRB 1WELA 5AJ3J 4IRDA 2XS2A 2CZVC 2KDOA 2OTJS 1FDAA 4RNNA 2BQ3A 4B3MJ 2V2ZA 5KFTA 4Y6IA 1T9UA 2CQ4A 5D78A 3PRDA 3HSDA 3DRRA 5DLFA 4OQJA 3I32A 1KHWA 1F1BB 3HT0A 4KHRA 4A4JA 3M6XA 4IG0B 1RK8A 1XMOF 2QV6A 2OPPB 4HYKA 3VVUA 2F9JA 1S97A 1NH7A 4IFYA 4CLZA 5ETOA 2L08A 4EYIB 1VQ4S 2W01A 4ANDA 5KFVA 3H5YA 1UA1A 1WI8A 4IOAQ 1YJWS 4NLPA 4F3MA 1KTVA 4WBFA 3ILJA 5KFUA 4DV0F 3N5FA 1N34J 4NWBA 1U26A 2ZZMA 2MGZA 5LT5A 3GFXA 4FF2A 5IS2A 2C2MB 3PDNA 2DKOB 4ED1A 1T9TA 2GX8A 4J9PA 5F41A 5L38A 2HIQA 5HMXA 1H6KX 4FS1A 3R7SB 2C28A 1RAAB 2HFNA 4AXJA 2UXCF 2W25A 3OL8A 1XK8A 1HPZA 4PXEA 5A8KB 4WZMA 3RYLA 4MKBA 4NX9A 3Q83A 2F3JA 4HHJA 5GAEI 3TI0A 2RUGA 2E7VA 4ERDA 4FYDA 3T19A 2DGWA 2W2OP 4X4NA 2B51A 2DNZA 5AJ3F 3R5CA 3A3NB 2R8IA 3KTQA 3HM9A 4B3MF 5I42A 1EJ7L 1UW4A 4D3HA 1M0SA 2C2RA 3PIOQ 1I94J 3AJ2A 3OSNA 1JJ2R 3RBEA 1M5VC 2GJFA 2LMIA 3PO5A 2VFUA 4URGA 3J7Z5 2VH7A 1A6LA 1JIHA 2UV8G 3THTA 1S49A 2AZ1A 1APSA 4DX7A 4ZP6A 1NJIT 2VASA 1GXTA 3CCMS 5KFSA 1NK0A 2WK4A 4DR3J 2MSSA 2VPZB 1N34F 1IKWB 4RWWA 4MK8A 4O3PA 3TZXA 1TU0B 5K8OA 2HAIA 2RRBA 3I9V9 3TARA 2FTRA 2PFFB 1RT5A 4AL6A 1F9EB 4ZS6A 1UVNA 3MEEA 1LW2A 1QTNB 2JVRA 4CYUB 1FERA 2YWEA 4RUHA 2CVEA 1MMDA 2RRAA 2OTLS 3M8QA 4PCQA 1NDPA 1NJWA 1C4CA 4PXBA 2XY6A 2FJDB 3M30B 4YP3A 5KFEA 1LEOA 1BLUA 4L3NA 3GIMA 2R7SA 3ZNJ1 1U1RA 1I94F 3RRKA 4NXMJ 3C6TB 3S1TA 4HKQA 3DDIA 1V5VA 3FEXB 1NMEB 1SH3A 1PAEX 5BJRA 4FNIA 1R6VA 5F8MA 2XYPB 1RT1A 3CF5Q 3PYDA 5A0YB 2QLXA 2CJ9A 4WZQA 2RQ4A 3HFVA 5E0OA 2NSBA 2WZ1A 4B3RJ 3BBBA 3C8YA 2WCXA 4M8LA 1QLNA 1JLQA 1ULRA 4OFZA 2CQIA 4LR8A 5IV3A 1HD1A 3Q8PB 2JL9A 3K57A 5KOWA 4DR3F 4ED5A 2ZKTA 2JX2A 2B7CB 3I5BA 3N0VA 3GIJA 2H3EB 5KT5A 1GX5A 4LMZA 3DLEB 2VJVA 2QT7A 2J9EA 2NUHA 2DY9A 1URRA 3H90A 1DTTA 2CJBA 3ZC4A 4F25A 3P5TL 1MG7A 2EFVA 4J9OA 3PV8A 1SJFA 1RHMB 5J2NA 4DU8A 2XMKA 1UWBA 5A6WA 4NOHA 2N3OA 1PYOB 3FC9A 3IRXB 2HFSA 1GTHA 2J0WA 2YXLA 4X4VA 3OHBA 3CMES 1RA6A 1RWPB 3U1NA 4JV2A 3HHLB 5KFFA 3FCVA 1H2VZ 3ILIA 2R8KA 1VRTB 3PX6A 4NXMF 4K59A 3H5XA 4RNMA 1T94A 4LFCF 2O3DA 4RX6A 2LA6A 4ZJQA 2DEIA 2PI4A 3AD9C 3V6KA 4KHMA 2E66A 5HVGA 5BYSA 3PTWA 3KLEB 2BJ3A 1NJZA 3RAXA 3SBMA 2A18A 1B3TA 5F8HA 2EKNA 5KFGA 3HFKA 1TV6B 2DXDA 1WDDA 4B3RF 5FDLA 4DCJB 3HZEA 2OSRA 1S79A 1DHMA 2WAQD 5LJ3Y 4CO4A 2KT5A 1TUVA 2YKNA 3DKDA 2Q79A 3QWUA 1HFEL 1WC3A 4XDDA 3EX7B 5LSLA 5KG2A 2CQ3A 4H4MB 1UPPA 2LQ5A 2QX0A 4F2RA 2COLA 2HNDA 2GMHA 3VTIA 2WB1D 5AXKA 3OVAA 1N0VC 1F3VA 3M2RA 4GO5X 1VLOA 2IYIA 2ZD1A 3W3SA 4F8RA 3RW6A 4QW8A 1WC4A 1JKHA 1S7HA 1MMNA 1N33J 1UJ4A 3LH2S 3KJFB 2CJXB 3ZTSA 4DN0A 2R2UA 1FNXH 2OD4A 3R1LA 3RTVA 3M05A 2Z57B 3FKBA 1YHQS 1EQ0A 1ROFA 1RWVB 3DRPA 1S9GB 5J1EB 2HNZA 4KGVB 1RTJB 1ZZFA 4DZ6A 1UVMA 2AJ1A 1FI4A 2JEJA 3IP0A 1HWLA 4LF7F 2YNHB 2F8MA 4N8NA 1CJTA 3ENVA 1UMJA 9RUBA 4ILRA 2WBMA 4XPCA 1S1VA 2LQ9A 4DFJA 3D0GE 5H9FJ 2W1BA 4C9DA 4K4XA 1X9SA 2I6WA 1N6QA 1MMLA 2ZDOA 2HHXA 2KVQE 1IQZA 1HNVA 3DLKA 3CVKA 2GVZB 3PJXA 3V4IB 1RE1B 1H0HB 2XBPA 4ZA1A 1O6XA 1IJFB 3EZ5A 2Y1JA 3ZZRA 2XY7A 5D0HA 3N28A 2G13A 2D9PA 4USIA 3MMAB 2XTJP 2VC1A 3TAPA 4LSLA 2HRYA 2KVIA 4RW8A 2XLIA 3HD1A 1DLOB 2RKIB 3GG1A 2HMIB 5KG7A 4QPTA 1N33F 4EU0A 2HQGA 1NAQA 3RR7A 1N5YB 2A2DA 3EGNA 4CWBA 4KSEB 2B4UA 4JUZA 2QRRA 3HP6A 1NDKA 3IG1A 3WZ0A 5C25A 4XDCA 3UQSA 3C3LA 2XI3A 4HH1A 3OL6A 5A76A 3PZPA 3ETMA 3SFGA 1SC3B 2ERRA 4R8UB 5LJ5Y 2CPYA 1RT7A 3KG0A 3H2UB 4B9VA 3NMAA 5L1IA 1YRXA 3K7RA 2B9XA 1R6YA 2L9WA 1RDRA 5KFCA 2CQDA 2A1BA 2HQFA 3LPEA 4ZVGA 3SDEA 4F26A 5C24A 2WW8A 1JLCB 2B9WA 1NB7A 2CG4A 2EG2A 3RAMA 1L5UA 4DU7A 2J0XA 2I5JB 3PYGA 4O0NA 5DZ6A 2RILA 1JLAB 2CJQA 1NO8A 1VISA 4PXCA 4W4MA 3CUNA 3M6UA 3I6PA 4PG6A 3D1OA 1D9AA 3THVA 5HROB 4OJ3A 2Q6CA 3GV8B 4X4SA 2M52A 3C6UA 1C0TA 4RR5A 1JNZB 4L3KA 3OXFA 4Q7AA 2KO1A 1SQEA 2JZ5A 4H4KC 1TFWA 2JFKA 2AD9A 2IM2A 4NI2A 2M4MA 5C42A 1U6BA 2SXLA 4OJ1A 2DNLA 1IKYA 3P6YC 4ED4A 2AYGA 5F0UA 3OHAA 2MKJA 5KG5A 1RKIA 3F0NA 3EVWA 3CJKA 2FZGB 1HBUB 5B0FA 3BQ2A 4EO8A 4DOZA 4OX8A 4KRWA 4UTGA 1KQKA 5L1KA 2V50A 3GJQB 4CO2A 4DS5A 3I0RB 4M63A 4IKAA 2IAJA 3OQ2A 4R0EA 5HLFA 3L3CA 3T5HA 2QFIA 4YMEA 1PCAA 3UR3C 1N5VA 3BN7A 1RACB 1K0VA 5DZ7A 1NSAA 5HP1A 1RAOA 4U95A 2V4QA 2VFSA 1U2CA 2GA7A 1WHWA 2JLFA 1BQXA 4QYRA 4I2PB 2C2DA 1WOOA 3QT8A 5E3QA 1VRQC 2CYYA 2YQ0A 2VPWB 2EWHA 2J0QD 2PFDA 3JAMU 1RTDB 1NPKA 4CO3A 1DARA 1NK6A 3CCJS 2Q6BA 2GS8A 1U49A 4OZ5A 1MROB 3S8SA 4Q45A 1KTQA 1JLGA 1N52B 2MSTA 4C4WA 4XO0A 1S0NA 8AT1B 1H2TZ 3OJUA 2YKOA 3HZGA 4WXOA 2JEFA 1FXLA 1YVFA 4M5JA 2ILZA 2B43A 3M8PB 1HL6A 4LF4J 5KFDA 1SBRA 3MI7X 3VAFA 1RT4B 1BQMA 4NCBA 2O01C 2LCWA 3G4SS 3GZ7A 2QN6B 2HWTA 1HNZJ 3ICLA 1XBWA 2DR6A 1VBZA 3GIKA 1SJRA 4N76A 1B64A 5CYJA 1SJ4P 4Z7YA 3TR5A 3B6BA 1T9XA 4PWWA 3LALA 1FEEA 3HX9A 3LAMA 1RWNB 3EZUA 1N32J 4K2JA 1V3SA 2M70A 5B0AA 3K58A 2OPQA 3I4PA 1PGZA 2XB2D 3PX4A 3BSNA 2B4PA 2LA4A 2AJFE 4YB7A 3MCMA 1Q5VA 2GHWA 5AXLA 4XPEA 2EW9A 1IM6A 4UT4A 3GCWP 2ASLA 4J5OA 1B0VA 2RAQA 4LSNB 2RB7A 3LF0A 4Z7CA 1TKTB 2HRUA 1YI2S 1UETA 1YBTA 2B3TB 2W9BB 3N6LA 2AMCB 2ZVSA 2MPUA 2VIHA 2LXFA 4DS4A 1C0UB 3FFIA 1U0HA 2GNKA 8RUCA 1R89A 2NUUG 5ETQA 1VQKS 3QJPA 4YR3A 3TUZC 5BR8J 3OTDA 1LXNA 4KKOB 4X65J 4UF4A 1N54B 4KPYA 4LF4F 4BS2A 4H4KA 2IM0A 2Z2LA 3LOUA 2XMMA 3LWMA 4HACA 2YWGA 5A8WA 4HVZA 1ZOTA 2XYGB 1GXLA 5JXSA 1S6QA 4C3KA 1WF1A 2PE8A 3B8HA 4JI8F 3AH6A 2IJRA 3O44A 1FWLA 1HNZF 3AHPA 4WE1A 1FE0A 2CVIA 1Q0NA 1X4AA 3BQ1A 3TJ9A 1XERA 4ED8A 1KVKA 1N88A 1NHKL 2G2OA 4PQAA 4ZOSA 3PJWA 4UW2A 3VQTA 1YSJA 4GC7A 4Y2KA 1XMBA 1N32F 2IVYA 2W2MP 2XWXA 1BGXT 1UWAA 4EBEA 3K8WA 2UXBJ 1KS2A 2DHGA 1SH2A 2C3YA 1RA7A 2BQUA 4RW7A 4U8YA 2MTLA 2BDPA 5HQLA 2HVHA 3J81j 1HNXJ 3OLBA 4PQUB 1CULB 2GIQA 3TUJC 4ED3A 4OX7A 2C2EA 3PW4A 3MAQA 2W8LA 3R7BB 5KFRA 4B9SA 1KOHA 3MPUB 1X60A 1EKRA 1R7IA 3KUEA 3BSCA 4OLPA 4TYAA 2ATLA 1FVQA 3U1LA 1DQ8A 1UVLA 2NR0A 1CC8A 4KFBB 4IG3B 1Z2ZA 2M2BA 2A6MA 5BR8F 4X65F 4C0HA 1YJ9S 1XN9A 2KT2A 2Z2ZA 4FKXA 2R2TA 4KPCA 1X0FA 1F0XA 3LPYA 2I9SA 2CQ0A 2FJXA 1PBAA 4YB6A 4NMLA 4TU7A 2BMBA 3IC1A 2YWKA 3QGPA 4IDKA 8ATCB 1LWEA 1Y00A 1Q16B 1N4LA 1YBAA 3LA0A 5KT2A 5ETPA 4UQTA 4ICLA 1WC6A 3MM9B 3I0SA 3EYZA 1QDUB 3IWNC 3MR2A 1J27A 4DPTA 4OYWA 3ULHA 5HATA 3VWSA 1RZMA 4FYWB 2YNIB 1UL3A 1U2RA 1FKPB 2ZEJA 3RGIA 5THWA 3WBZA 3AJ1A 1ZA1B 3KG4A 4ZCIA 2W9AA 2UXBF 1P8GA 2P2CB 1HNXF 2BE7D 5EGYA 4OI2A 2F8HA 2QG9B 4NA2A 2A0FB 2BRKA 1QE1A 4P6QA 4O4GB 3D66A 3ZTPA 1C1CA 5B08A 3CJ8A 3M8SA 2XWYA 3AOAA 1TFYA 2LXIA 1LW0A 1FWKA 3DLHA 1YJNS 2BJ7A 4J9SA 4CLWA 4ZLLA 3IRWP 4H4OB 2VC0A 4U7CA 4O23A 1T05A 1SIZA 1KD1T 2YKMA 3UR0A 2ZBRA 2YVSA 4J9KA 4WU3A 3HPOA 3BDEA 5J2MB 1HYSA 4ENOA 2RF2A 2MKSA 2YNGA 1JNRB 1VJWA 1A7GE 4QU7A 2VPXB 4YDXA 2XCAA 4I2QA 2QA2A 2VPYB 1FEHA 5IXUA 1N5SA 1OYDA 2IC3B 4EEYA 3IMQJ 5J1NA 7AT1B 2FGOA 2W7AA 2GJ2A 1RT6A 4CNZA 3VR1A 4M5HA 1RT2B 1RHJB 1YJTA 3CCQS 3AT1B 3M8ZA 5L8RC 2HHUA 4U6PA 1I5OB 3A12A 4J9LA 3CMAS 2HLTA 3M32A 3SQGA 1LWCB 2I2YA 4K7QA 2HSEB 2B8PA 2DR7A 2MZQA 2IBKA 1M1GA 4DPXA 4C8LA 5KT4A 1RJJA 2M8HA 2BJDA 1U2FA 3CDAA 3W61A 3MEEB 4F4YA 4FP9A 2FZKB 1LW2B 4KO0A 1NHUA 1QD1A 5KOXA 1WKKA 1M1HA 2DIVA 3AOCA 2MDAA 4RWXA 5GAHI 1ZM3A 2ABYA 3V81A 1H2UX 3UDCA 5CYQA 2CQGA 5DS7A 1RISA 3Q0AA 1HBOB 1FT8A 4DCPB 1S12A 2RNEA 3KLHB 2UUWA 4IH7A 4OI4A 3KLGB 5EX0A 1FJGJ 2FY8A 4LRCA 3PHEA 3R97A 2DNMA 5LXRA 2EK1A 3CXCR 3CCLS 3L4BC 1T8EA 4RNOA 1SC1B 2KXFA 1U6ZA 1RKJA 1PG5B 1LK7A 2ZBCA 2J76E 3J7YU 3VAJA 1UFWA 7FDRA 4P9SA 3JXOA 2FDNA 5EHHA 2NXNA 1QVGR 4QIEA 4DL3A 1BMQB 2FJWA 4KJIA 1RWWB 3UD4P 3I5CA 1FD2A 2E7XA 3DHXA 3MUTP 4X4OA 3BF4A 3KYLA 3TZZA 3LWLA 2CQHA 4OIXA 3LQVA 2QYCA 4UY8T 3PEJA 3H42A 1PJ7A 4ZN1A 4K5RA 4PPZA 1K44A 3K5OA 4ZK7M 2ZHOA 1I1GA 3G2XA 1I6JA 1Y4ZB 5F8LA 4OI0A 3PKYA 2L3MA 1LK5A 2OPPA 4C2MA 4DV6J 1XR7A 4D3GA 3ZZOA 1R43A 1N48A 2A2CA 5LXYA 2ZH8A 2RSQA 3FCHA 4TLRA 2FHJA 3G6ES 1SUQB 2IDEA 2B4VA 4G1IA 3Q8SB 1RBOB 3SMZA 5KFXA 3ZFVA 1Q79A 1X0PA 2X1BA 3THPA 3GLJA 1SJ3P 2XMJA 3EICA 2IA6A 1FJGF 4OLOA 5HBMB 3SQOP 3LO3A 1H7WA 5GMDA 1NRKA 3CD0A 3WHIA 4Q8FA 2ASJA 5FDLB 1QSYA 4QJVA 1VBXA 4ETZA 3BM7A 1GQEA 4R25A 2HZVA 4FXWA 4CLYA 3DYAB 4U96A 4CLUA 4QR2A 1C1BA 6FDRA 1X4BA 3W64A 1T11A 5IWAJ 1S9EA 4AXIA 4XIUA 2YKNB 5K8NA 2HEKA 2UZAA 4LF9J 2HBZB 3OXGA 2HK3A 1J5OB 2J9DE 2W4DA 3CULA 4NXNJ 2V68A 2MJNA 2XMTA 1QVFR 1U8WA 3L7OA 1U47A 2J5AA 1TUWA 2WW4A 2BW2A 2CAJA 2OH2A 3MD3A 4PKDB 5G0RB 4NYZA 1PC4A 2J6UA 4DR4J 5E41A 2W7PA 1JKHB 3G71S 2QE5A 3GV7B 4USHA 5KFMA 4RUAA 2DPIA 1HA1A 4LRFA 3BQ0A 2GJIA 4B3OB 4DV6F 1WI6A 4ZVFA 3MPYA 3KHHA 3F41A 2ILYA 4KT0C 2BR0A 1R3NA 2PI5A 4GMKA 4OYMA 1HW9A 1MSWD 3NOCA 3PHTA 1KWMA 5M2RA 1GX6A 3RB0A 2EC0A 2V4JA 4HI2A 2MHNA 3ITHB 1NSPA 4RUBA 2HVEA 2BKNA 1HIYA 1X4FA 1D8YA 2I38A 4DL5A 1WUUA 2ATCB 1HNIB 2RH3A 2ZZTA 3GR0A 3DGPB 4BWMA 2YNFA 2IHR1 1S1VB 4FVMA 3U27A 4O3SA 4E0DA 2IMOA 4WCEQ 1GT8A 2DHSA 3FEZA 4QWEA 1IN0A 1UCNA 4WWSA 4X2BA 3VGTA 4CYUA 1JK9B 2XNQA 2V9WA 2R7UA 3AOBA 1FRMA 2ZC4A 1OS5A 2CG8A 5IWAF 2IPOB 2QMUB 1AFJA 3QNWB 1HBMB 2C1EB 4LF9F 4GC6A 3M30A 2C2ZB 2HVZA 3EXYA 3NWGA 4NXNF 3TOQA 3HVAA 2VL1A 4NLUA 4KB7A 1S1UB 4DX8H 3C6TA 2CRLA 3K59A 2W2PP 2V4RA 2XGQA 2MZRA 1HNWJ 2MYFA 3N6NA 3RB6A 3H25A 3VHQA 1YG0A 1UFLA 3BKTA 5A0YA 2ZITA 4ZPCA 4DV3J 3OBIA 1Y11A 4K4VA 4O3QA 3HHDA 2DHHA 3PACA 4B3TJ 4Y2CA 3T9ZA 2RS8A 3KNGA 2AGQA 3HK2A 2PA3A 5KG6A 1OSCA 2Q1LA 1FFWB 2PEHA 4A8OA 2CQ2A 2OMLA 2PMWA 3T6BA 1OQ6A 3KK3B 4F50A 3IAS9 1D9DA 1TK5A 4LFAF 4RBTA 4B9MA 4AQYJ 2XEXA 3DLEA 3PRVA 4HTJA 5CCMA 4E8UA 2EC2A 2IYGA 3CDUA 1W25A 3D5MA 3PG9A 4EO6A 4B08A 4WXWA 4DXLA 1AA1B 2OFGX 1GXUA 4NRTA 3IRXA 4CCHA 1SIWB 4K4YA 1FRIA 2EFOA 1XC9A 3E2EA 4OHZA 2AJ0A 2NZ4A 3H2LA 1IM4A 4MIAA 1TZ0A 4DPYA 3HHLA 1RBAA 2QLFB 3BS9A 4MYUA 1SI9A 3O8WA 2J6TA 2E5JA 2E44A 2QJ3A 2FVCA 1VRTA 2PDAA 3KOAA 5DETA 2IFXA 1VC0A 4CP5A 3P5BP 2HZCA 2VHGA 3L09A 3FMBA 1HNWF 2BM1A 1U8SA 2GQQA 3G6VA 1SL1A 3VCDA 3KLEA 3TAQA 1HHTP 2F65A 4DV3F 1TV6A 4B3TF 4IO1A 2EI5A 1HR0J 2DNPA 4C8MA 1FDNA 3LGMA 4RW6A 3SXLA 3TX8A 4JB8B 4PG5A 1PYTA 4ECSA 5A8RB 4H4MA 2KYXA 2RD5C 3UCGA 3DI6B 4AQYF 1M5KC 1H3DA 4EZ6A 5A2QU 3UVJB 3FK4A 2WONB 3K8VA 4V1Ak 4Y2IA 2QZ8A 2C22A 5ETKA 3C15A 3BZQA 2EG1A 1WC0A 4FVCA 3RG6A 4CO5A 5LSOA 2GIFA 4QU6A 4C8OA 1GH8A 2YBVA 3MEKA 3A8IA 3CCZA 2K1RB 4ANEA 1VBKA 1XJWB 1HMVB 2YH0A 2B5JB 1QSLA 4LBIA 2D74B 4UOHA 1VDHA 1RYSA 2N7YA 2EK6A 4ED0A 4N7TA 3G6XA 5B09A 1QJHA 4QPXA 3CDBA 1S9GA 5J1EA 1RTJA 2MY7A 2VD3A 1NUEA 4F2SA 3R3TA 2MKKA 5L9XA 3HCXA 5ETRA 4YFUA 2FZCB 3OR1B 4HTIA 4OJGA 2YNHA 2LEBA 2MZSA 3HD2A 2DRBA 2E5HA 1W26A 2DB1A 5HJYA 1X31C 1IBLF 3GIRA 1WKJA 2GMLA 4QR1A 1HR0F 3MWBA 5D3GB 1ZM9A 3Q24A 5F0WA 4ED6A 5D0RA 3Q22A 3K17A 3RBXA 1YKWA 3GV5B 2GVZA 4OX9J 3KJVB 3V4IA 2FVSA 2LKZA 2Z2YB 3TNVA 4USVA 2YWWA 1DQ9A 4K5SA 5BYQA 4OHXA 4G6VB 3MMAA 2XZDB 1SQFA 3ADAC 3GYGA 5C2GA 2HS4A 1FWPA 1DLOA 1DBDA 2RKIA 1WTFA 3DOLB 4ER8A 3DXBA 4NZ7A 4LSZB 4NCAA 2HMIA 4DHVA 3A8JA 1PSDA 5CYMB 1M5HA 4KYZA 3CC7S 1UZDA 3M8WA 4CLLA 2ASYA 1N5YA 1OPIA 3FBFA 3H5UA 2ROPA 3SV3A 5HMYA 3PNIA 2ROGA 1U24A 3PFEA 4M1KA 4R0JA 1Y5LB 2HS0A 3VAHA 3G8SA 2DNHA 2VOOA 4NLVA 2LP4A 4TNOA 4R8UA 1CJUB 1U0SA 2AJ4A 4I4BA 5IFMA 1FXRA 1FTCA 4ETXA 4FYYB 4WTYA 1HQUB 2NCKL 2FJAB 3B4MA 1MU2B 4IFVB 1VQ6S 2G2ZA 5DDPC 1Q81T 2XSJB 5D77A 2CNNB 1RAHB 4M5MA 4X66J 3LGNA 1FVSA 1UEUA 3NRBA 2ZDPA 4OHYA 4A47A 4FBTA 4NLDA 3JB9k 4QW9A 1RAGB 2I5JA 1WEZA 1IR1A 4OX9F 4JI4J 1IR2A 5DG7A 3NP5A 1JLAA 2QMXA 1S6QB 2ZH9A 4B17A 2L9NA 3VAGA 3R5AA 5HROA 1VLYA 2GFFA 3C14B 5J1PA 1Q8KA 4PYAA 2Z2MA 1L3VA 4FBUA 3R7NB 1RT3B 2QLJB 2UVWA 5KG4A 3G8QA 2HHQA 3R6GB 2XHWA 1NJYA 3AAWB 2QGFB 2F1FA 2IVMA 2RU9A 1M5OC 3RB3A 3TZWA 3OXLA 1TKZB 4DPWA 2VBZA 4LF5J 4UZCA 1HBUA 4GKKJ 4ZLPA 1DTQB 1X9MA 3ZTOA 2KHDA 2CJYB 3UNGC 1NSQA 3BO4A 1S0OA 4DV1J 3OTBA 1W2BR 5D4NA 3HSZA 3NL0A 4FS2A 3I0RA 4A8YA 5K9FA 1LV5A 3BGRB 1CVJA 1EHWA 3QFHA 1X9WA 5KFAA 2DJWA 2DISA 3KK1A 3D28A 3KHRA 2E9RX 2LLZA 4X66F 2YPZA 4F3QA 2W4PA 4DL6A 1S77D 2HFVA 1G1XA 4JI4F 4ZDNA 3J7A1 3GE9A 1SPBP 4I2PA 2VQFJ 3R5GA 3RW7A 3EWGA 1LWEB 2BE9B 3IGNA 3QRRA 4EMDA 3DDNA 4AL5A 5KT7A 3T41A 2Y3YA 1VQNS 4DUTA 3CB4A 3PO4A 1X4GA 4P2MA 2ADCA 1VIOA 1D3WA 3TJ8A 1RTDA 1U1NA 2ZWOA 1EQMA 4NLOA 3FRYA 3EVOA 2EBGA 2OIHA 2OAUA 3J81Y 3UCZP 4B9LA 2ZBPA 4FF1A 4YB1P 1MROA 3GSDA 3BJYA 1OIAA 4KQZA 4USWA 2PIIA 2BZ2A 3L9ZA 4DZDA 2MZJA 2M5YA 4K0KJ 4LF5F 3M8PA 2V2KA 4GKKF 5DM7Q 4K4WA 3H98A 5HO4A 1RT4A 1DJ0A 2LU1A 2G9OA 4DV1F 3ONQA 5T7LB 3R5JB 2CPJA 2K3IA 4CZCA 1S57A 3HHNB 4GO7X 2IRUA 3FQLA 3SV4A 1CSJA 3TVKA 1CPZA 3DU6A 2JDJA 4TU9A 2YKMB 3CWJA 2YH1A 4QR0A 1RCOB 4U8VA 2U1AA 3CE8A 1CQNA 2R9LA 1DZ5A 2WVCA 1NNDA 2VQFF 3QGHA 3GONA 5G4DA 3I82A 3IR5B 2IRXA 1MW7A 4YY3F 1SQGA 1N8RT 4Q0BB 2CQPA 2ZZNA 2FD2A 2NS1B 5AXNA 4E2FB 2DGUA 1IR0A 2A3JA 5F8NA 1JLEA 1SC6A 4LSNA 3G82B 1PJ5A 2G4BA 1TKTA 4LQ3A 1NKEA 4I68A 2W9BA 3UN3A 3SQGB 1A9NB 2DNGA 1C0UA 5D4PA 2CPXA 4NYOA 3JTOA 4K0KF 4KKOA 4O44B 5HMZA 2GCFA 3LANA 2HG4A 3T1AA 4DV4J 3F44A 5J2PB 4CI0B 5E3AA 3DGVA 4JI6J 1HWJA 1RTIA 2AEJA 1VC5A 1RADB 1VQYA 2KFZA 4NMXA 2OFHX 3GTYX 2KJVA 3CCRS 4J9RA 3W60A 2XO7A 4FF4A 1FESA 1RWMB 1JQGA 3KHGA 2YY3A 2R3VA 1EP4A 4Q2MA 2FLOA 1WHVA 1DQAA 4NLSA 3DM2B 3I4HX 3MM8B 4HLBA 4LF6F 4PQUA 1CULA 1OWXA 4ZJLA 2LEAA 1OY9A 2XSFA 1S1WB 2DGVA 4OJHA 2FJEB 2UVRA 2DRAA 2DHXA 4UOFA 1CEZA 2J8AA 4MYTA 3DC2A 4QCLA 3CTRA 2UV8A 1VQ9S 4OL8A 4KFBA 4IG3A 4IR1A 3POTB 2YX7A 2EVZA 1JJ4A 3J7ZT 2IRYA 4FXVA 2KFNA 4AFFA 4DV4F 3MTKA 1ZBTA 2CPEA 3O2IA 3NAIA 4JI6F 4ES3A 3EM1A 1YTYA 1WG4A 3FMWA 4GVLA 3MM9A 1VI7A 3EVMA 4N77A 3NS7B 4A8WA 4Y28C 2FLLA 2DPJA 2J0SD 3M8RA 2NZCA 2YNIA 3CCUS 3JQKA 2KU7A 1FKPA 4MT1A 5F9LA 1NB2A 4URQU 1NK7A 2FVPA 4BBYA 4WYWA 5HVHA 4JP8A 3U02A 4BC9A 4YR0A 3MM5A 4NLWA 3ZZYA 3K89A 3BBCA 2JLGA 3E51A 1G4CA 4DCOB 1CG2A 3CMQA 2JEGA 3QLHB 3L7UA 3DDKA 3IS9A 2KFYA 4KAIA 1XR5A 4O4GA 2VICA 4Y65A 2CPDA 1T7PA 4KH1B 5B0BA 1UZHA 2OSQA 4ELUA 5K20B 2Y0BB 1TQLA 2KXHA 1C1BB 2FYXA 1S9EB 3D7SB 3OD2A 4H4OA 1KEKA 2DNRA 3GJRB 1JXLA 1Z2LA 4C3LA 1Q95G 5GMEA 5DGBA 3MEDB 5J2MA 1OJ4A 1O0PA 3GJTB 2KT3A 4C7QA 2OEJA 4JBCA 1NM2A 1Q7LB 2VONA 1XWLA 4HDGA 4DWIA 2AX1A 4IH5A 2V8GA 2MLXA 2OELA 1GTEA 4OMFG 2IC3A 5E5NA 2DCLA 1PIEA 4N41A 1RT2A 4WP9A 2HIYA 5M2PA 4USTA 1T03A 4TQSA 4M5GA 4DF4A 2PT0A 5L1JA 3C19A 2V4JB 3W5YA 3NGUA 1LWCA 4J37A 2MQPA 4ZPWR 3RJMB 1HWKA 2VQEJ 5DDRC 2AIRB 4DG1B 5CD4H 3NBPB 4FNHA 2LFVA 3TA1A 4OZ0A 2YNFB 3NCPA 2LECA 3N5BA 5FIIA 2RUSA 3CCWA 1UJ5A 1O51A 1X4CA 2DH9A 2YKAA 1E6VB 1FX2A 2Z8QA 2B4OA 4UUXA 1NCLA 2HAFA 1HBOA 3MMJA 1HARA 2BBEA 2JEIA 2H5JB 3KLHA 1NDCA 1RAIB 5J2QB 4USKA 2ZUAA 4C97A 1U02A 2ZJQQ 1VBYA 5K8PA 2FHMA 2OEMA 4IRKA 3LGHA 4W90B 1SV5B 3KLGA 3I31A 3HJFA 1WOSA 2B56A 2QIFA 4CLTA 2KKHA 1X5PA 5KFZA 2H65B 2I8EA 4LIRA 2V9KA 2XG8A 1HKAA 1IXKA 1VRUA 2DR8A 3R5DA 2NXJA 2JJ4D 3HXMA 2FJVA 1KQFB 1WOPA 2D41A 2ZNZA 3EDRB 2VQEF 3IR7B 4L75A 3WC2A 1KONA 3MEGB 3TANA 3FCWA 1YDLA 2PC6A 1REVB 3MM7B 1FA0A 3CD7A 4LVNP 4C0BA 2ZWPA 2ACYA 2AGPA 4FPRA 4P2FA 2W2QP 4JI7J 1LNQA 2LEPA 4NLTA 3A3OB 4MFBA 1H73A 2P6TA 3MR6A 2RQKA 4C8NA 3KLFB 3O3LA 4EGLA 2X3GA 1S0MA 1P9QC 2ZFHA 4WK1A 1Q78A 3NS6A 3UFCX 2CPFA 4JI0J 4TLQA 1TR0A 4WPAA 3KK2B 3R27A 2VDHA 1SUQA 5EWFA 1TKDA 1TL3B 2J6SA 3FZBA 2V8VA 1XQIA 3PM9A 3OV7A 2Y8YA 3KWMA 5E3CA 3W62A 4ZP8A 3Q2TC 1YJ7A 1RWOB 3BGOP 5IM0B 3FRZA 3LP0B 2JH3A 1H98A 2B0GA 2C2KB 1DAXA 3VZHA 3BO3A 1QAJA 5HBMA 3EXCX 3NKYA 5GAGI 3RRHA 5CZXA 3Q2SC 3TUPA 4RW4B 2A6OA 1WD6A 3ZZ0A 4ILMA 2D1CA 4RW6B 2HQ3A 2BKPA 5DO2A 3CD5A 2M88A 4IRCA 4PG4A 2YTCA 3DYAA 1KR4A 1VCTA 4N56A 4O3OA 2CADA 3MECB 4J9VA 2DY1A 5KG1A 1RP5A 1J5OA 3TQEA 1V3ZA 4JOUA 2MQNA 2MLYA 5AE1A 2CZ4A 2DRDA 4ZP7A 1FKAF 4ZCMA 4CDIA 2DCUB 5G0RA 1IKVA 5HK4A 3TJAA 1CJKA 1FCAA 4ZP9A 4ZVPB 4IUFA 4N8OA 3C15B 3Q8VA 2MQ8A 3AQOA 1NLKL 2CQBA 4JI7F 3H59A 3RUBL 1KFSA 4CLFA 2W9CA 5ETVA 4F02A 2C2OB 1IVZA 3QT5A 5GADI 2RIJA 4B3OA 2M9KA 3QGGA 2QMWA 4QIVA 3R6LB 2ZVIA 4JI0F 1OYEA 2XQCA 2WSFC 2YQ1A 1HI1A 4CH7A 1P6TA 3RZAA 3MCNA 2C2NA 2HNYB 4F0KA 4P7TA 1S0VA 4WYLA 1IBCB 4L72B 3OTCA 1HI0P 3QZ7A 4LT6A 3MF5A 1MNEA 2W8KA 3ITHA 1FK9B 5HN0A 1VQLS 2BEFA 1HNIA 3DGPA 5C5JA 3H4BA 4O3NA 2CNKB 2JLEA 1ZAVA 2BE2B 1B7YB 1T9WA 2GV1A 2R2RA 1HBMA 1XR6A 1FRHA 2LDIA 4X62J 4DUZJ 1ZM4A 4OX6A 2C3PA 2MMYA 4P52A 3BBFA 2YX1A 3QRPA 2YQ3A 4NLQA 2WBRA 4Z37A 5EWEA 1B0TA 2D9OA 4U9RA 4A8XA 3CDEA 3O1LA 2VA3A 2EFPA 1K73T 1S1UA 2E1PA 1RYRA 2CDQA 4HL9A 2D3UA 4TU8A 1R0CB 5KFIA 5ADZA 2GO9A 1Q1KA 5LOQA 4DL0C 2KJWA 4HDHA 3W9HA 4EFAC 3TQ1A 2YKQA 1EIYB 1FO1A 3NEKA 2XMAA 3ETOA 4OHWA 2F9DA 1VQ5S 4RO0A 2VZ9A 3JSBA 2XS5A 2RJZA 4NA3A 5KFWA 4JI5J 4DEZA 2K06A 3MPVA 1JWWA 5DG9A 4V19X 4RNHA 4A8FA 2M3DA 3HT3A 1TTHB 1S1TB 1D0EA 3KK3A 1S4EA 1RWUA 5B0EA 3W7BA 2QLWA 1IJEB 4Y3CA 5H9FK 1VJQA 3W9IA 1BWEA 1F60B 1TVRB 4Q5VA 1KLMB 5SUHA 2OJ3A 2V63A 3HMJG 4DX5A 4UZBA 3I96A 1JLFB 4XK8C 2DNNA 2N4CA 4JV5J 2V69A 1RWXB 2H54B 3AJDA 1J2VA 1JLBB 3OTEA 1SH0A 1RTZA 2OGUA 4X62F 4DUZF 3NCQA 3WIUA 4FYXB 3S6EA 3MAAB 2P9EA 3H40A 5L39A 3QYYA 2EBEA 3EZOA 3DU5A 4J91A 4PXDA 1N5TA 5CZVA 1KLNA 1RI7A 2PMHA 3FEYB 3WIVA 4DR1J 2Z4PA 1QTMA 5GAHU 2PSZA 1PILA 1JJCB 3NGDA 4URSA 1K47A 2YWHA 2R7QA 4TY9A 4P10A 2CPIA 3BR9A 4JV0A 5DM6Q 1OMSA 3US5A 4JI5F 3FSXA 1TL1B 2V94A 2GVDA 2EEYA 2F8EX 3ZZZA 1TL4A 5A8RA 3TEHB 4MKAA 1EETB 1WORA 2CPHA 3D6TB 5KT3A 5KFNA 3DI6A 1W7WA 3FBCA 1AXQA 3UVJA 4M94A 1R27B 3JSRA 4J7CA 2WONA 1VK3A 2MKIA 1XEZA 3D6MB 3QO9B 3KK1B 4JV5F 5HQ8A 2BW7A 2VG7B 3DNCA 1BUXA 2RRNA 2E29A 4O3RA 3AD7C 2F40A 1I3OB 3VAIA 3NAHA 2JC0A 2MJUA 3LP2B 2K1RA 3OPKA 4LF8J 1HMVA 3W5ZA 2B5JA 2LQJA 3CT9A 4I6WA 4WFZA 5ETLA 4OZLA 1NDLA 2W4CA 3V6HA 2MKHA 3NNHA 5K14B 3MDFA 4DSLA 1CJVA 3QATA 3VQSA 4WFAQ 2K7KA 2IIHA 3DRYA 1KSPA 4NEZA 2FQQB 1U1OA 4DR1F 3OR1A 1Y9OA 4ZVSB 4ECXA 4I64A 1SKRA 3ENAA 5KFPA 5HJXA 2K3KA 1RSCA 3PW0A 2LYVA 3NG8A 1YRUA 1D09B 4WF9Q 4ZCLA 4USJC 3H2VE 3UD3P 3MMCB 5KTQA 1CS4B 1RLCL 3PR4A 5K5MA 5D3GA 4KGXB 3NOGA 1UW9A 2E1RA 4HR2A 1FXDA 5JJBA 2UVUA 4DPUA 3KJVA 4NCGB 4M5KA 1JXVA 2AF6A 5M2UA 4DFKA 3HLUA 1S7IA 2KRBA 5KFBA 5C7PA 3IO1A 4XTTA 2IVFB 4DX6A 2KM8B 4TXSA 2FVRA 4Q2LA 2UUAJ 3BR8A 1RAJA 1RTHB 5D15A 3UD5A 2XYHB 2HKEA 3DOLA 3TX0A 1HHSA 1HHQA 2ZOGA 5CYMA 4CM0A 4LBPA 4ZVUB 4O4RA 2JOQA 3PCOB 4DPOA 5EWGA 4DV5J 2AEFA 1LWXA 4JI2J 2P5VA 2YX4A 1FJEB 3VAMA 4LF8F 3HULA 2CJAA 3H7HB 2NPFA 4PEOA 2CWXA 4WP8A 2AQ4A 2XZWA 2WTFA 2O5DA 1U7LA 4C3MA 2FIUA 3F73A 1FRLA 2R4FA 5D0EA 2DXFA 2GQ2A 1RAFB 4N5SA 3M7VA 2O1PA 5L1LA 4CLKA 1CJUA 2L41A 3OJSA 1JLEB 1ELOA 1NPPA 2CJKA 4TYBA 4IR9A 4WK3A 4F3OA 1HQUA 5ETTA 3V6DB 2BXJA 2KTQA 2QYGA 1MU2A 4EWTA 1SVDA 4IFVA 2BACA 2HRTA 1V9OA 2XSJA 1C2PA 4WFBQ 5EUHA 4AE5A 2HBYB 1VGYA 1FJCA 4I67A 2R7WA 1F5AA 1KVIA 3N9UC 5D8HB 2ZJRQ 4M5DB 3MM6B 1NKCA 3EDQB 2WOMB 3TRGA 4C98A 4RW9B 3H5SA 3PJ9A 2OHDA 2F63A 3OFHA 4GRSA 2BOPA 3ISZA 3TYTA 3OL9A 2ZH4A 2BM0A 2U2FA 2A10A 3M8YA 1RTIB 3KXDA 3VALA 3RB4A 4LUBA 1HQEB 3GIIA 1NHVA 2DTJA 2E5LJ 2UUAF 4YHHJ 3C14A 4DR2J 2K2PA 5HANA 3PR5B 2VOPA 1GMUA 4ITSA 1RT3A 3DCAA 4ED2A 1UP1A 4DV5F 1EP4B 2DO0A 2IJFA 1D9FA 4JI2F 2PD1A 3LW5C 1RABB 3W5XA 1YBUA 5F8IA 2HGLA 4GVBB 1VR6A 5HI7A 5HL7Q 4FYVB 3E8OA 3ZZUA 3M1VB 1TKZA 3R8YA 4H54A 1V3RA 3MAHA 2R7TA 1P1TA 2ZKUA 5FJ4A 1DTQA 4K4SA 1VQMS 4YDDB 4PG8A 1BHNA 4DBQA 1Q8BA 1AUDA 3TAMB 2R7XA 3LP1B 3M2VB 3HVTB 2HWHA 2UP1A 3EGVA 1AT1B 1GFWB 1WHXA 1ZPWX 2DEJA 2VFRA 1SKUB 2NPIA 3BGRA 3HHEA 3HI9A 1JJHA 4KV8A 3M9OB 2RDIA 4CT8A 2AZ3A 2XO6A 4DFPA 1X5OA 2VUGA 1D8ZA 4J90A 4ANCA 4BC7A 1P1LA 2QA1A 2KYZA 4DL4A 4M5NA 3Q8RB 1FFGB 2QO3A 2N7CA 4MK7A 4BWJA 4RBUA 1YZ7A 4USMA 4CT9A 3M9NB 5KT6A 4DQQA 1Y5NB 3AFGA 4ECUA 4OYIA 3IAM9 5ITHA 1WSRA 2GAHC 1LOUA 2HGNA 4CH0S 4ZLNA 2E5LF 3I87A 4YHHF 4DR2F 3A1YG 2JVOA 3UO0A 3OFFA 2XC9A 1SKSA 3GCXP 1HQ2A 4LR9A 2AYEA 1IUJA 3NNAA 3NXZA 1F6TA 1OY6A 4C11B 3CC2S 3MM5B 3BDPA 3QRQA 1TMJA 3TW0A 3UPFA 4USUA 2E9ZA 2D3ZA 1LFPA 2GGPB 1ZTTA 3KDOA 5HVFA 2EFQA 3W2VB 1CLFA 5DDOC 4MKYA 3JYTB 3K5LA 3IS9B 2X7IA 2FUG9 2P9CA 1WDTA 4F36A 5T7LA 3QPIA 2FVQA 3BGFA 3PY8A 2WVFA 3ET6A 1DY3A 3UN2A 1YJRA 2WVBA 3BN4A 3QJJA 4CO1A 1KOOA 4F0MA 3KUGA 5FLXU 2FHOB 2MKCA 4AT1B 3M2UB 1S6PB 2Z0GA 2G1DA 4KIAA 3MD1A 3DLGB 3SSSA 2VV5A 2EFNA 4P2XA 4CTAB 1NEEA 2NXUA 1V6HA 3OFEA 4LFCJ 2KI2A 1X5SA 4Q0BA 3CJTA 3CIZA 4ILLA 1ZAWA 2ASDA 1FNOA 1MWQA 5DQHA 5L46A 3EGWB 3G82A 1T03B 2HBRB 4DMZA 1RXOB 2LU2A 4ZLJA 2BABA 2GO8A 3KLIA 2QA4G 3W9JA 1F3FA 2HHHJ 4ID5A 2LQBA 4J9UE 3IBFB 3M6WA 3C46A 2LQ8A 1TMMA 3JS9A 3PRBA 3HVRA 3KMSA 2Z30B 2CKWA 5IOLA 3IBWA 2Y1IA 4O44A 3DLBA 4RU2A 4ZPAA 1VQSA 2WVEA 4MMOA 1QAYA 1VFJA 2QLBB 5B0CA 4KY3A 4U67Q 1FDBA 1KFDA 4PUOB 5J2PA 3U7JA 4CNYA 2V8DA 2MY8A 3Q89A 3BGLA 1B99A 1VIXA 3DHWC 4ECZA 1TL7B 3UCUP 2IY5B 3VF0B 2D7SA 4U7UD 3N01A 3SI8A 2VU5A 1SC4B 4CQ1A 1FKOA 1S6UA 4QWDA 2P8IA 4F4KA 3G6YA 1ZZNA 2C3UA 2ZBIA 4P73A 3BYPA 1WF2A 3HKWA 4IOCQ 4FZVA 2R8GA 2ZC3A 2FJBB 1NU4A 5I3UB 3DM2A 3T5JA 3GFHA 3CJSA 3MM8A 2V8PA 3RBDA 2I0XA 4OYPA 1AW0A 2ADBA 5I4MA 4LF7J 2WRMA 4M95A 1S1WA 5KG3A 1S10A 4ZHRB 3FBBA 2ALZA 1VRUB 3HSGA 2Y1LB 2HHHF 5KFJA 2OP5A 4DQRA 2ZBQA 4QIWD 4DUYJ 2D69A 3BKUA 5DRKA 3ZO7A 3POTA 4RKUC 1WNEA 4ECWA 3G87A 5DGAA 2AYBA 2RDDA 2N4DA 3NNCA 1HBNB 2JC1A 4P7VA 3IWXA 3FDSA 5FLXY 4ECYA 4MFBB 4OZJA 3KMQA 1R8AA 4LVOP 2FC8A 2NXEA 1ZS6A 4MH8A 3CO9A 3BKFA 4G1QB 4RUCA 3CJ0A 1F9HA 3W63A 2QSWA 1OQ3A 1ZA2B 2IM3A 3JTNA 4RPFA 4I0WA 4DL7A 5GVQA 3PIPQ 3OSPA 2HS3A 5D6GA 4YUDA 1IWAA 1ZYQA 4JI3J 3K2YA 4V19J 3D54A 1G6BA 2DGXA 3CPWR 5LMUJ 1H72C 1R0AB 2XY5A 1YRTA 1H7XA 3U1MA 2ZH5A 1RUSA 4WJBA 3GWCA 3GJSB 1VK8A 3QLHA 3DLJA 3GR1A 1S72S 1ZTWA 1S1XA 3NY0A 3VGSA 5ETSA 1FDDA 1N0UA 1FRKA 1SB6A 3OTOJ 4YQWA 3R9LA 3MMBB 2ROEA 3C16B 4UQGA 4NE9C 3AY0A 1HW8A 3TP2A 4DUYF 4UUWA 1WWHA 2XM3A 2CIMA 3R2CJ 3HF5A 5KFQA 2E1AA 3MEDA 6FD1A 4NEYA 1IKVB 1CJKB 3X3UA 3AB2B 3T5LA 1SXLA 3EPIA 5AE3A 1GK8A 1RB0A 4PWUA 2UU9J 4NA1A 1JB0C 2NREA 2W9CB 1BD6A 1XTZA 4IQMA 2O67A 4NZ6A 1VMBA 4K4ZA 1Y3KA 3MUVP 2HHVA 3SIPB 1X4HA 2V34A 4WIIA 1S76D 2M0GB 3T1YJ 4CLPA 1VS3A 4DV2J 2V2QA 4JI3F 2DBBA 3KJQB 1U1QA 1VQPS 1QM9A 2DHAA 3NMRA 5LMUF 2RU3A 2OPRB 3P49B 1UEVA 2PEBA 1LWFB 5CD4A 2BANB 3DOMB 1IBKJ 1TKXB 2M8DB 2QL7B 4DG1A 3MFHA 3NBPA 1KQSR 3D4JA 2DT9A 4DLGA 3B78A 3FUYA 3JSMB 3A3PB 2GQCA 1WTBA 2OPSB 2G1HA 9ATCB 1E6VA 3OTOF 1E6YB 3W2WA 2QFJA 3O6QA 4ECRA 3CCVS 3DFEA 2CFXA 3AQPA 4OV1A 2AJQA 1KP6A 3UWTA 2GMJA 3BH7B 3SYZA 4C8ZA 1IKXA 3B54A 1TK0A 4OYXA 4I7FB 3HO1A 4DR4F 5J2QA 1AZSB 1UVJA 4CO0A 3F56A 2UU9F 4BDPA 2KL8A 4B02A 1SV5A 3ZZTA 5T41A 2F4VJ 1FD8A 3DOKA 1EX8A 3GG0A 4PYDA 3QIPB 4PWDB 5ETMA 4NL5A 1JMTA 2BJ1A 3T1YF 4DV2F 1TAQA 1Z4UA 3L7PA 4QIFA 2KZZA 2BJ8A 1PAUB 4ZVTB 1WG5A 2DITA 2R7VA 3G86A 4OHVA 3QZ8A 3CW2C 1IBKF 1WG1A 2AHOB 1TAUA 3MEGA 2MQOA 2XULA 4TN2A 2VDIA 1REVA 2UXDJ 3GYXB 3MM7A 4IO9Q 2EKYA 4MIBA 1YWXA 3ENQA 2NYHA 4DR5J 2WB4A 1LXJA 3VZIA 4Q43A 5IZHA 1FX4A 2QTWA 4ZMMA 4WKRA 1NBEB 3KLFA 4KHPJ 3OUYA 1T95A 4TY8B 2FC9A 2CZ9A 3KFWX 1GMWA 5GMKa 3IM9A 2GHVC 4ES1A 2VKZG 2ZE2B 3DRSB 1LKZA 3BREA 5U47A 5H9EK 2X1GA 4DDFA 3KK2A 3JQMA 1TL3A 1MWZA 2V2VA 4WFNQ 1TUGB 2HHSA 3KJNB 2E5GA 4WU2A 2MLZA 1CBKA 5IM0A 4A46A 2V0NA 4IQXA 3LP0A 2HWIA 2F4VF 2AKWB 2FPHX 4K2XA 2FLNA 4KH0B 1QAXA 3AA9A 1SL2A 1WJ9A 2GIRA 1KDNA 5DQGA 3PYFA 3QQCD 4RW4A 4JV1A 3Q8QB 1S48A 2GVDB 2J7KA 3MPDA 3CCES 2CA9A 2FGCA 3MECA 3SEOA 2UVVA 3KG1A 2H48B 1S6OA 4QBUA 3P45B 3CD6S 4WP3A 2AGOA 2UXDF 4OYAA 4JI8J 3M9MB 2IBOA 1RHRB 4DR5F 3V5RA 5HQMA 4DR7J 4I6AA 4MKVA 1FHTA 3AXMA 1RU2A 3IXQA 2KH9A 4G1PA 5KFYA 1RGVA 4OYZA 1NZ8A 1KHVA 2HURA 4KHPF 2UUTA 1WF0A 2RHQB 4DN9A 1RQ0A 2H4YB 4QQBA 1KBRA 2AP6A 3PFOA 2ZH6A 3S7RA 1R31A 1EB0A 2L48A 4ZVQB 2DK2A 3P3DA 4LJMA 4Q44A 3E01B 2CNLB 2G0CA 2HNYA 2BKOA 1FF2A 4B9NA 2POKA 4FF3A 4LFBJ 2Q43A 4F4ZA 2DNQA 1CJVB 5B0GA 2B9YA 1XMQJ 1NK5A 1K8AT 1FK9A 1JXEA 5B0DA 3FJ2A 1L3UA 4ECVA 4EZ9A 3OR2B 1R8CA 1NZAA 2R7OA 1UKUA 3NGSA 3VVTA 3CJ5A 2B7BB 3K5NA 3OFGA 3CSKA 2BE2A 2NYIA 2DD8S 5EX3A 2YWFA 2X3DA 1EAYC 3QIDA 3W8GA 3MCOA 1FRJA 3SCIE 1Y3JA 5L9NA 2RHSB 1UTAA 1XNQJ 1MN9A 2N82B 5KAKA 2QEXS 2OUGA 2HYIB 5LMNJ 4NZ0A 3CDWA 4DR7F 4EI2A 2O66A 4C48A 3MR5A 3KLVA 3T9NA 2BRLA 2P9GA 1K9MT 5IQ6A 3CO0P 3UN5A 3VGVA 4Y2AA 2VG6B 3A4TA 4QZVB 1AFIA 2KM8C 3GFZA 3MFIA 3D0HE 1GNKA 3JAMY 3J81U 2ZM6J 3W66A 2HVDA 2G0JA 1P9YA 4KGMA 3ISNC 1EARA 4ED7A 4LFBF 4HT7A 3SSQA 2YKPA 2FY1A 4TKTA 2LDYA 3DMJB 1S1TA 1XMQF 3EGZA 1PBUA 4OYOA 4EBDA 2JFDA 4KGKA 5KFLA 3TWZA 2B6AA 3RAQA 1U48A 4ATNA 5F8JA 3G96A 3GSIA 1U1KA 2Z58B 3MCSA 4KGZB 1TVRA 3D6FB 1KLMA 4R5PB 1NK8A 3V2UC 3QMQA 1JLFA 2JWNA 4HT5A 4CIOA 3Q8YA 2VG5B 3CJ3A 1KRPA 4LRAA 4P71A 2DR9A 1BQNB 1VYAA 1JLBA 4LF1A 1S59A 2VB6A 3TVYA 1DURA 1IBMJ 3MAAA 1GMVA 3MTJA 2VFTA 3P8BB 1XNQF 4HHHA 1ZH5A 3GPAA 3DRRB 5IQQA 1OSDA 2C42A 3M4XA 2VBXA 5LMNF 1HD0A 4F04B 1U1PA 1FTRA 4FKYA 3WX8A 2I1RA 4NLXA 3OW2R 3MGJA 2CQCA 2QL9B 2EFGA 1QSSA 2R42A 4IFYB 4KR0B 2HHTA 3NGKA 4PABA 1ZM2A 2FHKA 3QT7A 3HDSA 5CAAA 2DO4A 2Y8WA 4OZ2A 4QWCA 3UI3A 2ZM6F 1YGYA 1TL1A 2MGZB 2V67A 2ZHAA 1DRZA 4NLRA 4PPDA 2HHWA 1EETA 1RWKB 2QA4S 4WKYA 2NXCA 2OO4A 1TK8A 1VQ7S 4PZVA 1Y7PA 4DFMA 3FSYA 1M5PC 1R8HA 2H5EA 4KV8B 1TELA 5KFKA 1HPZB 1AUSL 3QWPA 1PJ6A 1SJQA 1RHKB 3QO9A 2UUBJ 3W8PA 2VG7A 3PKMA 1MN7A 1U6FA 2GC8A 2VFVA 4S0MA 5CQGA 1T3NA 3H8YA 4LQ9A 5I42B 3LP2A 1G7CB 3D1HA 6AT1B 1IBMF 2WSCC 1S9FA 1HWIA 3AODA 2VBYA 1Y5IB 4ECQA 1U25A 2R2SA 2ZHBA 2JNJA 5K14A 2PN6A 4QYZK 4FDFA 4ZKAA 5EDWA 5IV4A 2ZH2A 5CH7B 3JTPA 4O0IA 4QIGA 4RU9A 1N5QA 4DV7J 1EKSA 4M5IA 3ILOA 1SL0A 4I6YA 3MMCA 1CS4A 2HLUA 2FLPA 4NCGA 5CABA 2MZ1A 3ZTQA 1Q7YT 3HVWA 1RT5B 2MZTA 1YJUA 5IC4B 4DSEA 2OI2A 3ET6B 2KB2A 5GAGU 4ZPBA 3MXHP 1Q8IA 3UDEA 1RTHA 3NCRA 2Q3PA 1CC7A 2UUBF 3M8QB 2RQCA 4OZNA 5HAOA 5HSPA 5HMWA 5F3ZA 2DNYA 1YIJS 1WHYA 1U1MA 3V6JA 3PW7A 1NPRA 3QAUA 1WEXA 4A8MP 1VOMA 2NQPA 1NK4A 3FSIA 1S99A 2IJNA 5E2QA 1RLDA 4JYAJ 2F7VA 1WEYA 3MR7A 1RT1B 3DXSX 2DH7A 1XIQA 3IBCB 3KLIB 2L9DA 3GB0A 4DV7F 3V6DA 3D2WA 5GADU 3Q8UA 2FB0A 4ID5B 5DDQC 1JLQB 3D6HB 1GMWD 2F5GA 4HI1A 1MLAA 4ZVOB 1B70B 5RUBA 3WC0A 5JVGQ 2R8JA 4YEAA 1PKUA 3I56S 2XCPA 4M5DA 3ELHA 4BCAA 3MM6A 2DGSA 3PX0A 4AYBD 1BE4A 2DNOA 2WOMA 4RW9A 2QSFA 4N47A 4F4AA 3IFEA 3LTOA 2NSCA 1DTTB 4RZRA 2X51A 1P27B 1HQEA 2KN4A 5J2NB 4WFYA 3NGTA 3BSAA 3JSYA 5E3PA 1UWBB 1FFSB 4IG0A 4EK2A 3ENWA 5AT1B 1UVKA 4ZPTR 3UE2A 1FKOB 2Z56B 1BY9A 1ZETA 4OZ3A 2H5IB 3D3CJ 3TZYA 3O5TB 5CCLA 2AT1B 2J7UA 1RHUB 2UUCJ 3OVBA 4GVBA 1FRXA 4LR7A 3M1VA 2XMUA 2F4FA 3IN5A 4JYAF 4Q8EA 4ZIVA 1UAWA 2M7SA 2VODA 3R1HA 1D1UA 1L3KA 3TAMA 1RU1A 1GEHA 3LP1A 4DQSA 3M2VA 4CM2A 3HVTA 3HHLC 1PO6A 1Q4RA 3TO8A 2KRRA 3Q86A 1H74A 3HSJA 2XS7A 3KUHA 4KTQA 1M90T 3H0PA 5A8KA 1B7FA 2E7WA 4FPIA 2CQ1A 2MHEA 3EPGA 5IT9U 5F9NA 1AYEA 4L76A 2ZH7A 1ACMB 3DLLQ 2R8HA 4ZVRB 1Q8LA 2V8HA 2C3OA 2HNDB 4Y2MA 3BGUA 4UOCA 2BJ9A 3M2RB 2Y9HA 2YPYA 1YX2A 1F5CA 3BH6B 5AE2A 2VA2A 4ZITA 2ZD1B 4YR2A 1YK9A 3MPWA 2HQCA 4YS2A 5EN1A 2KHCA 2G2YA 4ZIWA 1KVJA 4C0OC 3NGRA 3S01A 3CJQA 2R7RA 2LVWA 3MUMP 4ZVHA 2HFUA 2XHCA 3T6JA 1LQ9A 4C11A 4OZ1A 3KDNA 1UFKA 4MTPA 4UY85 2UUCF 2MQLA 2QC3A 2XLKA 3I55S 1VHIA 2HPUA 3DRPB 2GGPA 5T14A 1IWGA 2HNZB 1IKWA 5ETNA 2Y1RI 2HFZA 3L95X 2MB0B 1QUVA 3W2VA 1U4BA 4LFAJ 1S1XB 3JYTA 2BUNA 4DQIA 5K8MA 4CRJA 2DNKA 1CJTB 2BYCA 1BXNA 2E1MC 3R5BA 2XMWA 4WTOB 3QJLA 3HJVA 2BX6A 2PMZD 4RLEA 1KC8T 2CXEA 4I1TA 2WVDA 1W2IA 1N6QB 3VGUA 1HNVB 3DLKB 1L3TA 1URNA 3WQPA 2JHEA 3SCJE 5JVHQ 3GFYA 3PW2A 2HGMA 3M2UA 1S6PA 1YLXA 2BQRA 2IM1A 4A8KA 2H9ZA 3QT6A 5MAOA 3DLGA 3EE3A 3I9ZA 3VAKA 4LSLB 4CTAA 4RW8B 2WHOA 3T1HJ 5H9EJ 1X4DA 3QBCA 2DVIA 2VKRA 3IGVA 4X4PA 1X7VA 2B9EA 2MQMA 2AX0A 3EJMA 4ZVEA 4YOEA 5JMNA 1UVIA 3IG1B 4EUVA 4GKJJ 4ZCKA 5C25B 1YITS 1SCJB
chains in the Genus database with same CATH topology
3J7A1 3PY8A 4H4KC 5F3TA 1TFWA 2JFKA 2AD9A 2IM2A 2RS2A 3GE9A 1YJRA 4I2PA 2M4MA 5C42A 1U6BA 1M5SA 2SXLA 4OJ1A 3BN4A 2DNLA 1VQ8S 1IKYA 3QJJA 1RT7B 3RW7A 1LWEB 3IGNA 3MZIA 3DDNA 4AL5A 3P6YC 4CO1A 1KOOA 2AYGA 5KT7A 5F0UA 1VQNS 3CB4A 4ES2A 3OHAA 3LAKA 4A8SA 3KHLA 3PO4A 1X4GA 4K4TA 1T3OA 3CGIA 2MKJA 5KG5A 2ADCA 1VIOA 1D3WA 2FHOB 1RKIA 2MKCA 3DN9A 4X4TA 1RTDA 4PUOA 1U1NA 3CJKA 4LIWA 3M2UB 1S6PB 5IT9Y 1HBUB 4NLOA 5B0FA 3SDEB 3BQ2A 4EO8A 2Z0GA 4DOZA 2G1DA 4KIAA 4OX8A 3C2PA 5C24B 3FRYA 3MD1A 3DLGB 3SSSA 2EBGA 3W2WB 2OIHA 2OAUA 4KRWA 3MOJB 3J81Y 2VV5A 3UCZP 4B9LA 4FF1A 2EFNA 2J7WA 4YB1P 1MROA 4CTAB 1NEEA 2NXUA 1KQKA 1V6HA 5L1KA 3GSDA 3OFEA 4WFXA 2KI2A 3BJYA 1OIAA 2ZH1A 4KQZA 1X5SA 3FVYA 2PIIA 4Q0BA 2BZ2A 3E3XA 5DJBA 4CO2A 3CIZA 2XLJA 4DS5A 3I0RB 4ILLA 1ZAWA 2ASDA 4M63A 4K4UA 1FNOA 4IKAA 2IAJA 3OQ2A 4R0EA 1IKXB 2MZJA 5HLFA 5DQHA 2M5YA 3L3CA 4LF5F 3T5HA 3M8PA 2V2KA 4GKKF 3EGWB 2ZUGA 4YMEA 1T03B 5DM7Q 4K4WA 3D1QA 3H98A 3UR3C 4DMZA 5HO4A 2LU2A 1RT4A 2BABA 2GO8A 1N5VA 3KLIA 3BN7A 1ZPVA 1K0VA 1DJ0A 3C6UB 1C0TB 5HP1A 3T1HF 2QA4G 5I3UA 1OPZA 2LU1A 2G9OA 2V4QA 4DV1F 3ONQA 5T7LB 4ID5A 2LQBA 2CPJA 2VFSA 5IT0A 2K3IA 4CZCA 3DOKB 3M6WA 4J9NA 3C46A 2GA7A 2AYMA 3HHNB 1WHWA 2JLFA 4OI6A 4GO7X 2BA9A 3PRBA 2IRUA 3NS5A 3HVRA 3KMSA 1BQXA 4QYRA 4I2PB 5C42B 2CKWA 3IBWA 2Y1IA 3FQLA 1UJ6A 4O44A 1IKYB 2DGOA 3SV4A 3DLBA 4EBCA 1CSJA 3TVKA 4ZHRA 3T5KA 2C2DA 4YB5A 3DU6A 1CPZA 4RU2A 5E3QA 4ZPAA 2JDJA 4TU9A 2YKMB 4GKJF 1VQSA 3CWJA 4MMOA 1QAYA 1VFJA 2WSEC 2CYYA 2YH1A 2VPWB 5B0CA 4U67Q 2EWHA 4QR0A 1FDBA 2J0QD 1KFDA 4J9MA 4PUOB 5J2PA 1RTDB 3U7JA 4KBIA 4CO3A 2X1FA 2KG0A 3CJKB 2U1AA 3CE8A 4CNYA 1DARA 1NK6A 1CQNA 2V8DA 2DGTA 2MY8A 2R9LA 3CCJS 1DZ5A 3BGLA 1X8DA 1NNDA 2Q6BA 2VQFF 1U49A 1VIXA 3QGHA 3DHWC 3CEDA 4OZ5A 5G4DA 1Q53A 1MROB 3I82A 3S8SA 4Q45A 4ECZA 1KTQA 3IR5B 1JLGA 2IRXA 1N52B 1MW7A 2MSTA 4XO0A 1S0NA 2NLWA 4YY3F 4C4WA 3UCUP 1N8RT 1H2TZ 3MHYA 2DGQA 3VF0B 3OJUA 2CQPA 2ZZNA 4Q0BB 2D7SA 2YKOA 2FD2A 2NS1B 3HZGA 3N01A 4WXOA 4QWBA 5AXNA 3SI8A 2JEFA 2HVIA 2DGUA 4CQ1A 1FXLA 1FKOA 1HBNA 4ELVA 1IR0A 1S6UA 2IAJB 1YVFA 2A3JA 4QWDA 2ILZA 5HLFB 4F4KA 3G6YA 5F8NA 5A6PA 1JLEA 2B43A 1ZZNA 2C3UA 2ZBIA 3M8PB 1SC6A 4LSNA 5FD1A 1WF2A 1HL6A 3HKWA 5KFDA 1SBRA 3MI7X 2G4BA 3VAFA 1TKTA 1RT4B 4FZVA 4IOCQ 3TVZA 2R8GA 2ZC3A 4LQ3A 1BQMA 4J9QA 4RBVA 1NKEA 3OUYB 4I68A 4NCBA 2BJEA 1R8BA 4G1QA 3PXGa 2W9BA 2FJBB 5CA5A 2RDJA 5HP1B 1NU4A 5I3UB 1H38A 2O01C 4G3IA 3DM2A 3SQGB 3T5JA 3GFHA 1A9NB 2DNGA 2LCWA 3Q23A 3MM8A 3G4SS 3RBDA 2I0XA 1C0UA 3GZ7A 5D4PA 1AW0A 2CPXA 5DQIA 2HWTA 4NYOA 3ICLA 1XBWA 3JTOA 5I4MA 2ADBA 4RNFA 1VBZA 2WRMA 3GIKA 1SJRA 4M95A 1S1WA 5DG8A 4K0KF 4KKOA 4O44B 4X4RA 4N76A 4DSFA 5KG3A 3FNNA 3KNAA 1S10A 2DH8A 4ZHRB 1B64A 5HMZA 2GCFA 2K8GA 2PA8D 3LANA 5CYJA 4NRUA 2AU0A 1R0AA 1N36F 1SJ4P 2ALZA 1VRUB 3TR5A 2HG4A 3T1AA 1J5EF 3F44A 3G8TA 4P2SA 4Y34A 4CI0B 5J2PB 5E3AA 5KFJA 3LUYA 4DL2A 2HHHF 1XNRF 1KNZA 2OP5A 4DQRA 3LALA 1FEEA 3HX9A 4QIWD 3LAMA 5KFOA 3H20A 1HWJA 3EZUA 1RTIA 2XMVA 5E33A 1V3SA 1VC5A 1VQYA 2M70A 1VQOS 5E3RA 2W7OA 2KFZA 5B0AA 5DRKA 3K58A 2OPQA 3POTA 3I4PA 4RKUC 2OFHX 3ISND 1PGZA 2XB2D 1WNEA 1O5JA 3BSNA 2KJVA 4ECWA 3PX4A 2B4PA 3CCRS 4J9RA 1JLGB 5DGAA 2XO7A 2LA4A 2PGCA 2AYBA 2AJFE 4FF4A 4YB7A 2N4DA 3GQCA 3NNCA 2GHWA 5AXLA 4XPEA 2EW9A 1FESA 1HBNB 3MMBA 4B9TA 2ASLA 4J5OA 4XAKA 2JC1A 1B0VA 3KHGA 1VC6A 2YY3A 3MR3A 4P7VA 1EP4A 3IWXA 4Q2MA 4LSNB 3FDSA 5FLXY 4ECYA 4MFBB 4DSKA 4OZJA 3KMQA 2RB7A 1KQGB 2J9DA 4FXDA 1R8AA 3LF0A 3P96A 3CCSS 4LVOP 2FC8A 1TKTB 2HRUA 1YI2S 1BQMB 4MH8A 1UETA 1WHVA 2FLOA 3CO9A 1U45A 3C66A 4G1QB 2B3TB 2W9BB 1DQAA 3N6LA 4NLSA 4RUCA 3CJ0A 2ZVSA 2MPUA 3DM2B 2QSWA 3I4HX 1OQ3A 2IM3A 3JTNA 3MM8B 2LXFA 4I0WA 4DS4A 1JX4A 4ELTA 4DL7A 1C0UB 3FFIA 4HLBA 2BVZA 2GNKA 4LF6F 4PQUA 5GVQA 1OWXA 3PIPQ 3OSPA 2HS3A 3M6VA 2LEAA 4ZPDA 3SCKE 5D6GA 1R89A 2HQIA 2NUUG 2XSFA 3FZ2A 1VQKS 3QJPA 4YR3A 4YUDA 1ZYQA 3TUZC 1S1WB 4PRFA 3OTDA 1LXNA 3V4MA 4KKOB 3K2YA 1N54B 4V19J 2DGVA 4OJHA 2FJEB 4NPOA 4KPYA 4LF4F 2MXYA 2UVRA 4BS2A 2DRAA 3D54A 4H4KA 1G6BA 2IM0A 2Z2LA 2XMMA 2DHXA 3LOUA 3LWMA 1DFDA 2DGXA 3CPWR 1C4AA 4FN5A 2J8AA 2YWGA 3D0IE 4HVZA 5A8WA 2ZH3A 1CEZA 1R0AB 1ZOTA 2XY5A 1YRTA 1H7XA 3U1MA 5MLCV 4MYTA 1GXLA 3DC2A 1K1QA 1S6QA 5JXSA 2ZH5A 4C3KA 1TP7A 1WF1A 2PE8A 3B8HA 4QCLA 5GAEU 3TA0A 4WJBA 4JI8F 2RT3A 3AH6A 3GWCA 1HWUA 3O44A 4MJKA 3J7YI 3CTRA 1VK8A 1HNZF 2UV8A 1VQ9S 2IA0A 3AHPA 4WE1A 4KFBA 4B9UA 4OL8A 3QLHA 1G2EA 3DLJA 1FE0A 3GR1A 4IG3A 4I69A 1ZTWA 1S1XA 2CVIA 1S72S 4IR1A 1X4AA 2OPQB 3POTB 3BQ1A 3K5PA 2YX7A 1XERA 2EVZA 4ED8A 1JJ4A 2VBWA 1FDDA 1NJXA 1N88A 3J7ZT 1N0UA 2IRYA 5CHCB 4PQAA 4ZOSA 1FRKA 4FXVA 1F2GA 1GAOA 4F67A 2OPRA 3PJWA 2KFNA 1SB6A 4AFFA 4DV4F 2GHPA 4YQWA 1Q86T 4UW2A 3VQTA 1ZAXA 1LWFA 3MMBB 3MTKA 1YSJA 1ZBTA 2OMOA 2BANA 3DOMA 4NLGA 1TKXA 2ROEA 2CPEA 3O2IA 3NAIA 4JI6F 4UQGA 4ES3A 4GC7A 3AY0A 1HW8A 3TP2A 4Y2KA 4F4WA 1NKBA 1XMBA 4MK9A 1N32F 2IVYA 1YTYA 4DUYF 4UUWA 5IT4A 2XWXA 1WG4A 3FMWA 1WWHA 4A48A 1F9FA 1BGXT 2CIMA 3JSMA 2OKQA 4EBEA 3MM9A 5AXMA 3K8WA 1KS2A 3HF5A 1VI7A 2DHGA 1SH2A 2E1AA 2C3YA 4N77A 4NLYA 4Z2XA 5KFQA 1RA7A 3MEDA 2BQUA 4RW7A 2OPSA 6FD1A 1Z1ZA 4A8WA 4Y28C 2BDPA 1IKVB 2FLLA 1X5TA 3FFIB 5I3QA 1BC6A 2HVHA 3OLBA 2DPJA 2J0SD 4PQUB 3X3UA 1E6YA 3M8RA 3RRGA 2GIQA 2YNIA 3AB2B 3TUJC 3CCUS 3FQKA 4ED3A 3T5LA 2KU7A 1SXLA 1K0TA 1FKPA 3EPIA 5AE3A 1X4EA 4OX7A 4EYHB 5F9LA 1JLCA 1K1SA 4URQU 5BYRA 2C2EA 1NK7A 4PWUA 2FHJD 3PW4A 2FVPA 3MAQA 4BBYA 5A2QY 4NA1A 1JB0C 4WYWA 2NREA 2W9CB 1BD6A 2W8LA 1XTZA 4IQMA 5KFRA 3U02A 1Q82T 1AROP 4BC9A 4B9SA 2O67A 4NZ6A 1KOHA 3MM5A 4YR0A 5A8WB 4Y00A 2MQQA 1VMBA 4K4ZA 4NLWA 3ZZYA 1QY7A 1Y3KA 3PW5A 5CXTA 1R7IA 4W92B 3MUVP 5I3PA 4HEA9 4QOTA 3BSCA 4OLPA 4TYAA 2JLGA 2ATLA 2HHVA 1FVQA 3U1LA 1DQ8A 1X4HA 3E51A 1UVLA 1CG2A 4I7FA 2EPIA 2NR0A 3BSOA 1CC8A 2JEGA 4WE1B 4KFBB 3QLHB 4IG3B 4WIIA 1S76D 2M0GB 1Z2ZA 3DDKA 2M2BA 1VS3A 5BR8F 1SJ1A 3IS9A 2KFYA 4X65F 4KAIA 2DBBA 4JI3F 1U1QA 1XR5A 4O4GA 1VQPS 4C0HA 1WACA 1QM9A 2DHAA 3NMRA 1YJ9S 3IWLA 4Y65A 2CPDA 1XN9A 2KT2A 2R2TA 1X0FA 1L3SA 1T7PA 5B0BA 2OSQA 4ELUA 5LMUF 2RU3A 1TQLA 2OPRB 3P49B 2KXHA 1F0XA 1UEVA 3LPYA 1C1BB 1LWFB 1S9EB 2I9SA 2XGPA 2CQ0A 2FJXA 2BANB 3QIPA 4YB6A 4NMLA 1TKXB 4IH6A 2M8DB 4TU7A 4DG1A 4PWDA 3IC1A 2YWKA 2AWZA 3MFHA 4QYZJ 3QGPA 4IDKA 3NBPA 4H4OA 1KQSR 1KEKA 1LWEA 2DT9A 2DNRA 1Y00A 4DLGA 1Q16B 3GYNA 1N4LA 1YBAA 3B78A 3N4WA 5KT2A 2D3OR 1JXLA 1Z2LA 4UQTA 4ICLA 3JSMB 4C3LA 3MM9B 3I0SA 3EYZA 3IWNC 3MR2A 2GQCA 2PO4A 1WTBA 5DGBA 3MEDB 4RW7B 2OPSB 3ULHA 5J2MA 3VWSA 1E6VA 3OTOF 1E6YB 1O0PA 2YNIB 1UL3A 1U2RA 2RQMA 5B7WA 2KT3A 4C7QA 1FKPB 3W2WA 2QFJA 4JBCA 3O6QA 2B6AB 1TL5A 1Q7LB 4ECRA 1FJ7A 2VONA 1XWLA 4HDGA 3CCVS 3DFEA 2CFXA 5THWA 1YJVA 3WBZA 4DWIA 3AQPA 4OV1A 1M1KT 3X1LB 2AJQA 3AJ1A 3UWTA 3OLAA 2AX1A 2ZOMA 2GMJA 4IH5A 2V8GA 4PG7A 1GTEA 4OMFG 3SYZA 2IC3A 1MWYA 3KG4A 3WX4A 5E5NA 4ZCIA 2DCLA 2DIUA 4PR6A 2W9AA 4MAKA 4N41A 4X64F 4C8ZA 2UXBF 4OI1A 1IKXA 1P8GA 3IA0A 3TUIC 1RT2A 5D4OA 1QAIA 1TK0A 5M2PA 3N79A 4I7FB 1HNXF 3HO1A 1G3OA 1T03A 4A8QA 1QUPA 4DR4F 5EGYA 5J2QA 2E1CA 2E9TA 4OI2A 1UVJA 2F8HA 4CO0A 3F56A 4NA2A 4TQSA 4DF4A 2BRKA 1QE1A 2PT0A 4P6QA 4TY8A 2UU9F 4BDPA 4O4GB 2RMLA 4B02A 5L1JA 4DSJA 2V4JB 1C1CA 1SV5A 5B08A 3ZZTA 5T41A 1FD8A 1LWCA 4TQRA 4J37A 2MQPA 3DOKA 2ZE2A 4ZPWR 3DRSA 2XWYA 3M8SA 1HWKA 4JI1F 1TFYA 2HW3A 2LXIA 3CCTA 1LW0A 3GG0A 1YJNS 3DLHA 3QIPB 5DDRC 2HFOA 4DG1B 1O8BA 4PWDB 3AB4B 4J9SA 3CC4S 1S4FA 4IDKB 5CD4H 3NBPB 3IRWP 4H4OB 2VC0A 4FNHA 1VHFA 4DR6F 4NL5A 4U7CA 3TA1A 4OZ0A 4O23A 1JMTA 2YNFB 1T05A 1SIZA 1KD1T 2YKMA 3UR0A 3NCPA 2LECA 3T1YF 4DV2F 3N5BA 5FIIA 1TAQA 3CCWA 4ICLB 1UJ5A 2YVSA 1Z4UA 3I0SB 1O51A 3GILA 4J9KA 4DSIA 4WU3A 3L7PA 1X4CA 2DH9A 2YKAA 4NYPA 4QIFA 5LSRA 3HPOA 2KZZA 3CJ2A 3BDEA 5J2MB 1HYSA 2JSXA 2RF2A 3B82A 1WG5A 2MKSA 4KC5A 2DITA 2YNGA 4ALZA 3G86A 2R7VA 1E6VB 2Z8QA 4OHVA 1JNRB 1VJWA 2B4OA 4ECTA 1U1LA 3QZ8A 1R8PA 1IBKF 1A7GE 2P6SA 4UUXA 1WG1A 4QU7A 1TAUA 2RVJA 2KZMA 2VPXB 3MEGA 7FD1A 4YDXA 2MQOA