4B3MK

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4b3mK00
1XMQK 1N34K 4V19S 4DV1K 4DV6K 2UUBK 4K0KK 4GKKK 4LF6K 1N32K 3JAMO 2UXBK 5IWAK 4CVNE 1HNWK 5AJ3K 4GKJK 2UXCK 5IT9O 4LFAK 4DR7K 4DV4K 4DR3K 5LL6Z 4JI8K 4YHHK 3T1HK 4LF5K 4DR4K 4DUYK 4JI0K 4OX9K 4JI3K 4YY3K 4LFCK 1N36K 2HHHK 5A2QO 4LF9K 3J7AP 2UXDK 2ZM6K 4B3TK 1FJGK 4JI7K 2UUAK 4DR1K 4X65K 5FLXO 4DR2K 2F4VK 2VQFK 3T1YK 3J7YP 4JV5K 3J81O 5BR8K 3OTOK 4X64K 2UU9K 4B3MK 4DV5K 4X62K 4JI6K 1HNZK 4DV2K 4B3RK 4JI1K 4DV7K 4X66K 4NXMK 1IBMK 2E5LK 4CW7B 4LF7K 4JI2K 4DV3K 4DR5K 3J80O 2UUCK 1XMOK 4KHPK 4LFBK 2VQEK 5LMNK 4JYAK 4B3SK 1HNXK 1I94K 4DUZK 1IBLK 4LF4K 1IBKK 1HR0K 1XNQK 4DR6K 4LF8K 4JI4K 4DV0K 1N33K 1XNRK 4AQYK 5LMUK 4JI5K 1J5EK 4NXNK
chains in the Genus database with same CATH superfamily
4CHYA 1YT3A 4M63C 4PKIA 5GAGP 4CJEA 1Z26A 4O44A 1RBVA 4I2QA 4HUGA 4DFJA 3SNNA 1DGKN 1S22A 4EP5A 4MLEA 1M1KO 3NF6A 1ZBSA 1NGBA 4RW7A 5T7BA 1TYQB 5DMRA 1FKPA 1C0FA 3CFOA 4BC2A 5HP1A 2V51B 4WCEL 3QINA 5AQRA 3KVGA 4OPHA 2Y1IA 1RTDA 4PKHA 4ILGB 2QW9A 4E89A 4LF5K 3SV4A 5AQPA 3ZX0A 1NJWA 2CH5A 3ENBA 4OJRA 5JMVA 2PY5A 3DOLA 1RBUA 3U9ZA 3RRGA 3E9OA 5A2QO 2Z1HA 4B9SA 4JI7K 2IVPA 4EIAA 4IDKA 3EKUA 2P9KA 1TUYA 1GLBG 3OYGA 1VSJA 3KD1E 4PQUA 4GV3A 3SUPA 4A2BA 1NJIO 5FPNA 4YOWA 4JRPA 3CQXA 1EWQA 2OPPA 3D45A 3HRGA 3C7NB 5GINA 3V6DA 4DU4A 3OS0A 3N4PA 3CD6N 4Y1DA 1HYZA 1RT6A 3CCQN 3NGYA 1LOTB 2D0BA 2HVHA 3VEXA 3LAMA 3CI5A 1BL3A 5KRSA 1Z6RA 3ZT4A 5HBMA 1IKWA 4EP4A 3EY1A 5BRHA 3KKRA 5KQ8A 3KLGA 2JWLA 4FCYA 3M1FA 1CZBA 3H3NO 1SUQA 5JLHA 4RTFD 4V19S 1GLJO 3VF6A 2PBDA 3BGRA 2H3GX 5CR4A 1SS6A 3CCEN 1T8EA 3NMUA 4O8UA 3EZWA 3AVFA 1VQLN 1D5AA 3BUZB 1MDUB 1Q9YA 4GKKK 4EFHA 3CHWA 4FJXA 2HF4A 4CEOA 1S1WA 2QWOA 2PAVA 4DG1A 4DR7K 5DM6L 1Q81O 3TSQA 4E1NA 1HNIA 4FJMA 4CJ3A 4JI8K 5AQMA 1JLGA 1BG3A 3HZ6A 1T05A 1QVGM 4OKKA 3VENA 1HKCA 5KQDA 4F2SA 2JWKA 5SWMA 1U4BA 4YDUA 4JD2A 1LAVA 1FJGK 2FF6A 1KVBA 3QBXA 3AAQA 5FPMA 1X9WA 1KRPA 4FM2A 3EE8A 4IG0A 4FPAA 4KI4A 2D4WA 3TI0A 4AHCA 3U3YA 3CC4N 2QXLA 4BGBA 5C2DA 2AP1A 3ZEUA 2OYQA 3BF1A 4BVOA 4DV5K 2GTDA 1RFQA 3WXMB 3WXKA 4JI6K 3G4SN 3A2FA 3VESA 2X6SA 3DLGA 4W5OA 3SUQA 3SLCA 2DFEA 2VCPA 1GLAG 3ZETB 4K25A 5DK5A 1BO5O 4DQ8A 4DTXA 1WSJA 4DU1A 2BUPA 4YOUA 2YHXA 3QEIA 4CEQA 4R79A 2RF2A 2D0OA 3Q7BA 1HUXA 3HOSA 2XY6A 1P8ZA 1V4SA 2UYTA 5KRTA 1KVAA 3T3FA 2ZQBA 1IKXA 1JLCA 3NAEA 1YJ9N 4CF2A 1QZ6A 3CC2N 3CMEN 4N47A 2I7PA 3U8XA 3LAKA 2JGUA 3HSCA 1BIUA 4M7YA 4O5FA 2O4IA 2Z1GA 1VSFA 3EO3A 1SL0A 3E9LA 1KFDA 3HK2A 3HP9A 4PA1A 4B8CA 3PSFA 1TVRA 3PY8A 1ASVA 3VEWA 1NBWA 4DQIA 4CJUA 1VRTA 1HLUA 2HSTA 4CESA 4K41A 4BR0A 4E7LA 4JKGB 3OYMA 4M42A 4FOEA 3WQTA 2V7YA 1NGEA 3THXA 1U48A 4BG9A 4GKJK 2NRXA 3EN9A 4KHYA 3CCMN 3ZSWA 3ZETA 5FPEA 1HPZA 3HBTA 1JJ2M 3SUNA 2OTLN 1NK4A 4J2DA 3VGLA 2WBNA 1QQOA 2IDOA 4B9VA 4LFCK 4M3YA 1L3VA 3FZHA 1K8KA 3H45C 2E8AA 3U4LA 1SL1A 1IV0A 4CGHA 1RT3A 3NGZA 2F96A 3NDKA 3CETA 4FL9A 2FBXA 3C7NA 3SPYA 4BRIA 1A5XA 3G71N 3SMPA 3T1YK 3J7YP 4GY2B 2HHQA 3AVHA 4CK3A 2E2NA 2GX9A 3R3LA 3ZSRA 4JHDB 3MEEA 3KWIA 4YNQA 4QS7A 1Y97A 3H46O 3I0RA 5CE3A 4NCAA 4DTMA 3H6EA 1SKSA 1SKWA 3HPHA 5EOYA 1BOTO 3SJJA 4Z4EA 3VQ6A 2FSNA 3O1WA 3I8BA 4LF4K 3MCAB 4HCCA 3HTVA 3CPWM 3SJHA 1HR0K 3VQ7A 1ZBIA 3J7ZO 1RDWX 3KKSA 2GV9A 2KQ2A 4CGIA 4IOAL 4I6MB 4EZ9A 5HRSA 4J8FA 4K8XA 1KLMA 3ITHA 3OY9A 4CJQA 4DQRA 1QVFM 1DEJA 4B3OA 3HT3A 5LMUK 4RW9A 1NWKA 3AO1A 1K8AO 4KPYA 1QS4A 2P9LA 3GE1A 4O5BA 3HOTA 3AVGA 1XMQK 1GOBA 1LV5A 1RBRA 3JYTA 4C8OA 4CJFA 1VAZA 5J2PA 4IXCA 3O9QA 3TAGA 4DV6K 4DTPA 3A8YA 3NF8A 4JNEA 1J53A 3AO5A 3NVKA 1IKYA 5AQTA 4GNIA 1YJWN 2UXCK 2W6KA 4H0YB 4DCHA 3CG7A 3L2RA 4YOVA 4DB3A 1U2VB 2QKBA 1XI1A 3DLKA 2E2OA 1QSLA 4RG8A 4DKWA 5BN8A 3AY9A 1XWLA 2ASMA 3V1OA 4DUYK 3CJ7A 4KHQA 3EEQA 3SQ4A 4Z94A 4KB0A 2P5OA 3TAFA 1UA0A 3MN5A 4BACA 3SQ0A 3L3UA 4FWPA 2FBVA 1WSGA 4CZGA 5K14A 4DFKA 4OGCA 4KI6A 4ILHA 4DMNA 3OS2A 2KZZA 2EHGA 1IH7A 3ALYA 1NG9A 2RE2A 4UQGA 3MXJA 1X1PA 1XHXA 2W42A 1W2BM 4JS5A 1HNZK 4NB4A 3SUOA 5AQNA 4KRFA 2W6LA 4KTQA 4YOXA 2ZJRL 1JLQA 4IKFA 4CIEA 2VQEK 4BROA 1YTUA 4FW2A 5LMNK 3UIQA 1TKTA 4FLTA 3GG4A 3IAYA 5AZJB 4DQPA 4I7FA 3C65A 1WLJA 2Z1JA 1VSKA 5KPZA 3ZSQA 4DSIA 3VQQA 2IVNA 3BZKA 1RDBA 2XRIA 3V9XA 5AQLA 1VQON 2P9PB 2NUBA 2YNHA 3QB0A 3MMVA 1A5WA 2YHBA 3VF4A 3VQCA 4HUEA 1KC8O 3VQ4A 3ISNC 1BI4B 3U3GA 4JK7A 1RT2A 2E88A 2NRWA 4LSLA 1XQSC 2HNDA 3MN7A 1C0TA 4ILJA 3RTVA 3I33A 1NOZA 5BPLA 4DLEA 1HJRA 3UKUB 1EO1A 3H08A 1N32K 4DTJA 1JLEA 2NRTA 2EX3A 1OH5A 5IT9O 3M6GA 3SYZA 2HBKA 3QETA 3SI6A 4NO7A 3AARA 2G8FA 4BRKA 3QNNA 2NRZA 4FLXA 3WXLA 4JD2B 3SZ2A 3S3NA 2CH6A 3AAPA 3F5TA 2ZM6K 4IG3A 2VGMA 4FJLA 4UY8O 5AQUA 4JN4A 1KAXA 2NNWA 4IOXA 1RDUA 2P9SA 2NRRA 1E4FT 2PFUA 4FWNA 4FZZA 2E1YA 1O1WA 3HM8A 2QTDA 4Q0BA 4X64K 3LL3A 3OYAA 4X62K 1M90O 3O08A 1J5OA 3FGUA 3DRSA 1E4GT 5B8HA 1JL2A 3DLLL 1WBBA 2FSJA 3VF2A 4AH9A 5AQKA 2OCEA 2Q0UA 4E7KA 3MECA 3CM6A 2QWRA 3NGIA 2GUPA 4JHDA 5AZJA 4XH5A 2YI1A 1Z25A 1NK6A 3GDQA 3UKUA 4FWOA 3V1QA 5JLFA 3FZMA 2Q97A 4CZKA 1WBDA 4H0XB 4U7BA 3R9PA 1N33K 1XNRK 3OYNA 3WNEA 2FBTA 5ADXH 3TTFA 4BE2A 3L2QA 4KO0A 4DTRA 2DPNA 1CLQA 1W7AA 1RNHA 1KVCA 1HPMA 3F2KA 3SCXA 1ATSA 3ZX2A 4B1XB 1VHXA 4K8ZA 4JKDA 3OBYA 4QOZB 4QS9A 5I3UA 1DTTA 3KZBA 4CIFA 3D2EA 2ETJA 4CJKA 4M3RA 5M1QA 4Q5VA 3KWGA 4DSKA 3MCPA 1EP4A 3O1BA 5AQZA 4IEIA 3EKSA 3HJFA 4WFAL 1HNWK 3OHRA 4H0PA 4A62A 3MDQA 1Y64A 3C94A 1YAGA 3DRPA 5C10A 2QXFA 4EHUA 3TSPA 1P90A 3RSEB 4A5AA 4DSEA 3MXIA 1O13A 2QEXN 3CPEA 4MDAA 3HP6A 4IJNA 2HHXA 3ATVA 1BCOA 4FLVA 3D2FB 2G8HA 5M1OA 3ZSYA 3BDPA 5CZ2A 3KJVA 5E84A 1YF5L 5BRDA 1RBTA 1FW6A 4KHSA 1LWEA 1ZBFA 1WSHA 5FLXO 5J2QA 4HCBA 5JS1A 5AFUH 3DXMB 3DRRA 3VERA 3NH2A 4O55A 1YTAA 1SAZA 4B8AB 3LZIA 3T1AA 2FSKA 2VYPA 5ADXA 2I5JA 1NJYA 4FYDA 2IGIA 2Q3SA 3EE9A 4BY9C 4CW7B 3TAQA 1BIZA 4ISGA 5AR0A 1EXQA 2NLXA 1TV6A 1ASUA 4B3SK 4B9TA 4CZMA 2XY8A 2GBZA 5C0YA 3MWPA 3A5NC 3G6EN 3QMLA 3VTHA 1YJNN 1YXQA 1VQ8N 5FRMA 1NKCA 1C1BA 5E41A 2CGJA 4F3OA 4YOTA 4DFMA 3VQBA 3AV9A 3KLHA 3E66A 4W5NA 3JXUA 2G8UA 2P51A 5AQQA 1NGJA 3ZYYX 1TYQA 3BY5A 3NH0A 3K59A 1JCGA 1UAXA 1MWKA 2Q1NA 1NJXA 1T6CA 2NRHA 2RKIA 4KHNA 5JVHL 3LM9A 4CEBA 2ZD1A 4M3ZA 4JAXA 2HHVA 4N41A 3IUCA 2O8CB 3QEWA 4CF1A 3TU5A 1QSSA 1EKEA 4H5WA 3IRXA 3NH1A 4Z0UA 1BCMA 2HNYA 4BQLA 1J6ZA 3NE6A 1S1UA 2V7ZA 2HF3A 1NGCA 3CM5A 3M3ZA 3P38A 4FZXC 1N8RO 1S72N 4FLZA 1A5VA 2YNGA 1NNEA 4B08A 3VEZA 3SQ2A 3THXB 1IG9A 5C42A 3QICA 4DQSA 1LW0A 4JLHA 1G15A 4C1NK 4FLUA 5HRRA 3M8SA 1Q82O 4FJIA 4O0IA 3LDSA 3DLRA 3RR7A 1JCEA 3QNOA 4KB1A 3NCIA 5JVGL 4JI1K 2A42A 3VPZA 4H5NA 1S9EA 3RR8A 2QWMA 2YX6A 2QI2A 3VQ5A 4CGDA 1Q7YO 1QHTA 3OJSA 3RMDA 4IDHA 4WE1A 3RWUA 2HHUA 3C6AA 5GAHP 1T6DA 1U6ZA 3KHYA 1C0GA 1H1VA 3FZLA 5KPTA 1I39A 3BEXA 5M1KA 1HNXK 1IBKK 1JL1A 3OYCA 1C0MA 1W0HA 2HBLA 4IBNA 3DLHA 4IFYA 3M5RA 1NJZA 1NKEA 1N6QA 3VGKA 4CJ4A 5LY3A 4L8RB 1KSPA 1VQ6N 1V4TA 4ISFA 1N34K 3DMJA 4CFAA 1KFSA 1VSLA 4NCGA 1TAUA 4DV1K 1RTIA 3AO3A 3SAFA 1IO2A 1NM1A 4HTUA 3H1QA 2IVOA 2ZJPL 2HMIA 3VEOA 4KREA 1JXEA 4RCHA 3K5NA 4KHWA 4CEDA 4EAHD 3R8EA 3CERA 3LP3A 1REVA 4DHYA 5AJ3K 4OKEA 3AO4A 1KAYA 4Z4FA 2O8DA 2W40A 4IEEA 4DV4K 4OVLA 4NCBA 3L0QA 4PUOA 3NVMA 4DR4K 2R7YA 4MQ3A 4CD1A 3ZEUB 1TUUA 2PYJA 2XY5A 2AJQA 4CZHA 4FXDA 2VG6A 2KHOA 5AFUA 5LJWA 2UUAK 1VSIA 3TAEA 4LH5A 1JLBA 2F9WA 4BRCA 4BRDA 2F4VK 4MO4A 5HL7L 1S5JA 2F9TA 4C8NA 3VGMA 4KKOA 1J9AA 5M1PA 3LDNA 4Z4HA 3AVJA 4E7JA 3ZT1A 1Z05A 3S41A 5M1FA 1J54A 4PL7A 2ITMA 2P9UA 1BISA 5F2RA 3HVTA 3WEEA 4B1UB 3PIOL 3OYBA 2P9IB 4FJ7A 4DV3K 4F4KA 2GUIA 4AF1A 2OPSA 2OZMA 4B9QA 1WOQA 5C2FA 4OPAA 4FO0A 2YKMA 4H0OA 4CFCA 4HVJA 3NBPA 4H03B 3OVNA 1TL3A 4CFDA 3V1RA 1T44A 4LF8K 2HMPA 4DF4A 4I9LA 2YHWA 3L2WA 2QWNA 3EZ5A 4BREA 5BPNA 5CHIA 2WUSA 2RHKA 3SAHA 1ATNA 3WNGA 4ICLA 4CJ5A 3HM9A 3P39A 5BPMA 3K5LA 4CBWA 1XC3A 4CJVA 2AA4A 3ID6A 1RT7A 4FLWA 3QBWA 2O8FA 3E01A 3VQ8A 4DS4A 3LP0A 1FK9A 4J2EA 3CCVN 3L3VA 3BP8A 4JKAA 1B9DA 4CZEA 3AVNA 1SZ2A 4JKHA 5FRNA 1MWMA 3ZCMA 4KHUA 4FVMA 3SK3A 2UUBK 4K0KK 2IC3A 2O8DB 2P9UB 4OKJA 1VQKN 3JAMO 3PX6A 3LP1A 3D0PA 3O4WA 1KQSM 5AQJA 4LFAK 4DU3A 2Q31A 3KLIA 2E20A 3WXJA 4M3XA 5BN9A 3RSEA 4CGFA 4FJHA 3VETA 1JLAA 1NK9A 2ZJQL 4DTSA 4OX9K 1BHLA 1RBSA 1QHAA 4Y0WA 2IAJA 1ZC6A 4LC9B 3K5MA 2IS3A 1RT5A 1D4XA 1EX4A 3FR0A 3J7AP 2UXDK 3MN6A 1WAFA 2VWBA 2P9PA 4BC5A 4IO8A 3WXIA 3O8MA 4CCHA 1RT4A 4OGEA 4BVPA 3TWHA 4CF9A 4FJ8A 1B9FA 3V9UA 1NU0A 4BDPA 3OTOK 4FWRA 1YUWA 3ZT3A 3S3MA 1WN7A 3L2UA 4G1QA 3TANA 3CFRA 3CMAN 5FDLA 1IBMK 3NHGA 4XIUA 3DOKA 2D0CA 4BRGA 3PSIA 4KHPK 2KLAA 3HL8A 4FJKA 4ID1A 3L8BA 1BUPA 1SQKA 2HOEA 1K8KB 3A5OC 4NLBA 3EL2A 4FK4A 2YNFA 4MFBA 2A3ZA 5I42A 3UE5A 1SKRA 4IJAA 4JI4K 2G8KA 3KLEA 1LAWA 3P31A 2VWKA 4AQYK 3D6RA 4IFEA 4PY5A 4N76A 3DI6A 4Y1CA 4BRFA 3CFPA 3QFPA 5HLFA 4A57A 4NXNK 4E3SA 3PLAA 4HTLA 3EYZA 2KTQA 4CEAA 3OW2M 3G25A 3KK7A 3TAPA 1ZYQA 1U47A 3THYA 3LDPA 1L3SA 4K42A 3O9SA 4ZTFA 3OYKA 4AILC 3P1GA 3FZFA 1YVNA 2XO7A 4DLGA 3IKMA 4DTUA 4FK0A 3L2VA 4KFBA 1RCHA 5HRNA 3RMAA 3OYJA 3S3OA 2KFNA 4BE0A 1DKGD 3CJBA 1L3UA 1ZXOA 5LL6Z 1RGIA 4BC3A 4JI0K 3QO9A 4LSNA 3UB5A 1WB9A 4DSJA 3CQYA 4YY3K 1N36K 5BRFA 1VQNN 4FW1A 2KKZA 1TK8A 4CF8A 2JLEA 1LWFA 3AVLA 3FLCO 2HBMA 3MX2A 3KK1A 3CJAA 1N5YA 4IFVA 1BA1A 3AA2A 2Z1IA 1OVYA 4FSVA 1VSEA 4LH4A 3UKRB 4CI6A 5C12A 3KK3A 3WEEB 3LDOA 1S1XA 4CJSA 3H3OB 2A1SA 2D5RA 2Y1JA 4JV5K 3U6FA 2O8EA 4BWMA 4FJGA 1G99A 2B6AA 2E6MA 2V52B 4CJTA 1BWFO 5KPRA 1D9FA 3ZSZA 3QERA 1VQ7N 4AM7A 1QQCA 3V9ZA 1MU2A 3MX5A 1TK0A 3KD5E 4NXMK 1Q9XA 4B9MA 2PYLA 4O0JA 3SBTA 3LP2A 2DFHA 4L3QA 5D3GA 2QKKA 1BU6O 3V9SA 1IBLK 3OJUA 4PL8A 4A59A 4ELUA 2VWJA 1GOCA 4DV0K 3DJCA 3ASMA 1EETA 3TTCA 2OPRA 4F3TA 3OYIA 4CEFA 4M45A 4OLBA 4B9UA 4JI5K 2WFBA 4DTNA 4CZFA 2OA8A 1NMNA 5HRPA 1OH6A 4BRNA 1FXXA 4JRQA 1UA1A 3MEDA 3TAMA 4R5PA 3TARA 4BR2A 3L4QA 3THYB 1GLLO 4C8KA 2A40A 2BGGA 4DS5A 3THWA 4FOIA 4LY7A 2DY4A 2GWJA 1ZBUA 4H0VB 4CVNE 3JS6A 5J2MA 4E1JA 5J1EA 1TKXA 4BWJA 5KTQA 4ELTA 1HKGA 3DYAA 1NLVA 3F73A 2ITGA 4J2AA 1KXPA 1KTQA 3MAQA 1EQYA 3FFKB 4DR3K 3OBWA 4CE9A 3AVAA 3LWLA 2HW3A 3LANA 2BTFA 2RN2A 5SZTA 3SV3A 4KBOA 1D8YA 3G0ZA 2DTUA 4M7XA 2HHWA 2QK9A 4CJRA 4W5TA 3SPZA 4WFBL 3F9KA 4WYBA 1D9DA 1RT1A 3K9JA 2O8EB 1X3MA 3WT0A 3UKRA 3ENOA 3VQAA 3D2EB 2YCHA 3FE1A 1IJJA 3AGRA 4XEIA 2IOCA 4C8MA 4FJJA 4BR5A 4DF8A 3RVCA 2B4JA 1VK0A 4IOCL 1S9GA 4AHRA 4B3MK 5EVZA 1NK0A 3RMBA 1R0AA 2YV0X 4ID5A 2HNZA 4FWLA 3AVMA 1CZAN 3P5JA 1JLFA 3B6PA 3MN9A 4EHTA 3HI0A 1VSHA 2GELA 1ILYA 3J80O 4PHTX 4I6MA 4LFBK 4JEPA 4H5RA 2G8IA 3F9MA 3SAGA 4MLHA 3CJ1A 4BR9A 4CZIA 1NGFA 3O5BA 4H4OA 2A41A 2OZSA 1S6QA 1S3XA 3GL1A 4N56A 1JKHA 4A2AA 1GOAA 1YI2N 4OLAA 2ZGYA 5AQOA 3ZLJA 4B9LA 3I55N 4CGGA 1C1AA 1J5EK 1BI4A 1OVQA 4YFUA 1OKJA 2FF3B 4KH4A 3OYHA 4GV6A 5HOOA 4BRAA 1YHQN 3WUHA 1KD1O 4M3UA 3SMSA 1IG8A 4KH5A 4G9ZA 1ITGA 4I2PA 5JS2A 1WSEA 1BQNA 1RDCA 2YHYA 3AO2A 4IWVA 1QSYA 4H0TB 1T7PA 4CERA 3D2FA 3H1VX 3ULEB 3CCSN 4FVUA 2O8BA 3LM2A 3PX0A 4FWQA 2LSNA 2ZWHA 3AA3A 4CHPA 1QZ5A 2ASOA 1TGOA 3IDHA 4EZ6A 3CQ8A 2XHBA 3K58A 4O4GA 1CZ9A 2HHHK 3O4NA 3LWMA 4WFNL 2ATQA 4BE1A 1JCFA 4LF9K 4B3TK 4QS8A 1Q18A 2ZGZA 4H5TA 3ZT2A 4GV9A 2QWLA 5ELZA 4KTWA 5EU7A 4PWDA 2A1RA 1HYVA 2W41A 4J2BA 1CXQA 4A61A 1HKBA 5AQSA 4C1NI 4DFPA 1NK5A 4JKBA 4CJPA 1VQMN 1R59O 3G10A 4B3RK 1L3TA 3MEGA 3OS1A 2E5LK 4LD0A 4CJWA 5C24A 3RRHA 1QTMA 4E19A 4CJLA 2E6LA 2RPIA 4ZTJA 3O9RA 3TPQA 1RTHA 4DTOA 1X3NA 3KIOA 4JYAK 5LJVA 4RW4A 4DUZK 2YJEA 2KW4A 2NZTA 5TKYA 4CF0A 1BQMA 4WQ5C 4I9QA 4WF9L 1WSFA 3O3FA 1QQMA 1TAQA 5AZIA 4HWIA 1OH7A 4BDYA 4F8RA 4FJ5A 2E2PA 1NMDA 3D7EO 5AQIA 3TTDA 5JICA 2NRVA 4Z4IA 3C6TA 2Q2RA 3L6QA 3PIPL 5GADP 3VOVA 3T69A 3Q7CA 2D1KA 1KCFA 4BRQA 1VSDA 5GIPA 4FJ9A 2UXBK 3QESA 3BF3A 2FC0A 4CIGA 4E7IA 3AVKA 3W3DA 4W5QA 3C95A 4F2RA 4E7HA 2P9KB 3O4QA 3WQUA 1K9MO 4FM1A 3MK6A 4JKCA 3ZSVA 1EWRA 3E1YA 4W5RA 1NGDA 3AGKA 4BRLA 3HPOA 1KAZA 1RDAA 4FWKA 3LPTA 4HHTA 1XHZA 2P9NB 4A5BA 4CBUA 3HXMA 3N4QA 4K43A 3I8DA 4DWIA 4MO5A 4QAGA 4RW6A 4IO9L 5EXWA 4RW8A 2I7NA 1Q86O 2E4LA 5KGWA 3ZT0A 5DM7L 2X74A 2KFZA 1ASWA 2Q36A 2IIRA 1UOCA 4YORA 4BR4A 4M3WA 2DFFA 3QDKA 2QM1A 5C25A 1GLEG 1IKVA 3QFUA 3R6MA 4XH1A 4AHVA 3PX4A 1NGGA 1GLFO 4AHUA 4CHNA 4JK9A 4CBXA 1S1TA 2J4RA 3I0SA 4JK8A 1OH8A 5CYQA 2BDPA 3C6HA 2E2QA 4YDUC 4CZLA 4BRMA 3I56N 1YITN 1HNVA 1QE1A 4DR6K 3OYEA 2O4GA 3AVCA 2P1JA 3ENHA 2CGKA 2A6AA 4FJNA 3DAWA 1U2VA 3CIPA 4XH4A 5AQVA 4DSFA 5AQHA 4CHQA 2KZMA 1HQEA 1TKZA 4B1ZA 2D0PA 3ULEA 4HUFA 2P9NA 2OANA 3PV8A 4CD3A 4CEEA 1ZBHA 4H4MA 4BR7A 1VQ5N 3QEPA 1LCUA 1WNSA 4BDZA 2QA4N 5EY4A 2CGLA 1I3AA 4KV8A 4Z4GA 1DLOA 3VQ9A 1CXUA 4LF6K 1L5UA 3L4IA 1NKBA 3AVIA 1QQNA 1HQUA 4BGAA 3O3HA 4CGJA 5KGXA 5F0XA 3TSUA 1DTQA 1ZBLA 4JI3K 3OYFA 3K2PA 3ATUA 3MXMA 3KLFA 4CEZA 3DXMA 4JS4A 3LZJA 4ELVA 1RTJA 5BREA 3VQDA 3VEYA 1BA0A 4FZYA 3T19A 2D0AA 3V81A 3DM2A 3CC7N 1X9JA 4FLYA 3J81O 3M8QA 2Q0RA 3HVRA 1TK5A 4KAZA 3FZKA 3CCRN 1S1VA 3ZSOA 4FK2A 3CCUN 4DV2K 1WUAA 3HPGA 4U67L 3DXKB 4X66K 3JSMA 1NGAA 1BGXT 1HRHA 3MWTA 4LF7K 2UUCK 2WONA 4H5VA 4CZJA 4CK2A 1LWCA 4BG8A 1VQ4N 2OPQA 2O8FB 4JKEA 1W97L 2GEMA 2WOMA 2HVIA 1XUPO 4TSXA 1NK8A 1RDDA 3AA4A 3CCLN 3S9HA 3QLHA 2FBYA 4MDBA 3QIOA 2HB5A 3TR8A 1NGIA 5AQYA 4GW6A 1T3VA 5AQFA 2XY7A 3O80A 4CJ7A 4JKGA 3PO5A 4E0DA 4BRPA 2O8CA 3QEXA 5GAEP 1TKDA 4BQZA 2QWQA 3TABA 2A5XA 3O9TA 1E3MA 1C0UA 3HSTB 4FWMA 2WC9A 4AHTA 2O8BB 1YVUA 2VG7A 3NF9A 5FPDA 3LPUA 1NGHA 2B5JA 3R1XA 1VQ9N 1WAJA 3O6WA 1NOYA 1ESVA 2P5GA 4DSLA 1JXBA 3DXKA 5EX5A 3T1HK 4CK1A 2YNIA 2HBJA 3ID8A 2G8VA 4H8KA 2VGNA 1BDGA 1C6VA 2E1ZA 3THWB 3PO4A 3AA5X 2F7TA 3VTIA 3CCJN 1KLNA 1X9SA 3CJCA 4CHOA 3A5LC 2QWPA 3GBTA 1YIJN 3THVA 1B92A 3E9PA 1HMVA 3GOIA 2G8WA 1SV5A 2UU9K 2YKNA 3VN5A 3LDLA 5J2NA 2ASPA 1HYSA 3PUFA 4NLCA 5FROA 5CZ1A 4DV7K 2EWSA 2P9IA 1K73O 4N5SA 3P4IA 4M3TA 4FPBA 4RWTA 4NYNA 3LDQA 4ZHRA 1HJOA 4FWSA 1VQPN 3T7ZA 3WNHA 4OO1J 4PKGA 1LW2A 3M8PA 3ULDA 3IMXA 1WSIA 5GIOA 1XNQK 4FM0A 1S6PA 1MA9B 1TL1A 4GVMA 5H1SQ 5AQWA 5C15A 4CHZA 2HHSA 3ZX3A 4Z4CA 4GVEA 2PZSA 1FKOA 1HX1A 3V9WA 3CYMA 2F8TA 2ZF5O 3P83D 4OPJA 3AVBA 5AZIB 5HROA 1GLDG 1GLCG 2X6NA 4BC4A 1U49A 2BE2A 3QIPA 4B1WB 5BR9A 2OTJN 5TKWA 3KK2A 3DLEA 3CJ9A 3K57A 3J8AA 4YOYA 3OYLA 3K0SA 3RMCA 2VG5A 1F21A 4NYFA 5IWAK 4GMJB 4IZ9A 3VMFB 3LALA 3W0LA 4KTZA 2F8SA 3C0BA 3K9KA 2GWKA 2FXUA 3KTQA 4CECA 4OPKA 4WQ4A 5KI6A 1K6YA 4E1MA 4C23A 4YHHK 3ZSXA 3IFRA 3M8RA 2FLOA 3DWLA 3VA3A 4AM6A 1XC9A 1ATRA 5CY4A 3CF5L 1U45A 1RILA 4DQQA 2YJFA 4F9OA 5AQGA 4DR1K 4X65K 5F1XA 1T03A 3OA9A 4JKFA 3QEVA 1W9HA 4DR2K 3C6UA 3FFIA 2X78A 2WTUA 4C8LA 2VQFK 3B8AX 1VRUA 4CFBA 1Q8IA 1SL2A 4ISEA 4QCLA 5BR8K 3K5OA 3NF7A 3HYFA 4M41A 3SBGA 3DLBA 1U04A 3VQPA 3VQEA 5MLCQ 3NFAA 3CXCM 3VA0A 3BZCA 2YHAA 3A0IX 2BH1A 3IG1A 3IS9A 4WQ4C 2BANA 4B1VA 4JI2K 4DR5K 3V4IA 1XMOK 3A5MC 1DT9A 3WNFA 5CYMA 3U9DA 3VEVA 2HHTA 1I94K 4B1YB 3B6OA 3OYDA 1NK7A 4AHSA 4WQ5A 3O9UA 3SQ1A 5M1NA 4KH6A 3O3GA 3HO1A 2P9SB 1C1CA 4B9NA 4BRHA 5I9EB 1UWBA 1VSMA 4O8KA 1X9MA 2P9LB 5AQXA 5E26A 2ZE2A
chains in the Genus database with same CATH topology
1XMQK 1N34K 4V19S 4DV1K 4DV6K 2UUBK 4K0KK 4GKKK 4LF6K 1N32K 3JAMO 2UXBK 5IWAK 4CVNE 1HNWK 5AJ3K 4GKJK 2UXCK 5IT9O 4LFAK 4DR7K 4DV4K 4DR3K 5LL6Z 4JI8K 4YHHK 3T1HK 4LF5K 4DR4K 4DUYK 4JI0K 4OX9K 4JI3K 4YY3K 4LFCK 1N36K 2HHHK 5A2QO 4LF9K 3J7AP 2UXDK 2ZM6K 4B3TK 1FJGK 4JI7K 2UUAK 4DR1K 4X65K 5FLXO 4DR2K 2F4VK 2VQFK 3T1YK 3J7YP 4JV5K 3J81O 5BR8K 3OTOK 4X64K 2UU9K 4B3MK 4DV5K 4X62K 4JI6K 1HNZK 4DV2K 4B3RK 4JI1K 4DV7K 4X66K 4NXMK 1IBMK 2E5LK 4CW7B 4LF7K 4JI2K 4DV3K 4DR5K 3J80O 2UUCK 1XMOK 4KHPK 4LFBK 2VQEK 5LMNK 4JYAK 4B3SK 1HNXK 1I94K 4DUZK 1IBLK 4LF4K 1IBKK 1HR0K 1XNQK 4DR6K 4LF8K 4JI4K 4DV0K 1N33K 1XNRK 4AQYK 5LMUK 4JI5K 1J5EK 4NXNK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ K;  1N34 K;  4V19 S;  4DV1 K;  4DV6 K;  2UUB K;  4K0K K;  4GKK K;  4LF6 K;  1N32 K;  3JAM O;  2UXB K;  5IWA K;  4CVN E;  1HNW K;  5AJ3 K;  4GKJ K;  2UXC K;  5IT9 O;  4LFA K;  4DR7 K;  4DV4 K;  4DR3 K;  5LL6 Z;  4JI8 K;  4YHH K;  3T1H K;  4LF5 K;  4DR4 K;  4DUY K;  4JI0 K;  4OX9 K;  4JI3 K;  4YY3 K;  4LFC K;  1N36 K;  2HHH K;  5A2Q O;  4LF9 K;  3J7A P;  2UXD K;  2ZM6 K;  4B3T K;  1FJG K;  4JI7 K;  2UUA K;  4DR1 K;  4X65 K;  5FLX O;  4DR2 K;  2F4V K;  2VQF K;  3T1Y K;  3J7Y P;  4JV5 K;  3J81 O;  5BR8 K;  3OTO K;  4X64 K;  2UU9 K;  4B3M K;  4DV5 K;  4X62 K;  4JI6 K;  1HNZ K;  4DV2 K;  4B3R K;  4JI1 K;  4DV7 K;  4X66 K;  4NXM K;  1IBM K;  2E5L K;  4CW7 B;  4LF7 K;  4JI2 K;  4DV3 K;  4DR5 K;  3J80 O;  2UUC K;  1XMO K;  4KHP K;  4LFB K;  2VQE K;  5LMN K;  4JYA K;  4B3S K;  1HNX K;  1I94 K;  4DUZ K;  1IBL K;  4LF4 K;  1IBK K;  1HR0 K;  1XNQ K;  4DR6 K;  4LF8 K;  4JI4 K;  4DV0 K;  1N33 K;  1XNR K;  4AQY K;  5LMU K;  4JI5 K;  1J5E K;  4NXN K; 
#chains in the Genus database with same CATH topology
 4CHY A;  1YT3 A;  4M63 C;  4PKI A;  5GAG P;  4CJE A;  1Z26 A;  4O44 A;  1RBV A;  4I2Q A;  4HUG A;  4DFJ A;  3SNN A;  1DGK N;  1S22 A;  4EP5 A;  4MLE A;  1M1K O;  3NF6 A;  1ZBS A;  1NGB A;  4RW7 A;  5T7B A;  1TYQ B;  5DMR A;  1FKP A;  1C0F A;  3CFO A;  4BC2 A;  5HP1 A;  2V51 B;  4WCE L;  3QIN A;  5AQR A;  3KVG A;  4OPH A;  2Y1I A;  1RTD A;  4PKH A;  4ILG B;  2QW9 A;  4E89 A;  4LF5 K;  3SV4 A;  5AQP A;  3ZX0 A;  1NJW A;  2CH5 A;  3ENB A;  4OJR A;  5JMV A;  2PY5 A;  3DOL A;  1RBU A;  3U9Z A;  3RRG A;  3E9O A;  5A2Q O;  2Z1H A;  4B9S A;  4JI7 K;  2IVP A;  4EIA A;  4IDK A;  3EKU A;  2P9K A;  1TUY A;  1GLB G;  3OYG A;  1VSJ A;  3KD1 E;  4PQU A;  4GV3 A;  3SUP A;  4A2B A;  1NJI O;  5FPN A;  4YOW A;  4JRP A;  3CQX A;  1EWQ A;  2OPP A;  3D45 A;  3HRG A;  3C7N B;  5GIN A;  3V6D A;  4DU4 A;  3OS0 A;  3N4P A;  3CD6 N;  4Y1D A;  1HYZ A;  1RT6 A;  3CCQ N;  3NGY A;  1LOT B;  2D0B A;  2HVH A;  3VEX A;  3LAM A;  3CI5 A;  1BL3 A;  5KRS A;  1Z6R A;  3ZT4 A;  5HBM A;  1IKW A;  4EP4 A;  3EY1 A;  5BRH A;  3KKR A;  5KQ8 A;  3KLG A;  2JWL A;  4FCY A;  3M1F A;  1CZB A;  3H3N O;  1SUQ A;  5JLH A;  4RTF D;  4V19 S;  1GLJ O;  3VF6 A;  2PBD A;  3BGR A;  2H3G X;  5CR4 A;  1SS6 A;  3CCE N;  1T8E A;  3NMU A;  4O8U A;  3EZW A;  3AVF A;  1VQL N;  1D5A A;  3BUZ B;  1MDU B;  1Q9Y A;  4GKK K;  4EFH A;  3CHW A;  4FJX A;  2HF4 A;  4CEO A;  1S1W A;  2QWO A;  2PAV A;  4DG1 A;  4DR7 K;  5DM6 L;  1Q81 O;  3TSQ A;  4E1N A;  1HNI A;  4FJM A;  4CJ3 A;  4JI8 K;  5AQM A;  1JLG A;  1BG3 A;  3HZ6 A;  1T05 A;  1QVG M;  4OKK A;  3VEN A;  1HKC A;  5KQD A;  4F2S A;  2JWK A;  5SWM A;  1U4B A;  4YDU A;  4JD2 A;  1LAV A;  1FJG K;  2FF6 A;  1KVB A;  3QBX A;  3AAQ A;  5FPM A;  1X9W A;  1KRP A;  4FM2 A;  3EE8 A;  4IG0 A;  4FPA A;  4KI4 A;  2D4W A;  3TI0 A;  4AHC A;  3U3Y A;  3CC4 N;  2QXL A;  4BGB A;  5C2D A;  2AP1 A;  3ZEU A;  2OYQ A;  3BF1 A;  4BVO A;  4DV5 K;  2GTD A;  1RFQ A;  3WXM B;  3WXK A;  4JI6 K;  3G4S N;  3A2F A;  3VES A;  2X6S A;  3DLG A;  4W5O A;  3SUQ A;  3SLC A;  2DFE A;  2VCP A;  1GLA G;  3ZET B;  4K25 A;  5DK5 A;  1BO5 O;  4DQ8 A;  4DTX A;  1WSJ A;  4DU1 A;  2BUP A;  4YOU A;  2YHX A;  3QEI A;  4CEQ A;  4R79 A;  2RF2 A;  2D0O A;  3Q7B A;  1HUX A;  3HOS A;  2XY6 A;  1P8Z A;  1V4S A;  2UYT A;  5KRT A;  1KVA A;  3T3F A;  2ZQB A;  1IKX A;  1JLC A;  3NAE A;  1YJ9 N;  4CF2 A;  1QZ6 A;  3CC2 N;  3CME N;  4N47 A;  2I7P A;  3U8X A;  3LAK A;  2JGU A;  3HSC A;  1BIU A;  4M7Y A;  4O5F A;  2O4I A;  2Z1G A;  1VSF A;  3EO3 A;  1SL0 A;  3E9L A;  1KFD A;  3HK2 A;  3HP9 A;  4PA1 A;  4B8C A;  3PSF A;  1TVR A;  3PY8 A;  1ASV A;  3VEW A;  1NBW A;  4DQI A;  4CJU A;  1VRT A;  1HLU A;  2HST A;  4CES A;  4K41 A;  4BR0 A;  4E7L A;  4JKG B;  3OYM A;  4M42 A;  4FOE A;  3WQT A;  2V7Y A;  1NGE A;  3THX A;  1U48 A;  4BG9 A;  4GKJ K;  2NRX A;  3EN9 A;  4KHY A;  3CCM N;  3ZSW A;  3ZET A;  5FPE A;  1HPZ A;  3HBT A;  1JJ2 M;  3SUN A;  2OTL N;  1NK4 A;  4J2D A;  3VGL A;  2WBN A;  1QQO A;  2IDO A;  4B9V A;  4LFC K;  4M3Y A;  1L3V A;  3FZH A;  1K8K A;  3H45 C;  2E8A A;  3U4L A;  1SL1 A;  1IV0 A;  4CGH A;  1RT3 A;  3NGZ A;  2F96 A;  3NDK A;  3CET A;  4FL9 A;  2FBX A;  3C7N A;  3SPY A;  4BRI A;  1A5X A;  3G71 N;  3SMP A;  3T1Y K;  3J7Y P;  4GY2 B;  2HHQ A;  3AVH A;  4CK3 A;  2E2N A;  2GX9 A;  3R3L A;  3ZSR A;  4JHD B;  3MEE A;  3KWI A;  4YNQ A;  4QS7 A;  1Y97 A;  3H46 O;  3I0R A;  5CE3 A;  4NCA A;  4DTM A;  3H6E A;  1SKS A;  1SKW A;  3HPH A;  5EOY A;  1BOT O;  3SJJ A;  4Z4E A;  3VQ6 A;  2FSN A;  3O1W A;  3I8B A;  4LF4 K;  3MCA B;  4HCC A;  3HTV A;  3CPW M;  3SJH A;  1HR0 K;  3VQ7 A;  1ZBI A;  3J7Z O;  1RDW X;  3KKS A;  2GV9 A;  2KQ2 A;  4CGI A;  4IOA L;  4I6M B;  4EZ9 A;  5HRS A;  4J8F A;  4K8X A;  1KLM A;  3ITH A;  3OY9 A;  4CJQ A;  4DQR A;  1QVF M;  1DEJ A;  4B3O A;  3HT3 A;  5LMU K;  4RW9 A;  1NWK A;  3AO1 A;  1K8A O;  4KPY A;  1QS4 A;  2P9L A;  3GE1 A;  4O5B A;  3HOT A;  3AVG A;  1XMQ K;  1GOB A;  1LV5 A;  1RBR A;  3JYT A;  4C8O A;  4CJF A;  1VAZ A;  5J2P A;  4IXC A;  3O9Q A;  3TAG A;  4DV6 K;  4DTP A;  3A8Y A;  3NF8 A;  4JNE A;  1J53 A;  3AO5 A;  3NVK A;  1IKY A;  5AQT A;  4GNI A;  1YJW N;  2UXC K;  2W6K A;  4H0Y B;  4DCH A;  3CG7 A;  3L2R A;  4YOV A;  4DB3 A;  1U2V B;  2QKB A;  1XI1 A;  3DLK A;  2E2O A;  1QSL A;  4RG8 A;  4DKW A;  5BN8 A;  3AY9 A;  1XWL A;  2ASM A;  3V1O A;  4DUY K;  3CJ7 A;  4KHQ A;  3EEQ A;  3SQ4 A;  4Z94 A;  4KB0 A;  2P5O A;  3TAF A;  1UA0 A;  3MN5 A;  4BAC A;  3SQ0 A;  3L3U A;  4FWP A;  2FBV A;  1WSG A;  4CZG A;  5K14 A;  4DFK A;  4OGC A;  4KI6 A;  4ILH A;  4DMN A;  3OS2 A;  2KZZ A;  2EHG A;  1IH7 A;  3ALY A;  1NG9 A;  2RE2 A;  4UQG A;  3MXJ A;  1X1P A;  1XHX A;  2W42 A;  1W2B M;  4JS5 A;  1HNZ K;  4NB4 A;  3SUO A;  5AQN A;  4KRF A;  2W6L A;  4KTQ A;  4YOX A;  2ZJR L;  1JLQ A;  4IKF A;  4CIE A;  2VQE K;  4BRO A;  1YTU A;  4FW2 A;  5LMN K;  3UIQ A;  1TKT A;  4FLT A;  3GG4 A;  3IAY A;  5AZJ B;  4DQP A;  4I7F A;  3C65 A;  1WLJ A;  2Z1J A;  1VSK A;  5KPZ A;  3ZSQ A;  4DSI A;  3VQQ A;  2IVN A;  3BZK A;  1RDB A;  2XRI A;  3V9X A;  5AQL A;  1VQO N;  2P9P B;  2NUB A;  2YNH A;  3QB0 A;  3MMV A;  1A5W A;  2YHB A;  3VF4 A;  3VQC A;  4HUE A;  1KC8 O;  3VQ4 A;  3ISN C;  1BI4 B;  3U3G A;  4JK7 A;  1RT2 A;  2E88 A;  2NRW A;  4LSL A;  1XQS C;  2HND A;  3MN7 A;  1C0T A;  4ILJ A;  3RTV A;  3I33 A;  1NOZ A;  5BPL A;  4DLE A;  1HJR A;  3UKU B;  1EO1 A;  3H08 A;  1N32 K;  4DTJ A;  1JLE A;  2NRT A;  2EX3 A;  1OH5 A;  5IT9 O;  3M6G A;  3SYZ A;  2HBK A;  3QET A;  3SI6 A;  4NO7 A;  3AAR A;  2G8F A;  4BRK A;  3QNN A;  2NRZ A;  4FLX A;  3WXL A;  4JD2 B;  3SZ2 A;  3S3N A;  2CH6 A;  3AAP A;  3F5T A;  2ZM6 K;  4IG3 A;  2VGM A;  4FJL A;  4UY8 O;  5AQU A;  4JN4 A;  1KAX A;  2NNW A;  4IOX A;  1RDU A;  2P9S A;  2NRR A;  1E4F T;  2PFU A;  4FWN A;  4FZZ A;  2E1Y A;  1O1W A;  3HM8 A;  2QTD A;  4Q0B A;  4X64 K;  3LL3 A;  3OYA A;  4X62 K;  1M90 O;  3O08 A;  1J5O A;  3FGU A;  3DRS A;  1E4G T;  5B8H A;  1JL2 A;  3DLL L;  1WBB A;  2FSJ A;  3VF2 A;  4AH9 A;  5AQK A;  2OCE A;  2Q0U A;  4E7K A;  3MEC A;  3CM6 A;  2QWR A;  3NGI A;  2GUP A;  4JHD A;  5AZJ A;  4XH5 A;  2YI1 A;  1Z25 A;  1NK6 A;  3GDQ A;  3UKU A;  4FWO A;  3V1Q A;  5JLF A;  3FZM A;  2Q97 A;  4CZK A;  1WBD A;  4H0X B;  4U7B A;  3R9P A;  1N33 K;  1XNR K;  3OYN A;  3WNE A;  2FBT A;  5ADX H;  3TTF A;  4BE2 A;  3L2Q A;  4KO0 A;  4DTR A;  2DPN A;  1CLQ A;  1W7A A;  1RNH A;  1KVC A;  1HPM A;  3F2K A;  3SCX A;  1ATS A;  3ZX2 A;  4B1X B;  1VHX A;  4K8Z A;  4JKD A;  3OBY A;  4QOZ B;  4QS9 A;  5I3U A;  1DTT A;  3KZB A;  4CIF A;  3D2E A;  2ETJ A;  4CJK A;  4M3R A;  5M1Q A;  4Q5V A;  3KWG A;  4DSK A;  3MCP A;  1EP4 A;  3O1B A;  5AQZ A;  4IEI A;  3EKS A;  3HJF A;  4WFA L;  1HNW K;  3OHR A;  4H0P A;  4A62 A;  3MDQ A;  1Y64 A;  3C94 A;  1YAG A;  3DRP A;  5C10 A;  2QXF A;  4EHU A;  3TSP A;  1P90 A;  3RSE B;  4A5A A;  4DSE A;  3MXI A;  1O13 A;  2QEX N;  3CPE A;  4MDA A;  3HP6 A;  4IJN A;  2HHX A;  3ATV A;  1BCO A;  4FLV A;  3D2F B;  2G8H A;  5M1O A;  3ZSY A;  3BDP A;  5CZ2 A;  3KJV A;  5E84 A;  1YF5 L;  5BRD A;  1RBT A;  1FW6 A;  4KHS A;  1LWE A;  1ZBF A;  1WSH A;  5FLX O;  5J2Q A;  4HCB A;  5JS1 A;  5AFU H;  3DXM B;  3DRR A;  3VER A;  3NH2 A;  4O55 A;  1YTA A;  1SAZ A;  4B8A B;  3LZI A;  3T1A A;  2FSK A;  2VYP A;  5ADX A;  2I5J A;  1NJY A;  4FYD A;  2IGI A;  2Q3S A;  3EE9 A;  4BY9 C;  4CW7 B;  3TAQ A;  1BIZ A;  4ISG A;  5AR0 A;  1EXQ A;  2NLX A;  1TV6 A;  1ASU A;  4B3S K;  4B9T A;  4CZM A;  2XY8 A;  2GBZ A;  5C0Y A;  3MWP A;  3A5N C;  3G6E N;  3QML A;  3VTH A;  1YJN N;  1YXQ A;  1VQ8 N;  5FRM A;  1NKC A;  1C1B A;  5E41 A;  2CGJ A;  4F3O A;  4YOT A;  4DFM A;  3VQB A;  3AV9 A;  3KLH A;  3E66 A;  4W5N A;  3JXU A;  2G8U A;  2P51 A;  5AQQ A;  1NGJ A;  3ZYY X;  1TYQ A;  3BY5 A;  3NH0 A;  3K59 A;  1JCG A;  1UAX A;  1MWK A;  2Q1N A;  1NJX A;  1T6C A;  2NRH A;  2RKI A;  4KHN A;  5JVH L;  3LM9 A;  4CEB A;  2ZD1 A;  4M3Z A;  4JAX A;  2HHV A;  4N41 A;  3IUC A;  2O8C B;  3QEW A;  4CF1 A;  3TU5 A;  1QSS A;  1EKE A;  4H5W A;  3IRX A;  3NH1 A;  4Z0U A;  1BCM A;  2HNY A;  4BQL A;  1J6Z A;  3NE6 A;  1S1U A;  2V7Z A;  2HF3 A;  1NGC A;  3CM5 A;  3M3Z A;  3P38 A;  4FZX C;  1N8R O;  1S72 N;  4FLZ A;  1A5V A;  2YNG A;  1NNE A;  4B08 A;  3VEZ A;  3SQ2 A;  3THX B;  1IG9 A;  5C42 A;  3QIC A;  4DQS A;  1LW0 A;  4JLH A;  1G15 A;  4C1N K;  4FLU A;  5HRR A;  3M8S A;  1Q82 O;  4FJI A;  4O0I A;  3LDS A;  3DLR A;  3RR7 A;  1JCE A;  3QNO A;  4KB1 A;  3NCI A;  5JVG L;  4JI1 K;  2A42 A;  3VPZ A;  4H5N A;  1S9E A;  3RR8 A;  2QWM A;  2YX6 A;  2QI2 A;  3VQ5 A;  4CGD A;  1Q7Y O;  1QHT A;  3OJS A;  3RMD A;  4IDH A;  4WE1 A;  3RWU A;  2HHU A;  3C6A A;  5GAH P;  1T6D A;  1U6Z A;  3KHY A;  1C0G A;  1H1V A;  3FZL A;  5KPT A;  1I39 A;  3BEX A;  5M1K A;  1HNX K;  1IBK K;  1JL1 A;  3OYC A;  1C0M A;  1W0H A;  2HBL A;  4IBN A;  3DLH A;  4IFY A;  3M5R A;  1NJZ A;  1NKE A;  1N6Q A;  3VGK A;  4CJ4 A;  5LY3 A;  4L8R B;  1KSP A;  1VQ6 N;  1V4T A;  4ISF A;  1N34 K;  3DMJ A;  4CFA A;  1KFS A;  1VSL A;  4NCG A;  1TAU A;  4DV1 K;  1RTI A;  3AO3 A;  3SAF A;  1IO2 A;  1NM1 A;  4HTU A;  3H1Q A;  2IVO A;  2ZJP L;  2HMI A;  3VEO A;  4KRE A;  1JXE A;  4RCH A;  3K5N A;  4KHW A;  4CED A;  4EAH D;  3R8E A;  3CER A;  3LP3 A;  1REV A;  4DHY A;  5AJ3 K;  4OKE A;  3AO4 A;  1KAY A;  4Z4F A;  2O8D A;  2W40 A;  4IEE A;  4DV4 K;  4OVL A;  4NCB A;  3L0Q A;  4PUO A;  3NVM A;  4DR4 K;  2R7Y A;  4MQ3 A;  4CD1 A;  3ZEU B;  1TUU A;  2PYJ A;  2XY5 A;  2AJQ A;  4CZH A;  4FXD A;  2VG6 A;  2KHO A;  5AFU A;  5LJW A;  2UUA K;  1VSI A;  3TAE A;  4LH5 A;  1JLB A;  2F9W A;  4BRC A;  4BRD A;  2F4V K;  4MO4 A;  5HL7 L;  1S5J A;  2F9T A;  4C8N A;  3VGM A;  4KKO A;  1J9A A;  5M1P A;  3LDN A;  4Z4H A;  3AVJ A;  4E7J A;  3ZT1 A;  1Z05 A;  3S41 A;  5M1F A;  1J54 A;  4PL7 A;  2ITM A;  2P9U A;  1BIS A;  5F2R A;  3HVT A;  3WEE A;  4B1U B;  3PIO L;  3OYB A;  2P9I B;  4FJ7 A;  4DV3 K;  4F4K A;  2GUI A;  4AF1 A;  2OPS A;  2OZM A;  4B9Q A;  1WOQ A;  5C2F A;  4OPA A;  4FO0 A;  2YKM A;  4H0O A;  4CFC A;  4HVJ A;  3NBP A;  4H03 B;  3OVN A;  1TL3 A;  4CFD A;  3V1R A;  1T44 A;  4LF8 K;  2HMP A;  4DF4 A;  4I9L A;  2YHW A;  3L2W A;  2QWN A;  3EZ5 A;  4BRE A;  5BPN A;  5CHI A;  2WUS A;  2RHK A;  3SAH A;  1ATN A;  3WNG A;  4ICL A;  4CJ5 A;  3HM9 A;  3P39 A;  5BPM A;  3K5L A;  4CBW A;  1XC3 A;  4CJV A;  2AA4 A;  3ID6 A;  1RT7 A;  4FLW A;  3QBW A;  2O8F A;  3E01 A;  3VQ8 A;  4DS4 A;  3LP0 A;  1FK9 A;  4J2E A;  3CCV N;  3L3V A;  3BP8 A;  4JKA A;  1B9D A;  4CZE A;  3AVN A;  1SZ2 A;  4JKH A;  5FRN A;  1MWM A;  3ZCM A;  4KHU A;  4FVM A;  3SK3 A;  2UUB K;  4K0K K;  2IC3 A;  2O8D B;  2P9U B;  4OKJ A;  1VQK N;  3JAM O;  3PX6 A;  3LP1 A;  3D0P A;  3O4W A;  1KQS M;  5AQJ A;  4LFA K;  4DU3 A;  2Q31 A;  3KLI A;  2E20 A;  3WXJ A;  4M3X A;  5BN9 A;  3RSE A;  4CGF A;  4FJH A;  3VET A;  1JLA A;  1NK9 A;  2ZJQ L;  4DTS A;  4OX9 K;  1BHL A;  1RBS A;  1QHA A;  4Y0W A;  2IAJ A;  1ZC6 A;  4LC9 B;  3K5M A;  2IS3 A;  1RT5 A;  1D4X A;  1EX4 A;  3FR0 A;  3J7A P;  2UXD K;  3MN6 A;  1WAF A;  2VWB A;  2P9P A;  4BC5 A;  4IO8 A;  3WXI A;  3O8M A;  4CCH A;  1RT4 A;  4OGE A;  4BVP A;  3TWH A;  4CF9 A;  4FJ8 A;  1B9F A;  3V9U A;  1NU0 A;  4BDP A;  3OTO K;  4FWR A;  1YUW A;  3ZT3 A;  3S3M A;  1WN7 A;  3L2U A;  4G1Q A;  3TAN A;  3CFR A;  3CMA N;  5FDL A;  1IBM K;  3NHG A;  4XIU A;  3DOK A;  2D0C A;  4BRG A;  3PSI A;  4KHP K;  2KLA A;  3HL8 A;  4FJK A;  4ID1 A;  3L8B A;  1BUP A;  1SQK A;  2HOE A;  1K8K B;  3A5O C;  4NLB A;  3EL2 A;  4FK4 A;  2YNF A;  4MFB A;  2A3Z A;  5I42 A;  3UE5 A;  1SKR A;  4IJA A;  4JI4 K;  2G8K A;  3KLE A;  1LAW A;  3P31 A;  2VWK A;  4AQY K;  3D6R A;  4IFE A;  4PY5 A;  4N76 A;  3DI6 A;  4Y1C A;  4BRF A;  3CFP A;  3QFP A;  5HLF A;  4A57 A;  4NXN K;  4E3S A;  3PLA A;  4HTL A;  3EYZ A;  2KTQ A;  4CEA A;  3OW2 M;  3G25 A;  3KK7 A;  3TAP A;  1ZYQ A;  1U47 A;  3THY A;  3LDP A;  1L3S A;  4K42 A;  3O9S A;  4ZTF A;  3OYK A;  4AIL C;  3P1G A;  3FZF A;  1YVN A;  2XO7 A;  4DLG A;  3IKM A;  4DTU A;  4FK0 A;  3L2V A;  4KFB A;  1RCH A;  5HRN A;  3RMA A;  3OYJ A;  3S3O A;  2KFN A;  4BE0 A;  1DKG D;  3CJB A;  1L3U A;  1ZXO A;  5LL6 Z;  1RGI A;  4BC3 A;  4JI0 K;  3QO9 A;  4LSN A;  3UB5 A;  1WB9 A;  4DSJ A;  3CQY A;  4YY3 K;  1N36 K;  5BRF A;  1VQN N;  4FW1 A;  2KKZ A;  1TK8 A;  4CF8 A;  2JLE A;  1LWF A;  3AVL A;  3FLC O;  2HBM A;  3MX2 A;  3KK1 A;  3CJA A;  1N5Y A;  4IFV A;  1BA1 A;  3AA2 A;  2Z1I A;  1OVY A;  4FSV A;  1VSE A;  4LH4 A;  3UKR B;  4CI6 A;  5C12 A;  3KK3 A;  3WEE B;  3LDO A;  1S1X A;  4CJS A;  3H3O B;  2A1S A;  2D5R A;  2Y1J A;  4JV5 K;  3U6F A;  2O8E A;  4BWM A;  4FJG A;  1G99 A;  2B6A A;  2E6M A;  2V52 B;  4CJT A;  1BWF O;  5KPR A;  1D9F A;  3ZSZ A;  3QER A;  1VQ7 N;  4AM7 A;  1QQC A;  3V9Z A;  1MU2 A;  3MX5 A;  1TK0 A;  3KD5 E;  4NXM K;  1Q9X A;  4B9M A;  2PYL A;  4O0J A;  3SBT A;  3LP2 A;  2DFH A;  4L3Q A;  5D3G A;  2QKK A;  1BU6 O;  3V9S A;  1IBL K;  3OJU A;  4PL8 A;  4A59 A;  4ELU A;  2VWJ A;  1GOC A;  4DV0 K;  3DJC A;  3ASM A;  1EET A;  3TTC A;  2OPR A;  4F3T A;  3OYI A;  4CEF A;  4M45 A;  4OLB A;  4B9U A;  4JI5 K;  2WFB A;  4DTN A;  4CZF A;  2OA8 A;  1NMN A;  5HRP A;  1OH6 A;  4BRN A;  1FXX A;  4JRQ A;  1UA1 A;  3MED A;  3TAM A;  4R5P A;  3TAR A;  4BR2 A;  3L4Q A;  3THY B;  1GLL O;  4C8K A;  2A40 A;  2BGG A;  4DS5 A;  3THW A;  4FOI A;  4LY7 A;  2DY4 A;  2GWJ A;  1ZBU A;  4H0V B;  4CVN E;  3JS6 A;  5J2M A;  4E1J A;  5J1E A;  1TKX A;  4BWJ A;  5KTQ A;  4ELT A;  1HKG A;  3DYA A;  1NLV A;  3F73 A;  2ITG A;  4J2A A;  1KXP A;  1KTQ A;  3MAQ A;  1EQY A;  3FFK B;  4DR3 K;  3OBW A;  4CE9 A;  3AVA A;  3LWL A;  2HW3 A;  3LAN A;  2BTF A;  2RN2 A;  5SZT A;  3SV3 A;  4KBO A;  1D8Y A;  3G0Z A;  2DTU A;  4M7X A;  2HHW A;  2QK9 A;  4CJR A;  4W5T A;  3SPZ A;  4WFB L;  3F9K A;  4WYB A;  1D9D A;  1RT1 A;  3K9J A;  2O8E B;  1X3M A;  3WT0 A;  3UKR A;  3ENO A;  3VQA A;  3D2E B;  2YCH A;  3FE1 A;  1IJJ A;  3AGR A;  4XEI A;  2IOC A;  4C8M A;  4FJJ A;  4BR5 A;  4DF8 A;  3RVC A;  2B4J A;  1VK0 A;  4IOC L;  1S9G A;  4AHR A;  4B3M K;  5EVZ A;  1NK0 A;  3RMB A;  1R0A A;  2YV0 X;  4ID5 A;  2HNZ A;  4FWL A;  3AVM A;  1CZA N;  3P5J A;  1JLF A;  3B6P A;  3MN9 A;  4EHT A;  3HI0 A;  1VSH A;  2GEL A;  1ILY A;  3J80 O;  4PHT X;  4I6M A;  4LFB K;  4JEP A;  4H5R A;  2G8I A;  3F9M A;  3SAG A;  4MLH A;  3CJ1 A;  4BR9 A;  4CZI A;  1NGF A;  3O5B A;  4H4O A;  2A41 A;  2OZS A;  1S6Q A;  1S3X A;  3GL1 A;  4N56 A;  1JKH A;  4A2A A;  1GOA A;  1YI2 N;  4OLA A;  2ZGY A;  5AQO A;  3ZLJ A;  4B9L A;  3I55 N;  4CGG A;  1C1A A;  1J5E K;  1BI4 A;  1OVQ A;  4YFU A;  1OKJ A;  2FF3 B;  4KH4 A;  3OYH A;  4GV6 A;  5HOO A;  4BRA A;  1YHQ N;  3WUH A;  1KD1 O;  4M3U A;  3SMS A;  1IG8 A;  4KH5 A;  4G9Z A;  1ITG A;  4I2P A;  5JS2 A;  1WSE A;  1BQN A;  1RDC A;  2YHY A;  3AO2 A;  4IWV A;  1QSY A;  4H0T B;  1T7P A;  4CER A;  3D2F A;  3H1V X;  3ULE B;  3CCS N;  4FVU A;  2O8B A;  3LM2 A;  3PX0 A;  4FWQ A;  2LSN A;  2ZWH A;  3AA3 A;  4CHP A;  1QZ5 A;  2ASO A;  1TGO A;  3IDH A;  4EZ6 A;  3CQ8 A;  2XHB A;  3K58 A;  4O4G A;  1CZ9 A;  2HHH K;  3O4N A;  3LWM A;  4WFN L;  2ATQ A;  4BE1 A;  1JCF A;  4LF9 K;  4B3T K;  4QS8 A;  1Q18 A;  2ZGZ A;  4H5T A;  3ZT2 A;  4GV9 A;  2QWL A;  5ELZ A;  4KTW A;  5EU7 A;  4PWD A;  2A1R A;  1HYV A;  2W41 A;  4J2B A;  1CXQ A;  4A61 A;  1HKB A;  5AQS A;  4C1N I;  4DFP A;  1NK5 A;  4JKB A;  4CJP A;  1VQM N;  1R59 O;  3G10 A;  4B3R K;  1L3T A;  3MEG A;  3OS1 A;  2E5L K;  4LD0 A;  4CJW A;  5C24 A;  3RRH A;  1QTM A;  4E19 A;  4CJL A;  2E6L A;  2RPI A;  4ZTJ A;  3O9R A;  3TPQ A;  1RTH A;  4DTO A;  1X3N A;  3KIO A;  4JYA K;  5LJV A;  4RW4 A;  4DUZ K;  2YJE A;  2KW4 A;  2NZT A;  5TKY A;  4CF0 A;  1BQM A;  4WQ5 C;  4I9Q A;  4WF9 L;  1WSF A;  3O3F A;  1QQM A;  1TAQ A;  5AZI A;  4HWI A;  1OH7 A;  4BDY A;  4F8R A;  4FJ5 A;  2E2P A;  1NMD A;  3D7E O;  5AQI A;  3TTD A;  5JIC A;  2NRV A;  4Z4I A;  3C6T A;  2Q2R A;  3L6Q A;  3PIP L;  5GAD P;  3VOV A;  3T69 A;  3Q7C A;  2D1K A;  1KCF A;  4BRQ A;  1VSD A;  5GIP A;  4FJ9 A;  2UXB K;  3QES A;  3BF3 A;  2FC0 A;  4CIG A;  4E7I A;  3AVK A;  3W3D A;  4W5Q A;  3C95 A;  4F2R A;  4E7H A;  2P9K B;  3O4Q A;  3WQU A;  1K9M O;  4FM1 A;  3MK6 A;  4JKC A;  3ZSV A;  1EWR A;  3E1Y A;  4W5R A;  1NGD A;  3AGK A;  4BRL A;  3HPO A;  1KAZ A;  1RDA A;  4FWK A;  3LPT A;  4HHT A;  1XHZ A;  2P9N B;  4A5B A;  4CBU A;  3HXM A;  3N4Q A;  4K43 A;  3I8D A;  4DWI A;  4MO5 A;  4QAG A;  4RW6 A;  4IO9 L;  5EXW A;  4RW8 A;  2I7N A;  1Q86 O;  2E4L A;  5KGW A;  3ZT0 A;  5DM7 L;  2X74 A;  2KFZ A;  1ASW A;  2Q36 A;  2IIR A;  1UOC A;  4YOR A;  4BR4 A;  4M3W A;  2DFF A;  3QDK A;  2QM1 A;  5C25 A;  1GLE G;  1IKV A;  3QFU A;  3R6M A;  4XH1 A;  4AHV A;  3PX4 A;  1NGG A;  1GLF O;  4AHU A;  4CHN A;  4JK9 A;  4CBX A;  1S1T A;  2J4R A;  3I0S A;  4JK8 A;  1OH8 A;  5CYQ A;  2BDP A;  3C6H A;  2E2Q A;  4YDU C;  4CZL A;  4BRM A;  3I56 N;  1YIT N;  1HNV A;  1QE1 A;  4DR6 K;  3OYE A;  2O4G A;  3AVC A;  2P1J A;  3ENH A;  2CGK A;  2A6A A;  4FJN A;  3DAW A;  1U2V A;  3CIP A;  4XH4 A;  5AQV A;  4DSF A;  5AQH A;  4CHQ A;  2KZM A;  1HQE A;  1TKZ A;  4B1Z A;  2D0P A;  3ULE A;  4HUF A;  2P9N A;  2OAN A;  3PV8 A;  4CD3 A;  4CEE A;  1ZBH A;  4H4M A;  4BR7 A;  1VQ5 N;  3QEP A;  1LCU A;  1WNS A;  4BDZ A;  2QA4 N;  5EY4 A;  2CGL A;  1I3A A;  4KV8 A;  4Z4G A;  1DLO A;  3VQ9 A;  1CXU A;  4LF6 K;  1L5U A;  3L4I A;  1NKB A;  3AVI A;  1QQN A;  1HQU A;  4BGA A;  3O3H A;  4CGJ A;  5KGX A;  5F0X A;  3TSU A;  1DTQ A;  1ZBL A;  4JI3 K;  3OYF A;  3K2P A;  3ATU A;  3MXM A;  3KLF A;  4CEZ A;  3DXM A;  4JS4 A;  3LZJ A;  4ELV A;  1RTJ A;  5BRE A;  3VQD A;  3VEY A;  1BA0 A;  4FZY A;  3T19 A;  2D0A A;  3V81 A;  3DM2 A;  3CC7 N;  1X9J A;  4FLY A;  3J81 O;  3M8Q A;  2Q0R A;  3HVR A;  1TK5 A;  4KAZ A;  3FZK A;  3CCR N;  1S1V A;  3ZSO A;  4FK2 A;  3CCU N;  4DV2 K;  1WUA A;  3HPG A;  4U67 L;  3DXK B;  4X66 K;  3JSM A;  1NGA A;  1BGX T;  1HRH A;  3MWT A;  4LF7 K;  2UUC K;  2WON A;  4H5V A;  4CZJ A;  4CK2 A;  1LWC A;  4BG8 A;  1VQ4 N;  2OPQ A;  2O8F B;  4JKE A;  1W97 L;  2GEM A;  2WOM A;  2HVI A;  1XUP O;  4TSX A;  1NK8 A;  1RDD A;  3AA4 A;  3CCL N;  3S9H A;  3QLH A;  2FBY A;  4MDB A;  3QIO A;  2HB5 A;  3TR8 A;  1NGI A;  5AQY A;  4GW6 A;  1T3V A;  5AQF A;  2XY7 A;  3O80 A;  4CJ7 A;  4JKG A;  3PO5 A;  4E0D A;  4BRP A;  2O8C A;  3QEX A;  5GAE P;  1TKD A;  4BQZ A;  2QWQ A;  3TAB A;  2A5X A;  3O9T A;  1E3M A;  1C0U A;  3HST B;  4FWM A;  2WC9 A;  4AHT A;  2O8B B;  1YVU A;  2VG7 A;  3NF9 A;  5FPD A;  3LPU A;  1NGH A;  2B5J A;  3R1X A;  1VQ9 N;  1WAJ A;  3O6W A;  1NOY A;  1ESV A;  2P5G A;  4DSL A;  1JXB A;  3DXK A;  5EX5 A;  3T1H K;  4CK1 A;  2YNI A;  2HBJ A;  3ID8 A;  2G8V A;  4H8K A;  2VGN A;  1BDG A;  1C6V A;  2E1Z A;  3THW B;  3PO4 A;  3AA5 X;  2F7T A;  3VTI A;  3CCJ N;  1KLN A;  1X9S A;  3CJC A;  4CHO A;  3A5L C;  2QWP A;  3GBT A;  1YIJ N;  3THV A;  1B92 A;  3E9P A;  1HMV A;  3GOI A;  2G8W A;  1SV5 A;  2UU9 K;  2YKN A;  3VN5 A;  3LDL A;  5J2N A;  2ASP A;  1HYS A;  3PUF A;  4NLC A;  5FRO A;  5CZ1 A;  4DV7 K;  2EWS A;  2P9I A;  1K73 O;  4N5S A;  3P4I A;  4M3T A;  4FPB A;  4RWT A;  4NYN A;  3LDQ A;  4ZHR A;  1HJO A;  4FWS A;  1VQP N;  3T7Z A;  3WNH A;  4OO1 J;  4PKG A;  1LW2 A;  3M8P A;  3ULD A;  3IMX A;  1WSI A;  5GIO A;  1XNQ K;  4FM0 A;  1S6P A;  1MA9 B;  1TL1 A;  4GVM A;  5H1S Q;  5AQW A;  5C15 A;  4CHZ A;  2HHS A;  3ZX3 A;  4Z4C A;  4GVE A;  2PZS A;  1FKO A;  1HX1 A;  3V9W A;  3CYM A;  2F8T A;  2ZF5 O;  3P83 D;  4OPJ A;  3AVB A;  5AZI B;  5HRO A;  1GLD G;  1GLC G;  2X6N A;  4BC4 A;  1U49 A;  2BE2 A;  3QIP A;  4B1W B;  5BR9 A;  2OTJ N;  5TKW A;  3KK2 A;  3DLE A;  3CJ9 A;  3K57 A;  3J8A A;  4YOY A;  3OYL A;  3K0S A;  3RMC A;  2VG5 A;  1F21 A;  4NYF A;  5IWA K;  4GMJ B;  4IZ9 A;  3VMF B;  3LAL A;  3W0L A;  4KTZ A;  2F8S A;  3C0B A;  3K9K A;  2GWK A;  2FXU A;  3KTQ A;  4CEC A;  4OPK A;  4WQ4 A;  5KI6 A;  1K6Y A;  4E1M A;  4C23 A;  4YHH K;  3ZSX A;  3IFR A;  3M8R A;  2FLO A;  3DWL A;  3VA3 A;  4AM6 A;  1XC9 A;  1ATR A;  5CY4 A;  3CF5 L;  1U45 A;  1RIL A;  4DQQ A;  2YJF A;  4F9O A;  5AQG A;  4DR1 K;  4X65 K;  5F1X A;  1T03 A;  3OA9 A;  4JKF A;  3QEV A;  1W9H A;  4DR2 K;  3C6U A;  3FFI A;  2X78 A;  2WTU A;  4C8L A;  2VQF K;  3B8A X;  1VRU A;  4CFB A;  1Q8I A;  1SL2 A;  4ISE A;  4QCL A;  5BR8 K;  3K5O A;  3NF7 A;  3HYF A;  4M41 A;  3SBG A;  3DLB A;  1U04 A;  3VQP A;  3VQE A;  5MLC Q;  3NFA A;  3CXC M;  3VA0 A;  3BZC A;  2YHA A;  3A0I X;  2BH1 A;  3IG1 A;  3IS9 A;  4WQ4 C;  2BAN A;  4B1V A;  4JI2 K;  4DR5 K;  3V4I A;  1XMO K;  3A5M C;  1DT9 A;  3WNF A;  5CYM A;  3U9D A;  3VEV A;  2HHT A;  1I94 K;  4B1Y B;  3B6O A;  3OYD A;  1NK7 A;  4AHS A;  4WQ5 A;  3O9U A;  3SQ1 A;  5M1N A;  4KH6 A;  3O3G A;  3HO1 A;  2P9S B;  1C1C A;  4B9N A;  4BRH A;  5I9E B;  1UWB A;  1VSM A;  4O8K A;  1X9M A;  2P9L B;  5AQX A;  5E26 A;  2ZE2 A; 
#chains in the Genus database with same CATH homology
 1XMQ K;  1N34 K;  4V19 S;  4DV1 K;  4DV6 K;  2UUB K;  4K0K K;  4GKK K;  4LF6 K;  1N32 K;  3JAM O;  2UXB K;  5IWA K;  4CVN E;  1HNW K;  5AJ3 K;  4GKJ K;  2UXC K;  5IT9 O;  4LFA K;  4DR7 K;  4DV4 K;  4DR3 K;  5LL6 Z;  4JI8 K;  4YHH K;  3T1H K;  4LF5 K;  4DR4 K;  4DUY K;  4JI0 K;  4OX9 K;  4JI3 K;  4YY3 K;  4LFC K;  1N36 K;  2HHH K;  5A2Q O;  4LF9 K;  3J7A P;  2UXD K;  2ZM6 K;  4B3T K;  1FJG K;  4JI7 K;  2UUA K;  4DR1 K;  4X65 K;  5FLX O;  4DR2 K;  2F4V K;  2VQF K;  3T1Y K;  3J7Y P;  4JV5 K;  3J81 O;  5BR8 K;  3OTO K;  4X64 K;  2UU9 K;  4B3M K;  4DV5 K;  4X62 K;  4JI6 K;  1HNZ K;  4DV2 K;  4B3R K;  4JI1 K;  4DV7 K;  4X66 K;  4NXM K;  1IBM K;  2E5L K;  4CW7 B;  4LF7 K;  4JI2 K;  4DV3 K;  4DR5 K;  3J80 O;  2UUC K;  1XMO K;  4KHP K;  4LFB K;  2VQE K;  5LMN K;  4JYA K;  4B3S K;  1HNX K;  1I94 K;  4DUZ K;  1IBL K;  4LF4 K;  1IBK K;  1HR0 K;  1XNQ K;  4DR6 K;  4LF8 K;  4JI4 K;  4DV0 K;  1N33 K;  1XNR K;  4AQY K;  5LMU K;  4JI5 K;  1J5E K;  4NXN K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...