4B3ST

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4b3sT00
4DR3T 5BR8T 4DUZT 4JI3T 2UXDT 1J5ET 1HNWT 4GKJT 4X62T 1N32T 4DV5T 4JI6T 1IBMT 4OX9T 4X65T 2UUCT 4DV6T 4JI8T 4X66T 4B3MT 2VQFT 3T1HT 4DR4T 4YY3T 2UU9T 1IBLT 5LMNT 2F4VT 4JV5T 4DR5T 4NXNT 4X64T 1IBKT 4LFCT 4B3TT 4LF7T 4GKKT 4AQYT 2VQET 1XMOT 4DV2T 4KHPT 4DV1T 4LF4T 4JI5T 4JI7T 4DV4T 2UXCT 4DV3T 4LF6T 2ZM6T 4DR6T 1N33T 4JYAT 4JI4T 4LFAT 4DUYT 2UUAT 4LFBT 4JI1T 1HNZT 1N36T 1HNXT 4DV0T 2HHHT 2UXBT 4LF8T 1XMQT 1I94T 5LMUT 4JI0T 4DR7T 3OTOT 3T1YT 4K0KT 4JI2T 4DR1T 5IWAT 4DV7T 2UUBT 4LF5T 4DR2T 1XNQT 4NXMT 1N34T 1HR0T 1FJGT 4YHHT 1XNRT 2E5LT 4B3ST 4B3RT 4LF9T
chains in the Genus database with same CATH superfamily
1OWAA 2VL0A 3UU5A 2W61A 3RPUA 2LRLA 2H89A 3DTOA 4YFSA 4QX8B 1U5PA 1Z0PA 1YQ3A 5AQLB 3RIUA 4L5GA 3SWHA 4EYYR 4YSYA 2E2AA 5AQGB 3NVOA 2E9XA 4GKJT 5JR9B 3C4WA 4X62T 4QWNB 2YU1A 3RKGA 1OEDE 3B57A 5AQUB 5LHHB 3P4QA 3HA4A 4CI2B 2X0LB 3UQ7A 4AQYT 3DJBA 1ZKEA 1KNPA 4FJOA 4GK5E 5AQPB 4JI6T 2BG9A 4TWHA 1LVKA 3FZHB 3U3IA 2FJEA 3OVUA 5AQSB 4JI8T 2HN1A 3CPZA 3CX8B 2BKNA 4UVAB 5E0OA 2VQFT 2VB6A 1MIYA 3T1HT 4DR4T 4YJ3E 4YY3T 1HTJF 5HXHA 2BG9C 5LHIB 3SRZA 5LA6E 2XJ7A 1IBLT 1YKEB 3EAMA 2N9DA 5HYAA 1T98A 2I6HA 1QUUA 2JJ9A 3AA7B 1MNEA 3MACA 5DABA 3ZC1A 3TLVA 3PUWF 2X68A 3ZCJA 3Q5XA 4ZI2C 4NPPA 1UGOA 4F8HA 3V5UA 4BJMA 2NWBA 3PE0A 1W0AA 5FVKA 4X64T 3MK7C 2LEHA 4I4TE 4QH4A 1WFDA 2MBGA 1G8XA 5JTGA 3O9XA 2WDVA 1J5ET 4LFCT 1VCSA 4DIDB 4HFDA 1YQ4A 2WWUA 3RQUA 3SS1A 3N9OA 3KDSE 2CE7A 4PK4A 3HKEE 2WMOA 5AQMB 4Z91A 3EI0A 2IW5B 2PG8A 3K3OA 1IZNB 2A72A 2JIWA 4PFOA 1YKHB 4TUYE 2DCFA 2YOEA 3X1DA 4ERRA 1ZP0A 2D2SA 2G0UA 3R84B 2UXCT 4HFBA 2D5UA 2ZM2A 3FB2A 4LF6T 1Y01A 4DR6T 2V7JA 1KF6A 2M6IA 3H3AA 4JI4T 2XAQB 3M3ZB 3PUQA 5LG4A 2CBIA 4FI5A 5FY7A 4JI1T 3AAEB 4O4HE 3UUXB 1MMGA 3SFDA 1SUMB 1D1AA 3DP7A 4ISTA 2FJDA 3NZPA 1D1BA 2W00A 2VKDA 4G63A 2I0MA 2J4GA 2OV9A 4IT4A 4X1KE 3CQGB 4GOUA 4ZS3A 1ZOYA 2LHRA 2QRXA 4IDNA 3UU8A 4XAXB 3ZSTA 4YTPA 3PUVF 1HNXT 4DV0T 1WCRA 3RYCE 3U78A 3N2KE 2KWIB 3CX7B 1B7TA 3L09A 4YTMA 3S4UA 2CEAA 2HHHT 2J47A 4IE0A 5HEHA 1KFYA 3ZYLA 2MOZA 3P4WA 1QSDA 3CKDA 3O1IA 4L0RA 3UUBA 2X9HA 1OEDA 3J9X1 4ZHQE 2LKHA 3N9LA 4QXCB 2YN6A 2IUBA 3I9YA 2V5DA 5F5WA 1CUNA 3AXJB 4ISSA 5JVDE 3ZMTB 2LSYA 2M6BA 2QYWA 3G06A 3QOFA 4O4LE 4P0BA 2VURA 3HKCE 4JI2T 1T7SA 2CA5A 4K0UA 2K9AA 4O2BE 4PK5A 2WB5A 2JQ9A 2XAHB 3IF8B 5DQVA 4AKRB 4AKHA 4NUUA 3QB5A 4C90A 3JADA 2JPFA 4TNVA 2B76A 5LNKA 4EXTA 2NTYA 4DR2T 3I0OA 3PUZF 5LJNA 2KLQA 3CQXC 2ACZA 3IA3A 2W66A 3I0QA 4HGAA 3QK6A 2VKJA 5KXJA 1QLBA 5L3EB 2V8SV 5C2TA 2Q9QA 2E9XB 4ZI3D 2JRKA 3P4SA 4KMCA 3FZMB 3QB5K 4HTEA 1BR4A 3AECA 3KFWX 3C51A 4H9SE 3TKLB 5C3JA 3RRWA 4ANJA 2LKGA 3OYXA 5LGUB 1R8IA 4YHJA 1E7PA 3BQKA 3NWIA 2HPJA 2AXDS 4PAGA 5BR8T 2HH7A 2VK9A 3AAAB 4DR3T 2XZEA 3ZYMA 2UXDT 4LMJA 3WAKA 1HNWT 3C98B 2BS4A 2WAUA 3FZLB 3KV5A 5JQGE 2EHOA 2CLYB 2Q9QB 3P50A 5DQWA 2KSRA 5HEJA 4ZZBA 3AAIA 1H7CA 1NWMX 1ZV4X 2ZM0A 4X1YE 1IBMT 2PFVA 3UUMA 5ETWA 3BQLA 3ONXA 3AEAA 4PJLA 3RRCA 5CA1E 1KNZA 2MAWA 4B3MT 4H63V 5LGNB 1G73A 4WW0A 1D0YA 4KI0F 4U2YA 5CJ5A 1UK5A 5AQNB 2YDRA 1XDPA 2YU2A 5FVLA 4GYSA 1LKXA 5LMNT 3GA8A 3LK3B 3FZFB 3MKDA 4ILAA 2F4VT 1ZHCA 4J2CA 4AI6A 1KEYA 2LT3A 2LSIA 2XY8B 3PUSA 4HFVA 2DL1A 2YEVC 3LJCA 3N9MA 2WWVA 4DBRA 4P0AA 4BA9A 2HPLA 2A9UA 2FJBA 4WNKA 2WSSV 4NXNT 2JMKA 4HE8A 3ZCIA 2PJQA 1D0XA 4OHFA 3N9NA 4IGUA 3PUXF 4B3TT 2N2NA 5FXXA 2PTFA 2VVNA 3EDVA 1LVFA 4YSZA 3ZMVB 5KX5E 1HS7A 4O4JE 4LF7T 4MHCA 3QNUA 4JI0T 1BR1A 3W15B 2W63A 2LSKA 2VQET 4KHPT 1VOMA 2WBLA 3Q5DA 3RYFE 2FBWA 4COFA 3L3PA 2XQ8A 4U2ZA 5LCYA 3Q5WA 4JI7T 3VU7H 2SPCA 1IAPA 3C4XA 2Q9QD 3EABA 3MJXA 2BS3A 2L9QA 5AQKB 5AQQB 2BG9B 4XBFB 4G2AA 5EK4A 3ZPOA 1E2AA 4ADZA 4MBQA 4TZ4C 4DNDA 2UXNB 4U74A 2ZM6T 1N33T 1AJ3A 3CMLA 2XQ4A 4H9PC 3LSVA 4HFIA 2AE9A 2H3RA 1BR0A 1O3XA 4IHJE 2EHOB 4LMKA 2ACXA 2UUAT 2XHEB 4TWFA 5HAXA 1YXRA 4B3RT 5DJQC 4IDOA 2YDSA 4H9QC 5CA0E 1HX1B 2CWYA 1HG5A 3CX6B 5L47A 3OPCA 5CGMA 1SA0E 2X67A 4YT0A 5ABFB 2BKOA 5AQOB 3RH3A 1XWMA 3QC9A 4QX7B 2BBJA 2NOXA 1E1HB 5L3DB 3I9WA 3ABVA 5FXVA 2DLRA 3RKOA 4AKGA 1Y64B 1MIWA 4GKKT 1NEKA 3D0TA 3KV4A 3EUHA 2UXBT 1D0ZA 4UVCB 3PV0F 4Z90A 5M4YA 2D0TA 3AE5A 4MFRA 1NAFA 2LOSA 3ETUA 3FXDB 3P8CD 4JEUB 4A98A 3AEDA 4IE5A 4IL4A 5L3BB 2NW8A 4AKLA 4YXDA 2BKPA 2IHR1 3A8YC 3N9QA 5HEOA 3ZMUB 3AE3A 3GWHA 3TLWA 4YSXA 5LJMA 4EZ4A 4DR7T 3C4ZA 3GN5A 2XAFB 5FXWA 2CXDA 3NKZA 2W62A 2FJAA 5IWAT 2XUEA 4UF0A 3AEGA 3JAEA 3EDUA 3RI5A 3UTKA 2NR4A 2BS2A 1YD8G 4QKNA 5HXEA 2MYSA 2W4XA 2KZ7B 2V5CA 2VKOA 2XASB 2XQ3A 3MZKB 2VWAA 4JBWF 4IREA 4EZHA 3ONLC 2K48A 5AQRB 3ZMZB 2JMHA 1FEWA 2V7LA 4YLHA 5AQVB 2IDOB 3HKDE 2A3DA 2I59A 2XAGB 2W2UA 4U72A 5LB7B 2IC9A 2WM9A 4I50E 5JR9A 2V1DB 3AE2A 3ZT7A 4EIWA 2K3WA 3UFEA 4DO0A 3ZEFB 3H37A 4KBMB 4YTNA 1S94A 2LSGA 3C64A 2WZIA 1DU2A 1SHZC 3NZQA 2E9XC 4IDQA 3WI3A 2GK9A 5L4EA 3ZSSA 3Q9DA 1JNRA 1JNZA 2CHOA 1HX8A 3PURA 4UELA 3GN5B 4DUZT 4MLKA 1X9BA 4GK0E 3JAFA 4YJ2E 3CVRA 5LGTB 1X79A 3LBXB 5JH7E 1I6ZA 2CM0A 2LM2A 4HWIB 3PTRB 5IHYA 4E7SA 4WBNE 4DMWA 3RYHE 3E0ZA 1HF8A 2MPKA 2NW7A 2XQ6A 4HKAA 3P7IA 4CI1B 5J2TE 2P9BA 2XM2A 4N78D 4UV9B 3FHNA 3SFEA 4ZEYA 4X65T 4HWFA 4OX9T 2PBIA 4ILBA 5CB4E 4NUVA 5JREA 5LOVE 5ADXL 1IJ6A 2WU2A 4TX5A 5LYJE 2DWKA 2BBHA 2J1DG 2L3LA 3IHRA 4X66T 2YK0A 4LFBT 4A97A 2JQKA 3SOLA 5ABGA 4UVBB 5ABFA 5ABEA 5JDMA 3AA1B 4EOZB 3R6NA 2XSBA 2CHNA 2CCQA 3ZJ2A 4ASKA 4GYRA 5HEGA 4CZZB 2Y48B 2C5JA 1S35A 2DNXA 2H7VC 3GMIA 3K1SA 2L8KA 3KV6A 5L4HA 4CN6A 5LHGB 1XZYA 3LK2B 2DWGA 3Q2MA 2XQ7A 1T8BA 4HWCA 3FBLA 4QXBB 3EVYA 4ZI7E 4JV5T 3RHWA 5HXRA 1VRBA 3RC8A 2E9XD 2FUPA 1IBKT 2KT9A 5HXCA 3L39A 4TNWA 2ZLYA 4PJMA 2X9XA 5JDQA 4IE4A 1ZEEA 2YKSA 3LFMA 2IC6A 2X9WA 2JQHA 4OFZA 3ETVA 2KINB 1XDOA 5AQTB 4AQGA 3BQIA 5F3JA 3JC6D 3QUJA 2X9YA 2DI4A 2H7OA 4KUMB 2R6GF 3CWZB 3NRXA 2WDQA 3MA9A 5FKYA 4IIJE 4Q25A 4DV2T 4JI5T 4HFHA 1MMDA 1T72A 3KBTA 2WP9A 1W09A 2DHRA 2CPTA 4TN7B 4DV4T 3RGLA 3EHZA 5EK3A 5FP3A 5KDMC 5L3FB 4DV3T 1V9DA 2WCAA 5JDGA 4JYAT 5HCJA 1HG2A 1LRZA 3AE4A 4ZS2A 3N9PA 1D1CA 2UXXB 3IEEA 4DUYT 4F6RC 5L3GB 5A1LA 1KK7A 3ANWA 5FL0A 3AEEA 3K8PC 3Q5EA 4MALA 5C8YE 2HN2A 4I43B 4XZCA 3UT5E 5LBMA 3RC3A 3CQCB 5JRCA 2W0GA 2CXLA 5JR9C 4IE6A 4PFPA 5FMNA 3VR9A 3IBPA 4X1IE 2Y8DA 5FYMA 4OYJA 3UULA 2Y6XA 3I1AA 3KBUA 2LLYA 2ZM8A 3OBVE 3TLTA 3UU6A 5L2LA 3AE9A 3E22E 5HXSA 1UX4A 4E7ZA 4PW8A 3RF1A 4U33A 4UIGA 2XTLA 2V6XA 2BDEA 3K3NA 1W9RA 5LMUT 5EK2A 1Z8UA 4CQIA 2XQYA 4Z8XA 4TV8E 4ZZCA 3RQWA 5IYZE 4O4IE 4H9RC 3NBXX 3JCFA 4U7YA 4JUYA 1MNDA 2WMNA 4PJNA 3OTOT 3T1YT 3E08A 4U3CA 5EZYE 2JQQA 2D9DA 3P4PA 4QH1A 4WYVA 4ZI2D 2X0HA 5FXZA 1OEDC 5HEUA 5HWXA 3LK42 4HN9A 2UUBT 1XNQT 2EHOD 1M7KA 2WS3A 4QH5A 4ZXLA 3VR8A 1CHUA 3PU8A 3O1HA 5AQJB 2D0UA 2VASA 5CFBA 2IAKA 2KMFA 3B5MA 3RIAA 1N34T 4ILUA 3KINB 2MTQA 3K3QC 1FJGT 1WYCA 5L3CB 2OLTA 3RX6A 2ODUA 3P4RA 3AE7A 1WYBA 5LP6E 3CK6A 3ZN1B 3UFGA 4UR9A 1HFAA 2LOPA 4I0UA 2E5LT 5AFUL 4LF9T 2J62A 4JI3T 4WBOA 2LM9A 2WZHA 2XSAA 4BJNA 5FNVE 3VHLA 3OJAA 2LSJA 1MIVA 2K24A 3F31A 2Z6EA 4U7IA 5LG3A 3F2EA 3KVBA 2NTXA 2YDQA 5AQFB 1N32T 1UUSA 3KV9A 3NRYA 4DV5T 2QA7A 2V26A 3WAJA 4PNIA 1KNRA 3N5LA 3HKBE 1MMNA 2X0YA 4HWDA 2LHNA 2V7KA 2EHOC 3AEFA 3CIRA 3PUYF 4IL9A 4B6XA 3H3MA 5J0ZA 2V7MA 4DV6T 2UUCT 2XQ9A 4AQFC 1J1JA 3OKQA 5LXTE 3UUNA 2LRKA 5FL1A 2CBJA 4A56A 4X20E 5JDNA 5TAOA 4UEMA 4UXNB 2NW9A 2UU9T 4JEHB 2C5KT 2WU5A 3ESLA 4PK6A 1FMWA 4QHOA 4EEDA 2WDRA 2BVLA 3L8RA 4TWDA 4IDPA 2OA5A 4H9OC 2YINA 1OXZA 2ES0A 3PUGA 3RYIE 3ZYKA 3N2GE 1UX5A 3AA6B 4EEBA 4UV8B 2K5BB 2V6YB 4AXPA 3C50A 4KP3C 5H6QB 4DR5T 4EGWA 3UU3A 1WLXA 3AE6A 3ZC0A 5F8PA 3PJAJ 3RIUC 4EAHA 1BR2A 2X51A 2A2FX 2BZBA 4O2AE 5H6RB 4A5XA 3ZT6A 1XMOT 3ONJA 4V1Av 4C91A 4DV1T 4CN4A 1U4QA 5J1GA 4LF4T 2QGSA 4ILCA 2E8IA 3PDYA 3ANWB 5AQIB 3FZKB 1WR0A 2XQ5A 3HI2A 3MXZA 2XQAA 4GIWA 4HWHA 1L0VA 3T8OA 5FY0A 2RA1A 2QVAA 5BMVE 1GQEA 5LBQB 4CXXA 3VKHA 5AQHB 4NIQA 2V6YA 4JLEA 4P1NA 4AISA 4LFAT 2KXPB 4ZI3C 3VRAA 3HL6A 3AVSA 4EYUA 2CWOA 3N2OA 4H63H 4M1PA 3PU3A 4KHZF 3ZN0B 3AE1A 3LBXA 3KVAA 2IMLA 1HNZT 2BG9E 5KMGP 3AE8A 4O8SA 1MMAA 3ZJ1A 4CXYA 1N36T 5JRCB 3OYZA 4I55E 4QXHB 3RIFA 2C0SA 4U31A 3VKGA 2WQYA 4OYKA 4PJJA 1W0BA 2CLYC 2Q9QC 3LDQB 4IE7A 3M65A 3AXJA 3O4XE 2ODVA 3FBZA 3TLUA 3VRBA 1OEDB 1M62A 2C5IT 2V7IA 2WY2A 1VCTA 1YW0A 4CN1A 4IDZA 4LMLA 2W67A 2CRBA 2X66A 4LF8T 1FMVA 5ABHA 1XMQT 2XM1A 1I94T 4L9IA 2LE8A 3A5XA 1SE7A 1WR6A 3BK9A 2XAJB 2N1GA 1NENA 2RPAA 3LG7A 3J7Yq 4AKIA 1J5WA 1UCUA 1FIOA 2VL8A 3AB3B 4CI3B 4WZXA 3A7MA 2BVMA 3JC6C 4UF0B 4DBQA 4K0KT 4DR1T 4BAYB 4P09A 3ZKRA 5GONE 3ZMSB 2LJLA 2KNDA 2NP9A 3AEBA 5FY1A 3HR0A 3TLSA 3ZLIA 4DV7T 5JDHA 4X5TA 4LF5T 2IIUA 2XPKA 4KX6A 1WRDA 3PUAA 3FXEB 4TV9E 4AQFA 5J2UE 3AVRA 4HFCA 4HEAA 5HWYA 5JDLA 4NXMT 4EV6A 3AA0B 1HR0T 4DVDA 1US7B 4OK0A 4EB6E 4DMVA 2CXFA 4HFEA 3V5SA 4AIUA 1HCIA 4YHHT 2B1EA 1XNRT 3F57A 3O1JA 4ZOLE 2E5VA 2VVSA 5JDFA 2VKHA 2KWHA 4CXWA 5HCMA 2ZMAA 3UQ4A 3ZT5A 5IUXA 3B13A 1UURA 2CMRA 3PJAA 1EZ3A 3UU4A 3RLFF 4B3ST 2H88A 1IJ5A 4H9NC 2RP4A 2M67A
chains in the Genus database with same CATH topology
4DR3T 5BR8T 4DUZT 4JI3T 2UXDT 1J5ET 1HNWT 4GKJT 4X62T 1N32T 4DV5T 4JI6T 1IBMT 4OX9T 4X65T 2UUCT 4DV6T 4JI8T 4X66T 4B3MT 2VQFT 3T1HT 4DR4T 4YY3T 2UU9T 1IBLT 5LMNT 2F4VT 4JV5T 4DR5T 4NXNT 4X64T 1IBKT 4LFCT 4B3TT 4LF7T 4GKKT 4AQYT 2VQET 1XMOT 4DV2T 4KHPT 4DV1T 4LF4T 4JI5T 4JI7T 4DV4T 2UXCT 4DV3T 4LF6T 2ZM6T 4DR6T 1N33T 4JYAT 4JI4T 4LFAT 4DUYT 2UUAT 4LFBT 4JI1T 1HNZT 1N36T 1HNXT 4DV0T 2HHHT 2UXBT 4LF8T 1XMQT 1I94T 5LMUT 4JI0T 4DR7T 3OTOT 3T1YT 4K0KT 4JI2T 4DR1T 5IWAT 4DV7T 2UUBT 4LF5T 4DR2T 1XNQT 4NXMT 1N34T 1HR0T 1FJGT 4YHHT 1XNRT 2E5LT 4B3ST 4B3RT 4LF9T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 T;  5BR8 T;  4DUZ T;  4JI3 T;  2UXD T;  1J5E T;  1HNW T;  4GKJ T;  4X62 T;  1N32 T;  4DV5 T;  4JI6 T;  1IBM T;  4OX9 T;  4X65 T;  2UUC T;  4DV6 T;  4JI8 T;  4X66 T;  4B3M T;  2VQF T;  3T1H T;  4DR4 T;  4YY3 T;  2UU9 T;  1IBL T;  5LMN T;  2F4V T;  4JV5 T;  4DR5 T;  4NXN T;  4X64 T;  1IBK T;  4LFC T;  4B3T T;  4LF7 T;  4GKK T;  4AQY T;  2VQE T;  1XMO T;  4DV2 T;  4KHP T;  4DV1 T;  4LF4 T;  4JI5 T;  4JI7 T;  4DV4 T;  2UXC T;  4DV3 T;  4LF6 T;  2ZM6 T;  4DR6 T;  1N33 T;  4JYA T;  4JI4 T;  4LFA T;  4DUY T;  2UUA T;  4LFB T;  4JI1 T;  1HNZ T;  1N36 T;  1HNX T;  4DV0 T;  2HHH T;  2UXB T;  4LF8 T;  1XMQ T;  1I94 T;  5LMU T;  4JI0 T;  4DR7 T;  3OTO T;  3T1Y T;  4K0K T;  4JI2 T;  4DR1 T;  5IWA T;  4DV7 T;  2UUB T;  4LF5 T;  4DR2 T;  1XNQ T;  4NXM T;  1N34 T;  1HR0 T;  1FJG T;  4YHH T;  1XNR T;  2E5L T;  4B3S T;  4B3R T;  4LF9 T; 
#chains in the Genus database with same CATH topology
 1OWA A;  2VL0 A;  3UU5 A;  2W61 A;  3RPU A;  2LRL A;  2H89 A;  3DTO A;  4YFS A;  4QX8 B;  1U5P A;  1Z0P A;  1YQ3 A;  5AQL B;  3RIU A;  4L5G A;  3SWH A;  4EYY R;  4YSY A;  2E2A A;  5AQG B;  3NVO A;  2E9X A;  4GKJ T;  5JR9 B;  3C4W A;  4X62 T;  4QWN B;  2YU1 A;  3RKG A;  1OED E;  3B57 A;  5AQU B;  5LHH B;  3P4Q A;  3HA4 A;  4CI2 B;  2X0L B;  3UQ7 A;  4AQY T;  3DJB A;  1ZKE A;  1KNP A;  4FJO A;  4GK5 E;  5AQP B;  4JI6 T;  2BG9 A;  4TWH A;  1LVK A;  3FZH B;  3U3I A;  2FJE A;  3OVU A;  5AQS B;  4JI8 T;  2HN1 A;  3CPZ A;  3CX8 B;  2BKN A;  4UVA B;  5E0O A;  2VQF T;  2VB6 A;  1MIY A;  3T1H T;  4DR4 T;  4YJ3 E;  4YY3 T;  1HTJ F;  5HXH A;  2BG9 C;  5LHI B;  3SRZ A;  5LA6 E;  2XJ7 A;  1IBL T;  1YKE B;  3EAM A;  2N9D A;  5HYA A;  1T98 A;  2I6H A;  1QUU A;  2JJ9 A;  3AA7 B;  1MNE A;  3MAC A;  5DAB A;  3ZC1 A;  3TLV A;  3PUW F;  2X68 A;  3ZCJ A;  3Q5X A;  4ZI2 C;  4NPP A;  1UGO A;  4F8H A;  3V5U A;  4BJM A;  2NWB A;  3PE0 A;  1W0A A;  5FVK A;  4X64 T;  3MK7 C;  2LEH A;  4I4T E;  4QH4 A;  1WFD A;  2MBG A;  1G8X A;  5JTG A;  3O9X A;  2WDV A;  1J5E T;  4LFC T;  1VCS A;  4DID B;  4HFD A;  1YQ4 A;  2WWU A;  3RQU A;  3SS1 A;  3N9O A;  3KDS E;  2CE7 A;  4PK4 A;  3HKE E;  2WMO A;  5AQM B;  4Z91 A;  3EI0 A;  2IW5 B;  2PG8 A;  3K3O A;  1IZN B;  2A72 A;  2JIW A;  4PFO A;  1YKH B;  4TUY E;  2DCF A;  2YOE A;  3X1D A;  4ERR A;  1ZP0 A;  2D2S A;  2G0U A;  3R84 B;  2UXC T;  4HFB A;  2D5U A;  2ZM2 A;  3FB2 A;  4LF6 T;  1Y01 A;  4DR6 T;  2V7J A;  1KF6 A;  2M6I A;  3H3A A;  4JI4 T;  2XAQ B;  3M3Z B;  3PUQ A;  5LG4 A;  2CBI A;  4FI5 A;  5FY7 A;  4JI1 T;  3AAE B;  4O4H E;  3UUX B;  1MMG A;  3SFD A;  1SUM B;  1D1A A;  3DP7 A;  4IST A;  2FJD A;  3NZP A;  1D1B A;  2W00 A;  2VKD A;  4G63 A;  2I0M A;  2J4G A;  2OV9 A;  4IT4 A;  4X1K E;  3CQG B;  4GOU A;  4ZS3 A;  1ZOY A;  2LHR A;  2QRX A;  4IDN A;  3UU8 A;  4XAX B;  3ZST A;  4YTP A;  3PUV F;  1HNX T;  4DV0 T;  1WCR A;  3RYC E;  3U78 A;  3N2K E;  2KWI B;  3CX7 B;  1B7T A;  3L09 A;  4YTM A;  3S4U A;  2CEA A;  2HHH T;  2J47 A;  4IE0 A;  5HEH A;  1KFY A;  3ZYL A;  2MOZ A;  3P4W A;  1QSD A;  3CKD A;  3O1I A;  4L0R A;  3UUB A;  2X9H A;  1OED A;  3J9X 1;  4ZHQ E;  2LKH A;  3N9L A;  4QXC B;  2YN6 A;  2IUB A;  3I9Y A;  2V5D A;  5F5W A;  1CUN A;  3AXJ B;  4ISS A;  5JVD E;  3ZMT B;  2LSY A;  2M6B A;  2QYW A;  3G06 A;  3QOF A;  4O4L E;  4P0B A;  2VUR A;  3HKC E;  4JI2 T;  1T7S A;  2CA5 A;  4K0U A;  2K9A A;  4O2B E;  4PK5 A;  2WB5 A;  2JQ9 A;  2XAH B;  3IF8 B;  5DQV A;  4AKR B;  4AKH A;  4NUU A;  3QB5 A;  4C90 A;  3JAD A;  2JPF A;  4TNV A;  2B76 A;  5LNK A;  4EXT A;  2NTY A;  4DR2 T;  3I0O A;  3PUZ F;  5LJN A;  2KLQ A;  3CQX C;  2ACZ A;  3IA3 A;  2W66 A;  3I0Q A;  4HGA A;  3QK6 A;  2VKJ A;  5KXJ A;  1QLB A;  5L3E B;  2V8S V;  5C2T A;  2Q9Q A;  2E9X B;  4ZI3 D;  2JRK A;  3P4S A;  4KMC A;  3FZM B;  3QB5 K;  4HTE A;  1BR4 A;  3AEC A;  3KFW X;  3C51 A;  4H9S E;  3TKL B;  5C3J A;  3RRW A;  4ANJ A;  2LKG A;  3OYX A;  5LGU B;  1R8I A;  4YHJ A;  1E7P A;  3BQK A;  3NWI A;  2HPJ A;  2AXD S;  4PAG A;  5BR8 T;  2HH7 A;  2VK9 A;  3AAA B;  4DR3 T;  2XZE A;  3ZYM A;  2UXD T;  4LMJ A;  3WAK A;  1HNW T;  3C98 B;  2BS4 A;  2WAU A;  3FZL B;  3KV5 A;  5JQG E;  2EHO A;  2CLY B;  2Q9Q B;  3P50 A;  5DQW A;  2KSR A;  5HEJ A;  4ZZB A;  3AAI A;  1H7C A;  1NWM X;  1ZV4 X;  2ZM0 A;  4X1Y E;  1IBM T;  2PFV A;  3UUM A;  5ETW A;  3BQL A;  3ONX A;  3AEA A;  4PJL A;  3RRC A;  5CA1 E;  1KNZ A;  2MAW A;  4B3M T;  4H63 V;  5LGN B;  1G73 A;  4WW0 A;  1D0Y A;  4KI0 F;  4U2Y A;  5CJ5 A;  1UK5 A;  5AQN B;  2YDR A;  1XDP A;  2YU2 A;  5FVL A;  4GYS A;  1LKX A;  5LMN T;  3GA8 A;  3LK3 B;  3FZF B;  3MKD A;  4ILA A;  2F4V T;  1ZHC A;  4J2C A;  4AI6 A;  1KEY A;  2LT3 A;  2LSI A;  2XY8 B;  3PUS A;  4HFV A;  2DL1 A;  2YEV C;  3LJC A;  3N9M A;  2WWV A;  4DBR A;  4P0A A;  4BA9 A;  2HPL A;  2A9U A;  2FJB A;  4WNK A;  2WSS V;  4NXN T;  2JMK A;  4HE8 A;  3ZCI A;  2PJQ A;  1D0X A;  4OHF A;  3N9N A;  4IGU A;  3PUX F;  4B3T T;  2N2N A;  5FXX A;  2PTF A;  2VVN A;  3EDV A;  1LVF A;  4YSZ A;  3ZMV B;  5KX5 E;  1HS7 A;  4O4J E;  4LF7 T;  4MHC A;  3QNU A;  4JI0 T;  1BR1 A;  3W15 B;  2W63 A;  2LSK A;  2VQE T;  4KHP T;  1VOM A;  2WBL A;  3Q5D A;  3RYF E;  2FBW A;  4COF A;  3L3P A;  2XQ8 A;  4U2Z A;  5LCY A;  3Q5W A;  4JI7 T;  3VU7 H;  2SPC A;  1IAP A;  3C4X A;  2Q9Q D;  3EAB A;  3MJX A;  2BS3 A;  2L9Q A;  5AQK B;  5AQQ B;  2BG9 B;  4XBF B;  4G2A A;  5EK4 A;  3ZPO A;  1E2A A;  4ADZ A;  4MBQ A;  4TZ4 C;  4DND A;  2UXN B;  4U74 A;  2ZM6 T;  1N33 T;  1AJ3 A;  3CML A;  2XQ4 A;  4H9P C;  3LSV A;  4HFI A;  2AE9 A;  2H3R A;  1BR0 A;  1O3X A;  4IHJ E;  2EHO B;  4LMK A;  2ACX A;  2UUA T;  2XHE B;  4TWF A;  5HAX A;  1YXR A;  4B3R T;  5DJQ C;  4IDO A;  2YDS A;  4H9Q C;  5CA0 E;  1HX1 B;  2CWY A;  1HG5 A;  3CX6 B;  5L47 A;  3OPC A;  5CGM A;  1SA0 E;  2X67 A;  4YT0 A;  5ABF B;  2BKO A;  5AQO B;  3RH3 A;  1XWM A;  3QC9 A;  4QX7 B;  2BBJ A;  2NOX A;  1E1H B;  5L3D B;  3I9W A;  3ABV A;  5FXV A;  2DLR A;  3RKO A;  4AKG A;  1Y64 B;  1MIW A;  4GKK T;  1NEK A;  3D0T A;  3KV4 A;  3EUH A;  2UXB T;  1D0Z A;  4UVC B;  3PV0 F;  4Z90 A;  5M4Y A;  2D0T A;  3AE5 A;  4MFR A;  1NAF A;  2LOS A;  3ETU A;  3FXD B;  3P8C D;  4JEU B;  4A98 A;  3AED A;  4IE5 A;  4IL4 A;  5L3B B;  2NW8 A;  4AKL A;  4YXD A;  2BKP A;  2IHR 1;  3A8Y C;  3N9Q A;  5HEO A;  3ZMU B;  3AE3 A;  3GWH A;  3TLW A;  4YSX A;  5LJM A;  4EZ4 A;  4DR7 T;  3C4Z A;  3GN5 A;  2XAF B;  5FXW A;  2CXD A;  3NKZ A;  2W62 A;  2FJA A;  5IWA T;  2XUE A;  4UF0 A;  3AEG A;  3JAE A;  3EDU A;  3RI5 A;  3UTK A;  2NR4 A;  2BS2 A;  1YD8 G;  4QKN A;  5HXE A;  2MYS A;  2W4X A;  2KZ7 B;  2V5C A;  2VKO A;  2XAS B;  2XQ3 A;  3MZK B;  2VWA A;  4JBW F;  4IRE A;  4EZH A;  3ONL C;  2K48 A;  5AQR B;  3ZMZ B;  2JMH A;  1FEW A;  2V7L A;  4YLH A;  5AQV B;  2IDO B;  3HKD E;  2A3D A;  2I59 A;  2XAG B;  2W2U A;  4U72 A;  5LB7 B;  2IC9 A;  2WM9 A;  4I50 E;  5JR9 A;  2V1D B;  3AE2 A;  3ZT7 A;  4EIW A;  2K3W A;  3UFE A;  4DO0 A;  3ZEF B;  3H37 A;  4KBM B;  4YTN A;  1S94 A;  2LSG A;  3C64 A;  2WZI A;  1DU2 A;  1SHZ C;  3NZQ A;  2E9X C;  4IDQ A;  3WI3 A;  2GK9 A;  5L4E A;  3ZSS A;  3Q9D A;  1JNR A;  1JNZ A;  2CHO A;  1HX8 A;  3PUR A;  4UEL A;  3GN5 B;  4DUZ T;  4MLK A;  1X9B A;  4GK0 E;  3JAF A;  4YJ2 E;  3CVR A;  5LGT B;  1X79 A;  3LBX B;  5JH7 E;  1I6Z A;  2CM0 A;  2LM2 A;  4HWI B;  3PTR B;  5IHY A;  4E7S A;  4WBN E;  4DMW A;  3RYH E;  3E0Z A;  1HF8 A;  2MPK A;  2NW7 A;  2XQ6 A;  4HKA A;  3P7I A;  4CI1 B;  5J2T E;  2P9B A;  2XM2 A;  4N78 D;  4UV9 B;  3FHN A;  3SFE A;  4ZEY A;  4X65 T;  4HWF A;  4OX9 T;  2PBI A;  4ILB A;  5CB4 E;  4NUV A;  5JRE A;  5LOV E;  5ADX L;  1IJ6 A;  2WU2 A;  4TX5 A;  5LYJ E;  2DWK A;  2BBH A;  2J1D G;  2L3L A;  3IHR A;  4X66 T;  2YK0 A;  4LFB T;  4A97 A;  2JQK A;  3SOL A;  5ABG A;  4UVB B;  5ABF A;  5ABE A;  5JDM A;  3AA1 B;  4EOZ B;  3R6N A;  2XSB A;  2CHN A;  2CCQ A;  3ZJ2 A;  4ASK A;  4GYR A;  5HEG A;  4CZZ B;  2Y48 B;  2C5J A;  1S35 A;  2DNX A;  2H7V C;  3GMI A;  3K1S A;  2L8K A;  3KV6 A;  5L4H A;  4CN6 A;  5LHG B;  1XZY A;  3LK2 B;  2DWG A;  3Q2M A;  2XQ7 A;  1T8B A;  4HWC A;  3FBL A;  4QXB B;  3EVY A;  4ZI7 E;  4JV5 T;  3RHW A;  5HXR A;  1VRB A;  3RC8 A;  2E9X D;  2FUP A;  1IBK T;  2KT9 A;  5HXC A;  3L39 A;  4TNW A;  2ZLY A;  4PJM A;  2X9X A;  5JDQ A;  4IE4 A;  1ZEE A;  2YKS A;  3LFM A;  2IC6 A;  2X9W A;  2JQH A;  4OFZ A;  3ETV A;  2KIN B;  1XDO A;  5AQT B;  4AQG A;  3BQI A;  5F3J A;  3JC6 D;  3QUJ A;  2X9Y A;  2DI4 A;  2H7O A;  4KUM B;  2R6G F;  3CWZ B;  3NRX A;  2WDQ A;  3MA9 A;  5FKY A;  4IIJ E;  4Q25 A;  4DV2 T;  4JI5 T;  4HFH A;  1MMD A;  1T72 A;  3KBT A;  2WP9 A;  1W09 A;  2DHR A;  2CPT A;  4TN7 B;  4DV4 T;  3RGL A;  3EHZ A;  5EK3 A;  5FP3 A;  5KDM C;  5L3F B;  4DV3 T;  1V9D A;  2WCA A;  5JDG A;  4JYA T;  5HCJ A;  1HG2 A;  1LRZ A;  3AE4 A;  4ZS2 A;  3N9P A;  1D1C A;  2UXX B;  3IEE A;  4DUY T;  4F6R C;  5L3G B;  5A1L A;  1KK7 A;  3ANW A;  5FL0 A;  3AEE A;  3K8P C;  3Q5E A;  4MAL A;  5C8Y E;  2HN2 A;  4I43 B;  4XZC A;  3UT5 E;  5LBM A;  3RC3 A;  3CQC B;  5JRC A;  2W0G A;  2CXL A;  5JR9 C;  4IE6 A;  4PFP A;  5FMN A;  3VR9 A;  3IBP A;  4X1I E;  2Y8D A;  5FYM A;  4OYJ A;  3UUL A;  2Y6X A;  3I1A A;  3KBU A;  2LLY A;  2ZM8 A;  3OBV E;  3TLT A;  3UU6 A;  5L2L A;  3AE9 A;  3E22 E;  5HXS A;  1UX4 A;  4E7Z A;  4PW8 A;  3RF1 A;  4U33 A;  4UIG A;  2XTL A;  2V6X A;  2BDE A;  3K3N A;  1W9R A;  5LMU T;  5EK2 A;  1Z8U A;  4CQI A;  2XQY A;  4Z8X A;  4TV8 E;  4ZZC A;  3RQW A;  5IYZ E;  4O4I E;  4H9R C;  3NBX X;  3JCF A;  4U7Y A;  4JUY A;  1MND A;  2WMN A;  4PJN A;  3OTO T;  3T1Y T;  3E08 A;  4U3C A;  5EZY E;  2JQQ A;  2D9D A;  3P4P A;  4QH1 A;  4WYV A;  4ZI2 D;  2X0H A;  5FXZ A;  1OED C;  5HEU A;  5HWX A;  3LK4 2;  4HN9 A;  2UUB T;  1XNQ T;  2EHO D;  1M7K A;  2WS3 A;  4QH5 A;  4ZXL A;  3VR8 A;  1CHU A;  3PU8 A;  3O1H A;  5AQJ B;  2D0U A;  2VAS A;  5CFB A;  2IAK A;  2KMF A;  3B5M A;  3RIA A;  1N34 T;  4ILU A;  3KIN B;  2MTQ A;  3K3Q C;  1FJG T;  1WYC A;  5L3C B;  2OLT A;  3RX6 A;  2ODU A;  3P4R A;  3AE7 A;  1WYB A;  5LP6 E;  3CK6 A;  3ZN1 B;  3UFG A;  4UR9 A;  1HFA A;  2LOP A;  4I0U A;  2E5L T;  5AFU L;  4LF9 T;  2J62 A;  4JI3 T;  4WBO A;  2LM9 A;  2WZH A;  2XSA A;  4BJN A;  5FNV E;  3VHL A;  3OJA A;  2LSJ A;  1MIV A;  2K24 A;  3F31 A;  2Z6E A;  4U7I A;  5LG3 A;  3F2E A;  3KVB A;  2NTX A;  2YDQ A;  5AQF B;  1N32 T;  1UUS A;  3KV9 A;  3NRY A;  4DV5 T;  2QA7 A;  2V26 A;  3WAJ A;  4PNI A;  1KNR A;  3N5L A;  3HKB E;  1MMN A;  2X0Y A;  4HWD A;  2LHN A;  2V7K A;  2EHO C;  3AEF A;  3CIR A;  3PUY F;  4IL9 A;  4B6X A;  3H3M A;  5J0Z A;  2V7M A;  4DV6 T;  2UUC T;  2XQ9 A;  4AQF C;  1J1J A;  3OKQ A;  5LXT E;  3UUN A;  2LRK A;  5FL1 A;  2CBJ A;  4A56 A;  4X20 E;  5JDN A;  5TAO A;  4UEM A;  4UXN B;  2NW9 A;  2UU9 T;  4JEH B;  2C5K T;  2WU5 A;  3ESL A;  4PK6 A;  1FMW A;  4QHO A;  4EED A;  2WDR A;  2BVL A;  3L8R A;  4TWD A;  4IDP A;  2OA5 A;  4H9O C;  2YIN A;  1OXZ A;  2ES0 A;  3PUG A;  3RYI E;  3ZYK A;  3N2G E;  1UX5 A;  3AA6 B;  4EEB A;  4UV8 B;  2K5B B;  2V6Y B;  4AXP A;  3C50 A;  4KP3 C;  5H6Q B;  4DR5 T;  4EGW A;  3UU3 A;  1WLX A;  3AE6 A;  3ZC0 A;  5F8P A;  3PJA J;  3RIU C;  4EAH A;  1BR2 A;  2X51 A;  2A2F X;  2BZB A;  4O2A E;  5H6R B;  4A5X A;  3ZT6 A;  1XMO T;  3ONJ A;  4V1A v;  4C91 A;  4DV1 T;  4CN4 A;  1U4Q A;  5J1G A;  4LF4 T;  2QGS A;  4ILC A;  2E8I A;  3PDY A;  3ANW B;  5AQI B;  3FZK B;  1WR0 A;  2XQ5 A;  3HI2 A;  3MXZ A;  2XQA A;  4GIW A;  4HWH A;  1L0V A;  3T8O A;  5FY0 A;  2RA1 A;  2QVA A;  5BMV E;  1GQE A;  5LBQ B;  4CXX A;  3VKH A;  5AQH B;  4NIQ A;  2V6Y A;  4JLE A;  4P1N A;  4AIS A;  4LFA T;  2KXP B;  4ZI3 C;  3VRA A;  3HL6 A;  3AVS A;  4EYU A;  2CWO A;  3N2O A;  4H63 H;  4M1P A;  3PU3 A;  4KHZ F;  3ZN0 B;  3AE1 A;  3LBX A;  3KVA A;  2IML A;  1HNZ T;  2BG9 E;  5KMG P;  3AE8 A;  4O8S A;  1MMA A;  3ZJ1 A;  4CXY A;  1N36 T;  5JRC B;  3OYZ A;  4I55 E;  4QXH B;  3RIF A;  2C0S A;  4U31 A;  3VKG A;  2WQY A;  4OYK A;  4PJJ A;  1W0B A;  2CLY C;  2Q9Q C;  3LDQ B;  4IE7 A;  3M65 A;  3AXJ A;  3O4X E;  2ODV A;  3FBZ A;  3TLU A;  3VRB A;  1OED B;  1M62 A;  2C5I T;  2V7I A;  2WY2 A;  1VCT A;  1YW0 A;  4CN1 A;  4IDZ A;  4LML A;  2W67 A;  2CRB A;  2X66 A;  4LF8 T;  1FMV A;  5ABH A;  1XMQ T;  2XM1 A;  1I94 T;  4L9I A;  2LE8 A;  3A5X A;  1SE7 A;  1WR6 A;  3BK9 A;  2XAJ B;  2N1G A;  1NEN A;  2RPA A;  3LG7 A;  3J7Y q;  4AKI A;  1J5W A;  1UCU A;  1FIO A;  2VL8 A;  3AB3 B;  4CI3 B;  4WZX A;  3A7M A;  2BVM A;  3JC6 C;  4UF0 B;  4DBQ A;  4K0K T;  4DR1 T;  4BAY B;  4P09 A;  3ZKR A;  5GON E;  3ZMS B;  2LJL A;  2KND A;  2NP9 A;  3AEB A;  5FY1 A;  3HR0 A;  3TLS A;  3ZLI A;  4DV7 T;  5JDH A;  4X5T A;  4LF5 T;  2IIU A;  2XPK A;  4KX6 A;  1WRD A;  3PUA A;  3FXE B;  4TV9 E;  4AQF A;  5J2U E;  3AVR A;  4HFC A;  4HEA A;  5HWY A;  5JDL A;  4NXM T;  4EV6 A;  3AA0 B;  1HR0 T;  4DVD A;  1US7 B;  4OK0 A;  4EB6 E;  4DMV A;  2CXF A;  4HFE A;  3V5S A;  4AIU A;  1HCI A;  4YHH T;  2B1E A;  1XNR T;  3F57 A;  3O1J A;  4ZOL E;  2E5V A;  2VVS A;  5JDF A;  2VKH A;  2KWH A;  4CXW A;  5HCM A;  2ZMA A;  3UQ4 A;  3ZT5 A;  5IUX A;  3B13 A;  1UUR A;  2CMR A;  3PJA A;  1EZ3 A;  3UU4 A;  3RLF F;  4B3S T;  2H88 A;  1IJ5 A;  4H9N C;  2RP4 A;  2M67 A; 
#chains in the Genus database with same CATH homology
 4DR3 T;  5BR8 T;  4DUZ T;  4JI3 T;  2UXD T;  1J5E T;  1HNW T;  4GKJ T;  4X62 T;  1N32 T;  4DV5 T;  4JI6 T;  1IBM T;  4OX9 T;  4X65 T;  2UUC T;  4DV6 T;  4JI8 T;  4X66 T;  4B3M T;  2VQF T;  3T1H T;  4DR4 T;  4YY3 T;  2UU9 T;  1IBL T;  5LMN T;  2F4V T;  4JV5 T;  4DR5 T;  4NXN T;  4X64 T;  1IBK T;  4LFC T;  4B3T T;  4LF7 T;  4GKK T;  4AQY T;  2VQE T;  1XMO T;  4DV2 T;  4KHP T;  4DV1 T;  4LF4 T;  4JI5 T;  4JI7 T;  4DV4 T;  2UXC T;  4DV3 T;  4LF6 T;  2ZM6 T;  4DR6 T;  1N33 T;  4JYA T;  4JI4 T;  4LFA T;  4DUY T;  2UUA T;  4LFB T;  4JI1 T;  1HNZ T;  1N36 T;  1HNX T;  4DV0 T;  2HHH T;  2UXB T;  4LF8 T;  1XMQ T;  1I94 T;  5LMU T;  4JI0 T;  4DR7 T;  3OTO T;  3T1Y T;  4K0K T;  4JI2 T;  4DR1 T;  5IWA T;  4DV7 T;  2UUB T;  4LF5 T;  4DR2 T;  1XNQ T;  4NXM T;  1N34 T;  1HR0 T;  1FJG T;  4YHH T;  1XNR T;  2E5L T;  4B3S T;  4B3R T;  4LF9 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...