4B3MK

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4b3mK00
4LF5K 4NXMK 1XNRK 5IT9O 4YY3K 4JI7K 4JI4K 1XMQK 5A2QO 4DV7K 4JI8K 4OX9K 1IBMK 4X64K 2VQFK 4LF9K 1IBLK 4LF8K 4LF7K 1N34K 5IWAK 3T1HK 3OTOK 4DR3K 4DUZK 4LFBK 4JI5K 2UXCK 4DV1K 5LMUK 4DR4K 1HR0K 2HHHK 4DV3K 4DR7K 4LF4K 4DV5K 4DUYK 4B3MK 4JV5K 4JI2K 1N36K 4GKKK 5FLXO 4DV4K 1N33K 4YHHK 1XMOK 1HNWK 4KHPK 5AJ3K 4JYAK 2UU9K 1XNQK 3J7YP 3J81O 4CVNE 4LFAK 1J5EK 2E5LK 2UUCK 4B3SK 4DV6K 5BR8K 2F4VK 4B3TK 4K0KK 4V19S 4DR6K 4JI3K 2VQEK 4DR5K 4JI6K 4DR2K 2ZM6K 4DR1K 4NXNK 1I94K 4X66K 4GKJK 2UUBK 1IBKK 2UXBK 1HNZK 4DV2K 1FJGK 4JI0K 2UXDK 3JAMO 3T1YK 4X62K 2UUAK 4JI1K 4LF6K 3J7AP 4DV0K 4LFCK 3J80O 4AQYK 1N32K 4X65K 4CW7B 4B3RK 1HNXK 5LL6Z 5LMNK
chains in the Genus database with same CATH superfamily
4IEEA 1EQYA 1JXEA 4B9QA 4JI4K 2Z1HA 1GOAA 5C12A 3C6UA 4IG3A 4CZLA 5M1PA 1RGIA 4CJTA 4LF9K 4B9TA 2VGMA 1BDGA 1T6DA 3SAHA 2XY8A 3QEPA 2F8SA 4DFPA 2A6AA 4YDUC 1O13A 2P9IA 1BISA 3MX5A 5TKWA 5E41A 2OZMA 4FL9A 3R1XA 2OCEA 2D0PA 2A42A 1LWFA 3PSIA 1VQON 1J5OA 3TI0A 3C7NA 4JKFA 1QQOA 4AILC 1BHLA 1ATRA 3IS9A 2B6AA 2IVPA 2HNZA 4YDUA 3L2VA 5BRHA 1BCOA 2YKNA 3CCSN 4O4GA 1YJ9N 1ZBUA 3LANA 3VQ6A 2LSNA 4JS4A 4CZIA 3C6TA 4B9UA 2RPIA 4ELVA 1HMVA 4FO0A 1BCMA 3D2FA 3OYAA 4YOTA 4BR0A 4U67L 4XH4A 4V19S 1GLLO 4ISEA 3WT0A 3U4LA 4AHSA 1MWMA 2O8BB 3D7EO 4DF8A 3SUPA 5FRMA 1JLFA 3LPUA 4FPAA 1JKHA 1NNEA 4HUEA 4M3RA 1CZAN 3AVJA 4K43A 2HBKA 3O8MA 4CGFA 2KZZA 3Q7CA 1RBSA 4Z4CA 1M1KO 4B1YB 3VF4A 3VQPA 4BE0A 2HB5A 1R0AA 4B9SA 3I0RA 3VQQA 3VF6A 2P9NA 1N32K 5JS1A 3EZWA 5AZIB 4CZKA 4CFBA 4A2BA 4F3TA 3O4QA 5AQYA 1YJNN 1NBWA 2Q36A 4B3RK 1NGGA 2DFEA 3OVNA 2QKKA 4KTWA 3BEXA 2P9UA 3ZX0A 3VQAA 3AVIA 3TAGA 3PUFA 4LF5K 4MLEA 3CM5A 3MN5A 3L2RA 5F2RA 1VQ5N 4BQLA 3DM2A 3M5RA 2PZSA 2BE2A 2GELA 4B1VA 2XY7A 1L5UA 3PO5A 3T1HK 3P39A 3NF6A 1WOQA 4XIUA 1KD1O 1VQNN 3G4SN 2UXCK 3EZ5A 3RMBA 4CHQA 4FLXA 4DR4K 3AO5A 2JLEA 2D0BA 5BPNA 3OBYA 1BA1A 3LDOA 1LCUA 2G8WA 5GAEP 4LF4K 1DEJA 4FOIA 2OPPA 1C0TA 3OYKA 4B3MK 1BU6O 1W9HA 3CJ1A 3I0SA 4O8UA 4JI2K 2RN2A 1GLJO 1ZBFA 3ZT3A 3EYZA 4OPAA 4KI6A 3K59A 3CQ8A 5FLXO 1X3MA 3WQUA 3DOLA 3E1YA 2OTJN 3I8DA 3HRGA 1IG9A 4CJFA 1QE1A 4H0OA 4EAHD 2QWLA 5AQUA 3K5NA 4HWIA 4CVNE 2ZJPL 4BG8A 3O3HA 5HP1A 4K8XA 2F4VK 3VQ7A 2FF6A 1WSEA 4KHWA 3ID8A 3L8BA 1KVBA 2QXLA 3A5LC 3OY9A 3LP2A 3MMVA 1X9SA 4JKCA 3VEYA 3N4QA 1FJGK 2HF3A 3SK3A 3CM6A 5T7BA 3CC7N 4PHTX 4U7BA 1E4GT 4TSXA 2ZGYA 2HW3A 3TTDA 4CD3A 2CGJA 5KRSA 1U6ZA 1IKYA 4R79A 1ZBLA 3ZYYX 2VCPA 1NOZA 2QWQA 2RKIA 2WC9A 1NJYA 2HVHA 2KZMA 1VRUA 3P38A 3VA0A 2WOMA 2QM1A 4FSVA 5JLFA 2HOEA 4FLVA 4QOZB 3DAWA 1ILYA 3GDQA 4HTLA 1C1AA 3LP3A 2X6NA 2A1SA 3FLCO 3AA5X 2A41A 2O4GA 4CZEA 3BP8A 1NJXA 3DRSA 4OPHA 1ASWA 2E2QA 1Y64A 5IWAK 4AHCA 3SQ1A 3CD6N 2HHXA 4W5QA 4LSNA 5KGWA 3E01A 4PKIA 5KPZA 5GADP 4MQ3A 3QLHA 3ZT1A 3W3DA 4FJ9A 3I55N 3I33A 5HRRA 2G8UA 3ITHA 4NLBA 3WEEA 3L2WA 3QMLA 4FWLA 3TR8A 3CC4N 3HOTA 5KI6A 4KB0A 3PIOL 3WUHA 4H0YB 3DYAA 4AHVA 3QNOA 2QTDA 4H5TA 4OVLA 1S6QA 3IDHA 4B1UB 3HM8A 4CHNA 3KZBA 1EXQA 3L6QA 5AQOA 5KPTA 2BUPA 4Z4GA 2G8KA 3DRPA 3DLEA 4CEFA 4CJWA 4BQZA 2UUCK 1RILA 4KO0A 2X74A 1VSHA 3K5MA 4IBNA 5C15A 1TKTA 5EOYA 3OYBA 3O4WA 3IKMA 1Z05A 3JS6A 3TAMA 3SZ2A 3T69A 3VEZA 4IDHA 3CIPA 2F9TA 4NYFA 3HT3A 1NK8A 3DLHA 2HHWA 5ADXH 2ASPA 4DQQA 2A40A 3EKUA 4BC2A 5GIPA 3CPWM 4RTFD 1HPMA 1TK8A 4B1ZA 1NGIA 4JI1K 1SL2A 4W5OA 1BUPA 3IG1A 3L4QA 3LDSA 3M3ZA 4YNQA 3C7NB 3SQ2A 4OPJA 1T05A 3PX0A 2Y1JA 4I2PA 4E89A 4Z4HA 5J2MA 4M3TA 3U3YA 1K8KA 1K6YA 2W6KA 3VEOA 4H4OA 5CE3A 1T8EA 2JWKA 5DM6L 1RT5A 3CJBA 2HHTA 3JSMA 4DS5A 3QEWA 2A3ZA 3DLLL 4K42A 1NGCA 4IEIA 3MN6A 3ISNC 4KTZA 3VQEA 2VQFK 3ZETB 4A59A 1CZ9A 1TGOA 3OS0A 2P9PA 4M7YA 1X9JA 4DUZK 1JL1A 3LAKA 4JI5K 1E4FT 3NAEA 3QETA 4DV3K 1ZBIA 1YTAA 2ASMA 4H03B 3ZEUA 3HTVA 3L4IA 4CF9A 5EVZA 4JK9A 4PUOA 4DR7K 5M1FA 1WSFA 2Q0RA 4C8OA 4DUYK 3C94A 4ILHA 1MWKA 4BRMA 1JJ2M 1VSKA 4DQ8A 4N56A 1HNWK 4FJGA 4QS9A 1N5YA 2OYQA 1YIJN 3DLRA 3QEXA 4Z4EA 3KLHA 3OYFA 1Z26A 4A2AA 4M3XA 3CG7A 1CXUA 2BTFA 3J7YP 3OW2M 3CCJN 1QSSA 3WXLA 2BDPA 4JRQA 2VGNA 4IO9L 1BWFO 4IG0A 3KD1E 4M42A 4FXDA 4K0KK 3F2KA 3ZSRA 3SAGA 4DR6K 3RR7A 1QQMA 4YOXA 4RWTA 4WQ5C 4OLAA 3KLFA 4BRIA 3RVCA 4L8RB 4MO4A 4MDBA 1YAGA 3HZ6A 3PY8A 3MXJA 4I6MA 3THYB 4BRFA 3HBTA 3KWIA 3T1AA 4Y1DA 2WUSA 2W6LA 4AQYK 1NK6A 3EKSA 1KQSM 2Q1NA 2YCHA 4CIEA 4HUGA 2D4WA 1HQUA 3LDNA 3F9MA 4C1NI 3WNGA 5LL6Z 1A5WA 3AVCA 1JL2A 4BREA 3VEVA 3LWMA 2O8EA 1BOTO 3HM9A 2DPNA 2OPRA 5FROA 3AO4A 2ZJRL 4AH9A 4DLEA 2QK9A 3ZSOA 1LW2A 3RMCA 1MU2A 2XRIA 4DSKA 4WFNL 2FF3B 4BR2A 3QFUA 3QICA 2JWLA 4KKOA 4IFYA 4DSFA 3ZCMA 4ZHRA 4HUFA 3O9UA 1T7PA 4JKGB 3ZT2A 1U4BA 3E9PA 1WAFA 3NF8A 2VWBA 3KVGA 5BRDA 1GLBG 1B9DA 2P5GA 1A5VA 4EFHA 2V7ZA 1R59O 3CQXA 4BVOA 3NMUA 2IAJA 3MWTA 3KK7A 1N36K 4O0IA 4CZMA 4DTOA 3FFIA 5FPMA 1WB9A 1BG3A 4H0TB 3KIOA 3OYDA 1QZ5A 4FLTA 4BRHA 3AVKA 3TSUA 4CGGA 1VSIA 2Z1GA 2E5LK 1SUQA 2KFNA 4CK2A 3TSQA 4B3TK 4FK2A 1ZYQA 1NJWA 3LPTA 3E66A 2FLOA 2P9PB 4CEDA 3I56N 4IOCL 1IH7A 5TKYA 1Q9YA 2P9KB 1WBDA 1JLBA 3QIOA 4B8CA 1IBKK 2ZD1A 5AR0A 3MCAB 2X78A 4EHTA 4CEAA 4DMNA 3PV8A 3KD5E 2E20A 2W42A 4EP4A 3HSTB 2BH1A 2WTUA 3S3MA 2IVNA 4NB4A 4O5BA 1FK9A 4BC3A 3PX4A 2VWJA 4PWDA 4BROA 3OYIA 3J7AP 2EHGA 3CFPA 4WF9L 2V51B 4BDYA 3HYFA 3VETA 5JMVA 2D0CA 2E2PA 4E1NA 4FJXA 1Q18A 1S3XA 3H3OB 4B9NA 4A61A 4M3UA 1WBBA 5AQSA 3RR8A 4B9LA 4BDZA 1RTJA 3MDQA 3K9KA 1XMQK 2I7NA 1KAXA 3K5LA 1BIUA 3KK2A 4JI8K 4F8RA 2A5XA 3NVMA 3VENA 2PY5A 1HNVA 1GLFO 1X1PA 4FWKA 3NGZA 3AA4A 2E4LA 3SLCA 3F73A 4AHRA 3M8QA 3OS2A 1J6ZA 3GG4A 1RNHA 2YKMA 1RFQA 2HMPA 4J2EA 1F21A 2NLXA 3P83D 2EWSA 4FW1A 4DU4A 3LDLA 2HSTA 1TKZA 4FWRA 3TAFA 3H1VX 1S5JA 2YNIA 4WYBA 4FLZA 3LALA 4H0XB 4FZZA 4KRFA 3OYMA 1XNQK 4AHTA 1NGHA 4DSLA 4PKGA 5DK5A 4CJKA 3A5NC 4KREA 3R9PA 4FLWA 4H0VB 5C0YA 1MA9B 1SL0A 4FJ5A 2QWRA 3RMAA 2DFFA 4JI3K 1P90A 4B1XB 2O8DA 3AVAA 3ZETA 3N4PA 5ADXA 4JKDA 3KK1A 3THYA 3DJCA 1QQCA 3RMDA 4KHYA 4BY9C 5CZ2A 1S9EA 1UA0A 3HJFA 4IXCA 3JYTA 1WSHA 1CXQA 3DWLA 1NG9A 4GW6A 3CF5L 4Z94A 5HRSA 3QDKA 4JEPA 2RF2A 2O8CB 4F2SA 4FWQA 3ZSWA 4PY5A 5C42A 2V52B 4FVMA 3WXIA 4O0JA 4FLYA 3EY1A 5GINA 1BGXT 5C2FA 1C0GA 1HNXK 3U9ZA 3BDPA 2GWKA 1H1VA 4NXMK 4CIFA 1WAJA 1SZ2A 3O9TA 4C1NK 2Q97A 1BQNA 5CR4A 4FM2A 1JLGA 1VSDA 2VG7A 1GOBA 5K14A 4CEQA 1IJJA 3B8AX 4B3OA 4JKHA 3PX6A 4J2AA 2O8DB 4DU1A 1T44A 2GX9A 1S1XA 5LMUK 5AQIA 4NCGA 1OH7A 3CFOA 3ZEUB 4BR4A 4I9LA 4FWPA 2P9NB 4JN4A 4CGDA 2ETJA 4JD2A 4OKEA 1SV5A 1LV5A 2ATQA 2KW4A 3MWPA 1EO1A 5FRNA 3S3NA 5LJVA 3SPYA 4FZYA 3BF3A 3SMSA 3QFPA 3K57A 2EX3A 3H46O 1D8YA 4DQPA 1EWRA 5E26A 2X6SA 5M1OA 1E3MA 3SV3A 1NKCA 3CJCA 5DMRA 3THWA 1VSJA 4B3SK 4BC5A 4LSLA 3SYZA 1XQSC 3VESA 4NCBA 3TU5A 3QEIA 4KHNA 3O4NA 3AO1A 3QEVA 4B1WB 2QWMA 2IDOA 3EL2A 4CK3A 3O5BA 1DLOA 3DRRA 4DU3A 4DV2K 4G1QA 5AZJA 4B9VA 1NGFA 4OJRA 3A2FA 4XEIA 4EZ6A 2QI2A 1BI4B 5KQDA 2O8FA 1U04A 3EE9A 1YITN 1RT1A 1IKWA 4ISFA 3P5JA 1T03A 4CJVA 4X65K 3AVGA 5KGXA 4CHZA 3G71N 3O1BA 1Q7YO 1GOCA 3IAYA 1HYVA 3C0BA 4MDAA 3U8XA 3J7ZO 4DHYA 3SMPA 3AA3A 3VMFB 2IOCA 4FJHA 2XY5A 2P9SA 1N34K 1NGAA 3E9OA 1KTQA 1FW6A 3OTOK 2O8BA 5CYQA 1VSFA 4FM0A 3VQDA 3DLGA 3QNNA 3TARA 3KLIA 1KLNA 5BPLA 5I3UA 3TTFA 3CCRN 3KLEA 5AZJB 2ZQBA 1Q81O 1B92A 4H5NA 3CCVN 3VQCA 4KBOA 4QS7A 4DTRA 3KKRA 3WNHA 1RDCA 1U45A 1HNIA 4H5VA 3HP9A 3NF7A 3LM2A 3SNNA 3C95A 5M1NA 2PAVA 5HRPA 3OJUA 1C0MA 4M7XA 2G8FA 5EU7A 1NK7A 1M90O 1YI2N 4CGIA 3P31A 4JYAK 4FJIA 5JVHL 4ICLA 1JLAA 4CFCA 3PLAA 4OLBA 1VSEA 3ZX2A 3BGRA 4IOAL 1TL1A 2PFUA 3MCPA 5AQWA 2E6LA 3MX2A 3VQ5A 3PSFA 4DB3A 4ILGB 3CCEN 1TVRA 1VK0A 4Z4FA 1D9DA 1HLUA 1IV0A 3SJHA 2VQEK 5AQNA 3FE1A 4M41A 2ZM6K 4YOWA 5AQFA 1HNZK 1NKBA 1JLQA 4CCHA 3A5OC 1C1CA 4W5NA 3CJAA 4RW9A 3EE8A 3Q7BA 1YVNA 4JKEA 5AQPA 4YFUA 1TAUA 5H1SQ 3ULEB 4DFMA 1L3VA 3FZKA 3J8AA 4F3OA 4W5TA 3ZLJA 1XI1A 4FLUA 3CI5A 3OA9A 4CW7B 4JHDB 4OPKA 1NLVA 4DTUA 2WONA 3F5TA 4C8MA 4E1JA 2AJQA 1RT4A 2F96A 1K8KB 4QCLA 1I3AA 1UOCA 2CGLA 4H4MA 1I39A 5A2QO 4ELUA 1G15A 1FKPA 5BREA 2KFZA 4CGHA 2QWNA 1D9FA 3FFKB 4CFDA 3R8EA 1YT3A 4BWJA 4EZ9A 3AVFA 1WSIA 2DTUA 2YHXA 4AF1A 1LAVA 3ATVA 4IJNA 3ZT4A 3G10A 3K9JA 1QQNA 2VYPA 4BRGA 1EX4A 1SKRA 1TUYA 2OPQA 1NMNA 3O3GA 4GKKK 2YJEA 4B08A 4YHHK 2GBZA 3CCQN 3K58A 1Y97A 4DCHA 3O3FA 1OH5A 3EEQA 3VQ4A 4GV3A 1S1WA 5BN8A 1VHXA 2P51A 3THXB 2NRWA 4BRKA 1K8AO 1K9MO 4DLGA 1RT3A 2P9LA 4FJLA 2IS3A 4FWSA 3S9HA 4DKWA 1V4TA 4YOVA 1NWKA 2UYTA 2VG5A 5I9EB 2Q0UA 2E8AA 2YHWA 4PQUA 1REVA 4DTPA 2P9KA 3T7ZA 1YUWA 3HP6A 1GLEG 4WCEL 1ASVA 1RT7A 1WSJA 1ZBSA 3CFRA 5DM7L 1BA0A 3PIPL 1BQMA 3SV4A 3WXJA 3AVNA 4E7HA 2ZE2A 4CHPA 1YXQA 3ZSQA 3HO1A 2KLAA 1HKGA 3D0PA 1CLQA 1VAZA 4FVUA 4K41A 4MFBA 4H0PA 1NK5A 4YOYA 1KLMA 3P4IA 4CBUA 4CHYA 3AVBA 1ATSA 3RRHA 4FJ8A 1W2BM 2HBLA 4BGAA 2QWPA 5F0XA 1IKXA 3O9RA 4DSIA 3K0SA 3HSCA 4YY3K 5AFUA 3THXA 3TWHA 3NF9A 3OYCA 3LZJA 3AARA 5AQMA 4ISGA 2QW9A 4RW8A 1IBLK 1DTTA 1D5AA 1S72N 3VQBA 5J2QA 1EP4A 3TAEA 3ENHA 3AGKA 5LJWA 3ZT0A 4CZFA 3RTVA 2CH5A 3UKUA 4CJUA 5J1EA 1TK5A 1KRPA 3D2EB 1WLJA 1RCHA 1RDBA 3QO9A 4JNEA 2HBMA 2FBVA 4E7KA 4ELTA 3JXUA 3AY9A 3WXMB 3HXMA 1TYQB 2NZTA 4CZHA 4M3YA 2O8FB 2KTQA 5J2PA 4CEBA 1GLDG 4I7FA 4LH5A 5AZIA 1DKGD 3OYGA 1JXBA 4FJJA 4PL7A 3K5OA 5AQGA 3VGLA 1T6CA 1J53A 1KFSA 1OKJA 3VN5A 1Z25A 1Z6RA 3BZCA 3VEXA 3OYJA 4FJNA 5BPMA 4GV6A 1XC3A 4CJ7A 1NK0A 5C10A 1UA1A 2OZSA 1I94K 4NXNK 2ZGZA 3I8BA 3U9DA 3KK3A 4KH5A 3MECA 3DXKA 4GNIA 1TL3A 2NRRA 3LP1A 4CJ4A 1QS4A 5FPNA 3TSPA 1YVUA 1X3NA 4KHUA 4B8AB 1SAZA 1U48A 1NMDA 3NFAA 3TANA 5AQQA 4KB1A 3MXMA 1RDDA 3MN7A 3CC2N 5CYMA 2NRXA 1BO5O 1RDAA 4M45A 4BACA 1OH6A 2QWOA 3FZLA 1V4SA 2WFBA 2QA4N 4BRNA 2AA4A 1Q9XA 1NGDA 4NO7A 5E84A 2E2OA 4H5WA 4LH4A 4BE2A 3V9WA 4FWNA 3VEWA 5D3GA 1RBTA 4JI7K 3B6PA 3DMJA 3AO2A 4ZTFA 4OX9K 1VQPN 3CMAN 3GBTA 3CHWA 5C24A 4AHUA 3TPQA 2YHBA 4DFKA 2P9IB 3OYNA 2QXFA 4LFBK 1U2VB 4GVMA 1EETA 3HPGA 3AO3A 4RG8A 4E7LA 3SQ4A 4IDKA 3NCIA 3FZHA 1U49A 5EX5A 1NM1A 1ASUA 3TAPA 4BRAA 3NH1A 3E9LA 4EHUA 1C0UA 3V9UA 1N8RO 4DV4K 4CJEA 1P8ZA 1ESVA 4ID5A 5AQLA 3EN9A 4Z0UA 1N6QA 2XHBA 4EP5A 2UU9K 1IG8A 1NGBA 3C65A 5AQTA 2HHSA 5AQHA 4UY8O 4DTJA 3LAMA 2HHUA 2O8EB 2PYLA 3O08A 2V7YA 3VA3A 1JLEA 1KAZA 3THWB 2YNGA 4KHSA 1ZBHA 1C1BA 4FCYA 1WUAA 4JK7A 5JS2A 3BF1A 1SL1A 2DY4A 2ZJQL 2E88A 2UUBK 4C8KA 2F9WA 4IO8A 4LD0A 4O8KA 1BI4A 4CK1A 4FJMA 2E6MA 4JKGA 2E2NA 4FW2A 1SKSA 1RTHA 3IFRA 3QIPA 3NDKA 2UUAK 2D0OA 3PO4A 1HX1A 3ZSXA 4LF6K 3DLKA 4FOEA 2ASOA 2YHAA 4IWVA 4O5FA 3WNEA 3UE5A 4Q5VA 4DFJA 2Y1IA 3UIQA 4JRPA 1S1UA 5AQXA 1L3TA 1YHQN 2GTDA 4IKFA 3R3LA 3O6WA 1ATNA 4NLCA 4BR7A 2G8VA 1NKEA 1L3UA 4WFAL 4CEEA 1EKEA 2P9SB 2F8TA 3A0IX 3QESA 4MLHA 1LWEA 3CQYA 2KKZA 5MLCQ 4X64K 4LF8K 1QZ6A 2IC3A 3SUQA 4FPBA 3ULDA 4NYNA 4DTNA 4HCBA 5B8HA 1TAQA 1NK4A 3VPZA 3VERA 3LL3A 3WEEB 1W0HA 2HNYA 4Z4IA 4DQSA 2D0AA 2Q3SA 4OKKA 3T19A 5LY3A 2O8CA 4BRQA 5SWMA 4CD1A 3SJJA 1KSPA 3UKRA 3ATUA 1HKBA 3IUCA 3ZSYA 3HVRA 3IRXA 4CJQA 3HVTA 3HPHA 3RSEA 4A5BA 1RT6A 3H1QA 2A1RA 2GEMA 3W0LA 1HYZA 4OGCA 2FC0A 4MO5A 3NGIA 4GV9A 3VF2A 4CZGA 1D4XA 3DXMB 3AVMA 2OANA 1JLCA 2Q2RA 1FKOA 4HTUA 5BR8K 3SUOA 2VG6A 4E19A 4I9QA 3CMEN 1QVGM 1T3VA 1YF5L 1XWLA 1ITGA 2D1KA 3NH0A 4JI6K 1VQ7N 4HVJA 1QHTA 2PBDA 3NHGA 4DR1K 1GLAG 4X66K 3U3GA 3VQ8A 1NOYA 2B4JA 1BIZA 4DSJA 4CI6A 1SKWA 4CERA 1G99A 2WBNA 3OBWA 3QBXA 4JD2B 4E7JA 3OS1A 2KQ2A 4X62K 1TV6A 3VGMA 5HRNA 2W41A 5KQ8A 4WE1A 3F9KA 2O4IA 1RBUA 3CETA 2Z1JA 4CEOA 4W5RA 3MK6A 2YNHA 1JCGA 4YORA 4UQGA 1KVAA 5HLFA 4DQRA 3KKSA 5GAGP 5AQVA 3ENOA 3G25A 3D2FB 4F9OA 5JLHA 2P9LB 3LDPA 5BRFA 1XNRK 2XO7A 2GUIA 1W97L 4YOUA 1MDUB 5AQRA 5BN9A 1NJIO 2XY6A 2P1JA 2RHKA 2ITMA 4DR3K 3QINA 4FJ7A 4C23A 4DV1K 3VQ9A 1U47A 4CECA 2HHHK 3GOIA 1VRTA 4A57A 4FWMA 4E0DA 4JKAA 2ITGA 3SCXA 2H3GX 1LOTB 4NCAA 4Y0WA 3R6MA 2FBXA 4KPYA 3LZIA 4CHOA 4IZ9A 4XH1A 4CGJA 1RDUA 4BG9A 4A5AA 2AP1A 2IGIA 4BRCA 3CXCM 3OHRA 3CERA 1C6VA 1RDWX 4AM7A 3AA2A 1X9WA 1J5EK 3H3NO 1S6PA 4KI4A 4DR5K 3KJVA 1WSGA 4DR2K 4F4KA 3H6EA 3KTQA 4RW4A 3FZFA 1KC8O 3FGUA 1KVCA 2F7TA 2HHQA 1GLCG 2YNFA 2NRTA 3M1FA 3D6RA 3NE6A 3RRGA 4JI0K 2NRVA 3MEGA 1B9FA 2NNWA 3T1YK 4DQIA 3DLBA 1TUUA 4PL8A 3AAQA 5HOOA 2YV0X 3UKRB 4CJSA 1X9MA 4IOXA 1HYSA 4DS4A 1HPZA 4GMJB 4WQ4C 3V4IA 4DV0K 1RTIA 4CJ3A 3LWLA 4QS8A 3M8SA 4FYDA 3EO3A 3OYLA 1UWBA 1QTMA 1YTUA 4K25A 3SBTA 3L3UA 4H8KA 1VSLA 2VWKA 3VOVA 4CJPA 3L3VA 3SAFA 2D5RA 3OYEA 2B5JA 4CBXA 1JCFA 4J2DA 1C0FA 1KAYA 4O44A 4DV7K 1QVFM 1Q8IA 1UAXA 4A62A 4C8LA 1QHAA 3NGYA 4DSEA 4PA1A 4N5SA 3V1RA 3DXKB 1NGEA 4H5RA 1K73O 4LF7K 3UKUB 4IJAA 2PYJA 3L2QA 2FBTA 4FK4A 3NVKA 3FR0A 1VQLN 3CJ9A 5F1XA 5AQKA 5HBMA 1L3SA 3VTHA 1OVYA 1ZXOA 5KPRA 5M1KA 3NH2A 4WQ4A 3SQ0A 5BR9A 1BL3A 4ILJA 5AQJA 3V81A 4DTXA 3ZSZA 3BY5A 4CF0A 2CH6A 4BR5A 3MAQA 4RW6A 1KFDA 3B6OA 2P5OA 1RBRA 2YHYA 4Y1CA 4OKJA 4KHPK 3V9ZA 1LW0A 3QERA 2YI1A 3AVHA 3QBWA 3AAPA 3MN9A 4I2QA 4OGEA 5AQZA 3RWUA 2HBJA 3S41A 1RTDA 1XUPO 3TAQA 4HCCA 2FBYA 2E1YA 3ENBA 4CJ5A 1NU0A 2BANA 2BGGA 3KHYA 3AGRA 4I6MB 3IMXA 1QSYA 3GL1A 4BDPA 5M1QA 2OTLN 1ZC6A 2IVOA 3DI6A 1KCFA 4CJLA 3JAMO 3M6GA 1A5XA 1S22A 4BRDA 4KTQA 4LC9B 3ID6A 5FPEA 5CY4A 4LFCK 3HPOA 2DFHA 3LDQA 2FSJA 4CESA 2W40A 3T3FA 4HHTA 2QEXN 1DGKN 3RSEB 5J2NA 5KRTA 1HJRA 4BRPA 5ELZA 5HROA 2P9UB 2NUBA 1TK0A 5EY4A 4DTSA 4L3QA 3ALYA 4IFEA 3S3OA 4KHQA 3VGKA 4B9MA 4CF1A 4CFAA 1IBMK 4E1MA 4ZTJA 3DOKA 1IKVA 1FXXA 4IFVA 3ASMA 1J9AA 2I5JA 4FWOA 1HRHA 4N76A 2NRHA 4BWMA 4KFBA 3AVLA 3TABA 4M3ZA 4GVEA 2GWJA 5EXWA 5C25A 2HVIA 3L2UA 3CCLN 3O80A 2J4RA 4WQ5A 2IIRA 1TKXA 4J2BA 1N33K 5C2DA 3M8PA 2NRZA 1SS6A 2FXUA 5FDLA 1Q82O 4JHDA 3WXKA 4BGBA 1QSLA 1VQ9N 4QAGA 5AJ3K 3MEDA 3OJSA 3O1WA 2HF4A 4CF8A 4CEZA 4KV8A 4DTMA 4LFAK 4FM1A 1LWCA 3CPEA 4R5PA 4DV6K 4JAXA 3G6EN 3KLGA 4LY7A 1EWQA 3SI6A 4CE9A 2FSNA 4BR9A 3WQTA 3SUNA 1J54A 3AV9A 3H08A 1VSMA 4OO1J 4GKJK 1VQ4N 2OA8A 4BVPA 1RT2A 3BUZB 3D2EA 5FPDA 1W7AA 4GY2B 4AM6A 1SQKA 4O55A 3A5MC 4N47A 5JICA 5AFUH 2Q31A 4K8ZA 4M3WA 2HHVA 2UXDK 3HOSA 3CJ7A 1LAWA 3G0ZA 2E1ZA 3WNFA 4Q0BA 2ZF5O 4J8FA 3LM9A 4CF2A 5CHIA 3OYHA 4KH4A 3K2PA 5JVGL 4PKHA 4CIGA 3BZKA 3QB0A 1VQKN 3LP0A 1OVQA 5LMNK 3A8YA 3U6FA 4FK0A 1TKDA 2YX6A 5IT9O 1HKCA 3D45A 3ZSVA 3HL8A 4C8NA 4XH5A 1OH8A 2HNDA 4RW7A 5I42A 4FJKA 2FSKA 3FZMA 3CCMN 3V1OA 4CZJA 3HI0A 3SPZA 3V9XA 1HUXA 4G9ZA 1U2VA 3P1GA 3H45C 4JS5A 1HR0K 3L0QA 3NBPA 4E3SA 2Z1IA 1DTQA 3V6DA 1YJWN 5KTQA 1CZBA 4RCHA 2KHOA 4DV5K 2HMIA 4JV5K 4N41A 4F2RA 3ULEA 3KWGA 2G8IA 2QKBA 2ZWHA 1VQ8N 4CBWA 1XC9A 1XMOK 4BRLA 1IO2A 3SBGA 3V1QA 3M8RA 1RBVA 3UB5A 2R7YA 3TTCA 4BC4A 1TYQA 3MXIA 3DXMA 3GE1A 1S9GA 1DT9A 1XHZA 3V9SA 4DG1A 2I7PA 2OPSA 2CGKA 5HL7L 4JLHA 3CYMA 1VQ6N 3J81O 4ID1A 1VQMN 1NK9A 4WFBL 4BE1A 3CCUN 3C6HA 2GUPA 1NJZA 3HK2A 1JCEA 2YJFA 1XHXA 3VTIA 4JK8A 4CJRA 4FZXC 4JKBA 1WNSA 2UXBK 4KH6A 1KXPA 1O1WA 4M63C 5GIOA 3O9SA 2RE2A 5SZTA 5GAHP 3THVA 3C6AA 2GV9A 1Q86O 1NGJA 3O9QA 5CZ1A 2JGUA 1HJOA 1S1TA 4KAZA 4DWIA 3J80O 2G8HA 4EIAA 1S1VA 4DF4A 3ZX3A 4E7IA 3MEEA 1HQEA 1WN7A
chains in the Genus database with same CATH topology
4LF5K 4NXMK 1XNRK 5IT9O 4YY3K 4JI7K 4JI4K 1XMQK 5A2QO 4DV7K 4JI8K 4OX9K 1IBMK 4X64K 2VQFK 4LF9K 1IBLK 4LF8K 4LF7K 1N34K 5IWAK 3T1HK 3OTOK 4DR3K 4DUZK 4LFBK 4JI5K 2UXCK 4DV1K 5LMUK 4DR4K 1HR0K 2HHHK 4DV3K 4DR7K 4LF4K 4DV5K 4DUYK 4B3MK 4JV5K 4JI2K 1N36K 4GKKK 5FLXO 4DV4K 1N33K 4YHHK 1XMOK 1HNWK 4KHPK 5AJ3K 4JYAK 2UU9K 1XNQK 3J7YP 3J81O 4CVNE 4LFAK 1J5EK 2E5LK 2UUCK 4B3SK 4DV6K 5BR8K 2F4VK 4B3TK 4K0KK 4V19S 4DR6K 4JI3K 2VQEK 4DR5K 4JI6K 4DR2K 2ZM6K 4DR1K 4NXNK 1I94K 4X66K 4GKJK 2UUBK 1IBKK 2UXBK 1HNZK 4DV2K 1FJGK 4JI0K 2UXDK 3JAMO 3T1YK 4X62K 2UUAK 4JI1K 4LF6K 3J7AP 4DV0K 4LFCK 3J80O 4AQYK 1N32K 4X65K 4CW7B 4B3RK 1HNXK 5LL6Z 5LMNK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 K;  4NXM K;  1XNR K;  5IT9 O;  4YY3 K;  4JI7 K;  4JI4 K;  1XMQ K;  5A2Q O;  4DV7 K;  4JI8 K;  4OX9 K;  1IBM K;  4X64 K;  2VQF K;  4LF9 K;  1IBL K;  4LF8 K;  4LF7 K;  1N34 K;  5IWA K;  3T1H K;  3OTO K;  4DR3 K;  4DUZ K;  4LFB K;  4JI5 K;  2UXC K;  4DV1 K;  5LMU K;  4DR4 K;  1HR0 K;  2HHH K;  4DV3 K;  4DR7 K;  4LF4 K;  4DV5 K;  4DUY K;  4B3M K;  4JV5 K;  4JI2 K;  1N36 K;  4GKK K;  5FLX O;  4DV4 K;  1N33 K;  4YHH K;  1XMO K;  1HNW K;  4KHP K;  5AJ3 K;  4JYA K;  2UU9 K;  1XNQ K;  3J7Y P;  3J81 O;  4CVN E;  4LFA K;  1J5E K;  2E5L K;  2UUC K;  4B3S K;  4DV6 K;  5BR8 K;  2F4V K;  4B3T K;  4K0K K;  4V19 S;  4DR6 K;  4JI3 K;  2VQE K;  4DR5 K;  4JI6 K;  4DR2 K;  2ZM6 K;  4DR1 K;  4NXN K;  1I94 K;  4X66 K;  4GKJ K;  2UUB K;  1IBK K;  2UXB K;  1HNZ K;  4DV2 K;  1FJG K;  4JI0 K;  2UXD K;  3JAM O;  3T1Y K;  4X62 K;  2UUA K;  4JI1 K;  4LF6 K;  3J7A P;  4DV0 K;  4LFC K;  3J80 O;  4AQY K;  1N32 K;  4X65 K;  4CW7 B;  4B3R K;  1HNX K;  5LL6 Z;  5LMN K; 
#chains in the Genus database with same CATH topology
 4IEE A;  1EQY A;  1JXE A;  4B9Q A;  4JI4 K;  2Z1H A;  1GOA A;  5C12 A;  3C6U A;  4IG3 A;  4CZL A;  5M1P A;  1RGI A;  4CJT A;  4LF9 K;  4B9T A;  2VGM A;  1BDG A;  1T6D A;  3SAH A;  2XY8 A;  3QEP A;  2F8S A;  4DFP A;  2A6A A;  4YDU C;  1O13 A;  2P9I A;  1BIS A;  3MX5 A;  5TKW A;  5E41 A;  2OZM A;  4FL9 A;  3R1X A;  2OCE A;  2D0P A;  2A42 A;  1LWF A;  3PSI A;  1VQO N;  1J5O A;  3TI0 A;  3C7N A;  4JKF A;  1QQO A;  4AIL C;  1BHL A;  1ATR A;  3IS9 A;  2B6A A;  2IVP A;  2HNZ A;  4YDU A;  3L2V A;  5BRH A;  1BCO A;  2YKN A;  3CCS N;  4O4G A;  1YJ9 N;  1ZBU A;  3LAN A;  3VQ6 A;  2LSN A;  4JS4 A;  4CZI A;  3C6T A;  4B9U A;  2RPI A;  4ELV A;  1HMV A;  4FO0 A;  1BCM A;  3D2F A;  3OYA A;  4YOT A;  4BR0 A;  4U67 L;  4XH4 A;  4V19 S;  1GLL O;  4ISE A;  3WT0 A;  3U4L A;  4AHS A;  1MWM A;  2O8B B;  3D7E O;  4DF8 A;  3SUP A;  5FRM A;  1JLF A;  3LPU A;  4FPA A;  1JKH A;  1NNE A;  4HUE A;  4M3R A;  1CZA N;  3AVJ A;  4K43 A;  2HBK A;  3O8M A;  4CGF A;  2KZZ A;  3Q7C A;  1RBS A;  4Z4C A;  1M1K O;  4B1Y B;  3VF4 A;  3VQP A;  4BE0 A;  2HB5 A;  1R0A A;  4B9S A;  3I0R A;  3VQQ A;  3VF6 A;  2P9N A;  1N32 K;  5JS1 A;  3EZW A;  5AZI B;  4CZK A;  4CFB A;  4A2B A;  4F3T A;  3O4Q A;  5AQY A;  1YJN N;  1NBW A;  2Q36 A;  4B3R K;  1NGG A;  2DFE A;  3OVN A;  2QKK A;  4KTW A;  3BEX A;  2P9U A;  3ZX0 A;  3VQA A;  3AVI A;  3TAG A;  3PUF A;  4LF5 K;  4MLE A;  3CM5 A;  3MN5 A;  3L2R A;  5F2R A;  1VQ5 N;  4BQL A;  3DM2 A;  3M5R A;  2PZS A;  2BE2 A;  2GEL A;  4B1V A;  2XY7 A;  1L5U A;  3PO5 A;  3T1H K;  3P39 A;  3NF6 A;  1WOQ A;  4XIU A;  1KD1 O;  1VQN N;  3G4S N;  2UXC K;  3EZ5 A;  3RMB A;  4CHQ A;  4FLX A;  4DR4 K;  3AO5 A;  2JLE A;  2D0B A;  5BPN A;  3OBY A;  1BA1 A;  3LDO A;  1LCU A;  2G8W A;  5GAE P;  4LF4 K;  1DEJ A;  4FOI A;  2OPP A;  1C0T A;  3OYK A;  4B3M K;  1BU6 O;  1W9H A;  3CJ1 A;  3I0S A;  4O8U A;  4JI2 K;  2RN2 A;  1GLJ O;  1ZBF A;  3ZT3 A;  3EYZ A;  4OPA A;  4KI6 A;  3K59 A;  3CQ8 A;  5FLX O;  1X3M A;  3WQU A;  3DOL A;  3E1Y A;  2OTJ N;  3I8D A;  3HRG A;  1IG9 A;  4CJF A;  1QE1 A;  4H0O A;  4EAH D;  2QWL A;  5AQU A;  3K5N A;  4HWI A;  4CVN E;  2ZJP L;  4BG8 A;  3O3H A;  5HP1 A;  4K8X A;  2F4V K;  3VQ7 A;  2FF6 A;  1WSE A;  4KHW A;  3ID8 A;  3L8B A;  1KVB A;  2QXL A;  3A5L C;  3OY9 A;  3LP2 A;  3MMV A;  1X9S A;  4JKC A;  3VEY A;  3N4Q A;  1FJG K;  2HF3 A;  3SK3 A;  3CM6 A;  5T7B A;  3CC7 N;  4PHT X;  4U7B A;  1E4G T;  4TSX A;  2ZGY A;  2HW3 A;  3TTD A;  4CD3 A;  2CGJ A;  5KRS A;  1U6Z A;  1IKY A;  4R79 A;  1ZBL A;  3ZYY X;  2VCP A;  1NOZ A;  2QWQ A;  2RKI A;  2WC9 A;  1NJY A;  2HVH A;  2KZM A;  1VRU A;  3P38 A;  3VA0 A;  2WOM A;  2QM1 A;  4FSV A;  5JLF A;  2HOE A;  4FLV A;  4QOZ B;  3DAW A;  1ILY A;  3GDQ A;  4HTL A;  1C1A A;  3LP3 A;  2X6N A;  2A1S A;  3FLC O;  3AA5 X;  2A41 A;  2O4G A;  4CZE A;  3BP8 A;  1NJX A;  3DRS A;  4OPH A;  1ASW A;  2E2Q A;  1Y64 A;  5IWA K;  4AHC A;  3SQ1 A;  3CD6 N;  2HHX A;  4W5Q A;  4LSN A;  5KGW A;  3E01 A;  4PKI A;  5KPZ A;  5GAD P;  4MQ3 A;  3QLH A;  3ZT1 A;  3W3D A;  4FJ9 A;  3I55 N;  3I33 A;  5HRR A;  2G8U A;  3ITH A;  4NLB A;  3WEE A;  3L2W A;  3QML A;  4FWL A;  3TR8 A;  3CC4 N;  3HOT A;  5KI6 A;  4KB0 A;  3PIO L;  3WUH A;  4H0Y B;  3DYA A;  4AHV A;  3QNO A;  2QTD A;  4H5T A;  4OVL A;  1S6Q A;  3IDH A;  4B1U B;  3HM8 A;  4CHN A;  3KZB A;  1EXQ A;  3L6Q A;  5AQO A;  5KPT A;  2BUP A;  4Z4G A;  2G8K A;  3DRP A;  3DLE A;  4CEF A;  4CJW A;  4BQZ A;  2UUC K;  1RIL A;  4KO0 A;  2X74 A;  1VSH A;  3K5M A;  4IBN A;  5C15 A;  1TKT A;  5EOY A;  3OYB A;  3O4W A;  3IKM A;  1Z05 A;  3JS6 A;  3TAM A;  3SZ2 A;  3T69 A;  3VEZ A;  4IDH A;  3CIP A;  2F9T A;  4NYF A;  3HT3 A;  1NK8 A;  3DLH A;  2HHW A;  5ADX H;  2ASP A;  4DQQ A;  2A40 A;  3EKU A;  4BC2 A;  5GIP A;  3CPW M;  4RTF D;  1HPM A;  1TK8 A;  4B1Z A;  1NGI A;  4JI1 K;  1SL2 A;  4W5O A;  1BUP A;  3IG1 A;  3L4Q A;  3LDS A;  3M3Z A;  4YNQ A;  3C7N B;  3SQ2 A;  4OPJ A;  1T05 A;  3PX0 A;  2Y1J A;  4I2P A;  4E89 A;  4Z4H A;  5J2M A;  4M3T A;  3U3Y A;  1K8K A;  1K6Y A;  2W6K A;  3VEO A;  4H4O A;  5CE3 A;  1T8E A;  2JWK A;  5DM6 L;  1RT5 A;  3CJB A;  2HHT A;  3JSM A;  4DS5 A;  3QEW A;  2A3Z A;  3DLL L;  4K42 A;  1NGC A;  4IEI A;  3MN6 A;  3ISN C;  4KTZ A;  3VQE A;  2VQF K;  3ZET B;  4A59 A;  1CZ9 A;  1TGO A;  3OS0 A;  2P9P A;  4M7Y A;  1X9J A;  4DUZ K;  1JL1 A;  3LAK A;  4JI5 K;  1E4F T;  3NAE A;  3QET A;  4DV3 K;  1ZBI A;  1YTA A;  2ASM A;  4H03 B;  3ZEU A;  3HTV A;  3L4I A;  4CF9 A;  5EVZ A;  4JK9 A;  4PUO A;  4DR7 K;  5M1F A;  1WSF A;  2Q0R A;  4C8O A;  4DUY K;  3C94 A;  4ILH A;  1MWK A;  4BRM A;  1JJ2 M;  1VSK A;  4DQ8 A;  4N56 A;  1HNW K;  4FJG A;  4QS9 A;  1N5Y A;  2OYQ A;  1YIJ N;  3DLR A;  3QEX A;  4Z4E A;  3KLH A;  3OYF A;  1Z26 A;  4A2A A;  4M3X A;  3CG7 A;  1CXU A;  2BTF A;  3J7Y P;  3OW2 M;  3CCJ N;  1QSS A;  3WXL A;  2BDP A;  4JRQ A;  2VGN A;  4IO9 L;  1BWF O;  4IG0 A;  3KD1 E;  4M42 A;  4FXD A;  4K0K K;  3F2K A;  3ZSR A;  3SAG A;  4DR6 K;  3RR7 A;  1QQM A;  4YOX A;  4RWT A;  4WQ5 C;  4OLA A;  3KLF A;  4BRI A;  3RVC A;  4L8R B;  4MO4 A;  4MDB A;  1YAG A;  3HZ6 A;  3PY8 A;  3MXJ A;  4I6M A;  3THY B;  4BRF A;  3HBT A;  3KWI A;  3T1A A;  4Y1D A;  2WUS A;  2W6L A;  4AQY K;  1NK6 A;  3EKS A;  1KQS M;  2Q1N A;  2YCH A;  4CIE A;  4HUG A;  2D4W A;  1HQU A;  3LDN A;  3F9M A;  4C1N I;  3WNG A;  5LL6 Z;  1A5W A;  3AVC A;  1JL2 A;  4BRE A;  3VEV A;  3LWM A;  2O8E A;  1BOT O;  3HM9 A;  2DPN A;  2OPR A;  5FRO A;  3AO4 A;  2ZJR L;  4AH9 A;  4DLE A;  2QK9 A;  3ZSO A;  1LW2 A;  3RMC A;  1MU2 A;  2XRI A;  4DSK A;  4WFN L;  2FF3 B;  4BR2 A;  3QFU A;  3QIC A;  2JWL A;  4KKO A;  4IFY A;  4DSF A;  3ZCM A;  4ZHR A;  4HUF A;  3O9U A;  1T7P A;  4JKG B;  3ZT2 A;  1U4B A;  3E9P A;  1WAF A;  3NF8 A;  2VWB A;  3KVG A;  5BRD A;  1GLB G;  1B9D A;  2P5G A;  1A5V A;  4EFH A;  2V7Z A;  1R59 O;  3CQX A;  4BVO A;  3NMU A;  2IAJ A;  3MWT A;  3KK7 A;  1N36 K;  4O0I A;  4CZM A;  4DTO A;  3FFI A;  5FPM A;  1WB9 A;  1BG3 A;  4H0T B;  3KIO A;  3OYD A;  1QZ5 A;  4FLT A;  4BRH A;  3AVK A;  3TSU A;  4CGG A;  1VSI A;  2Z1G A;  2E5L K;  1SUQ A;  2KFN A;  4CK2 A;  3TSQ A;  4B3T K;  4FK2 A;  1ZYQ A;  1NJW A;  3LPT A;  3E66 A;  2FLO A;  2P9P B;  4CED A;  3I56 N;  4IOC L;  1IH7 A;  5TKY A;  1Q9Y A;  2P9K B;  1WBD A;  1JLB A;  3QIO A;  4B8C A;  1IBK K;  2ZD1 A;  5AR0 A;  3MCA B;  2X78 A;  4EHT A;  4CEA A;  4DMN A;  3PV8 A;  3KD5 E;  2E20 A;  2W42 A;  4EP4 A;  3HST B;  2BH1 A;  2WTU A;  3S3M A;  2IVN A;  4NB4 A;  4O5B A;  1FK9 A;  4BC3 A;  3PX4 A;  2VWJ A;  4PWD A;  4BRO A;  3OYI A;  3J7A P;  2EHG A;  3CFP A;  4WF9 L;  2V51 B;  4BDY A;  3HYF A;  3VET A;  5JMV A;  2D0C A;  2E2P A;  4E1N A;  4FJX A;  1Q18 A;  1S3X A;  3H3O B;  4B9N A;  4A61 A;  4M3U A;  1WBB A;  5AQS A;  3RR8 A;  4B9L A;  4BDZ A;  1RTJ A;  3MDQ A;  3K9K A;  1XMQ K;  2I7N A;  1KAX A;  3K5L A;  1BIU A;  3KK2 A;  4JI8 K;  4F8R A;  2A5X A;  3NVM A;  3VEN A;  2PY5 A;  1HNV A;  1GLF O;  1X1P A;  4FWK A;  3NGZ A;  3AA4 A;  2E4L A;  3SLC A;  3F73 A;  4AHR A;  3M8Q A;  3OS2 A;  1J6Z A;  3GG4 A;  1RNH A;  2YKM A;  1RFQ A;  2HMP A;  4J2E A;  1F21 A;  2NLX A;  3P83 D;  2EWS A;  4FW1 A;  4DU4 A;  3LDL A;  2HST A;  1TKZ A;  4FWR A;  3TAF A;  3H1V X;  1S5J A;  2YNI A;  4WYB A;  4FLZ A;  3LAL A;  4H0X B;  4FZZ A;  4KRF A;  3OYM A;  1XNQ K;  4AHT A;  1NGH A;  4DSL A;  4PKG A;  5DK5 A;  4CJK A;  3A5N C;  4KRE A;  3R9P A;  4FLW A;  4H0V B;  5C0Y A;  1MA9 B;  1SL0 A;  4FJ5 A;  2QWR A;  3RMA A;  2DFF A;  4JI3 K;  1P90 A;  4B1X B;  2O8D A;  3AVA A;  3ZET A;  3N4P A;  5ADX A;  4JKD A;  3KK1 A;  3THY A;  3DJC A;  1QQC A;  3RMD A;  4KHY A;  4BY9 C;  5CZ2 A;  1S9E A;  1UA0 A;  3HJF A;  4IXC A;  3JYT A;  1WSH A;  1CXQ A;  3DWL A;  1NG9 A;  4GW6 A;  3CF5 L;  4Z94 A;  5HRS A;  3QDK A;  4JEP A;  2RF2 A;  2O8C B;  4F2S A;  4FWQ A;  3ZSW A;  4PY5 A;  5C42 A;  2V52 B;  4FVM A;  3WXI A;  4O0J A;  4FLY A;  3EY1 A;  5GIN A;  1BGX T;  5C2F A;  1C0G A;  1HNX K;  3U9Z A;  3BDP A;  2GWK A;  1H1V A;  4NXM K;  4CIF A;  1WAJ A;  1SZ2 A;  3O9T A;  4C1N K;  2Q97 A;  1BQN A;  5CR4 A;  4FM2 A;  1JLG A;  1VSD A;  2VG7 A;  1GOB A;  5K14 A;  4CEQ A;  1IJJ A;  3B8A X;  4B3O A;  4JKH A;  3PX6 A;  4J2A A;  2O8D B;  4DU1 A;  1T44 A;  2GX9 A;  1S1X A;  5LMU K;  5AQI A;  4NCG A;  1OH7 A;  3CFO A;  3ZEU B;  4BR4 A;  4I9L A;  4FWP A;  2P9N B;  4JN4 A;  4CGD A;  2ETJ A;  4JD2 A;  4OKE A;  1SV5 A;  1LV5 A;  2ATQ A;  2KW4 A;  3MWP A;  1EO1 A;  5FRN A;  3S3N A;  5LJV A;  3SPY A;  4FZY A;  3BF3 A;  3SMS A;  3QFP A;  3K57 A;  2EX3 A;  3H46 O;  1D8Y A;  4DQP A;  1EWR A;  5E26 A;  2X6S A;  5M1O A;  1E3M A;  3SV3 A;  1NKC A;  3CJC A;  5DMR A;  3THW A;  1VSJ A;  4B3S K;  4BC5 A;  4LSL A;  3SYZ A;  1XQS C;  3VES A;  4NCB A;  3TU5 A;  3QEI A;  4KHN A;  3O4N A;  3AO1 A;  3QEV A;  4B1W B;  2QWM A;  2IDO A;  3EL2 A;  4CK3 A;  3O5B A;  1DLO A;  3DRR A;  4DU3 A;  4DV2 K;  4G1Q A;  5AZJ A;  4B9V A;  1NGF A;  4OJR A;  3A2F A;  4XEI A;  4EZ6 A;  2QI2 A;  1BI4 B;  5KQD A;  2O8F A;  1U04 A;  3EE9 A;  1YIT N;  1RT1 A;  1IKW A;  4ISF A;  3P5J A;  1T03 A;  4CJV A;  4X65 K;  3AVG A;  5KGX A;  4CHZ A;  3G71 N;  3O1B A;  1Q7Y O;  1GOC A;  3IAY A;  1HYV A;  3C0B A;  4MDA A;  3U8X A;  3J7Z O;  4DHY A;  3SMP A;  3AA3 A;  3VMF B;  2IOC A;  4FJH A;  2XY5 A;  2P9S A;  1N34 K;  1NGA A;  3E9O A;  1KTQ A;  1FW6 A;  3OTO K;  2O8B A;  5CYQ A;  1VSF A;  4FM0 A;  3VQD A;  3DLG A;  3QNN A;  3TAR A;  3KLI A;  1KLN A;  5BPL A;  5I3U A;  3TTF A;  3CCR N;  3KLE A;  5AZJ B;  2ZQB A;  1Q81 O;  1B92 A;  4H5N A;  3CCV N;  3VQC A;  4KBO A;  4QS7 A;  4DTR A;  3KKR A;  3WNH A;  1RDC A;  1U45 A;  1HNI A;  4H5V A;  3HP9 A;  3NF7 A;  3LM2 A;  3SNN A;  3C95 A;  5M1N A;  2PAV A;  5HRP A;  3OJU A;  1C0M A;  4M7X A;  2G8F A;  5EU7 A;  1NK7 A;  1M90 O;  1YI2 N;  4CGI A;  3P31 A;  4JYA K;  4FJI A;  5JVH L;  4ICL A;  1JLA A;  4CFC A;  3PLA A;  4OLB A;  1VSE A;  3ZX2 A;  3BGR A;  4IOA L;  1TL1 A;  2PFU A;  3MCP A;  5AQW A;  2E6L A;  3MX2 A;  3VQ5 A;  3PSF A;  4DB3 A;  4ILG B;  3CCE N;  1TVR A;  1VK0 A;  4Z4F A;  1D9D A;  1HLU A;  1IV0 A;  3SJH A;  2VQE K;  5AQN A;  3FE1 A;  4M41 A;  2ZM6 K;  4YOW A;  5AQF A;  1HNZ K;  1NKB A;  1JLQ A;  4CCH A;  3A5O C;  1C1C A;  4W5N A;  3CJA A;  4RW9 A;  3EE8 A;  3Q7B A;  1YVN A;  4JKE A;  5AQP A;  4YFU A;  1TAU A;  5H1S Q;  3ULE B;  4DFM A;  1L3V A;  3FZK A;  3J8A A;  4F3O A;  4W5T A;  3ZLJ A;  1XI1 A;  4FLU A;  3CI5 A;  3OA9 A;  4CW7 B;  4JHD B;  4OPK A;  1NLV A;  4DTU A;  2WON A;  3F5T A;  4C8M A;  4E1J A;  2AJQ A;  1RT4 A;  2F96 A;  1K8K B;  4QCL A;  1I3A A;  1UOC A;  2CGL A;  4H4M A;  1I39 A;  5A2Q O;  4ELU A;  1G15 A;  1FKP A;  5BRE A;  2KFZ A;  4CGH A;  2QWN A;  1D9F A;  3FFK B;  4CFD A;  3R8E A;  1YT3 A;  4BWJ A;  4EZ9 A;  3AVF A;  1WSI A;  2DTU A;  2YHX A;  4AF1 A;  1LAV A;  3ATV A;  4IJN A;  3ZT4 A;  3G10 A;  3K9J A;  1QQN A;  2VYP A;  4BRG A;  1EX4 A;  1SKR A;  1TUY A;  2OPQ A;  1NMN A;  3O3G A;  4GKK K;  2YJE A;  4B08 A;  4YHH K;  2GBZ A;  3CCQ N;  3K58 A;  1Y97 A;  4DCH A;  3O3F A;  1OH5 A;  3EEQ A;  3VQ4 A;  4GV3 A;  1S1W A;  5BN8 A;  1VHX A;  2P51 A;  3THX B;  2NRW A;  4BRK A;  1K8A O;  1K9M O;  4DLG A;  1RT3 A;  2P9L A;  4FJL A;  2IS3 A;  4FWS A;  3S9H A;  4DKW A;  1V4T A;  4YOV A;  1NWK A;  2UYT A;  2VG5 A;  5I9E B;  2Q0U A;  2E8A A;  2YHW A;  4PQU A;  1REV A;  4DTP A;  2P9K A;  3T7Z A;  1YUW A;  3HP6 A;  1GLE G;  4WCE L;  1ASV A;  1RT7 A;  1WSJ A;  1ZBS A;  3CFR A;  5DM7 L;  1BA0 A;  3PIP L;  1BQM A;  3SV4 A;  3WXJ A;  3AVN A;  4E7H A;  2ZE2 A;  4CHP A;  1YXQ A;  3ZSQ A;  3HO1 A;  2KLA A;  1HKG A;  3D0P A;  1CLQ A;  1VAZ A;  4FVU A;  4K41 A;  4MFB A;  4H0P A;  1NK5 A;  4YOY A;  1KLM A;  3P4I A;  4CBU A;  4CHY A;  3AVB A;  1ATS A;  3RRH A;  4FJ8 A;  1W2B M;  2HBL A;  4BGA A;  2QWP A;  5F0X A;  1IKX A;  3O9R A;  4DSI A;  3K0S A;  3HSC A;  4YY3 K;  5AFU A;  3THX A;  3TWH A;  3NF9 A;  3OYC A;  3LZJ A;  3AAR A;  5AQM A;  4ISG A;  2QW9 A;  4RW8 A;  1IBL K;  1DTT A;  1D5A A;  1S72 N;  3VQB A;  5J2Q A;  1EP4 A;  3TAE A;  3ENH A;  3AGK A;  5LJW A;  3ZT0 A;  4CZF A;  3RTV A;  2CH5 A;  3UKU A;  4CJU A;  5J1E A;  1TK5 A;  1KRP A;  3D2E B;  1WLJ A;  1RCH A;  1RDB A;  3QO9 A;  4JNE A;  2HBM A;  2FBV A;  4E7K A;  4ELT A;  3JXU A;  3AY9 A;  3WXM B;  3HXM A;  1TYQ B;  2NZT A;  4CZH A;  4M3Y A;  2O8F B;  2KTQ A;  5J2P A;  4CEB A;  1GLD G;  4I7F A;  4LH5 A;  5AZI A;  1DKG D;  3OYG A;  1JXB A;  4FJJ A;  4PL7 A;  3K5O A;  5AQG A;  3VGL A;  1T6C A;  1J53 A;  1KFS A;  1OKJ A;  3VN5 A;  1Z25 A;  1Z6R A;  3BZC A;  3VEX A;  3OYJ A;  4FJN A;  5BPM A;  4GV6 A;  1XC3 A;  4CJ7 A;  1NK0 A;  5C10 A;  1UA1 A;  2OZS A;  1I94 K;  4NXN K;  2ZGZ A;  3I8B A;  3U9D A;  3KK3 A;  4KH5 A;  3MEC A;  3DXK A;  4GNI A;  1TL3 A;  2NRR A;  3LP1 A;  4CJ4 A;  1QS4 A;  5FPN A;  3TSP A;  1YVU A;  1X3N A;  4KHU A;  4B8A B;  1SAZ A;  1U48 A;  1NMD A;  3NFA A;  3TAN A;  5AQQ A;  4KB1 A;  3MXM A;  1RDD A;  3MN7 A;  3CC2 N;  5CYM A;  2NRX A;  1BO5 O;  1RDA A;  4M45 A;  4BAC A;  1OH6 A;  2QWO A;  3FZL A;  1V4S A;  2WFB A;  2QA4 N;  4BRN A;  2AA4 A;  1Q9X A;  1NGD A;  4NO7 A;  5E84 A;  2E2O A;  4H5W A;  4LH4 A;  4BE2 A;  3V9W A;  4FWN A;  3VEW A;  5D3G A;  1RBT A;  4JI7 K;  3B6P A;  3DMJ A;  3AO2 A;  4ZTF A;  4OX9 K;  1VQP N;  3CMA N;  3GBT A;  3CHW A;  5C24 A;  4AHU A;  3TPQ A;  2YHB A;  4DFK A;  2P9I B;  3OYN A;  2QXF A;  4LFB K;  1U2V B;  4GVM A;  1EET A;  3HPG A;  3AO3 A;  4RG8 A;  4E7L A;  3SQ4 A;  4IDK A;  3NCI A;  3FZH A;  1U49 A;  5EX5 A;  1NM1 A;  1ASU A;  3TAP A;  4BRA A;  3NH1 A;  3E9L A;  4EHU A;  1C0U A;  3V9U A;  1N8R O;  4DV4 K;  4CJE A;  1P8Z A;  1ESV A;  4ID5 A;  5AQL A;  3EN9 A;  4Z0U A;  1N6Q A;  2XHB A;  4EP5 A;  2UU9 K;  1IG8 A;  1NGB A;  3C65 A;  5AQT A;  2HHS A;  5AQH A;  4UY8 O;  4DTJ A;  3LAM A;  2HHU A;  2O8E B;  2PYL A;  3O08 A;  2V7Y A;  3VA3 A;  1JLE A;  1KAZ A;  3THW B;  2YNG A;  4KHS A;  1ZBH A;  1C1B A;  4FCY A;  1WUA A;  4JK7 A;  5JS2 A;  3BF1 A;  1SL1 A;  2DY4 A;  2ZJQ L;  2E88 A;  2UUB K;  4C8K A;  2F9W A;  4IO8 A;  4LD0 A;  4O8K A;  1BI4 A;  4CK1 A;  4FJM A;  2E6M A;  4JKG A;  2E2N A;  4FW2 A;  1SKS A;  1RTH A;  3IFR A;  3QIP A;  3NDK A;  2UUA K;  2D0O A;  3PO4 A;  1HX1 A;  3ZSX A;  4LF6 K;  3DLK A;  4FOE A;  2ASO A;  2YHA A;  4IWV A;  4O5F A;  3WNE A;  3UE5 A;  4Q5V A;  4DFJ A;  2Y1I A;  3UIQ A;  4JRP A;  1S1U A;  5AQX A;  1L3T A;  1YHQ N;  2GTD A;  4IKF A;  3R3L A;  3O6W A;  1ATN A;  4NLC A;  4BR7 A;  2G8V A;  1NKE A;  1L3U A;  4WFA L;  4CEE A;  1EKE A;  2P9S B;  2F8T A;  3A0I X;  3QES A;  4MLH A;  1LWE A;  3CQY A;  2KKZ A;  5MLC Q;  4X64 K;  4LF8 K;  1QZ6 A;  2IC3 A;  3SUQ A;  4FPB A;  3ULD A;  4NYN A;  4DTN A;  4HCB A;  5B8H A;  1TAQ A;  1NK4 A;  3VPZ A;  3VER A;  3LL3 A;  3WEE B;  1W0H A;  2HNY A;  4Z4I A;  4DQS A;  2D0A A;  2Q3S A;  4OKK A;  3T19 A;  5LY3 A;  2O8C A;  4BRQ A;  5SWM A;  4CD1 A;  3SJJ A;  1KSP A;  3UKR A;  3ATU A;  1HKB A;  3IUC A;  3ZSY A;  3HVR A;  3IRX A;  4CJQ A;  3HVT A;  3HPH A;  3RSE A;  4A5B A;  1RT6 A;  3H1Q A;  2A1R A;  2GEM A;  3W0L A;  1HYZ A;  4OGC A;  2FC0 A;  4MO5 A;  3NGI A;  4GV9 A;  3VF2 A;  4CZG A;  1D4X A;  3DXM B;  3AVM A;  2OAN A;  1JLC A;  2Q2R A;  1FKO A;  4HTU A;  5BR8 K;  3SUO A;  2VG6 A;  4E19 A;  4I9Q A;  3CME N;  1QVG M;  1T3V A;  1YF5 L;  1XWL A;  1ITG A;  2D1K A;  3NH0 A;  4JI6 K;  1VQ7 N;  4HVJ A;  1QHT A;  2PBD A;  3NHG A;  4DR1 K;  1GLA G;  4X66 K;  3U3G A;  3VQ8 A;  1NOY A;  2B4J A;  1BIZ A;  4DSJ A;  4CI6 A;  1SKW A;  4CER A;  1G99 A;  2WBN A;  3OBW A;  3QBX A;  4JD2 B;  4E7J A;  3OS1 A;  2KQ2 A;  4X62 K;  1TV6 A;  3VGM A;  5HRN A;  2W41 A;  5KQ8 A;  4WE1 A;  3F9K A;  2O4I A;  1RBU A;  3CET A;  2Z1J A;  4CEO A;  4W5R A;  3MK6 A;  2YNH A;  1JCG A;  4YOR A;  4UQG A;  1KVA A;  5HLF A;  4DQR A;  3KKS A;  5GAG P;  5AQV A;  3ENO A;  3G25 A;  3D2F B;  4F9O A;  5JLH A;  2P9L B;  3LDP A;  5BRF A;  1XNR K;  2XO7 A;  2GUI A;  1W97 L;  4YOU A;  1MDU B;  5AQR A;  5BN9 A;  1NJI O;  2XY6 A;  2P1J A;  2RHK A;  2ITM A;  4DR3 K;  3QIN A;  4FJ7 A;  4C23 A;  4DV1 K;  3VQ9 A;  1U47 A;  4CEC A;  2HHH K;  3GOI A;  1VRT A;  4A57 A;  4FWM A;  4E0D A;  4JKA A;  2ITG A;  3SCX A;  2H3G X;  1LOT B;  4NCA A;  4Y0W A;  3R6M A;  2FBX A;  4KPY A;  3LZI A;  4CHO A;  4IZ9 A;  4XH1 A;  4CGJ A;  1RDU A;  4BG9 A;  4A5A A;  2AP1 A;  2IGI A;  4BRC A;  3CXC M;  3OHR A;  3CER A;  1C6V A;  1RDW X;  4AM7 A;  3AA2 A;  1X9W A;  1J5E K;  3H3N O;  1S6P A;  4KI4 A;  4DR5 K;  3KJV A;  1WSG A;  4DR2 K;  4F4K A;  3H6E A;  3KTQ A;  4RW4 A;  3FZF A;  1KC8 O;  3FGU A;  1KVC A;  2F7T A;  2HHQ A;  1GLC G;  2YNF A;  2NRT A;  3M1F A;  3D6R A;  3NE6 A;  3RRG A;  4JI0 K;  2NRV A;  3MEG A;  1B9F A;  2NNW A;  3T1Y K;  4DQI A;  3DLB A;  1TUU A;  4PL8 A;  3AAQ A;  5HOO A;  2YV0 X;  3UKR B;  4CJS A;  1X9M A;  4IOX A;  1HYS A;  4DS4 A;  1HPZ A;  4GMJ B;  4WQ4 C;  3V4I A;  4DV0 K;  1RTI A;  4CJ3 A;  3LWL A;  4QS8 A;  3M8S A;  4FYD A;  3EO3 A;  3OYL A;  1UWB A;  1QTM A;  1YTU A;  4K25 A;  3SBT A;  3L3U A;  4H8K A;  1VSL A;  2VWK A;  3VOV A;  4CJP A;  3L3V A;  3SAF A;  2D5R A;  3OYE A;  2B5J A;  4CBX A;  1JCF A;  4J2D A;  1C0F A;  1KAY A;  4O44 A;  4DV7 K;  1QVF M;  1Q8I A;  1UAX A;  4A62 A;  4C8L A;  1QHA A;  3NGY A;  4DSE A;  4PA1 A;  4N5S A;  3V1R A;  3DXK B;  1NGE A;  4H5R A;  1K73 O;  4LF7 K;  3UKU B;  4IJA A;  2PYJ A;  3L2Q A;  2FBT A;  4FK4 A;  3NVK A;  3FR0 A;  1VQL N;  3CJ9 A;  5F1X A;  5AQK A;  5HBM A;  1L3S A;  3VTH A;  1OVY A;  1ZXO A;  5KPR A;  5M1K A;  3NH2 A;  4WQ4 A;  3SQ0 A;  5BR9 A;  1BL3 A;  4ILJ A;  5AQJ A;  3V81 A;  4DTX A;  3ZSZ A;  3BY5 A;  4CF0 A;  2CH6 A;  4BR5 A;  3MAQ A;  4RW6 A;  1KFD A;  3B6O A;  2P5O A;  1RBR A;  2YHY A;  4Y1C A;  4OKJ A;  4KHP K;  3V9Z A;  1LW0 A;  3QER A;  2YI1 A;  3AVH A;  3QBW A;  3AAP A;  3MN9 A;  4I2Q A;  4OGE A;  5AQZ A;  3RWU A;  2HBJ A;  3S41 A;  1RTD A;  1XUP O;  3TAQ A;  4HCC A;  2FBY A;  2E1Y A;  3ENB A;  4CJ5 A;  1NU0 A;  2BAN A;  2BGG A;  3KHY A;  3AGR A;  4I6M B;  3IMX A;  1QSY A;  3GL1 A;  4BDP A;  5M1Q A;  2OTL N;  1ZC6 A;  2IVO A;  3DI6 A;  1KCF A;  4CJL A;  3JAM O;  3M6G A;  1A5X A;  1S22 A;  4BRD A;  4KTQ A;  4LC9 B;  3ID6 A;  5FPE A;  5CY4 A;  4LFC K;  3HPO A;  2DFH A;  3LDQ A;  2FSJ A;  4CES A;  2W40 A;  3T3F A;  4HHT A;  2QEX N;  1DGK N;  3RSE B;  5J2N A;  5KRT A;  1HJR A;  4BRP A;  5ELZ A;  5HRO A;  2P9U B;  2NUB A;  1TK0 A;  5EY4 A;  4DTS A;  4L3Q A;  3ALY A;  4IFE A;  3S3O A;  4KHQ A;  3VGK A;  4B9M A;  4CF1 A;  4CFA A;  1IBM K;  4E1M A;  4ZTJ A;  3DOK A;  1IKV A;  1FXX A;  4IFV A;  3ASM A;  1J9A A;  2I5J A;  4FWO A;  1HRH A;  4N76 A;  2NRH A;  4BWM A;  4KFB A;  3AVL A;  3TAB A;  4M3Z A;  4GVE A;  2GWJ A;  5EXW A;  5C25 A;  2HVI A;  3L2U A;  3CCL N;  3O80 A;  2J4R A;  4WQ5 A;  2IIR A;  1TKX A;  4J2B A;  1N33 K;  5C2D A;  3M8P A;  2NRZ A;  1SS6 A;  2FXU A;  5FDL A;  1Q82 O;  4JHD A;  3WXK A;  4BGB A;  1QSL A;  1VQ9 N;  4QAG A;  5AJ3 K;  3MED A;  3OJS A;  3O1W A;  2HF4 A;  4CF8 A;  4CEZ A;  4KV8 A;  4DTM A;  4LFA K;  4FM1 A;  1LWC A;  3CPE A;  4R5P A;  4DV6 K;  4JAX A;  3G6E N;  3KLG A;  4LY7 A;  1EWQ A;  3SI6 A;  4CE9 A;  2FSN A;  4BR9 A;  3WQT A;  3SUN A;  1J54 A;  3AV9 A;  3H08 A;  1VSM A;  4OO1 J;  4GKJ K;  1VQ4 N;  2OA8 A;  4BVP A;  1RT2 A;  3BUZ B;  3D2E A;  5FPD A;  1W7A A;  4GY2 B;  4AM6 A;  1SQK A;  4O55 A;  3A5M C;  4N47 A;  5JIC A;  5AFU H;  2Q31 A;  4K8Z A;  4M3W A;  2HHV A;  2UXD K;  3HOS A;  3CJ7 A;  1LAW A;  3G0Z A;  2E1Z A;  3WNF A;  4Q0B A;  2ZF5 O;  4J8F A;  3LM9 A;  4CF2 A;  5CHI A;  3OYH A;  4KH4 A;  3K2P A;  5JVG L;  4PKH A;  4CIG A;  3BZK A;  3QB0 A;  1VQK N;  3LP0 A;  1OVQ A;  5LMN K;  3A8Y A;  3U6F A;  4FK0 A;  1TKD A;  2YX6 A;  5IT9 O;  1HKC A;  3D45 A;  3ZSV A;  3HL8 A;  4C8N A;  4XH5 A;  1OH8 A;  2HND A;  4RW7 A;  5I42 A;  4FJK A;  2FSK A;  3FZM A;  3CCM N;  3V1O A;  4CZJ A;  3HI0 A;  3SPZ A;  3V9X A;  1HUX A;  4G9Z A;  1U2V A;  3P1G A;  3H45 C;  4JS5 A;  1HR0 K;  3L0Q A;  3NBP A;  4E3S A;  2Z1I A;  1DTQ A;  3V6D A;  1YJW N;  5KTQ A;  1CZB A;  4RCH A;  2KHO A;  4DV5 K;  2HMI A;  4JV5 K;  4N41 A;  4F2R A;  3ULE A;  3KWG A;  2G8I A;  2QKB A;  2ZWH A;  1VQ8 N;  4CBW A;  1XC9 A;  1XMO K;  4BRL A;  1IO2 A;  3SBG A;  3V1Q A;  3M8R A;  1RBV A;  3UB5 A;  2R7Y A;  3TTC A;  4BC4 A;  1TYQ A;  3MXI A;  3DXM A;  3GE1 A;  1S9G A;  1DT9 A;  1XHZ A;  3V9S A;  4DG1 A;  2I7P A;  2OPS A;  2CGK A;  5HL7 L;  4JLH A;  3CYM A;  1VQ6 N;  3J81 O;  4ID1 A;  1VQM N;  1NK9 A;  4WFB L;  4BE1 A;  3CCU N;  3C6H A;  2GUP A;  1NJZ A;  3HK2 A;  1JCE A;  2YJF A;  1XHX A;  3VTI A;  4JK8 A;  4CJR A;  4FZX C;  4JKB A;  1WNS A;  2UXB K;  4KH6 A;  1KXP A;  1O1W A;  4M63 C;  5GIO A;  3O9S A;  2RE2 A;  5SZT A;  5GAH P;  3THV A;  3C6A A;  2GV9 A;  1Q86 O;  1NGJ A;  3O9Q A;  5CZ1 A;  2JGU A;  1HJO A;  1S1T A;  4KAZ A;  4DWI A;  3J80 O;  2G8H A;  4EIA A;  1S1V A;  4DF4 A;  3ZX3 A;  4E7I A;  3MEE A;  1HQE A;  1WN7 A; 
#chains in the Genus database with same CATH homology
 4LF5 K;  4NXM K;  1XNR K;  5IT9 O;  4YY3 K;  4JI7 K;  4JI4 K;  1XMQ K;  5A2Q O;  4DV7 K;  4JI8 K;  4OX9 K;  1IBM K;  4X64 K;  2VQF K;  4LF9 K;  1IBL K;  4LF8 K;  4LF7 K;  1N34 K;  5IWA K;  3T1H K;  3OTO K;  4DR3 K;  4DUZ K;  4LFB K;  4JI5 K;  2UXC K;  4DV1 K;  5LMU K;  4DR4 K;  1HR0 K;  2HHH K;  4DV3 K;  4DR7 K;  4LF4 K;  4DV5 K;  4DUY K;  4B3M K;  4JV5 K;  4JI2 K;  1N36 K;  4GKK K;  5FLX O;  4DV4 K;  1N33 K;  4YHH K;  1XMO K;  1HNW K;  4KHP K;  5AJ3 K;  4JYA K;  2UU9 K;  1XNQ K;  3J7Y P;  3J81 O;  4CVN E;  4LFA K;  1J5E K;  2E5L K;  2UUC K;  4B3S K;  4DV6 K;  5BR8 K;  2F4V K;  4B3T K;  4K0K K;  4V19 S;  4DR6 K;  4JI3 K;  2VQE K;  4DR5 K;  4JI6 K;  4DR2 K;  2ZM6 K;  4DR1 K;  4NXN K;  1I94 K;  4X66 K;  4GKJ K;  2UUB K;  1IBK K;  2UXB K;  1HNZ K;  4DV2 K;  1FJG K;  4JI0 K;  2UXD K;  3JAM O;  3T1Y K;  4X62 K;  2UUA K;  4JI1 K;  4LF6 K;  3J7A P;  4DV0 K;  4LFC K;  3J80 O;  4AQY K;  1N32 K;  4X65 K;  4CW7 B;  4B3R K;  1HNX K;  5LL6 Z;  5LMN K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...