4B3ST

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4b3sT00
4DR5T 4JI6T 4B3MT 4DV1T 3T1HT 1HR0T 1IBKT 4LF4T 4LF9T 1XMQT 2E5LT 4LFCT 4JI7T 1XMOT 4B3ST 4LF6T 4JI3T 5IWAT 4NXMT 4AQYT 4JV5T 4JI1T 2UUCT 2UUBT 1XNRT 4DR6T 4DV0T 1XNQT 1HNWT 2F4VT 1IBLT 4X65T 4DR4T 4DR2T 4DV6T 4JI5T 5LMNT 2VQFT 1FJGT 2UXBT 4LFAT 2ZM6T 4DV2T 5BR8T 3T1YT 4OX9T 4KHPT 4LF5T 3OTOT 4DV3T 4DV7T 4YHHT 1N33T 4JYAT 2HHHT 2UXDT 4B3RT 4DV5T 2UUAT 1HNXT 4X62T 4X64T 1N34T 4DR3T 4LF8T 1I94T 4JI4T 1IBMT 2VQET 4GKJT 4K0KT 4B3TT 4JI8T 4NXNT 2UU9T 4DUZT 4JI0T 1N32T 4X66T 4DUYT 4GKKT 1HNZT 4LF7T 4DR1T 2UXCT 4LFBT 4JI2T 1J5ET 4DV4T 4YY3T 1N36T 5LMUT 4DR7T
chains in the Genus database with same CATH superfamily
3N9MA 2K5BB 5FY0A 4I0UA 1YKEB 4HWIB 4XZCA 4HE8A 5LOVE 3M65A 5LJMA 1XMQT 4JI7T 4COFA 1XDPA 3K3NA 4QX7B 2WQYA 5JDMA 5IWAT 5IHYA 4HGAA 4IE0A 4UEMA 3AE9A 4DV0T 2X9HA 2WWUA 3B57A 2LOPA 3ZJ1A 2N2NA 4ZOLE 4QH1A 5AQRB 5J2TE 2DCFA 5AQOB 3HR0A 2X9YA 2XQ8A 2W0GA 4ZS2A 5HEUA 3WAKA 4KHPT 3AE8A 3OTOT 5FL0A 1HG2A 4HTEA 1N33T 3NKZA 3UULA 5ABHA 3ETUA 5L3FB 4JUYA 4JI4T 1WLXA 3UU4A 2XQ6A 3FB2A 4MALA 1LKXA 1ZP0A 5FXWA 3F31A 2VVNA 2MYSA 2WDRA 5ABGA 1MIVA 2N9DA 1E7PA 4HFDA 3ZMZB 2Y8DA 2XAJB 3JAFA 5CA0E 3OPCA 4UF0B 2W63A 4IL9A 2XQ9A 4LF4T 2BBHA 2A3DA 3HKDE 3PUQA 2NOXA 3NBXX 2FJBA 4EEBA 1KK7A 2LLYA 3HKCE 5L47A 3AECA 4M1PA 2SPCA 4YSYA 2CRBA 2VL0A 3BK9A 3LDQB 2PTFA 5DABA 4QXCB 4U3CA 3Q5WA 1HTJF 1SE7A 5LG4A 4O2AE 3RKOA 3TLWA 3ZJ2A 4Q25A 4HFIA 5ADXL 1BR2A 3KV4A 1V9DA 4NUVA 2ZMAA 4OX9T 4EAHA 3SOLA 2FBWA 2VKHA 2CM0A 4X62T 3C64A 4K0UA 1N34T 2WZIA 5AQGB 1I94T 5LGTB 3RC8A 1BR1A 5JRCA 3QNUA 5HYAA 4UV8B 3SS1A 3VR9A 4PJNA 4DBQA 2X9WA 3CQXC 3AVRA 2A2FX 5HCJA 3U3IA 3CIRA 3AEAA 4DV1T 2XM1A 3ZMTB 4U2ZA 5LXTE 1OXZA 3IF8B 4IT4A 3W15B 4ZZBA 4H9RC 4KUMB 4E7ZA 3ZN1B 2K48A 5AQHB 3B13A 4KX6A 5LGNB 5AQNB 3QUJA 2BDEA 4WBOA 2XQ5A 5DQWA 2YOEA 1UX4A 3UQ4A 2W2UA 3V5UA 4JI5T 2VQFT 3DP7A 4N78D 2DNXA 3KDSE 3E22E 3QB5A 2NW7A 3A8YC 3T1YT 3AVSA 3Q5DA 3I1AA 2EHOC 3ZSTA 2XAFB 3EAMA 4IDQA 3ZT6A 3OKQA 4LF8T 4ILUA 2G0UA 3ZEFB 3IEEA 1SUMB 5C2TA 3X1DA 2CHOA 3MZKB 2BZBA 2V6YA 2CMRA 4B3TT 4V1Av 2NTXA 3UU6A 4WNKA 5AQQB 2BS2A 4TN7B 3O4XE 4DUYT 2HN1A 1KFYA 1NEKA 2KXPB 3AEGA 4ZEYA 4CQIA 4JI2T 5FL1A 3AAIA 3VRAA 2JQKA 4DV4T 3UT5E 4ZI3C 3N5LA 4JI6T 3PU8A 2W00A 3L8RA 5HXCA 2BKOA 2FJAA 3SWHA 3EVYA 3AE1A 2B76A 2J1DG 4TNWA 1XMOT 3LBXA 1VOMA 2V7IA 4YT0A 1S35A 5FXVA 4JV5T 4JI1T 4IIJE 4PJLA 3LG7A 2RA1A 3Q9DA 1E1HB 1IBLT 2XSBA 4X1IE 4ASKA 3RYIE 2YDSA 3QK6A 3ZPOA 2IMLA 2KT9A 4G63A 3P7IA 5EK2A 3MA9A 2KNDA 3AE7A 3FBZA 2YKSA 4TWFA 4DV7T 3AE3A 3SFEA 4PFOA 2BG9A 2UUAT 1X9BA 4X64T 4DR3T 3O1HA 5LYJE 2WDVA 3H3AA 2W4XA 2PFVA 3C4ZA 1OEDC 4KMCA 2QYWA 1LRZA 3OJAA 1HS7A 2LKGA 2LT3A 2X51A 2CXFA 4NIQA 3ONLC 1S94A 1G8XA 1UGOA 4ADZA 1T7SA 4HWCA 2JRKA 2B1EA 2CWYA 2WP9A 3ETVA 4XBFB 1Y64B 5J2UE 5LG3A 5JDHA 3AEDA 2E8IA 3RYHE 2NTYA 5HXRA 2XASB 4CN1A 2V5DA 1WRDA 2WU5A 2WS3A 2YDRA 2P9BA 3RC3A 5KX5E 2YK0A 3CK6A 3CQGB 3PUYF 4HWHA 2X0YA 3VKHA 4DV6T 2PJQA 2XTLA 4EV6A 2JQ9A 4DMWA 1QSDA 1ZV4X 1US7B 2LEHA 3R84B 1BR0A 3N9OA 4Z90A 2DL1A 4YJ3E 5FVLA 1IZNB 2Q9QC 3P4QA 5ABFB 1LVFA 1J5WA 2DHRA 4ZZCA 2MBGA 4JYAT 2UXDT 1HNXT 3O9XA 4PK5A 4GYSA 3FXEB 2X67A 3LK42 1D0XA 4F8HA 3RH3A 2FJEA 5F3JA 2OLTA 2VB6A 1N32T 4AISA 4X20E 4GYRA 4E7SA 3PE0A 2E5VA 2WDQA 2IIUA 1HFAA 1W09A 5HEGA 1ZHCA 3VHLA 3OYZA 4CXYA 5CFBA 4YY3T 1U5PA 2CBIA 1YQ3A 2LM2A 5AQUB 5L4HA 3DJBA 5FVKA 4YTNA 2X66A 4AKIA 2IHR1 1IBKT 2K3WA 4ZI2C 2E5LT 2XHEB 3E08A 4B3ST 5AFUL 2LSIA 3C51A 2UUBT 1XNRT 4EYUA 3FBLA 1AJ3A 3TLVA 3H3MA 2ZLYA 4DR4T 2D5UA 4U2YA 2XM2A 4WBNE 3L3PA 4ILAA 5HAXA 3GA8A 3I9WA 4B6XA 4AIUA 2WU2A 4AQFA 2IW5B 4ILCA 2XQYA 5LCYA 2XQ4A 5E0OA 2ZM6T 4DV2T 1O3XA 2XQ3A 5DJQC 2FJDA 3KBTA 4DV3T 2LHRA 1FMWA 3UQ7A 3L09A 3PUZF 3BQIA 4HFCA 2YU1A 3PTRB 2CA5A 4K0KT 2RPAA 5L3EB 3L39A 2JPFA 2UU9T 4DBRA 2X0LB 1BR4A 5F8PA 4WZXA 4GOUA 4LF7T 2JQHA 1T8BA 4H9NC 5CGMA 5HCMA 2IUBA 2I0MA 1HX1B 1UK5A 2N1GA 2M67A 4EYYR 2V26A 1YQ4A 2L9QA 3EDVA 4OYKA 2WMNA 4A5XA 3UU3A 1EZ3A 4EOZB 2JJ9A 4U72A 4JEUB 3UU5A 3AA7B 1OWAA 5AQTB 2QA7A 1WR6A 3JCFA 1D0YA 3VU7H 2EHOB 1E2AA 3P50A 4PW8A 2BG9C 3PUVF 4HFHA 2V5CA 3N9QA 3UU8A 5LHGB 2WY2A 3PUAA 2YEVC 3JAEA 2V7MA 4CXXA 3RKGA 2DWKA 4CI3B 3K8PC 4EZ4A 2E2AA 2H7VC 3AA1B 3ZN0B 2A9UA 3ZC0A 5HWYA 4UIGA 2WM9A 5JQGE 2HHHT 2X0HA 3RIUA 4B3RT 3KFWX 3KINB 2JMKA 3D0TA 3HI2A 2BG9E 2M6IA 4BA9A 2UXNB 2NW9A 4IE4A 3UFGA 1Z8UA 5LBMA 4TWHA 4PK4A 2NW8A 1NENA 3ZCIA 3UUXB 2DLRA 4MBQA 5LMUT 5L3DB 2XPKA 2I6HA 3RYFE 5AQSB 4LMJA 3RX6A 3QOFA 4QWNB 4U7YA 4ISTA 2J47A 2W67A 3ZC1A 3R6NA 4CZZB 3F2EA 2E9XC 2W66A 5LNKA 4JEHB 3IHRA 1QLBA 5JR9C 4QH5A 1VCSA 2F4VT 4X65T 3AE4A 3MK7C 3AE2A 1HG5A 3PUWF 2XAGB 4AKHA 1D0ZA 2C0SA 2JQQA 3PDYA 3WI3A 1OEDB 3EUHA 2X68A 4X5TA 3PUXF 4H9OC 5LHHB 1FJGT 2J62A 3CX6B 5AQKB 3RGLA 5H6RB 2L3LA 1HF8A 2C5IT 1UCUA 3Q5EA 2HH7A 3FZHB 4DV5T 5BMVE 2QGSA 4YHJA 5AQVB 2EHOD 3J9X1 3LSVA 1IBMT 4EEDA 3FXDB 2GK9A 5CA1E 4CXWA 1D1AA 3CX7B 2KWHA 4IE5A 3HKEE 3P4WA 3CPZA 1GQEA 4LMLA 1WR0A 3O1JA 4UXNB 1HX8A 3LJCA 3AEFA 1KF6A 3EI0A 3G06A 4ZI3D 5C8YE 2JMHA 5LB7B 4O4JE 2H7OA 2CBJA 4LFCT 1YKHB 5L3GB 3ONJA 1ZEEA 2YN6A 4QH4A 4AQFC 3FZLB 4JI3T 4Z91A 2Q9QB 2J4GA 2UUCT 1CHUA 4UVCB 2LJLA 4TV9E 3CMLA 2CCQA 2IDOB 4IHJE 3ZMVB 1QUUA 5HXHA 2YINA 5LMNT 2H88A 3QC9A 2LSGA 3TLUA 3N2GE 3HA4A 2KSRA 1R8IA 2NP9A 3I0QA 4TUYE 5JH7E 4UR9A 4LMKA 3VR8A 3ZYMA 1B7TA 1Z0PA 2VKOA 4C91A 2Y6XA 4MHCA 3PURA 4GKJT 4KBMB 2LRLA 2WZHA 1JNZA 5EZYE 2AXDS 3MJXA 3A5XA 5AQMB 3C4XA 1HNZT 2XAQB 4U74A 3CKDA 4U7IA 5FP3A 4EB6E 4PNIA 3TLTA 5ABFA 4OYJA 3OYXA 4AKLA 1YW0A 5HXSA 1WYCA 5HEJA 4DR5T 4TNVA 2MAWA 3C50A 4PFPA 3ANWB 1HR0T 5M4YA 4LF9T 5KDMC 4G2AA 4Z8XA 2VL8A 3UUBA 3OBVE 4MFRA 1M7KA 3ZT7A 4ZS3A 1UX5A 1XNQT 3KV5A 4WW0A 3RIUC 1U4QA 3JC6D 4HFBA 2KINB 3EABA 5JDQA 4DO0A 2VK9A 4IGUA 4IREA 5JDFA 1W0BA 4YFSA 2UXBT 2VKJA 1IAPA 4GIWA 1MNEA 2Q9QD 4EIWA 4YHHT 1X79A 5FNVE 3IBPA 2A72A 2BVMA 5L4EA 2VQET 2CXLA 2ZM2A 2XZEA 5H6QB 4NXNT 2LSYA 3N9PA 1T98A 4GKKT 4F6RC 2CWOA 5ETWA 4H9SE 5LHIB 5JDNA 4AKGA 1J5ET 2K24A 2XY8B 2BG9B 4I55E 1XZYA 2VURA 3PU3A 1L0VA 4DIDB 3QB5K 4QXBB 3N2KE 3RQUA 5AQIB 3SFDA 4TWDA 4O4HE 4QHOA 1IJ6A 2VWAA 1CUNA 1H7CA 3HKBE 3FZKB 4YLHA 2D0TA 1KNRA 2XQAA 2V1DB 4X1YE 3ZKRA 2IC6A 1HNWT 3JADA 1D1CA 3RYCE 3GN5B 2BS4A 3KVBA 4CN4A 2VVSA 3AXJB 2D9DA 4CI1B 3RHWA 4AI6A 5J0ZA 4LF5T 4TV8E 2RP4A 1MMDA 3DTOA 3NWIA 4QXHB 2KMFA 3LK2B 4UF0A 1MMAA 3AB3B 5FMNA 1FIOA 3RRWA 3NRYA 4HKAA 3O1IA 4HWDA 4DUZT 2E9XB 1NAFA 4MLKA 1KNZA 2CPTA 4AQGA 2YDQA 5JR9B 4QKNA 4H9QC 4A97A 3ESLA 1MIWA 4YJ2E 4P1NA 1MMGA 3FZFB 4H63V 2LSJA 4H9PC 3KV6A 4QX8B 3P4RA 4U33A 2BS3A 5FY1A 2QVAA 3RI5A 3MACA 2Y48B 2YU2A 4DR6T 3ZCJA 5LJNA 4YSZA 2M6BA 4P09A 4OK0A 5JVDE 4O8SA 4PJJA 2WBLA 3VKGA 1XWMA 2CHNA 2IC9A 3TLSA 2BBJA 1FMVA 5BR8T 2BVLA 2LM9A 4C90A 2LRKA 4ZHQE 5JDLA 4ILBA 3NZQA 3AEEA 3ONXA 1UUSA 4P0BA 2XJ7A 4UVBB 2XUEA 2BKPA 5LA6E 4OHFA 3WAJA 1OEDA 2HPLA 3OVUA 4HWFA 1M62A 1W0AA 3P4PA 1KEYA 4YTPA 2UXCT 2DI4A 1KNPA 2MTQA 4YSXA 5EK4A 2KLQA 3AE6A 2V6XA 3RF1A 2WB5A 4O2BE 2OV9A 2FUPA 5A1LA 3NZPA 3I0OA 1Y01A 3V5SA 2AE9A 2H3RA 4IDOA 2CLYC 3RPUA 4CI2B 3RIFA 3SRZA 2HPJA 4BJMA 3BQLA 2E9XD 2WAUA 4IDPA 3AA6B 2LOSA 3UFEA 3PUGA 1YD8G 4UV9B 4IDNA 4DNDA 2ACZA 4LFAT 2VKDA 4JBWF 2BKNA 5L2LA 4AXPA 3CQCB 5KXJA 3U78A 4ANJA 4EXTA 3EDUA 2Q9QA 3ZMUB 2MOZA 5AQFB 1IJ5A 1SA0E 1UURA 3HL6A 3KV9A 2WCAA 4BAYB 2XQ7A 4GK5E 3UUMA 3MXZA 2W62A 4HEAA 3LFMA 5AQJB 5HEOA 3A7MA 4JI8T 4DMVA 3ZLIA 5C3JA 4FI5A 2PG8A 2WMOA 3BQKA 2D2SA 4GK0E 4DR1T 4LFBT 4BJNA 1VRBA 3RRCA 4IDZA 4CN6A 5CB4E 5FY7A 4KI0F 1VCTA 1NWMX 4DR7T 5ABEA 3N2OA 2CXDA 1MMNA 4TX5A 3CX8B 5F5WA 5JDGA 4EZHA 2LHNA 4H63H 2XAHB 4LF6T 2VASA 5GONE 3I9YA 2V8SV 2OA5A 5AQLB 5L3CB 3K3OA 3KVAA 5JRCB 5EK3A 4IE6A 3ANWA 2NWBA 1T72A 3C4WA 5FKYA 3AEBA 3EHZA 5KMGP 1WCRA 3M3ZB 2KWIB 3C98B 4O4LE 3ABVA 2QRXA 3MKDA 4U31A 4A56A 2C5JA 5HXEA 1JNRA 4ZI7E 4O4IE 2CEAA 2C5KT 5IUXA 3TKLB 2ODUA 4AKRB 4ISSA 5IYZE 4JLEA 4JI0T 2HN2A 2ODVA 4NUUA 4UVAB 3B5MA 4DVDA 3ZT5A 1FEWA 2L8KA 3RLFF 2W61A 5JTGA 2V7JA 2Z6EA 3AA0B 3H37A 4PJMA 3CWZB 3T1HT 3GWHA 1J1JA 3S4UA 4A98A 1LVKA 2DWGA 2IAKA 4NXMT 4AQYT 5AQPB 2JIWA 4HFVA 5FYMA 4L5GA 1HCIA 4I43B 2V6YB 5LBQB 1SHZC 3LK3B 4KHZF 3RIAA 3N9NA 2WWVA 4I50E 1WFDA 3UTKA 2LKHA 1D1BA 2LSKA 2XSAA 3K3QC 3P4SA 3Q5XA 1WYBA 3NVOA 4NPPA 4PAGA 3CVRA 2ES0A 2V7LA 3UUNA 3GN5A 4YTMA 4EGWA 3P8CD 4WYVA 3F57A 1G73A 5J1GA 3LBXB 3K1SA 4YXDA 1OEDE 3IA3A 3AXJA 3ZYKA 3AAAB 3AE5A 5JREA 3AAEB 3N9LA 3VRBA 4P0AA 3GMIA 1I6ZA 2I59A 4ZXLA 2CE7A 2K9AA 3E0ZA 2V7KA 2WSSV 5DQVA 4B3MT 4IL4A 3JC6C 4IE7A 4ERRA 1ZOYA 4HFEA 3NRXA 3T8OA 2D0UA 3J7Yq 3KBUA 2ZM0A 2E9XA 1MIYA 4J2CA 5JR9A 2KZ7B 3PUSA 5TAOA 2LE8A 4L9IA 4DR2T 3ZMSB 3ZSSA 2PBIA 4ZI2D 3PJAA 4L0RA 4X1KE 3ZYLA 4UELA 3PV0F 5HWXA 1DU2A 3FHNA 5CJ5A 3PJAJ 3RQWA 2X9XA 1W9RA 4I4TE 2MPKA 1MNDA 1XDOA 4HN9A 5LP6E 3FZMB 4FJOA 2ACXA 4PK6A 4TZ4C 4OFZA 2CLYB 5FXZA 2H89A 2R6GF 5L3BB 4X66T 4XAXB 2NR4A 2ZM8A 3Q2MA 1YXRA 4KP3C 1ZKEA 5LGUB 2EHOA 5HEHA 1N36T 2UXXB 5FXXA
chains in the Genus database with same CATH topology
4DR5T 4JI6T 4B3MT 4DV1T 3T1HT 1HR0T 1IBKT 4LF4T 4LF9T 1XMQT 2E5LT 4LFCT 4JI7T 1XMOT 4B3ST 4LF6T 4JI3T 5IWAT 4NXMT 4AQYT 4JV5T 4JI1T 2UUCT 2UUBT 1XNRT 4DR6T 4DV0T 1XNQT 1HNWT 2F4VT 1IBLT 4X65T 4DR4T 4DR2T 4DV6T 4JI5T 5LMNT 2VQFT 1FJGT 2UXBT 4LFAT 2ZM6T 4DV2T 5BR8T 3T1YT 4OX9T 4KHPT 4LF5T 3OTOT 4DV3T 4DV7T 4YHHT 1N33T 4JYAT 2HHHT 2UXDT 4B3RT 4DV5T 2UUAT 1HNXT 4X62T 4X64T 1N34T 4DR3T 4LF8T 1I94T 4JI4T 1IBMT 2VQET 4GKJT 4K0KT 4B3TT 4JI8T 4NXNT 2UU9T 4DUZT 4JI0T 1N32T 4X66T 4DUYT 4GKKT 1HNZT 4LF7T 4DR1T 2UXCT 4LFBT 4JI2T 1J5ET 4DV4T 4YY3T 1N36T 5LMUT 4DR7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 T;  4JI6 T;  4B3M T;  4DV1 T;  3T1H T;  1HR0 T;  1IBK T;  4LF4 T;  4LF9 T;  1XMQ T;  2E5L T;  4LFC T;  4JI7 T;  1XMO T;  4B3S T;  4LF6 T;  4JI3 T;  5IWA T;  4NXM T;  4AQY T;  4JV5 T;  4JI1 T;  2UUC T;  2UUB T;  1XNR T;  4DR6 T;  4DV0 T;  1XNQ T;  1HNW T;  2F4V T;  1IBL T;  4X65 T;  4DR4 T;  4DR2 T;  4DV6 T;  4JI5 T;  5LMN T;  2VQF T;  1FJG T;  2UXB T;  4LFA T;  2ZM6 T;  4DV2 T;  5BR8 T;  3T1Y T;  4OX9 T;  4KHP T;  4LF5 T;  3OTO T;  4DV3 T;  4DV7 T;  4YHH T;  1N33 T;  4JYA T;  2HHH T;  2UXD T;  4B3R T;  4DV5 T;  2UUA T;  1HNX T;  4X62 T;  4X64 T;  1N34 T;  4DR3 T;  4LF8 T;  1I94 T;  4JI4 T;  1IBM T;  2VQE T;  4GKJ T;  4K0K T;  4B3T T;  4JI8 T;  4NXN T;  2UU9 T;  4DUZ T;  4JI0 T;  1N32 T;  4X66 T;  4DUY T;  4GKK T;  1HNZ T;  4LF7 T;  4DR1 T;  2UXC T;  4LFB T;  4JI2 T;  1J5E T;  4DV4 T;  4YY3 T;  1N36 T;  5LMU T;  4DR7 T; 
#chains in the Genus database with same CATH topology
 3N9M A;  2K5B B;  5FY0 A;  4I0U A;  1YKE B;  4HWI B;  4XZC A;  4HE8 A;  5LOV E;  3M65 A;  5LJM A;  1XMQ T;  4JI7 T;  4COF A;  1XDP A;  3K3N A;  4QX7 B;  2WQY A;  5JDM A;  5IWA T;  5IHY A;  4HGA A;  4IE0 A;  4UEM A;  3AE9 A;  4DV0 T;  2X9H A;  2WWU A;  3B57 A;  2LOP A;  3ZJ1 A;  2N2N A;  4ZOL E;  4QH1 A;  5AQR B;  5J2T E;  2DCF A;  5AQO B;  3HR0 A;  2X9Y A;  2XQ8 A;  2W0G A;  4ZS2 A;  5HEU A;  3WAK A;  4KHP T;  3AE8 A;  3OTO T;  5FL0 A;  1HG2 A;  4HTE A;  1N33 T;  3NKZ A;  3UUL A;  5ABH A;  3ETU A;  5L3F B;  4JUY A;  4JI4 T;  1WLX A;  3UU4 A;  2XQ6 A;  3FB2 A;  4MAL A;  1LKX A;  1ZP0 A;  5FXW A;  3F31 A;  2VVN A;  2MYS A;  2WDR A;  5ABG A;  1MIV A;  2N9D A;  1E7P A;  4HFD A;  3ZMZ B;  2Y8D A;  2XAJ B;  3JAF A;  5CA0 E;  3OPC A;  4UF0 B;  2W63 A;  4IL9 A;  2XQ9 A;  4LF4 T;  2BBH A;  2A3D A;  3HKD E;  3PUQ A;  2NOX A;  3NBX X;  2FJB A;  4EEB A;  1KK7 A;  2LLY A;  3HKC E;  5L47 A;  3AEC A;  4M1P A;  2SPC A;  4YSY A;  2CRB A;  2VL0 A;  3BK9 A;  3LDQ B;  2PTF A;  5DAB A;  4QXC B;  4U3C A;  3Q5W A;  1HTJ F;  1SE7 A;  5LG4 A;  4O2A E;  3RKO A;  3TLW A;  3ZJ2 A;  4Q25 A;  4HFI A;  5ADX L;  1BR2 A;  3KV4 A;  1V9D A;  4NUV A;  2ZMA A;  4OX9 T;  4EAH A;  3SOL A;  2FBW A;  2VKH A;  2CM0 A;  4X62 T;  3C64 A;  4K0U A;  1N34 T;  2WZI A;  5AQG B;  1I94 T;  5LGT B;  3RC8 A;  1BR1 A;  5JRC A;  3QNU A;  5HYA A;  4UV8 B;  3SS1 A;  3VR9 A;  4PJN A;  4DBQ A;  2X9W A;  3CQX C;  3AVR A;  2A2F X;  5HCJ A;  3U3I A;  3CIR A;  3AEA A;  4DV1 T;  2XM1 A;  3ZMT B;  4U2Z A;  5LXT E;  1OXZ A;  3IF8 B;  4IT4 A;  3W15 B;  4ZZB A;  4H9R C;  4KUM B;  4E7Z A;  3ZN1 B;  2K48 A;  5AQH B;  3B13 A;  4KX6 A;  5LGN B;  5AQN B;  3QUJ A;  2BDE A;  4WBO A;  2XQ5 A;  5DQW A;  2YOE A;  1UX4 A;  3UQ4 A;  2W2U A;  3V5U A;  4JI5 T;  2VQF T;  3DP7 A;  4N78 D;  2DNX A;  3KDS E;  3E22 E;  3QB5 A;  2NW7 A;  3A8Y C;  3T1Y T;  3AVS A;  3Q5D A;  3I1A A;  2EHO C;  3ZST A;  2XAF B;  3EAM A;  4IDQ A;  3ZT6 A;  3OKQ A;  4LF8 T;  4ILU A;  2G0U A;  3ZEF B;  3IEE A;  1SUM B;  5C2T A;  3X1D A;  2CHO A;  3MZK B;  2BZB A;  2V6Y A;  2CMR A;  4B3T T;  4V1A v;  2NTX A;  3UU6 A;  4WNK A;  5AQQ B;  2BS2 A;  4TN7 B;  3O4X E;  4DUY T;  2HN1 A;  1KFY A;  1NEK A;  2KXP B;  3AEG A;  4ZEY A;  4CQI A;  4JI2 T;  5FL1 A;  3AAI A;  3VRA A;  2JQK A;  4DV4 T;  3UT5 E;  4ZI3 C;  3N5L A;  4JI6 T;  3PU8 A;  2W00 A;  3L8R A;  5HXC A;  2BKO A;  2FJA A;  3SWH A;  3EVY A;  3AE1 A;  2B76 A;  2J1D G;  4TNW A;  1XMO T;  3LBX A;  1VOM A;  2V7I A;  4YT0 A;  1S35 A;  5FXV A;  4JV5 T;  4JI1 T;  4IIJ E;  4PJL A;  3LG7 A;  2RA1 A;  3Q9D A;  1E1H B;  1IBL T;  2XSB A;  4X1I E;  4ASK A;  3RYI E;  2YDS A;  3QK6 A;  3ZPO A;  2IML A;  2KT9 A;  4G63 A;  3P7I A;  5EK2 A;  3MA9 A;  2KND A;  3AE7 A;  3FBZ A;  2YKS A;  4TWF A;  4DV7 T;  3AE3 A;  3SFE A;  4PFO A;  2BG9 A;  2UUA T;  1X9B A;  4X64 T;  4DR3 T;  3O1H A;  5LYJ E;  2WDV A;  3H3A A;  2W4X A;  2PFV A;  3C4Z A;  1OED C;  4KMC A;  2QYW A;  1LRZ A;  3OJA A;  1HS7 A;  2LKG A;  2LT3 A;  2X51 A;  2CXF A;  4NIQ A;  3ONL C;  1S94 A;  1G8X A;  1UGO A;  4ADZ A;  1T7S A;  4HWC A;  2JRK A;  2B1E A;  2CWY A;  2WP9 A;  3ETV A;  4XBF B;  1Y64 B;  5J2U E;  5LG3 A;  5JDH A;  3AED A;  2E8I A;  3RYH E;  2NTY A;  5HXR A;  2XAS B;  4CN1 A;  2V5D A;  1WRD A;  2WU5 A;  2WS3 A;  2YDR A;  2P9B A;  3RC3 A;  5KX5 E;  2YK0 A;  3CK6 A;  3CQG B;  3PUY F;  4HWH A;  2X0Y A;  3VKH A;  4DV6 T;  2PJQ A;  2XTL A;  4EV6 A;  2JQ9 A;  4DMW A;  1QSD A;  1ZV4 X;  1US7 B;  2LEH A;  3R84 B;  1BR0 A;  3N9O A;  4Z90 A;  2DL1 A;  4YJ3 E;  5FVL A;  1IZN B;  2Q9Q C;  3P4Q A;  5ABF B;  1LVF A;  1J5W A;  2DHR A;  4ZZC A;  2MBG A;  4JYA T;  2UXD T;  1HNX T;  3O9X A;  4PK5 A;  4GYS A;  3FXE B;  2X67 A;  3LK4 2;  1D0X A;  4F8H A;  3RH3 A;  2FJE A;  5F3J A;  2OLT A;  2VB6 A;  1N32 T;  4AIS A;  4X20 E;  4GYR A;  4E7S A;  3PE0 A;  2E5V A;  2WDQ A;  2IIU A;  1HFA A;  1W09 A;  5HEG A;  1ZHC A;  3VHL A;  3OYZ A;  4CXY A;  5CFB A;  4YY3 T;  1U5P A;  2CBI A;  1YQ3 A;  2LM2 A;  5AQU B;  5L4H A;  3DJB A;  5FVK A;  4YTN A;  2X66 A;  4AKI A;  2IHR 1;  1IBK T;  2K3W A;  4ZI2 C;  2E5L T;  2XHE B;  3E08 A;  4B3S T;  5AFU L;  2LSI A;  3C51 A;  2UUB T;  1XNR T;  4EYU A;  3FBL A;  1AJ3 A;  3TLV A;  3H3M A;  2ZLY A;  4DR4 T;  2D5U A;  4U2Y A;  2XM2 A;  4WBN E;  3L3P A;  4ILA A;  5HAX A;  3GA8 A;  3I9W A;  4B6X A;  4AIU A;  2WU2 A;  4AQF A;  2IW5 B;  4ILC A;  2XQY A;  5LCY A;  2XQ4 A;  5E0O A;  2ZM6 T;  4DV2 T;  1O3X A;  2XQ3 A;  5DJQ C;  2FJD A;  3KBT A;  4DV3 T;  2LHR A;  1FMW A;  3UQ7 A;  3L09 A;  3PUZ F;  3BQI A;  4HFC A;  2YU1 A;  3PTR B;  2CA5 A;  4K0K T;  2RPA A;  5L3E B;  3L39 A;  2JPF A;  2UU9 T;  4DBR A;  2X0L B;  1BR4 A;  5F8P A;  4WZX A;  4GOU A;  4LF7 T;  2JQH A;  1T8B A;  4H9N C;  5CGM A;  5HCM A;  2IUB A;  2I0M A;  1HX1 B;  1UK5 A;  2N1G A;  2M67 A;  4EYY R;  2V26 A;  1YQ4 A;  2L9Q A;  3EDV A;  4OYK A;  2WMN A;  4A5X A;  3UU3 A;  1EZ3 A;  4EOZ B;  2JJ9 A;  4U72 A;  4JEU B;  3UU5 A;  3AA7 B;  1OWA A;  5AQT B;  2QA7 A;  1WR6 A;  3JCF A;  1D0Y A;  3VU7 H;  2EHO B;  1E2A A;  3P50 A;  4PW8 A;  2BG9 C;  3PUV F;  4HFH A;  2V5C A;  3N9Q A;  3UU8 A;  5LHG B;  2WY2 A;  3PUA A;  2YEV C;  3JAE A;  2V7M A;  4CXX A;  3RKG A;  2DWK A;  4CI3 B;  3K8P C;  4EZ4 A;  2E2A A;  2H7V C;  3AA1 B;  3ZN0 B;  2A9U A;  3ZC0 A;  5HWY A;  4UIG A;  2WM9 A;  5JQG E;  2HHH T;  2X0H A;  3RIU A;  4B3R T;  3KFW X;  3KIN B;  2JMK A;  3D0T A;  3HI2 A;  2BG9 E;  2M6I A;  4BA9 A;  2UXN B;  2NW9 A;  4IE4 A;  3UFG A;  1Z8U A;  5LBM A;  4TWH A;  4PK4 A;  2NW8 A;  1NEN A;  3ZCI A;  3UUX B;  2DLR A;  4MBQ A;  5LMU T;  5L3D B;  2XPK A;  2I6H A;  3RYF E;  5AQS B;  4LMJ A;  3RX6 A;  3QOF A;  4QWN B;  4U7Y A;  4IST A;  2J47 A;  2W67 A;  3ZC1 A;  3R6N A;  4CZZ B;  3F2E A;  2E9X C;  2W66 A;  5LNK A;  4JEH B;  3IHR A;  1QLB A;  5JR9 C;  4QH5 A;  1VCS A;  2F4V T;  4X65 T;  3AE4 A;  3MK7 C;  3AE2 A;  1HG5 A;  3PUW F;  2XAG B;  4AKH A;  1D0Z A;  2C0S A;  2JQQ A;  3PDY A;  3WI3 A;  1OED B;  3EUH A;  2X68 A;  4X5T A;  3PUX F;  4H9O C;  5LHH B;  1FJG T;  2J62 A;  3CX6 B;  5AQK B;  3RGL A;  5H6R B;  2L3L A;  1HF8 A;  2C5I T;  1UCU A;  3Q5E A;  2HH7 A;  3FZH B;  4DV5 T;  5BMV E;  2QGS A;  4YHJ A;  5AQV B;  2EHO D;  3J9X 1;  3LSV A;  1IBM T;  4EED A;  3FXD B;  2GK9 A;  5CA1 E;  4CXW A;  1D1A A;  3CX7 B;  2KWH A;  4IE5 A;  3HKE E;  3P4W A;  3CPZ A;  1GQE A;  4LML A;  1WR0 A;  3O1J A;  4UXN B;  1HX8 A;  3LJC A;  3AEF A;  1KF6 A;  3EI0 A;  3G06 A;  4ZI3 D;  5C8Y E;  2JMH A;  5LB7 B;  4O4J E;  2H7O A;  2CBJ A;  4LFC T;  1YKH B;  5L3G B;  3ONJ A;  1ZEE A;  2YN6 A;  4QH4 A;  4AQF C;  3FZL B;  4JI3 T;  4Z91 A;  2Q9Q B;  2J4G A;  2UUC T;  1CHU A;  4UVC B;  2LJL A;  4TV9 E;  3CML A;  2CCQ A;  2IDO B;  4IHJ E;  3ZMV B;  1QUU A;  5HXH A;  2YIN A;  5LMN T;  2H88 A;  3QC9 A;  2LSG A;  3TLU A;  3N2G E;  3HA4 A;  2KSR A;  1R8I A;  2NP9 A;  3I0Q A;  4TUY E;  5JH7 E;  4UR9 A;  4LMK A;  3VR8 A;  3ZYM A;  1B7T A;  1Z0P A;  2VKO A;  4C91 A;  2Y6X A;  4MHC A;  3PUR A;  4GKJ T;  4KBM B;  2LRL A;  2WZH A;  1JNZ A;  5EZY E;  2AXD S;  3MJX A;  3A5X A;  5AQM B;  3C4X A;  1HNZ T;  2XAQ B;  4U74 A;  3CKD A;  4U7I A;  5FP3 A;  4EB6 E;  4PNI A;  3TLT A;  5ABF A;  4OYJ A;  3OYX A;  4AKL A;  1YW0 A;  5HXS A;  1WYC A;  5HEJ A;  4DR5 T;  4TNV A;  2MAW A;  3C50 A;  4PFP A;  3ANW B;  1HR0 T;  5M4Y A;  4LF9 T;  5KDM C;  4G2A A;  4Z8X A;  2VL8 A;  3UUB A;  3OBV E;  4MFR A;  1M7K A;  3ZT7 A;  4ZS3 A;  1UX5 A;  1XNQ T;  3KV5 A;  4WW0 A;  3RIU C;  1U4Q A;  3JC6 D;  4HFB A;  2KIN B;  3EAB A;  5JDQ A;  4DO0 A;  2VK9 A;  4IGU A;  4IRE A;  5JDF A;  1W0B A;  4YFS A;  2UXB T;  2VKJ A;  1IAP A;  4GIW A;  1MNE A;  2Q9Q D;  4EIW A;  4YHH T;  1X79 A;  5FNV E;  3IBP A;  2A72 A;  2BVM A;  5L4E A;  2VQE T;  2CXL A;  2ZM2 A;  2XZE A;  5H6Q B;  4NXN T;  2LSY A;  3N9P A;  1T98 A;  4GKK T;  4F6R C;  2CWO A;  5ETW A;  4H9S E;  5LHI B;  5JDN A;  4AKG A;  1J5E T;  2K24 A;  2XY8 B;  2BG9 B;  4I55 E;  1XZY A;  2VUR A;  3PU3 A;  1L0V A;  4DID B;  3QB5 K;  4QXB B;  3N2K E;  3RQU A;  5AQI B;  3SFD A;  4TWD A;  4O4H E;  4QHO A;  1IJ6 A;  2VWA A;  1CUN A;  1H7C A;  3HKB E;  3FZK B;  4YLH A;  2D0T A;  1KNR A;  2XQA A;  2V1D B;  4X1Y E;  3ZKR A;  2IC6 A;  1HNW T;  3JAD A;  1D1C A;  3RYC E;  3GN5 B;  2BS4 A;  3KVB A;  4CN4 A;  2VVS A;  3AXJ B;  2D9D A;  4CI1 B;  3RHW A;  4AI6 A;  5J0Z A;  4LF5 T;  4TV8 E;  2RP4 A;  1MMD A;  3DTO A;  3NWI A;  4QXH B;  2KMF A;  3LK2 B;  4UF0 A;  1MMA A;  3AB3 B;  5FMN A;  1FIO A;  3RRW A;  3NRY A;  4HKA A;  3O1I A;  4HWD A;  4DUZ T;  2E9X B;  1NAF A;  4MLK A;  1KNZ A;  2CPT A;  4AQG A;  2YDQ A;  5JR9 B;  4QKN A;  4H9Q C;  4A97 A;  3ESL A;  1MIW A;  4YJ2 E;  4P1N A;  1MMG A;  3FZF B;  4H63 V;  2LSJ A;  4H9P C;  3KV6 A;  4QX8 B;  3P4R A;  4U33 A;  2BS3 A;  5FY1 A;  2QVA A;  3RI5 A;  3MAC A;  2Y48 B;  2YU2 A;  4DR6 T;  3ZCJ A;  5LJN A;  4YSZ A;  2M6B A;  4P09 A;  4OK0 A;  5JVD E;  4O8S A;  4PJJ A;  2WBL A;  3VKG A;  1XWM A;  2CHN A;  2IC9 A;  3TLS A;  2BBJ A;  1FMV A;  5BR8 T;  2BVL A;  2LM9 A;  4C90 A;  2LRK A;  4ZHQ E;  5JDL A;  4ILB A;  3NZQ A;  3AEE A;  3ONX A;  1UUS A;  4P0B A;  2XJ7 A;  4UVB B;  2XUE A;  2BKP A;  5LA6 E;  4OHF A;  3WAJ A;  1OED A;  2HPL A;  3OVU A;  4HWF A;  1M62 A;  1W0A A;  3P4P A;  1KEY A;  4YTP A;  2UXC T;  2DI4 A;  1KNP A;  2MTQ A;  4YSX A;  5EK4 A;  2KLQ A;  3AE6 A;  2V6X A;  3RF1 A;  2WB5 A;  4O2B E;  2OV9 A;  2FUP A;  5A1L A;  3NZP A;  3I0O A;  1Y01 A;  3V5S A;  2AE9 A;  2H3R A;  4IDO A;  2CLY C;  3RPU A;  4CI2 B;  3RIF A;  3SRZ A;  2HPJ A;  4BJM A;  3BQL A;  2E9X D;  2WAU A;  4IDP A;  3AA6 B;  2LOS A;  3UFE A;  3PUG A;  1YD8 G;  4UV9 B;  4IDN A;  4DND A;  2ACZ A;  4LFA T;  2VKD A;  4JBW F;  2BKN A;  5L2L A;  4AXP A;  3CQC B;  5KXJ A;  3U78 A;  4ANJ A;  4EXT A;  3EDU A;  2Q9Q A;  3ZMU B;  2MOZ A;  5AQF B;  1IJ5 A;  1SA0 E;  1UUR A;  3HL6 A;  3KV9 A;  2WCA A;  4BAY B;  2XQ7 A;  4GK5 E;  3UUM A;  3MXZ A;  2W62 A;  4HEA A;  3LFM A;  5AQJ B;  5HEO A;  3A7M A;  4JI8 T;  4DMV A;  3ZLI A;  5C3J A;  4FI5 A;  2PG8 A;  2WMO A;  3BQK A;  2D2S A;  4GK0 E;  4DR1 T;  4LFB T;  4BJN A;  1VRB A;  3RRC A;  4IDZ A;  4CN6 A;  5CB4 E;  5FY7 A;  4KI0 F;  1VCT A;  1NWM X;  4DR7 T;  5ABE A;  3N2O A;  2CXD A;  1MMN A;  4TX5 A;  3CX8 B;  5F5W A;  5JDG A;  4EZH A;  2LHN A;  4H63 H;  2XAH B;  4LF6 T;  2VAS A;  5GON E;  3I9Y A;  2V8S V;  2OA5 A;  5AQL B;  5L3C B;  3K3O A;  3KVA A;  5JRC B;  5EK3 A;  4IE6 A;  3ANW A;  2NWB A;  1T72 A;  3C4W A;  5FKY A;  3AEB A;  3EHZ A;  5KMG P;  1WCR A;  3M3Z B;  2KWI B;  3C98 B;  4O4L E;  3ABV A;  2QRX A;  3MKD A;  4U31 A;  4A56 A;  2C5J A;  5HXE A;  1JNR A;  4ZI7 E;  4O4I E;  2CEA A;  2C5K T;  5IUX A;  3TKL B;  2ODU A;  4AKR B;  4ISS A;  5IYZ E;  4JLE A;  4JI0 T;  2HN2 A;  2ODV A;  4NUU A;  4UVA B;  3B5M A;  4DVD A;  3ZT5 A;  1FEW A;  2L8K A;  3RLF F;  2W61 A;  5JTG A;  2V7J A;  2Z6E A;  3AA0 B;  3H37 A;  4PJM A;  3CWZ B;  3T1H T;  3GWH A;  1J1J A;  3S4U A;  4A98 A;  1LVK A;  2DWG A;  2IAK A;  4NXM T;  4AQY T;  5AQP B;  2JIW A;  4HFV A;  5FYM A;  4L5G A;  1HCI A;  4I43 B;  2V6Y B;  5LBQ B;  1SHZ C;  3LK3 B;  4KHZ F;  3RIA A;  3N9N A;  2WWV A;  4I50 E;  1WFD A;  3UTK A;  2LKH A;  1D1B A;  2LSK A;  2XSA A;  3K3Q C;  3P4S A;  3Q5X A;  1WYB A;  3NVO A;  4NPP A;  4PAG A;  3CVR A;  2ES0 A;  2V7L A;  3UUN A;  3GN5 A;  4YTM A;  4EGW A;  3P8C D;  4WYV A;  3F57 A;  1G73 A;  5J1G A;  3LBX B;  3K1S A;  4YXD A;  1OED E;  3IA3 A;  3AXJ A;  3ZYK A;  3AAA B;  3AE5 A;  5JRE A;  3AAE B;  3N9L A;  3VRB A;  4P0A A;  3GMI A;  1I6Z A;  2I59 A;  4ZXL A;  2CE7 A;  2K9A A;  3E0Z A;  2V7K A;  2WSS V;  5DQV A;  4B3M T;  4IL4 A;  3JC6 C;  4IE7 A;  4ERR A;  1ZOY A;  4HFE A;  3NRX A;  3T8O A;  2D0U A;  3J7Y q;  3KBU A;  2ZM0 A;  2E9X A;  1MIY A;  4J2C A;  5JR9 A;  2KZ7 B;  3PUS A;  5TAO A;  2LE8 A;  4L9I A;  4DR2 T;  3ZMS B;  3ZSS A;  2PBI A;  4ZI2 D;  3PJA A;  4L0R A;  4X1K E;  3ZYL A;  4UEL A;  3PV0 F;  5HWX A;  1DU2 A;  3FHN A;  5CJ5 A;  3PJA J;  3RQW A;  2X9X A;  1W9R A;  4I4T E;  2MPK A;  1MND A;  1XDO A;  4HN9 A;  5LP6 E;  3FZM B;  4FJO A;  2ACX A;  4PK6 A;  4TZ4 C;  4OFZ A;  2CLY B;  5FXZ A;  2H89 A;  2R6G F;  5L3B B;  4X66 T;  4XAX B;  2NR4 A;  2ZM8 A;  3Q2M A;  1YXR A;  4KP3 C;  1ZKE A;  5LGU B;  2EHO A;  5HEH A;  1N36 T;  2UXX B;  5FXX A; 
#chains in the Genus database with same CATH homology
 4DR5 T;  4JI6 T;  4B3M T;  4DV1 T;  3T1H T;  1HR0 T;  1IBK T;  4LF4 T;  4LF9 T;  1XMQ T;  2E5L T;  4LFC T;  4JI7 T;  1XMO T;  4B3S T;  4LF6 T;  4JI3 T;  5IWA T;  4NXM T;  4AQY T;  4JV5 T;  4JI1 T;  2UUC T;  2UUB T;  1XNR T;  4DR6 T;  4DV0 T;  1XNQ T;  1HNW T;  2F4V T;  1IBL T;  4X65 T;  4DR4 T;  4DR2 T;  4DV6 T;  4JI5 T;  5LMN T;  2VQF T;  1FJG T;  2UXB T;  4LFA T;  2ZM6 T;  4DV2 T;  5BR8 T;  3T1Y T;  4OX9 T;  4KHP T;  4LF5 T;  3OTO T;  4DV3 T;  4DV7 T;  4YHH T;  1N33 T;  4JYA T;  2HHH T;  2UXD T;  4B3R T;  4DV5 T;  2UUA T;  1HNX T;  4X62 T;  4X64 T;  1N34 T;  4DR3 T;  4LF8 T;  1I94 T;  4JI4 T;  1IBM T;  2VQE T;  4GKJ T;  4K0K T;  4B3T T;  4JI8 T;  4NXN T;  2UU9 T;  4DUZ T;  4JI0 T;  1N32 T;  4X66 T;  4DUY T;  4GKK T;  1HNZ T;  4LF7 T;  4DR1 T;  2UXC T;  4LFB T;  4JI2 T;  1J5E T;  4DV4 T;  4YY3 T;  1N36 T;  5LMU T;  4DR7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...