4B3MO

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4b3mO00
4B3RO 5H5NA 2UUCO 5IWAO 2HHHO 4B3TO 2FKXA 1FYJA 3M8AA 1X59A 2UXCO 4DV2O 4DV1O 5BY1A 1HNXO 3SDLA 4X64O 4LF8O 2DJVA 4DR3O 4DV4O 4LF6O 1AB3A 1G1XB 4A5UB 2VQFO 4DV6O 2UUAO 4JI0O 2Z0AA 1A32A 1YZBA 2AGAA 4JYAO 2UXDO 3J80N 2F4VO 4DR7O 1FJGO 4B3SO 4LFBO 1I94O 4LFCO 5IT9N 1NS1A 3T1HO 4JI4O 1IBLO 1HNWO 3O65A 4JI1O 4DV7O 2UU9O 1F7YA 4OPAA 4K0KO 1IBMO 2ZKOA 1XMQO 4JI6O 4JI8O 4X62O 5LMNO 2DOSA 4LFAO 4AQYO 3J7AU 1N32O 5FLXN 2JRIA 5BR8O 4DV0O 4DUZO 4DUYO 4NXMO 2ZM6O 1N33O 4DR4O 2VQEO 4JI5O 4JI3O 1HNZO 4DV5O 1J5EO 3F5TA 3OTOO 4OPHA 4GKKO 2LW7A 4X65O 4LF7O 2UXBO 4GKJO 4DR2O 1R1BA 4X66O 5BXZA 5LMUO 4KHPO 1N34O 1XNRO 3RT3C 1D2DA 4YY3O 4OX9O 3J81N 3JAMN 4NXNO 1FKAO 4LF9O 1DK1A 4LF5O 2UUBO 3R66A 4LF4O 5LL6Y 4B3MO 5A2QN 1XMOO 4DR1O 2E5LO 1N36O 4YHHO 4DR6O 1KUQA 4JI7O 1XEQA 4DV3O 2N74A 1XNQO 3T1YO 4DR5O 4JI2O 1HR0O 1AILA 1IBKO 1R6TA 4JV5O
chains in the Genus database with same CATH superfamily
2F4VB 2AZ0A 2D3OW 2HHHB 2ZIMA 3H1JH 4R50A 4DV1B 1R3LC 1XHXA 4X64B 3SDLA 1L1FA 1B06A 1WN7A 2PUSA 1QU7A 1V54C 1PL4A 1N0JA 3T4ZA 4WBNA 4EB6B 2IJJA 5TISZ 2YXHA 2LO1A 3B09A 4DR4B 3JD1A 4DR7O 4TSFG 3L72H 4UCVA 1SQBH 4LFBO 4JI4B 3W7SA 4JYBA 3U11A 1FXHA 4PDVA 1S5JA 1VEWA 4YJ2B 1KC8W 1F7YA 1S0VA 4BWAA 3JD2A 5H9CA 3QO7A 2FYUH 4NR1A 2P6JA 4JTAB 1XMQO 4AQYB 4X62O 1N32B 5GTHZ 4ZHQB 3A0BZ 2BSKA 1DTOA 1EBOA 1Q7YW 5J2TA 3RBZA 3W7XA 3JAKA 1K97A 2W0XA 5FL7G 3E86A 3E22B 2ATKC 3JCUZ 3FYIB 1VQKV 5ITZA 1YXBA 5IYZB 1NR7A 4LC1A 4JYYA 3K5MA 1S77D 1DK1A 1FS0G 3LSUA 3JALA 4DR1B 3SYAA 1XMOO 2M6YA 1LR1A 1AI4A 4DR6O 4AILC 3B77A 3CD6V 3T1CA 1VP7A 1ZLZA 4EFBA 4RUEA 1D5AA 4EEQA 1SQXH 2Q69A 1V55B 4PA3A 1Q6UA 1N4CA 2QKAA 3D3QA 4I50B 1VQ7V 4B3TO 1KD1W 4DXWA 1AI5A 4G28B 4X8AA 3K03A 4DV4O 4MTOA 4Q20A 1PM9A 2OIGA 1Q81W 3L74H 1S72V 2UXXA 1R6NA 2GHYA 4BIUA 2ARHA 4JYAO 1P49A 2UXDB 2EULA 2QEXV 1SQGA 1NTMH 1AJNA 2AHYA 4X1IB 3BRCA 1SS3A 4YJ2A 4AI8A 3OE7G 4L87A 1BT8A 2XNDG 4BIZA 2X7RB 4JI6O 1J95A 5LP6A 4Z1MG 1XMOB 3JARB 1Y74B 1IXBA 2EIMB 5B3SB 2QSAA 4O4HB 4ZIBA 5BMVB 5IJ0B 3E22A 3K0DA 2UXBO 1FPOA 1AI6A 4O2BA 4JF3A 3OMNB 5DN6G 1I5YA 5IYZA 2W6JG 3ASOB 4MW3A 2VRZA 3LSSA 4U3FH 1GN3A 3RVYA 3U0ZA 2E3CA 2ZE6A 4JZ2A 4YHHO 3AG3B 1N0NA 1DF5A 4FLTA 2W0FC 2IM9A 4FFKA 4LNUB 3GVMA 4DR5O 2PZSA 1IDSA 4RAIA 1M57B 2CE4A 5H6RA 4GZRB 5LGUA 3L75H 3AG4C 4QE9A 2CAZC 1Q90D 3ZMZA 3ZMSA 1QVFU 1UFIA 4DV2B 1RM1C 1HNXB 2ZE5A 5IYDO 4X1KB 3FB8C 3DC6A 4TQDA 2VQFB 1SETA 3MAQA 1FXVA 1MNGA 4MSWC 3IGAC 3QTCA 2AW9A 2RJZA 4O2AB 1M5IA 2UXBB 4X1IA 1K34A 3QF7A 1K33A 5FNVB 3H1IH 1BE3H 2EX3A 1MMMA 3L71H 1PNKA 5LBQA 4J42A 3OTFA 2N04A 1BHBA 1OCRB 1WB7A 1JPXA 2ZNIA 1YITV 4IHJB 4YIOA 1B04A 2M7WA 4TT3G 3JARA 4P30A 1Y74A 5BR8O 4DV0O 4YJ3B 1SZXA 1SESA 1PKXA 3MHHC 2ZM6O 4JI3B 5E1AC 4MTGA 4K35A 3Q4HB 5IJ0A 1H2NA 4RO2A 2V1DA 2QKSA 4HZ3A 4GKJB 3T2MA 2ODMA 2HVKC 3HKDA 2XAFA 4DR5B 3VQWA 1SF9A 3J81N 1GMGA 5GW7A 3F5WC 3IC9A 2N05A 3L70H 4JAVA 1MSDA 4FFBA 5EBLC 2JK5C 2E5LO 3ZN0A 3RYCB 4MVMA 2IH3C 4DRXB 3CCRV 1RFYA 5CN0A 2IJHA 5K1XA 3SPJA 1FFXA 3T1YO 1NZ6A 4WFFA 4JI2B 1IZ3A 2UXNA 2RN9A 1GAXA 2JGDA 4WFAV 4PDRA 1HWYA 5B66Z 2E75B 5EC2C 2F43G 3O9OA 3DC5A 2CTPA 1CPYA 3QG5A 1U96A 2NLJC 4JAAA 1QBZA 1TUBB 3K59A 3H1KH 4X1KA 4JAUA 2YXYA 1JR9A 4FLYA 2QKCA 1XI1A 3D36A 3HKEA 5B5EZ 4N21A 1W2BU 2QDOA 3QO5A 2ZM6B 4PA4A 4J11A 1O9HA 2OTLV 1QR8A 5JWPA 1FJGB 4O2AA 3IFXA 4H33A 4LH6A 4FJCC 4LFCO 3G6EV 4J9YB 3CMAV 4X20B 1YJWV 3H1HH 2UU9B 4JI1O 1IBMB 3W7TA 4K0KO 1ZL8B 3JD3A 3HR0A 3FAVA 2GV9A 3FYEB 4F6RB 4IHJA 5FLXN 2JRIA 4DUYB 5GTIZ 2E5LB 3RYHB 4R6ZA 1N33O 2PTMA 4WFEA 3CCJV 3DTUB 4LH7A 1XHZA 5EYPB 2WLLA 1V55C 2R70A 2DN9A 1XNRB 2KKWA 3LNNA 5KHIA 3NR7A 3SYCA 3AG1B 2WLJA 3ZCCA 3KG2A 1HW7A 3OGCC 2YICA 2WSSG 1WPXA 1NKDA 2XUMA 4AHCA 2B1GA 2OT5A 1XBLA 2YI9A 1ORQC 2XAJA 3THOA 5EK0A 4K8XA 1K4CC 3CPWU 3FKSG 1LUVA 5LYJB 1SERA 3K9SA 3OEEG 3WU2Z 3RFRA 2H8PC 2H3OA 2A0LA 4UFZA 1VQLV 3ZX6A 5IY5B 1Z2GA 3AEIA 4QGPA 3EFFK 3LDEA 5J2UB 4LFCB 2OWOA 1TGOA 1SA0B 2Q7GA 4GT1A 4Z2WA 4PA7A 3BVOA 5KMGB 2EIMC 2ZDIC 1Q86W 2HLDG 2Q4PA 2GDSA 3CCSV 3G6BA 1EN6A 2CH7B 2EINB 4HBNA 3ASOC 3JYCA 3HB3B 1NS1A 4MT8A 2CGNA 4QPKA 4QE7A 1K3EA 3D8CA 1SQFA 2KSDA 3RGBA 4O4IB 3OT7A 2HVJC 5L3CA 1D5NA 5IE9A 4EFEA 5LMNB 3PN1A 5L3GA 1PNMA 1G6UA 3AG3C 2XAHA 4DUZO 3LSQA 1CEZA 1WP8A 4RQEA 3SYQA 1HNZO 2F66C 2YDEA 1M56B 3ZHVA 1M57C 4DR2O 1GH6A 4XDJA 5EIBC 4X66O 1BZKA 4Z1VA 5LMUO 5JVDA 2BCCH 4CBCA 3G67A 3CRRA 4KUMA 1UPGA 4NXNO 3WG7B 5JCOA 4C7UA 1MSWD 1OCZB 3ETEA 5J2TB 4X1YB 3JAKB 1N36O 4MVZA 2WA4A 3SJBC 1QLEC 2R9AA 3OR7C 1EZVH 1MZFA 5ITZB 5LYJA 3ZHQA 3TXQA 2OIEA 2P4VA 1AJQA 2GTSA 1HR0B 5KLVH 1Q43A 4JV5B 3VQYA 3UO3A 1K73W 4WFGA 3APOA 5J2UA 4FLUA 1OCRC 1QHTA 2ADPA 2P67A 5BY1A 3H1LH 4MS2A 2MK3A 2KG7A 2XTAA 4CH5A 1L0NH 5KMGA 4J7KA 1BCCH 4FIPC 5LHHA 2R9RB 4R7CA 3BAAA 2UUAB 1XOUA 1Q82W 4GLXA 3SPCA 4QPJA 3WB2A 1YVWA 4FM0A 2CH7A 1H38A 1I94B 4EKWA 3AG7A 4QJFB 1URFA 4PI2A 4O4IA 2Q0OC 1GM9A 4JI8B 4PV1B 3K57A 5JQGB 1HDJA 1PL0A 1VQMV 1NVPD 1SRYA 4WCEV 4GCZA 1EZJA 2WLKA 1VF5B 4LBEC 3AK1A 1OZ0A 4BW5A 2Y0IA 3SJCC 1V9PA 3D3IA 2CTWA 4RWUA 1N34B 2LQTA 5A9GA 3CCLV 2AZ2A 4OX9B 3RYFA 5DEDA 3F7VC 1FKAO 3ZHRA 1VQPV 4LF9O 4ZBMA 5LP6B 4DK0A 2LP7A 1M90W 1XQ8A 1H2KA 2K1EA 4X1YA 2XT9A 3RYIA 1VF6C 3ZHSA 1MOFA 4JI7B 4JASA 2RMKB 4O2BB 3M7MX 1H2MA 3OEHG 1S5HC 3AG2C 1NTKH 1P4RA 5LHGA 2FMLA 3KKYA 1AR4A 1KMIZ 2EJ7A 4NTXA 1F4MA 2HFEC 2WLIA 4GX0A 4MVUA 3SGIA 2UUCO 3A0RA 2ITCC 5CA3A 2DYRB 3M8AA 4PDLA 4FM2A 4DW1A 2UXCO 4P9OA 2DMXA 4UB6Z 3CRQA 3A2FA 2YUAA 2Q67A 1B6QA 1SQPH 4OXSA 4F4LA 4E2LA 4DR7B 1P7GA 1ROPA 5L3EA 1NQTA 4LFBB 1OCOB 3AG1C 1EN4A 3P3PA 5JCOC 1FXKB 1RP3B 4XDLA 3O65A 1F4NA 2ZE7A 2QWRB 3CXHF 1YJ9V 1OJHA 3SJQC 2HKOA 1XMQB 5LHIA 1KKDA 4X62B 1DLBA 1Q3EA 1VQ4V 2YIAA 5JQGA 2YC0A 2LGQA 2ZT9B 1R6KA 2PI5A 1H8EG 2QWNB 3ZMVA 5IY5C 2XAQA 5C93A 5BZBA 1YCIA 2ADQB 1NR1A 3QVNA 3VQXA 3HKBB 2EBOA 4LF4O 1NU1H 3ABTA 5L3FA 3ZRWB 2E74B 3G80A 3SJAC 2JEUA 4CC5A 1WPBA 2VWJA 2GBOA 5KUMA 1YDXA 3K9AA 4DR6B 1B3QA 1I08A 1R3JC 3L9DA 1BMFG 5EC1C 5CBHA 1KECA 4DV3O 4J80A 3HKDB 3K5LA 2EINC 5KA6A 2YIBD 3TCUA 3ABUA 4ZKIA 2Q6AA 1E1QG 1X4TA 3CC2V 1VQNV 2QJ1A 3C3SA 4FFBB 1YTFD 5H5NA 4B3TB 2QA4V 2R9IA 3E35A 3CX5F 3ZBHA 3BEHA 3ABMB 4I5SA 2Z3YA 2L6LA 4DV4B 2HJDA 4LF6O 1BGYH 3UCSC 1FFXB 3N2KB 2XOKG 2Y48A 1M9NA 3TGUH 1M56C 3K79A 2JS3A 4JI0O 4JYAB 1JA8A 2JGDB 4UCUA 4F6EA 1K92A 3JSNA 2P06A 3J80N 1KYOF 2Q5ZA 3OMAB 5IT9N 5EBMC 3WG7C 4GYCB 1FXKA 1AROP 1IBLO 1JQ0A 1OCZC 2Q8VA 2YEVB 4CH4A 1RSOA 2HJFC 1NH2B 2NR5A 4JI6B 1KKCA 1K9MW 3M99B 1ENVA 4LFAO 3HKEB 4O4JB 1U97A 3X2QB 1Q5OA 4IL6Z 1Y67A 3STLC 1AI7A 2F93B 2EZOA 3LDDA 4BR6A 4D7SA 2P4KA 4LF7O 1F23A 5CA0B 3RVZA 5BXZA 1COWG 4KHPO 3CHXA 4UV9A 4JTDB 4YY3O 3FAVB 4WF9V 1W0KG 3HKBA 1L8DA 4HNAA 3T4DA 2V7QG 3ZRWA 1VMGA 2K9PA 3CYOA 2CK3G 2X0LA 4YHHB 1ZWIC 3CE2A 2YSUB 2WLLB 2P7TC 4TV8B 4UCRA 1S76D 1AJPA 1BL8A 4X88A 1KQSU 5DECA 2P22C 1AR5A 4UV8A 2QWOB 2WLHA 3OGIB 3MHSC 4B3RO 2CUGA 4MVRA 3BY6A 1X59A 3TETA 3CCMV 1ZAUA 4DO2A 2BTQA 2OYQA 4WFBV 4DR3O 2GTAA 1OHHG 4KFMA 3N2KA 2QM8A 4DYLA 1R3KC 1GN4A 1YJNV 4QIWF 2Z0AA 3JD0A 2AGAA 2GUZB 4PA9A 3NXSA 5JJEB 2Q0AA 2A06H 3HKCA 3PJSK 1NJIW 4FLZA 3CEIA 2WAMA 1HNWO 5D5QA 5LP6C 4I55B 3E83A 2YEVA 2IH1C 3LNMB 4H13B 5FPOA 4PD4F 3CJHA 2AXTZ 3J7AU 3TXSA 4LWSA 3ZHTA 1NTZH 4PA6A 1JJ2U 2DWDC 4O4JA 5BR8B 4DV0B 2LFSA 3ZMTA 3CB2A 1QQCA 4JI5O 4DV5O 2CGOA 3N27A 4KP4A 4UXNA 1KU9A 4X65O 5CA0A 2DYSB 1AP5A 1GN6A 3QNEA 4N23A 3ML0A 1YI2V 4O4LA 4PJ0Z 2DYRC 3CCEV 4LF5O 3CC7V 1XUQA 3C3TA 2HEPA 2OCCB 1S3JA 1IURA 3G4SV 1PNLA 3JSLA 2Q7HA 2HP8A 4W4LA 4TV8A 5IJ9A 3T1YB 5JVDB 4X89A 3JAWA 3N2GA 4UVAA 1K8AW 1XILA 1QVGU 1NVPB 5E79Z 1OCCB 3IC7A 2JGUA 3ZRSA 1VQ5V 1FXKC 1Q6IA 5B1OA 2DWEC 2Q9LA 3K3WA 5EBWC 1P84F 1BQ0A 1GO3F 3S3WA 3UT5B 3ZIAG 3JD4A 2F23A 3SPIA 1M4UA 1YF2A 4UVBA 4A5UB 1HP8A 2EIJB 4MTXA 4NTYA 1A32A 1GN2A 2B5UA 2GUZA 5JJJB 4CZZA 3EVKA 2Y69B 1K5QA 3UQ8A 4X65B 3GWKC 4GUNA 3ZMUA 3T1HO 4JI1B 2JDIG 4K0KB 4TV9A 2WPDG 2KG7B 4I55A 4I9WA 4ABMA 5B3SC 3B40A 1PPJH 3FB5C 4IIJB 2JEXA 2WA3A 4ASUG 1JFFA 2EIKB 3P32A 1N33B 2JIZG 2VQEO 2CDYA 2B9ZA 1J5EO 1VQOV 1KP3A 2JJ1G 5CMUA 3P3NA 5LGNA 2VWKA 2EILB 2XAGA 1BSMA 3K06A 1QR9A 3C90A 4OGQB 2A7WA 5LL6Y 4FLXA 3ABMC 1NI8A 3E89A 3ASNB 2LFRA 2YS8A 3FX7A 4U7OA 4KL1A 2QGNA 3GWOA 1NT2B 4FLWA 1XNQO 5KAIZ 4FMTA 3RYFB 3CS5A 1AILA 4FPPA 1IBKO 1Y6XA 4TUYB 4KXRA 1EN5A 3ETQA 3I5DA 5IWAO 4NB5A 1EFRG 2HHHO 3T1HB 3RYIB 5K1PA 1CP9A 2AHZA 4DV1O 2C2AA 2LW1A 1G8MA 4X64O 3D36C 2DJVA 3CRCA 3CCVV 3UT5A 3X2QC 1R3IC 2XHBA 4PDMA 5D5PA 3E8FA 2A9HA 2WLIB 1MZEA 1GTOA 3L73H 4B3SO 2Y4UA 1ZUQA 4JI4O 5CA1B 3MD0A 2X6BA 1OV9A 1XREA 3WFVA 3SYPA 1YTFB 1KB9F 5CB4B 4MW8A 3B8MA 4ICGA 4IIJA 4AQYO 1VQ6V 3OM3B 1N32O 4FZ0A 4DUZB 2IJKA 1FFTB 2IJIA 1G4YB 4JTCB 1HNZB 5KHKA 3ZS8C 3ETGA 3OTOO 5C8YA 2QWPB 3CCUV 4DR2B 4B7KA 4X66B 1XNQB 1R1BA 2NN4A 4J7JA 3G71V 2A79B 5LMUB 4YXWG 3DXRB 4NXNB 3CRAA 5KHJA 2ITDC 5KUKA 1SZTA 3R66A 3BHPA 4HYOA 1GRJA 4UVCA 4MVOA 3AK3A 5IWAB 4DR1O 1N36B 3MDSA 1GK9A 4B08A 1XEQA 1US6A 3I56V 1W0JG 1Y76B 4FLVA 1H8HG 1THZA 4ZI7B 3K5NA 3ABLB 3TK1A 4GX2A 1GM7A 1AP6A 1R6TA 1DGSA 2QM7A 4TUYA 1CXZB 2Q73A 4B3SB 1JCHA 1TVKB 2PY5A 5AG2A 2HR3A 4I9QA 5HFLA 1K4DC 2BOCC 2V4DA 4GX1A 2Y0PA 3CP1A 3OR6C 1SQVH 4DV6O 1MABG 4FZ1A 1AR1B 4UCTA 2DYSC 1SQQH 2ZNJA 4JZGA 4IYIA 2UXDO 4UCSA 3BCCH 3OTOB 1Y66A 1MA1A 2YIBA 1BHAA 5CA1A 3CMEV 2QM4A 5KHGA 5F2VO 1KBHA 4IYHA 2OCCC 2IW5A 2YI8A 4CH6A 5CB4A 4NKGB 2MW2B 2LGWA 3VOUA 2QTOA 4NXMO 3OD4A 3E8BA 4I0XB 3VBBA 3RW0A 1IX9A 1VARA 3F5TA 3OW2U 2LW7A 1OCCC 3W7WA 2WLMA 5B1BB 4G2KA 3DXRA 3E8HA 1EM1A 1RSOB 1K5SA 4K8ZA 4U3JA 4LF9B 4P2ZA 1VQ8V 2DQ0A 4B3MO 1H2LA 1I7FA 1ZTEA 3RWRD 5KX5B 1WNSA 1LNQA 1WA8B 5FPRA 2EIJC 1KUQA 1MG1A 4W4KA 4X9QA 4GX5A 5JJNB 2Y69C 1Y76A 2F1MA 4EB6A 3ICXA 4DV6B 3E8GA 4ZI7A 4G27B 2FB5A 1QCEA 2L35A 4HNAB 3IJ4A 5H6QA 2UUCB 1PD3A 2YXLA 1TVKA 1WLEA 2CTRA 2WWWA 2UXCB 3VQVA 4DV2O 1HNXO 5CBFA 5J9PC 3S3XA 3KCXA 4LF8O 4I4TB 3SR2C 1I5XA 2ZINA 2EIKC 4YIPA 1JJOA 2VQFO 1BS3A 3APQA 4NYKA 4RUFA 5EZYB 4ZHQA 4NXMB 3CC4V 2EILC 3ZJZA 1PP9H 1PV0A 4WFHA 3EHBB 2DQ3A 2BTQB 4HAMA 5B1AB 1E79G 2G38A 3BFRA 2X6CA 3H01A 3BPZA 3ASNC 4B3MB 2DOSA 3UKMA 1S5LZ 2Q7EA 4L8JA 2OTJV 4XBFA 3HKCB 4I0XA 3ABKB 1M1KW 4ZOLB 4JI3O 3WB0A 2Z5UA 5LA6B 4GKJO 3RN4A 3OFNG 3K5OA 1XDCA 4R8CA 2DW4A 2CTQA 3KZIZ 3WB1A 3CJHB 3IAYA 1DF4A 1VIBA 1GM8A 4J7ZA 4LF4B 2UUBO 4LWSB 1YSCA 3B4SA 5A2QN 3OUFA 4I50A 4TOIA 4TWKA 5KX5A 1WA8A 3AK2A 4LF8B 1W59A 2E76B 4DV3B 2EZPA 3A8TA 3GB7C 4H0LB 3CWBH 2JVDA 4JI2O 2ZCEA 5DM6V 1QLEB 4O4LB 1KP2A 4CS3A 5HFMA 1O9GA 3ZEDA 2RDCA 4MTFA 1VQ9V 4FK5C 3CRMA 1YIJV 1K7DA 5B1NA 3JASB 4MVSA 3SPGA 1Z5WA 3LUTB 4I4TA 2GSMB 4LF6B 5IJ9B 3JATB 1AB3A 3JAWB 3N2GB 4FVMA 1JX9A 5EZYA 4JI0B 3BA8A 2WLNA 4MVQA 4B7EA 2ZDIA 4JYCA 4O4HA 1FJGO 5BMVA 3ZN1A 2NNUA 2ZXWB 4LR3A 5IDJA 1IBLB 1TA8A 2UU9O 5CBGA 1IBMO 1JMKC 5LXTB 3OAAG 2ZKOA 2VS0A 3FD9A 3TJTA 2QTSA 2UUBB 4LFAB 2B1IA 2BE3A 1VF7A 2A3QA 4DUYO 1V54B 3KCYA 2ZE8A 4RQFA 3ETDA 3H9VA 3ZRXA 4ZOLA 1IVSA 4LF7B 3SPHA 4OPHA 4GKKO 3ABLC 5LA6A 4IT5A 4QNHB 4KHPB 3FFQA 4TV9B 1XNRO 4LNUA 1YHQV 4YY3B 2ILMA 2OCHA 1WJZA 1P7BA 5L3BA 1JFFB 2JS5A 2BTOA 1QNMA 3R65A 3LDCA 5KHHA 1BQZA 3UO2A 3BA9A 5IYBO 4U7NA 4BIOA 4DK1A 1E1RG 2PYJA 2PGGA 2ZD9A 1GKFA 3JCZA 5JH7B 5LOVB 3K0GA 2D2CB 4B3RB 1L0LH 4LP8A 2R72A 3AG2B 2FKXA 1FYJA 1TUEB 3U10A 3JASA 5FNVA 2IU3A 4H44B 4DR3B 4PELA 3JATA 4UUJC 2P90A 3B2EE 4CS4A 2PI4A 4J41A 3BABA 1OCOC 1QLNA 4CC6A 2ZR2A 4YJ3A 1JOYA 1H2GA 5B1BC 2PF4E 5KAFZ 1N8RW 4GKKB 4FM1A 3Q4HA 4K3AA 1HNWB 1RPOA 4DV7O 2Y4TA 2Q68A 4OPAA 2XASA 1I0HA 4PHZA 5LXTA 3SYOA 2IBZH 2F95B 5LMNO 1YEWA 2ZIOA 1T5EA 3P30A 3CXCU 4JI5B 2EJRA 4DV5B 5EIBD 3RYCA 4DRXA 3A0HZ 4DW0A 3ZHUA 4NTWA 3OMIB 3FB7C 3E2EA 2QR4A 4D6TH 1D2DA 1H2SB 3JAMN 1NBMG 3QO8A 4LF5B 1SC5B 2X6AA 5GONB 1XL6A 2O57A 1NH2D 1IXMA 3K58A 2QWQB 1JVMA 1TUBA 4BW9A 5C8YB 4XDKA 2JJ2G 3STZC 4IGGA 2N74A 1VF6A 5LGTA 4I7ZB 4H37A 3HPLC 1Q8IA 1HR0O 4E4EA 4J9ZB 3FB6C 2BOBC 3F7YC 5JH7A 5LOVA 4JV5O 2ETNA 5B1AC 3K08A 1LUWA 4CH3A 5IYCO 4JGSA 4DV7B 4X20A 2FTKA 1ZL8A 1RPRA 5H2FZ 1WP7A 4J10A 1G1XB 4WBNB 3ABKC 1TAEA 4F6RA 1Y4MA 2UUAO 1YZBA 3I55V 1WAZA 2YIDA 3RYHA 2F4VO 1M93A 2PYLA 1WB8A 1SKVA 5EYPA 1I94O 4P9PA 1F51A 4Q6GA 2RCVA 3AG4B 1UJWB 4TQFA 3DGEA 2ZR3A 1RM1B 4CS2A 4JI8O 2H94A 1AVMA 4PI0A 2BSKB 4NVPA 1FAFA 5L3DA 4UCOA 2VQEB 4DR4O 1J5EB 1Z5VA 2LJ2A 4D7TA 1Q6HA 4JPRA 3CSXA 2DE0X 3CCQV 1N34O 3RT3C 4OX9O 1XL4A 2RNBA 3ZRVA 2P5OA 2KB1A 5GONA 5KA5A 3JALB 2FL4A 2QE7G 3EXAA 3K04A 2KQXA 1R73A 1SA0A 3B8NA 2ZQMA 3OUSA 4JI7O 1ZX3A 4LCUC 2RQ6A 3UM7A 3W7UA 2IU0A 3DSQA 1ZSPA 2HG5C 1FD9A 4U3JB 4UB8Z 1IBKB 2ZXWC 2W6IG 4BAYA
chains in the Genus database with same CATH topology
4B3RO 5H5NA 2UUCO 5IWAO 2HHHO 4B3TO 2FKXA 1FYJA 3M8AA 1X59A 2UXCO 4DV2O 4DV1O 5BY1A 1HNXO 3SDLA 4X64O 4LF8O 2DJVA 4DR3O 4DV4O 4LF6O 1AB3A 1G1XB 4A5UB 2VQFO 4DV6O 2UUAO 4JI0O 2Z0AA 1A32A 1YZBA 2AGAA 4JYAO 2UXDO 3J80N 2F4VO 4DR7O 1FJGO 4B3SO 4LFBO 1I94O 4LFCO 5IT9N 1NS1A 3T1HO 4JI4O 1IBLO 1HNWO 3O65A 4JI1O 4DV7O 2UU9O 1F7YA 4OPAA 4K0KO 1IBMO 2ZKOA 1XMQO 4JI6O 4JI8O 4X62O 5LMNO 2DOSA 4LFAO 4AQYO 3J7AU 1N32O 5FLXN 2JRIA 5BR8O 4DV0O 4DUZO 4DUYO 4NXMO 2ZM6O 1N33O 4DR4O 2VQEO 4JI5O 4JI3O 1HNZO 4DV5O 1J5EO 3F5TA 3OTOO 4OPHA 4GKKO 2LW7A 4X65O 4LF7O 2UXBO 4GKJO 4DR2O 1R1BA 4X66O 5BXZA 5LMUO 4KHPO 1N34O 1XNRO 3RT3C 1D2DA 4YY3O 4OX9O 3J81N 3JAMN 4NXNO 1FKAO 4LF9O 1DK1A 4LF5O 2UUBO 3R66A 4LF4O 5LL6Y 4B3MO 5A2QN 1XMOO 4DR1O 2E5LO 1N36O 4YHHO 4DR6O 1KUQA 4JI7O 1XEQA 4DV3O 2N74A 1XNQO 3T1YO 4DR5O 4JI2O 1HR0O 1AILA 1IBKO 1R6TA 4JV5O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R O;  5H5N A;  2UUC O;  5IWA O;  2HHH O;  4B3T O;  2FKX A;  1FYJ A;  3M8A A;  1X59 A;  2UXC O;  4DV2 O;  4DV1 O;  5BY1 A;  1HNX O;  3SDL A;  4X64 O;  4LF8 O;  2DJV A;  4DR3 O;  4DV4 O;  4LF6 O;  1AB3 A;  1G1X B;  4A5U B;  2VQF O;  4DV6 O;  2UUA O;  4JI0 O;  2Z0A A;  1A32 A;  1YZB A;  2AGA A;  4JYA O;  2UXD O;  3J80 N;  2F4V O;  4DR7 O;  1FJG O;  4B3S O;  4LFB O;  1I94 O;  4LFC O;  5IT9 N;  1NS1 A;  3T1H O;  4JI4 O;  1IBL O;  1HNW O;  3O65 A;  4JI1 O;  4DV7 O;  2UU9 O;  1F7Y A;  4OPA A;  4K0K O;  1IBM O;  2ZKO A;  1XMQ O;  4JI6 O;  4JI8 O;  4X62 O;  5LMN O;  2DOS A;  4LFA O;  4AQY O;  3J7A U;  1N32 O;  5FLX N;  2JRI A;  5BR8 O;  4DV0 O;  4DUZ O;  4DUY O;  4NXM O;  2ZM6 O;  1N33 O;  4DR4 O;  2VQE O;  4JI5 O;  4JI3 O;  1HNZ O;  4DV5 O;  1J5E O;  3F5T A;  3OTO O;  4OPH A;  4GKK O;  2LW7 A;  4X65 O;  4LF7 O;  2UXB O;  4GKJ O;  4DR2 O;  1R1B A;  4X66 O;  5BXZ A;  5LMU O;  4KHP O;  1N34 O;  1XNR O;  3RT3 C;  1D2D A;  4YY3 O;  4OX9 O;  3J81 N;  3JAM N;  4NXN O;  1FKA O;  4LF9 O;  1DK1 A;  4LF5 O;  2UUB O;  3R66 A;  4LF4 O;  5LL6 Y;  4B3M O;  5A2Q N;  1XMO O;  4DR1 O;  2E5L O;  1N36 O;  4YHH O;  4DR6 O;  1KUQ A;  4JI7 O;  1XEQ A;  4DV3 O;  2N74 A;  1XNQ O;  3T1Y O;  4DR5 O;  4JI2 O;  1HR0 O;  1AIL A;  1IBK O;  1R6T A;  4JV5 O; 
#chains in the Genus database with same CATH topology
 2F4V B;  2AZ0 A;  2D3O W;  2HHH B;  2ZIM A;  3H1J H;  4R50 A;  4DV1 B;  1R3L C;  1XHX A;  4X64 B;  3SDL A;  1L1F A;  1B06 A;  1WN7 A;  2PUS A;  1QU7 A;  1V54 C;  1PL4 A;  1N0J A;  3T4Z A;  4WBN A;  4EB6 B;  2IJJ A;  5TIS Z;  2YXH A;  2LO1 A;  3B09 A;  4DR4 B;  3JD1 A;  4DR7 O;  4TSF G;  3L72 H;  4UCV A;  1SQB H;  4LFB O;  4JI4 B;  3W7S A;  4JYB A;  3U11 A;  1FXH A;  4PDV A;  1S5J A;  1VEW A;  4YJ2 B;  1KC8 W;  1F7Y A;  1S0V A;  4BWA A;  3JD2 A;  5H9C A;  3QO7 A;  2FYU H;  4NR1 A;  2P6J A;  4JTA B;  1XMQ O;  4AQY B;  4X62 O;  1N32 B;  5GTH Z;  4ZHQ B;  3A0B Z;  2BSK A;  1DTO A;  1EBO A;  1Q7Y W;  5J2T A;  3RBZ A;  3W7X A;  3JAK A;  1K97 A;  2W0X A;  5FL7 G;  3E86 A;  3E22 B;  2ATK C;  3JCU Z;  3FYI B;  1VQK V;  5ITZ A;  1YXB A;  5IYZ B;  1NR7 A;  4LC1 A;  4JYY A;  3K5M A;  1S77 D;  1DK1 A;  1FS0 G;  3LSU A;  3JAL A;  4DR1 B;  3SYA A;  1XMO O;  2M6Y A;  1LR1 A;  1AI4 A;  4DR6 O;  4AIL C;  3B77 A;  3CD6 V;  3T1C A;  1VP7 A;  1ZLZ A;  4EFB A;  4RUE A;  1D5A A;  4EEQ A;  1SQX H;  2Q69 A;  1V55 B;  4PA3 A;  1Q6U A;  1N4C A;  2QKA A;  3D3Q A;  4I50 B;  1VQ7 V;  4B3T O;  1KD1 W;  4DXW A;  1AI5 A;  4G28 B;  4X8A A;  3K03 A;  4DV4 O;  4MTO A;  4Q20 A;  1PM9 A;  2OIG A;  1Q81 W;  3L74 H;  1S72 V;  2UXX A;  1R6N A;  2GHY A;  4BIU A;  2ARH A;  4JYA O;  1P49 A;  2UXD B;  2EUL A;  2QEX V;  1SQG A;  1NTM H;  1AJN A;  2AHY A;  4X1I B;  3BRC A;  1SS3 A;  4YJ2 A;  4AI8 A;  3OE7 G;  4L87 A;  1BT8 A;  2XND G;  4BIZ A;  2X7R B;  4JI6 O;  1J95 A;  5LP6 A;  4Z1M G;  1XMO B;  3JAR B;  1Y74 B;  1IXB A;  2EIM B;  5B3S B;  2QSA A;  4O4H B;  4ZIB A;  5BMV B;  5IJ0 B;  3E22 A;  3K0D A;  2UXB O;  1FPO A;  1AI6 A;  4O2B A;  4JF3 A;  3OMN B;  5DN6 G;  1I5Y A;  5IYZ A;  2W6J G;  3ASO B;  4MW3 A;  2VRZ A;  3LSS A;  4U3F H;  1GN3 A;  3RVY A;  3U0Z A;  2E3C A;  2ZE6 A;  4JZ2 A;  4YHH O;  3AG3 B;  1N0N A;  1DF5 A;  4FLT A;  2W0F C;  2IM9 A;  4FFK A;  4LNU B;  3GVM A;  4DR5 O;  2PZS A;  1IDS A;  4RAI A;  1M57 B;  2CE4 A;  5H6R A;  4GZR B;  5LGU A;  3L75 H;  3AG4 C;  4QE9 A;  2CAZ C;  1Q90 D;  3ZMZ A;  3ZMS A;  1QVF U;  1UFI A;  4DV2 B;  1RM1 C;  1HNX B;  2ZE5 A;  5IYD O;  4X1K B;  3FB8 C;  3DC6 A;  4TQD A;  2VQF B;  1SET A;  3MAQ A;  1FXV A;  1MNG A;  4MSW C;  3IGA C;  3QTC A;  2AW9 A;  2RJZ A;  4O2A B;  1M5I A;  2UXB B;  4X1I A;  1K34 A;  3QF7 A;  1K33 A;  5FNV B;  3H1I H;  1BE3 H;  2EX3 A;  1MMM A;  3L71 H;  1PNK A;  5LBQ A;  4J42 A;  3OTF A;  2N04 A;  1BHB A;  1OCR B;  1WB7 A;  1JPX A;  2ZNI A;  1YIT V;  4IHJ B;  4YIO A;  1B04 A;  2M7W A;  4TT3 G;  3JAR A;  4P30 A;  1Y74 A;  5BR8 O;  4DV0 O;  4YJ3 B;  1SZX A;  1SES A;  1PKX A;  3MHH C;  2ZM6 O;  4JI3 B;  5E1A C;  4MTG A;  4K35 A;  3Q4H B;  5IJ0 A;  1H2N A;  4RO2 A;  2V1D A;  2QKS A;  4HZ3 A;  4GKJ B;  3T2M A;  2ODM A;  2HVK C;  3HKD A;  2XAF A;  4DR5 B;  3VQW A;  1SF9 A;  3J81 N;  1GMG A;  5GW7 A;  3F5W C;  3IC9 A;  2N05 A;  3L70 H;  4JAV A;  1MSD A;  4FFB A;  5EBL C;  2JK5 C;  2E5L O;  3ZN0 A;  3RYC B;  4MVM A;  2IH3 C;  4DRX B;  3CCR V;  1RFY A;  5CN0 A;  2IJH A;  5K1X A;  3SPJ A;  1FFX A;  3T1Y O;  1NZ6 A;  4WFF A;  4JI2 B;  1IZ3 A;  2UXN A;  2RN9 A;  1GAX A;  2JGD A;  4WFA V;  4PDR A;  1HWY A;  5B66 Z;  2E75 B;  5EC2 C;  2F43 G;  3O9O A;  3DC5 A;  2CTP A;  1CPY A;  3QG5 A;  1U96 A;  2NLJ C;  4JAA A;  1QBZ A;  1TUB B;  3K59 A;  3H1K H;  4X1K A;  4JAU A;  2YXY A;  1JR9 A;  4FLY A;  2QKC A;  1XI1 A;  3D36 A;  3HKE A;  5B5E Z;  4N21 A;  1W2B U;  2QDO A;  3QO5 A;  2ZM6 B;  4PA4 A;  4J11 A;  1O9H A;  2OTL V;  1QR8 A;  5JWP A;  1FJG B;  4O2A A;  3IFX A;  4H33 A;  4LH6 A;  4FJC C;  4LFC O;  3G6E V;  4J9Y B;  3CMA V;  4X20 B;  1YJW V;  3H1H H;  2UU9 B;  4JI1 O;  1IBM B;  3W7T A;  4K0K O;  1ZL8 B;  3JD3 A;  3HR0 A;  3FAV A;  2GV9 A;  3FYE B;  4F6R B;  4IHJ A;  5FLX N;  2JRI A;  4DUY B;  5GTI Z;  2E5L B;  3RYH B;  4R6Z A;  1N33 O;  2PTM A;  4WFE A;  3CCJ V;  3DTU B;  4LH7 A;  1XHZ A;  5EYP B;  2WLL A;  1V55 C;  2R70 A;  2DN9 A;  1XNR B;  2KKW A;  3LNN A;  5KHI A;  3NR7 A;  3SYC A;  3AG1 B;  2WLJ A;  3ZCC A;  3KG2 A;  1HW7 A;  3OGC C;  2YIC A;  2WSS G;  1WPX A;  1NKD A;  2XUM A;  4AHC A;  2B1G A;  2OT5 A;  1XBL A;  2YI9 A;  1ORQ C;  2XAJ A;  3THO A;  5EK0 A;  4K8X A;  1K4C C;  3CPW U;  3FKS G;  1LUV A;  5LYJ B;  1SER A;  3K9S A;  3OEE G;  3WU2 Z;  3RFR A;  2H8P C;  2H3O A;  2A0L A;  4UFZ A;  1VQL V;  3ZX6 A;  5IY5 B;  1Z2G A;  3AEI A;  4QGP A;  3EFF K;  3LDE A;  5J2U B;  4LFC B;  2OWO A;  1TGO A;  1SA0 B;  2Q7G A;  4GT1 A;  4Z2W A;  4PA7 A;  3BVO A;  5KMG B;  2EIM C;  2ZDI C;  1Q86 W;  2HLD G;  2Q4P A;  2GDS A;  3CCS V;  3G6B A;  1EN6 A;  2CH7 B;  2EIN B;  4HBN A;  3ASO C;  3JYC A;  3HB3 B;  1NS1 A;  4MT8 A;  2CGN A;  4QPK A;  4QE7 A;  1K3E A;  3D8C A;  1SQF A;  2KSD A;  3RGB A;  4O4I B;  3OT7 A;  2HVJ C;  5L3C A;  1D5N A;  5IE9 A;  4EFE A;  5LMN B;  3PN1 A;  5L3G A;  1PNM A;  1G6U A;  3AG3 C;  2XAH A;  4DUZ O;  3LSQ A;  1CEZ A;  1WP8 A;  4RQE A;  3SYQ A;  1HNZ O;  2F66 C;  2YDE A;  1M56 B;  3ZHV A;  1M57 C;  4DR2 O;  1GH6 A;  4XDJ A;  5EIB C;  4X66 O;  1BZK A;  4Z1V A;  5LMU O;  5JVD A;  2BCC H;  4CBC A;  3G67 A;  3CRR A;  4KUM A;  1UPG A;  4NXN O;  3WG7 B;  5JCO A;  4C7U A;  1MSW D;  1OCZ B;  3ETE A;  5J2T B;  4X1Y B;  3JAK B;  1N36 O;  4MVZ A;  2WA4 A;  3SJB C;  1QLE C;  2R9A A;  3OR7 C;  1EZV H;  1MZF A;  5ITZ B;  5LYJ A;  3ZHQ A;  3TXQ A;  2OIE A;  2P4V A;  1AJQ A;  2GTS A;  1HR0 B;  5KLV H;  1Q43 A;  4JV5 B;  3VQY A;  3UO3 A;  1K73 W;  4WFG A;  3APO A;  5J2U A;  4FLU A;  1OCR C;  1QHT A;  2ADP A;  2P67 A;  5BY1 A;  3H1L H;  4MS2 A;  2MK3 A;  2KG7 A;  2XTA A;  4CH5 A;  1L0N H;  5KMG A;  4J7K A;  1BCC H;  4FIP C;  5LHH A;  2R9R B;  4R7C A;  3BAA A;  2UUA B;  1XOU A;  1Q82 W;  4GLX A;  3SPC A;  4QPJ A;  3WB2 A;  1YVW A;  4FM0 A;  2CH7 A;  1H38 A;  1I94 B;  4EKW A;  3AG7 A;  4QJF B;  1URF A;  4PI2 A;  4O4I A;  2Q0O C;  1GM9 A;  4JI8 B;  4PV1 B;  3K57 A;  5JQG B;  1HDJ A;  1PL0 A;  1VQM V;  1NVP D;  1SRY A;  4WCE V;  4GCZ A;  1EZJ A;  2WLK A;  1VF5 B;  4LBE C;  3AK1 A;  1OZ0 A;  4BW5 A;  2Y0I A;  3SJC C;  1V9P A;  3D3I A;  2CTW A;  4RWU A;  1N34 B;  2LQT A;  5A9G A;  3CCL V;  2AZ2 A;  4OX9 B;  3RYF A;  5DED A;  3F7V C;  1FKA O;  3ZHR A;  1VQP V;  4LF9 O;  4ZBM A;  5LP6 B;  4DK0 A;  2LP7 A;  1M90 W;  1XQ8 A;  1H2K A;  2K1E A;  4X1Y A;  2XT9 A;  3RYI A;  1VF6 C;  3ZHS A;  1MOF A;  4JI7 B;  4JAS A;  2RMK B;  4O2B B;  3M7M X;  1H2M A;  3OEH G;  1S5H C;  3AG2 C;  1NTK H;  1P4R A;  5LHG A;  2FML A;  3KKY A;  1AR4 A;  1KMI Z;  2EJ7 A;  4NTX A;  1F4M A;  2HFE C;  2WLI A;  4GX0 A;  4MVU A;  3SGI A;  2UUC O;  3A0R A;  2ITC C;  5CA3 A;  2DYR B;  3M8A A;  4PDL A;  4FM2 A;  4DW1 A;  2UXC O;  4P9O A;  2DMX A;  4UB6 Z;  3CRQ A;  3A2F A;  2YUA A;  2Q67 A;  1B6Q A;  1SQP H;  4OXS A;  4F4L A;  4E2L A;  4DR7 B;  1P7G A;  1ROP A;  5L3E A;  1NQT A;  4LFB B;  1OCO B;  3AG1 C;  1EN4 A;  3P3P A;  5JCO C;  1FXK B;  1RP3 B;  4XDL A;  3O65 A;  1F4N A;  2ZE7 A;  2QWR B;  3CXH F;  1YJ9 V;  1OJH A;  3SJQ C;  2HKO A;  1XMQ B;  5LHI A;  1KKD A;  4X62 B;  1DLB A;  1Q3E A;  1VQ4 V;  2YIA A;  5JQG A;  2YC0 A;  2LGQ A;  2ZT9 B;  1R6K A;  2PI5 A;  1H8E G;  2QWN B;  3ZMV A;  5IY5 C;  2XAQ A;  5C93 A;  5BZB A;  1YCI A;  2ADQ B;  1NR1 A;  3QVN A;  3VQX A;  3HKB B;  2EBO A;  4LF4 O;  1NU1 H;  3ABT A;  5L3F A;  3ZRW B;  2E74 B;  3G80 A;  3SJA C;  2JEU A;  4CC5 A;  1WPB A;  2VWJ A;  2GBO A;  5KUM A;  1YDX A;  3K9A A;  4DR6 B;  1B3Q A;  1I08 A;  1R3J C;  3L9D A;  1BMF G;  5EC1 C;  5CBH A;  1KEC A;  4DV3 O;  4J80 A;  3HKD B;  3K5L A;  2EIN C;  5KA6 A;  2YIB D;  3TCU A;  3ABU A;  4ZKI A;  2Q6A A;  1E1Q G;  1X4T A;  3CC2 V;  1VQN V;  2QJ1 A;  3C3S A;  4FFB B;  1YTF D;  5H5N A;  4B3T B;  2QA4 V;  2R9I A;  3E35 A;  3CX5 F;  3ZBH A;  3BEH A;  3ABM B;  4I5S A;  2Z3Y A;  2L6L A;  4DV4 B;  2HJD A;  4LF6 O;  1BGY H;  3UCS C;  1FFX B;  3N2K B;  2XOK G;  2Y48 A;  1M9N A;  3TGU H;  1M56 C;  3K79 A;  2JS3 A;  4JI0 O;  4JYA B;  1JA8 A;  2JGD B;  4UCU A;  4F6E A;  1K92 A;  3JSN A;  2P06 A;  3J80 N;  1KYO F;  2Q5Z A;  3OMA B;  5IT9 N;  5EBM C;  3WG7 C;  4GYC B;  1FXK A;  1ARO P;  1IBL O;  1JQ0 A;  1OCZ C;  2Q8V A;  2YEV B;  4CH4 A;  1RSO A;  2HJF C;  1NH2 B;  2NR5 A;  4JI6 B;  1KKC A;  1K9M W;  3M99 B;  1ENV A;  4LFA O;  3HKE B;  4O4J B;  1U97 A;  3X2Q B;  1Q5O A;  4IL6 Z;  1Y67 A;  3STL C;  1AI7 A;  2F93 B;  2EZO A;  3LDD A;  4BR6 A;  4D7S A;  2P4K A;  4LF7 O;  1F23 A;  5CA0 B;  3RVZ A;  5BXZ A;  1COW G;  4KHP O;  3CHX A;  4UV9 A;  4JTD B;  4YY3 O;  3FAV B;  4WF9 V;  1W0K G;  3HKB A;  1L8D A;  4HNA A;  3T4D A;  2V7Q G;  3ZRW A;  1VMG A;  2K9P A;  3CYO A;  2CK3 G;  2X0L A;  4YHH B;  1ZWI C;  3CE2 A;  2YSU B;  2WLL B;  2P7T C;  4TV8 B;  4UCR A;  1S76 D;  1AJP A;  1BL8 A;  4X88 A;  1KQS U;  5DEC A;  2P22 C;  1AR5 A;  4UV8 A;  2QWO B;  2WLH A;  3OGI B;  3MHS C;  4B3R O;  2CUG A;  4MVR A;  3BY6 A;  1X59 A;  3TET A;  3CCM V;  1ZAU A;  4DO2 A;  2BTQ A;  2OYQ A;  4WFB V;  4DR3 O;  2GTA A;  1OHH G;  4KFM A;  3N2K A;  2QM8 A;  4DYL A;  1R3K C;  1GN4 A;  1YJN V;  4QIW F;  2Z0A A;  3JD0 A;  2AGA A;  2GUZ B;  4PA9 A;  3NXS A;  5JJE B;  2Q0A A;  2A06 H;  3HKC A;  3PJS K;  1NJI W;  4FLZ A;  3CEI A;  2WAM A;  1HNW O;  5D5Q A;  5LP6 C;  4I55 B;  3E83 A;  2YEV A;  2IH1 C;  3LNM B;  4H13 B;  5FPO A;  4PD4 F;  3CJH A;  2AXT Z;  3J7A U;  3TXS A;  4LWS A;  3ZHT A;  1NTZ H;  4PA6 A;  1JJ2 U;  2DWD C;  4O4J A;  5BR8 B;  4DV0 B;  2LFS A;  3ZMT A;  3CB2 A;  1QQC A;  4JI5 O;  4DV5 O;  2CGO A;  3N27 A;  4KP4 A;  4UXN A;  1KU9 A;  4X65 O;  5CA0 A;  2DYS B;  1AP5 A;  1GN6 A;  3QNE A;  4N23 A;  3ML0 A;  1YI2 V;  4O4L A;  4PJ0 Z;  2DYR C;  3CCE V;  4LF5 O;  3CC7 V;  1XUQ A;  3C3T A;  2HEP A;  2OCC B;  1S3J A;  1IUR A;  3G4S V;  1PNL A;  3JSL A;  2Q7H A;  2HP8 A;  4W4L A;  4TV8 A;  5IJ9 A;  3T1Y B;  5JVD B;  4X89 A;  3JAW A;  3N2G A;  4UVA A;  1K8A W;  1XIL A;  1QVG U;  1NVP B;  5E79 Z;  1OCC B;  3IC7 A;  2JGU A;  3ZRS A;  1VQ5 V;  1FXK C;  1Q6I A;  5B1O A;  2DWE C;  2Q9L A;  3K3W A;  5EBW C;  1P84 F;  1BQ0 A;  1GO3 F;  3S3W A;  3UT5 B;  3ZIA G;  3JD4 A;  2F23 A;  3SPI A;  1M4U A;  1YF2 A;  4UVB A;  4A5U B;  1HP8 A;  2EIJ B;  4MTX A;  4NTY A;  1A32 A;  1GN2 A;  2B5U A;  2GUZ A;  5JJJ B;  4CZZ A;  3EVK A;  2Y69 B;  1K5Q A;  3UQ8 A;  4X65 B;  3GWK C;  4GUN A;  3ZMU A;  3T1H O;  4JI1 B;  2JDI G;  4K0K B;  4TV9 A;  2WPD G;  2KG7 B;  4I55 A;  4I9W A;  4ABM A;  5B3S C;  3B40 A;  1PPJ H;  3FB5 C;  4IIJ B;  2JEX A;  2WA3 A;  4ASU G;  1JFF A;  2EIK B;  3P32 A;  1N33 B;  2JIZ G;  2VQE O;  2CDY A;  2B9Z A;  1J5E O;  1VQO V;  1KP3 A;  2JJ1 G;  5CMU A;  3P3N A;  5LGN A;  2VWK A;  2EIL B;  2XAG A;  1BSM A;  3K06 A;  1QR9 A;  3C90 A;  4OGQ B;  2A7W A;  5LL6 Y;  4FLX A;  3ABM C;  1NI8 A;  3E89 A;  3ASN B;  2LFR A;  2YS8 A;  3FX7 A;  4U7O A;  4KL1 A;  2QGN A;  3GWO A;  1NT2 B;  4FLW A;  1XNQ O;  5KAI Z;  4FMT A;  3RYF B;  3CS5 A;  1AIL A;  4FPP A;  1IBK O;  1Y6X A;  4TUY B;  4KXR A;  1EN5 A;  3ETQ A;  3I5D A;  5IWA O;  4NB5 A;  1EFR G;  2HHH O;  3T1H B;  3RYI B;  5K1P A;  1CP9 A;  2AHZ A;  4DV1 O;  2C2A A;  2LW1 A;  1G8M A;  4X64 O;  3D36 C;  2DJV A;  3CRC A;  3CCV V;  3UT5 A;  3X2Q C;  1R3I C;  2XHB A;  4PDM A;  5D5P A;  3E8F A;  2A9H A;  2WLI B;  1MZE A;  1GTO A;  3L73 H;  4B3S O;  2Y4U A;  1ZUQ A;  4JI4 O;  5CA1 B;  3MD0 A;  2X6B A;  1OV9 A;  1XRE A;  3WFV A;  3SYP A;  1YTF B;  1KB9 F;  5CB4 B;  4MW8 A;  3B8M A;  4ICG A;  4IIJ A;  4AQY O;  1VQ6 V;  3OM3 B;  1N32 O;  4FZ0 A;  4DUZ B;  2IJK A;  1FFT B;  2IJI A;  1G4Y B;  4JTC B;  1HNZ B;  5KHK A;  3ZS8 C;  3ETG A;  3OTO O;  5C8Y A;  2QWP B;  3CCU V;  4DR2 B;  4B7K A;  4X66 B;  1XNQ B;  1R1B A;  2NN4 A;  4J7J A;  3G71 V;  2A79 B;  5LMU B;  4YXW G;  3DXR B;  4NXN B;  3CRA A;  5KHJ A;  2ITD C;  5KUK A;  1SZT A;  3R66 A;  3BHP A;  4HYO A;  1GRJ A;  4UVC A;  4MVO A;  3AK3 A;  5IWA B;  4DR1 O;  1N36 B;  3MDS A;  1GK9 A;  4B08 A;  1XEQ A;  1US6 A;  3I56 V;  1W0J G;  1Y76 B;  4FLV A;  1H8H G;  1THZ A;  4ZI7 B;  3K5N A;  3ABL B;  3TK1 A;  4GX2 A;  1GM7 A;  1AP6 A;  1R6T A;  1DGS A;  2QM7 A;  4TUY A;  1CXZ B;  2Q73 A;  4B3S B;  1JCH A;  1TVK B;  2PY5 A;  5AG2 A;  2HR3 A;  4I9Q A;  5HFL A;  1K4D C;  2BOC C;  2V4D A;  4GX1 A;  2Y0P A;  3CP1 A;  3OR6 C;  1SQV H;  4DV6 O;  1MAB G;  4FZ1 A;  1AR1 B;  4UCT A;  2DYS C;  1SQQ H;  2ZNJ A;  4JZG A;  4IYI A;  2UXD O;  4UCS A;  3BCC H;  3OTO B;  1Y66 A;  1MA1 A;  2YIB A;  1BHA A;  5CA1 A;  3CME V;  2QM4 A;  5KHG A;  5F2V O;  1KBH A;  4IYH A;  2OCC C;  2IW5 A;  2YI8 A;  4CH6 A;  5CB4 A;  4NKG B;  2MW2 B;  2LGW A;  3VOU A;  2QTO A;  4NXM O;  3OD4 A;  3E8B A;  4I0X B;  3VBB A;  3RW0 A;  1IX9 A;  1VAR A;  3F5T A;  3OW2 U;  2LW7 A;  1OCC C;  3W7W A;  2WLM A;  5B1B B;  4G2K A;  3DXR A;  3E8H A;  1EM1 A;  1RSO B;  1K5S A;  4K8Z A;  4U3J A;  4LF9 B;  4P2Z A;  1VQ8 V;  2DQ0 A;  4B3M O;  1H2L A;  1I7F A;  1ZTE A;  3RWR D;  5KX5 B;  1WNS A;  1LNQ A;  1WA8 B;  5FPR A;  2EIJ C;  1KUQ A;  1MG1 A;  4W4K A;  4X9Q A;  4GX5 A;  5JJN B;  2Y69 C;  1Y76 A;  2F1M A;  4EB6 A;  3ICX A;  4DV6 B;  3E8G A;  4ZI7 A;  4G27 B;  2FB5 A;  1QCE A;  2L35 A;  4HNA B;  3IJ4 A;  5H6Q A;  2UUC B;  1PD3 A;  2YXL A;  1TVK A;  1WLE A;  2CTR A;  2WWW A;  2UXC B;  3VQV A;  4DV2 O;  1HNX O;  5CBF A;  5J9P C;  3S3X A;  3KCX A;  4LF8 O;  4I4T B;  3SR2 C;  1I5X A;  2ZIN A;  2EIK C;  4YIP A;  1JJO A;  2VQF O;  1BS3 A;  3APQ A;  4NYK A;  4RUF A;  5EZY B;  4ZHQ A;  4NXM B;  3CC4 V;  2EIL C;  3ZJZ A;  1PP9 H;  1PV0 A;  4WFH A;  3EHB B;  2DQ3 A;  2BTQ B;  4HAM A;  5B1A B;  1E79 G;  2G38 A;  3BFR A;  2X6C A;  3H01 A;  3BPZ A;  3ASN C;  4B3M B;  2DOS A;  3UKM A;  1S5L Z;  2Q7E A;  4L8J A;  2OTJ V;  4XBF A;  3HKC B;  4I0X A;  3ABK B;  1M1K W;  4ZOL B;  4JI3 O;  3WB0 A;  2Z5U A;  5LA6 B;  4GKJ O;  3RN4 A;  3OFN G;  3K5O A;  1XDC A;  4R8C A;  2DW4 A;  2CTQ A;  3KZI Z;  3WB1 A;  3CJH B;  3IAY A;  1DF4 A;  1VIB A;  1GM8 A;  4J7Z A;  4LF4 B;  2UUB O;  4LWS B;  1YSC A;  3B4S A;  5A2Q N;  3OUF A;  4I50 A;  4TOI A;  4TWK A;  5KX5 A;  1WA8 A;  3AK2 A;  4LF8 B;  1W59 A;  2E76 B;  4DV3 B;  2EZP A;  3A8T A;  3GB7 C;  4H0L B;  3CWB H;  2JVD A;  4JI2 O;  2ZCE A;  5DM6 V;  1QLE B;  4O4L B;  1KP2 A;  4CS3 A;  5HFM A;  1O9G A;  3ZED A;  2RDC A;  4MTF A;  1VQ9 V;  4FK5 C;  3CRM A;  1YIJ V;  1K7D A;  5B1N A;  3JAS B;  4MVS A;  3SPG A;  1Z5W A;  3LUT B;  4I4T A;  2GSM B;  4LF6 B;  5IJ9 B;  3JAT B;  1AB3 A;  3JAW B;  3N2G B;  4FVM A;  1JX9 A;  5EZY A;  4JI0 B;  3BA8 A;  2WLN A;  4MVQ A;  4B7E A;  2ZDI A;  4JYC A;  4O4H A;  1FJG O;  5BMV A;  3ZN1 A;  2NNU A;  2ZXW B;  4LR3 A;  5IDJ A;  1IBL B;  1TA8 A;  2UU9 O;  5CBG A;  1IBM O;  1JMK C;  5LXT B;  3OAA G;  2ZKO A;  2VS0 A;  3FD9 A;  3TJT A;  2QTS A;  2UUB B;  4LFA B;  2B1I A;  2BE3 A;  1VF7 A;  2A3Q A;  4DUY O;  1V54 B;  3KCY A;  2ZE8 A;  4RQF A;  3ETD A;  3H9V A;  3ZRX A;  4ZOL A;  1IVS A;  4LF7 B;  3SPH A;  4OPH A;  4GKK O;  3ABL C;  5LA6 A;  4IT5 A;  4QNH B;  4KHP B;  3FFQ A;  4TV9 B;  1XNR O;  4LNU A;  1YHQ V;  4YY3 B;  2ILM A;  2OCH A;  1WJZ A;  1P7B A;  5L3B A;  1JFF B;  2JS5 A;  2BTO A;  1QNM A;  3R65 A;  3LDC A;  5KHH A;  1BQZ A;  3UO2 A;  3BA9 A;  5IYB O;  4U7N A;  4BIO A;  4DK1 A;  1E1R G;  2PYJ A;  2PGG A;  2ZD9 A;  1GKF A;  3JCZ A;  5JH7 B;  5LOV B;  3K0G A;  2D2C B;  4B3R B;  1L0L H;  4LP8 A;  2R72 A;  3AG2 B;  2FKX A;  1FYJ A;  1TUE B;  3U10 A;  3JAS A;  5FNV A;  2IU3 A;  4H44 B;  4DR3 B;  4PEL A;  3JAT A;  4UUJ C;  2P90 A;  3B2E E;  4CS4 A;  2PI4 A;  4J41 A;  3BAB A;  1OCO C;  1QLN A;  4CC6 A;  2ZR2 A;  4YJ3 A;  1JOY A;  1H2G A;  5B1B C;  2PF4 E;  5KAF Z;  1N8R W;  4GKK B;  4FM1 A;  3Q4H A;  4K3A A;  1HNW B;  1RPO A;  4DV7 O;  2Y4T A;  2Q68 A;  4OPA A;  2XAS A;  1I0H A;  4PHZ A;  5LXT A;  3SYO A;  2IBZ H;  2F95 B;  5LMN O;  1YEW A;  2ZIO A;  1T5E A;  3P30 A;  3CXC U;  4JI5 B;  2EJR A;  4DV5 B;  5EIB D;  3RYC A;  4DRX A;  3A0H Z;  4DW0 A;  3ZHU A;  4NTW A;  3OMI B;  3FB7 C;  3E2E A;  2QR4 A;  4D6T H;  1D2D A;  1H2S B;  3JAM N;  1NBM G;  3QO8 A;  4LF5 B;  1SC5 B;  2X6A A;  5GON B;  1XL6 A;  2O57 A;  1NH2 D;  1IXM A;  3K58 A;  2QWQ B;  1JVM A;  1TUB A;  4BW9 A;  5C8Y B;  4XDK A;  2JJ2 G;  3STZ C;  4IGG A;  2N74 A;  1VF6 A;  5LGT A;  4I7Z B;  4H37 A;  3HPL C;  1Q8I A;  1HR0 O;  4E4E A;  4J9Z B;  3FB6 C;  2BOB C;  3F7Y C;  5JH7 A;  5LOV A;  4JV5 O;  2ETN A;  5B1A C;  3K08 A;  1LUW A;  4CH3 A;  5IYC O;  4JGS A;  4DV7 B;  4X20 A;  2FTK A;  1ZL8 A;  1RPR A;  5H2F Z;  1WP7 A;  4J10 A;  1G1X B;  4WBN B;  3ABK C;  1TAE A;  4F6R A;  1Y4M A;  2UUA O;  1YZB A;  3I55 V;  1WAZ A;  2YID A;  3RYH A;  2F4V O;  1M93 A;  2PYL A;  1WB8 A;  1SKV A;  5EYP A;  1I94 O;  4P9P A;  1F51 A;  4Q6G A;  2RCV A;  3AG4 B;  1UJW B;  4TQF A;  3DGE A;  2ZR3 A;  1RM1 B;  4CS2 A;  4JI8 O;  2H94 A;  1AVM A;  4PI0 A;  2BSK B;  4NVP A;  1FAF A;  5L3D A;  4UCO A;  2VQE B;  4DR4 O;  1J5E B;  1Z5V A;  2LJ2 A;  4D7T A;  1Q6H A;  4JPR A;  3CSX A;  2DE0 X;  3CCQ V;  1N34 O;  3RT3 C;  4OX9 O;  1XL4 A;  2RNB A;  3ZRV A;  2P5O A;  2KB1 A;  5GON A;  5KA5 A;  3JAL B;  2FL4 A;  2QE7 G;  3EXA A;  3K04 A;  2KQX A;  1R73 A;  1SA0 A;  3B8N A;  2ZQM A;  3OUS A;  4JI7 O;  1ZX3 A;  4LCU C;  2RQ6 A;  3UM7 A;  3W7U A;  2IU0 A;  3DSQ A;  1ZSP A;  2HG5 C;  1FD9 A;  4U3J B;  4UB8 Z;  1IBK B;  2ZXW C;  2W6I G;  4BAY A; 
#chains in the Genus database with same CATH homology
 4B3R O;  5H5N A;  2UUC O;  5IWA O;  2HHH O;  4B3T O;  2FKX A;  1FYJ A;  3M8A A;  1X59 A;  2UXC O;  4DV2 O;  4DV1 O;  5BY1 A;  1HNX O;  3SDL A;  4X64 O;  4LF8 O;  2DJV A;  4DR3 O;  4DV4 O;  4LF6 O;  1AB3 A;  1G1X B;  4A5U B;  2VQF O;  4DV6 O;  2UUA O;  4JI0 O;  2Z0A A;  1A32 A;  1YZB A;  2AGA A;  4JYA O;  2UXD O;  3J80 N;  2F4V O;  4DR7 O;  1FJG O;  4B3S O;  4LFB O;  1I94 O;  4LFC O;  5IT9 N;  1NS1 A;  3T1H O;  4JI4 O;  1IBL O;  1HNW O;  3O65 A;  4JI1 O;  4DV7 O;  2UU9 O;  1F7Y A;  4OPA A;  4K0K O;  1IBM O;  2ZKO A;  1XMQ O;  4JI6 O;  4JI8 O;  4X62 O;  5LMN O;  2DOS A;  4LFA O;  4AQY O;  3J7A U;  1N32 O;  5FLX N;  2JRI A;  5BR8 O;  4DV0 O;  4DUZ O;  4DUY O;  4NXM O;  2ZM6 O;  1N33 O;  4DR4 O;  2VQE O;  4JI5 O;  4JI3 O;  1HNZ O;  4DV5 O;  1J5E O;  3F5T A;  3OTO O;  4OPH A;  4GKK O;  2LW7 A;  4X65 O;  4LF7 O;  2UXB O;  4GKJ O;  4DR2 O;  1R1B A;  4X66 O;  5BXZ A;  5LMU O;  4KHP O;  1N34 O;  1XNR O;  3RT3 C;  1D2D A;  4YY3 O;  4OX9 O;  3J81 N;  3JAM N;  4NXN O;  1FKA O;  4LF9 O;  1DK1 A;  4LF5 O;  2UUB O;  3R66 A;  4LF4 O;  5LL6 Y;  4B3M O;  5A2Q N;  1XMO O;  4DR1 O;  2E5L O;  1N36 O;  4YHH O;  4DR6 O;  1KUQ A;  4JI7 O;  1XEQ A;  4DV3 O;  2N74 A;  1XNQ O;  3T1Y O;  4DR5 O;  4JI2 O;  1HR0 O;  1AIL A;  1IBK O;  1R6T A;  4JV5 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...