4B3ST

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4b3sT00
2UU9T 4JI6T 4DR6T 2UXBT 4DR1T 1N34T 4JI0T 2UUBT 4DR2T 4KHPT 4JI1T 1HNWT 5IWAT 3T1YT 4DR5T 2VQET 2UUAT 2HHHT 1N33T 5LMUT 2E5LT 1XNRT 4DV4T 4GKKT 1J5ET 4NXNT 4JI8T 4X66T 4X62T 4DV2T 4LF6T 4GKJT 3T1HT 3OTOT 1XNQT 4LF5T 4B3TT 2VQFT 4B3ST 4LF8T 1N36T 4YY3T 4LFAT 4LF9T 2UXDT 4JI2T 5BR8T 4B3RT 4NXMT 2UUCT 4DV1T 4X65T 2F4VT 1N32T 4OX9T 1XMOT 4DV3T 1IBMT 1XMQT 4DUYT 2ZM6T 4AQYT 4JV5T 1HNZT 4DR4T 4DV5T 4DV0T 1HNXT 4K0KT 1FJGT 4DUZT 4DR7T 4JI3T 1HR0T 4JYAT 4LF4T 5LMNT 4LFBT 4DV6T 4B3MT 4JI5T 4DV7T 4LFCT 4X64T 1IBKT 4YHHT 1I94T 4JI4T 2UXCT 4LF7T 4DR3T 1IBLT 4JI7T
chains in the Genus database with same CATH superfamily
3PJAA 2DLRA 5DJQC 3I0OA 2NW9A 2V6YA 2W66A 4I43B 4QH4A 5HEJA 2VKHA 3GA8A 3LDQB 2WP9A 4Z90A 3HL6A 4TUYE 2YOEA 1L0VA 3FZLB 3PU8A 4GK0E 3T1YT 2DCFA 2X0YA 3EABA 2VQET 3I1AA 3P4SA 5HEHA 5KXJA 2XAHB 3WAJA 2YU2A 3QNUA 3ZCIA 1WYBA 3CPZA 3B13A 4IDNA 4YSYA 3AE4A 2LKHA 5ABGA 2NTYA 3SRZA 3ZKRA 4LF8T 2BBJA 4YY3T 3MK7C 5JREA 2KSRA 4PAGA 2V7KA 4B3RT 3KV4A 2J47A 4U2YA 3CWZB 5HXHA 4H9SE 2XQYA 4YTPA 4UXNB 4A56A 4J2CA 2H88A 4UV9B 4QWNB 3E22E 4GIWA 4DR4T 2UXXB 4E7ZA 5FNVE 4DUZT 2XQ7A 4BJNA 2IDOB 4NIQA 5JVDE 3OKQA 4U2ZA 3ETVA 1D0XA 4DBQA 2LOPA 3RF1A 2Y48B 3O4XE 2ZM2A 2X9XA 4H9QC 3L09A 1E1HB 3AEDA 1LVKA 4OYJA 3UU6A 4YSXA 5HWYA 3AEAA 2X67A 2KMFA 5AQLB 4DVDA 5IYZE 1MIWA 4NXNT 3PTRB 3KINB 2VQFT 3SFEA 2DL1A 3AA7B 3RGLA 4AKLA 3UQ7A 3ETUA 3N9LA 2UUCT 3CIRA 2V7IA 2V5CA 3P7IA 5FVLA 3RYIE 3KV6A 3UUMA 3OPCA 2CWOA 3A5XA 5HEUA 2LM2A 3JCFA 3K8PC 4AISA 1WFDA 4HGAA 2W0GA 3RIAA 2R6GF 4K0KT 2CM0A 4UF0B 4ZI2D 5LGUB 3KBUA 3NKZA 3E0ZA 3ZJ1A 3ZCJA 2X0HA 4IE7A 2XSBA 5LG3A 4ERRA 4DV6T 4DV7T 4IE0A 1OXZA 2XQ4A 1MMDA 2V8SV 1UX4A 2VL0A 4QH5A 1KK7A 3DP7A 4V1Av 2E9XB 3RIUC 4O4LE 3I9WA 3UU8A 3RRWA 2MOZA 1VCSA 1QUUA 3CX7B 5HCMA 3JAFA 5H6QB 3UUNA 1MMNA 4C90A 3N2KE 3RHWA 4DV2T 2FJDA 3Q2MA 3P8CD 3VRBA 2JQQA 2M67A 4GYSA 2QRXA 2B76A 3C4XA 4QX8B 1ZOYA 5LBQB 2BZBA 2BS3A 1XMOT 1IAPA 2VL8A 4O4HE 2E8IA 3PUSA 3EHZA 4EZHA 4IE5A 1D1CA 2XQ3A 5JTGA 2CA5A 1D0ZA 4LMJA 4ILBA 4FI5A 5AQHB 4GOUA 1KFYA 2QVAA 4ZZBA 4DR7T 5FMNA 2W4XA 4ISTA 2BBHA 3ESLA 2ZMAA 2MPKA 3EI0A 4CN4A 2QA7A 3AA1B 3RI5A 3ANWB 4ASKA 3C4ZA 2W67A 3OBVE 1X9BA 2V7LA 4WBOA 5L3GB 4DR1T 3X1DA 4IE4A 2IW5B 4U31A 2XQ9A 1G8XA 1JNRA 1VOMA 4TV9E 2QYWA 1HF8A 2LM9A 2CXFA 5IHYA 3KBTA 5CJ5A 3OVUA 2FJBA 1SHZC 4UVCB 2BKNA 3HKEE 1S94A 1W0AA 3AE3A 3MJXA 2YDSA 1WRDA 5LOVE 1O3XA 1M62A 4NUVA 4AQFC 2ZLYA 2MTQA 3AEFA 3AEGA 3LSVA 3PUZF 3EDUA 5F5WA 4A5XA 3V5SA 2H7OA 2XY8B 3RH3A 4HKAA 4ANJA 3Q5EA 2XHEB 5KMGP 4Z8XA 1AJ3A 3ONLC 2XAGB 3AE6A 3N2GE 2XUEA 4EIWA 2SPCA 2OV9A 4OHFA 3AE7A 4JI5T 4I4TE 2X66A 2MAWA 4CXWA 4A97A 1IBKT 4ZI7E 3F31A 3G06A 2V5DA 1W9RA 2FUPA 4K0UA 4OYKA 3B57A 3VRAA 3Q9DA 5LBMA 2ODVA 2YEVC 3BK9A 3FZHB 2I6HA 5LP6E 2CMRA 4IDQA 4YLHA 3QC9A 3ZC1A 3Q5XA 3HKBE 4PFOA 1KNZA 4X20E 4JLEA 4TWHA 1N33T 2XAQB 3AE8A 3IEEA 4ZHQE 4I55E 4KMCA 5AQPB 4TWFA 2AXDS 5E0OA 4UELA 5HWXA 1XNQT 4OFZA 4IGUA 2KXPB 2K48A 5L2LA 3ZJ2A 3RIUA 3DTOA 4OX9T 5HXRA 5DQVA 2CLYB 5LJNA 4H9OC 5LG4A 1HX1B 3LBXB 1HCIA 1MNDA 1ZV4X 2CHOA 2X0LB 4PJJA 1NAFA 5LHIB 1GQEA 4Z91A 4ZEYA 4XBFB 4UF0A 5ABFA 5LJMA 4HWIB 3FZMB 2V26A 1I94T 4JI4T 5HXCA 4PK6A 4MHCA 5FXZA 5AFUL 2UXBT 4G2AA 2RP4A 4KX6A 3LJCA 4DNDA 2VURA 4U72A 4MALA 2D0UA 5JR9B 5L3EB 2DHRA 4IDZA 2V7MA 4QX7B 2CLYC 3VHLA 2WZHA 4IT4A 4PJLA 4JI8T 2CRBA 3BQLA 4HE8A 4IL9A 3K1SA 4KP3C 2XTLA 3HKCE 2YKSA 4H9RC 4U74A 2CHNA 5L4EA 3D0TA 4DMWA 3CQCB 1YQ4A 3ZT7A 4EGWA 2CCQA 3NZQA 1FJGT 4GYRA 1HG5A 2LKGA 4QHOA 1Z8UA 2FJAA 2N2NA 1T7SA 2WMOA 4ZZCA 3JADA 5JDLA 4EEDA 4AQFA 2MBGA 5JR9C 1X79A 2NOXA 3VU7H 4LFCT 4ZI3C 4X64T 2XASB 1LKXA 2WBLA 1WYCA 2PBIA 3ANWA 4ADZA 1IZNB 3AXJB 3H37A 3HI2A 3U3IA 1IJ6A 4HFIA 2XPKA 4DIDB 1T8BA 3CK6A 5AQUB 3ZT6A 2BKOA 5LGTB 5C8YE 3UU5A 4QKNA 2LE8A 3ZMUB 3UUBA 1OEDB 3ZSSA 4UVBB 5AQJB 4DV4T 4ISSA 5AQNB 2WM9A 4LF6T 4GKJT 2X9HA 3CQGB 4NUUA 3T1HT 4CI1B 5FL1A 2YDQA 3TLUA 5AQGB 4UEMA 3BQIA 2DNXA 2PFVA 5EK3A 3AAIA 4WNKA 5HAXA 3N9OA 2BS2A 3KDSE 1YKEB 1FEWA 1N32T 3EUHA 1I6ZA 1YQ3A 5FYMA 2BKPA 3ZMVB 1NEKA 1SA0E 2P9BA 2ZM6T 2VKOA 3FBLA 4PJMA 4CXYA 3BQKA 4DV5T 2LSIA 4P09A 4DV0T 5FXVA 4ILCA 4KBMB 4L0RA 5EZYE 5HEOA 4WW0A 2W2UA 4YFSA 4JYAT 3QB5A 4KI0F 2YK0A 3FB2A 2WWVA 2W63A 4L5GA 3MXZA 5L3DB 5FKYA 2L8KA 5JRCB 2C5KT 1OEDC 3AA0B 4NPPA 4YHHT 2KNDA 1UK5A 2XQAA 4ZOLE 2M6BA 2HPJA 2VWAA 3KVAA 5ABFB 4H63V 3AEEA 3H3AA 5HYAA 1YKHB 2LSGA 3MZKB 3LFMA 1N34T 4UV8B 2X51A 2JQ9A 5GONE 2J1DG 5HEGA 3CKDA 2BS4A 4UIGA 4ZXLA 1NENA 3UU4A 2ACXA 3AE5A 4DO0A 4CN1A 4AKRB 4X1YE 1LRZA 3KV5A 3NRXA 5JDNA 3L39A 2KWHA 4X62T 3Q5DA 4AKHA 3CVRA 3LK3B 2FBWA 3PUAA 4MFRA 3L3PA 2XSAA 4JUYA 4X5TA 3FBZA 3P4PA 4JI2T 4BA9A 2I0MA 3C51A 2NR4A 2BVMA 5H6RB 3U78A 3SOLA 5L3FB 5AQFB 2YINA 2WSSV 5L4HA 2DWGA 5TAOA 1BR1A 3ZMZB 5EK4A 4ZS2A 2N1GA 4WYVA 2VB6A 3C4WA 3TLSA 3LBXA 1UURA 5CFBA 4TN7B 3O9XA 3RYCE 4LMKA 4ZI3D 2A72A 1KF6A 2L3LA 2NP9A 5JDFA 2RPAA 4B3MT 5AQQB 5JDMA 2KT9A 5AQKB 3OYZA 3RKGA 4LF7T 2HN1A 2X68A 4DR3T 2WS3A 2V6XA 2ACZA 2KLQA 2JQHA 1T72A 2GK9A 5FXXA 1HS7A 1BR4A 4CQIA 4JI1T 1HNWT 1W0BA 1V9DA 2N9DA 4EV6A 5JR9A 4AIUA 1R8IA 2KINB 3PURA 4HWHA 3ZC0A 3OJAA 3RYHE 3K3QC 4UVAB 4B3ST 4AXPA 4LF9T 3PUQA 5LXTE 4NXMT 3JAEA 3ZEFB 2OA5A 1NWMX 2JMKA 1S35A 1YW0A 3IA3A 4WZXA 2CXDA 1OWAA 4CXXA 3K3NA 3QOFA 2V1DB 3J9X1 3RC3A 3RLFF 4HFEA 4JBWF 3IF8B 2KZ7B 3C98B 2Q9QD 5ADXL 3ZPOA 5C3JA 3HA4A 3P4QA 3RYFE 3KV9A 2UXCT 3J7Yq 1IBLT 4JI7T 3JC6C 2C0SA 2JQKA 5F3JA 3VR9A 2IMLA 3AXJA 3AAEB 2LRKA 4HTEA 3Q5WA 2UUAT 2B1EA 3W15B 4HEAA 4O4JE 1G73A 2WDQA 2PJQA 2E5LT 2CXLA 2X9WA 2K5BB 4H9NC 3EDVA 2W62A 4P1NA 1OEDA 4EEBA 2HN2A 3PV0F 1MIYA 4PW8A 3S4UA 5AQRB 1WR0A 1ZP0A 4GK5E 2BG9B 3ZYLA 2UXNB 4MLKA 4DV3T 1Y01A 3AECA 2JJ9A 4COFA 1J5WA 4JV5T 4YTNA 2J4GA 4HFVA 1HNXT 3EAMA 4HWDA 1QSDA 2CE7A 3M3ZB 2WAUA 1WLXA 2WMNA 2LLYA 2VVNA 4A98A 4HWFA 2A2FX 2WZIA 3WI3A 5IUXA 4QH1A 1UGOA 4O8SA 5JRCA 5FY0A 2M6IA 2CBIA 3TKLB 5L3BB 4E7SA 2CWYA 4X1IE 1YXRA 2Y8DA 5LHHB 2D5UA 2D9DA 2BG9C 1WR6A 4U7YA 4AI6A 3H3MA 2WWUA 2HHHT 4AKIA 4I0UA 4B6XA 2IIUA 4IDPA 3GWHA 2K9AA 4EZ4A 4LMLA 1D1BA 3HR0A 2EHOB 2I59A 3ZSTA 4G63A 1US7B 5AQSB 3P4WA 3AVRA 2X9YA 5AQMB 3NVOA 4IIJE 2FJEA 3UULA 2LT3A 2LHRA 3OYXA 1IBMT 5AQOB 3ZLIA 2RA1A 5M4YA 4PK5A 2D0TA 3PUYF 5HXSA 1UX5A 2JPFA 3UU3A 1VRBA 3FXEB 4TNWA 2LEHA 2YN6A 3F57A 2WQYA 3PJAJ 4IDOA 2WU2A 4LFBT 4C91A 4KUMB 2XM2A 2YDRA 3JC6D 4QXCB 3E08A 4YT0A 4YTMA 3ZYMA 4QXHB 1ZHCA 2EHOC 5LA6E 1XZYA 5AQIB 5IWAT 3PU3A 1MNEA 3MKDA 4YHJA 2XZEA 2H3RA 1MMAA 1XNRT 1HFAA 3ZYKA 3LK2B 1J5ET 5FVKA 4Q25A 4F8HA 5J1GA 5HXEA 1N36T 3T8OA 4DBRA 4TNVA 3UFGA 2D2SA 2OLTA 1CUNA 2ZM0A 2Q9QB 4EOZB 3QK6A 3ABVA 1XMQT 4EYUA 4AQYT 3MACA 1FMWA 1E7PA 3M65A 4FJOA 2PG8A 5LB7B 4EB6E 5BMVE 2JRKA 2Z6EA 2L9QA 2W61A 2K3WA 3AA6B 2ODUA 1XDPA 4H63H 3V5UA 5LCYA 2XQ5A 4U7IA 2BG9E 2VVSA 4WBNE 4EXTA 2AE9A 2WCAA 3GN5B 3N9PA 3UQ4A 2UU9T 5FL0A 3R6NA 4JI6T 2J62A 2WDVA 4U33A 2NW8A 3UTKA 4CZZB 1ZEEA 4AQGA 4JI0T 1HX8A 4M1PA 1U4QA 4KHPT 4IHJE 4YSZA 3RX6A 5ETWA 3A8YC 1FMVA 2DI4A 2Q9QC 5LMUT 5FY7A 3NZPA 5FXWA 1IJ5A 2IAKA 2LSJA 1B7TA 2VASA 1MMGA 4O4IE 1DU2A 1ZKEA 2LRLA 4U3CA 2LSKA 5J0ZA 3O1JA 4P0AA 3NRYA 4LFAT 3LK42 3NBXX 1JNZA 2F4VT 3PDYA 5CA0E 3VKHA 4YJ3E 2BG9A 2VKDA 4TX5A 1KEYA 4DUYT 4CI2B 2XQ6A 3NWIA 4TWDA 1XDOA 3AVSA 3P50A 2A3DA 3ZT5A 3I9YA 2WU5A 5AQTB 1VCTA 3AEBA 2CPTA 3HKDE 1W09A 5HCJA 5EK2A 2V6YB 3WAKA 3CX8B 2EHOD 4DR6T 2G0UA 3AE2A 2IC9A 3AB3B 3PUXF 3AE1A 4DR2T 3RC8A 5ABHA 2LSYA 3DJBA 3MA9A 2XAJB 5JDQA 4DR5T 4YJ2E 4PNIA 4P0BA 1BR2A 5KDMC 4EAHA 4GKKT 5CGMA 1Z0PA 1QLBA 3SS1A 5L47A 4LF5T 4B3TT 3TLVA 4HFBA 2XJ7A 1FIOA 1UUSA 2HPLA 1EZ3A 2E9XC 3FHNA 3K3OA 5JQGE 2JIWA 5DABA 2EHOA 3UUXB 1KNPA 3L8RA 2QGSA 4HN9A 2H7VC 3SFDA 1XWMA 4F6RC 3O1IA 4IL4A 2C5IT 5C2TA 2DWKA 4H9PC 3CX6B 3C64A 1D1AA 2IHR1 3RPUA 3C50A 4I50E 1J1JA 2V7JA 5A1LA 5LMNT 1BR0A 3N9QA 3O1HA 3UFEA 1CHUA 1OEDE 3PE0A 5ABEA 3R84B 4ZS3A 3N9NA 5CB4E 4EYYR 4HFDA 3TLTA 2ZM8A 2A9UA 2VK9A 5FP3A 4BJMA 2K24A 4L9IA 1LVFA 3AE9A 4YXDA 3I0QA 4ILAA 3P4RA 3CQXC 5L3CB 5JH7E 1E2AA 1Y64B 3N9MA 3PUGA 2BVLA 5JDGA 3LG7A 4XZCA 3ZMSB 3A7MA 2E2AA 5BR8T 1SE7A 3ZMTB 4DV1T 4X65T 1HG2A 4HFCA 4UR9A 2NWBA 3KFWX 3ONXA 5LYJE 2Q9QA 2H89A 3IHRA 4IREA 4PFPA 4JI3T 2PTFA 2WB5A 4KHZF 1HR0T 4HWCA 2CBJA 3FZFB 3ZN0B 1KNRA 3PUWF 2BDEA 4QXBB 4XAXB 3RIFA 3F2EA 1SUMB 5CA1E 5JDHA 5DQWA 5J2UE 3QUJA 4AKGA 2HH7A 4CI3B 3FXDB 2Y6XA 3GN5A 4N78D 5J2TE 2NTXA 4PK4A 3UT5E 3KVBA 2UUBT 3ZN1B 4HFHA 2XQ8A 3CMLA 1U5PA 3FZKB 5LNKA 1HTJF 2LJLA 2C5JA 2ES0A 2XM1A 4PJNA 4JEHB 1T98A 2IC6A 3RKOA 4X66T 2E9XD 4JEUB 3IBPA 3GMIA 3OTOT 2WDRA 4MBQA 4O2AE 1MIVA 5KX5E 4DMVA 5LGNB 2UXDT 3QB5K 3B5MA 4CN6A 3PUVF 4BAYB 5AQVB 3RQWA 2XAFB 5F8PA 2JMHA 4X1KE 4IE6A 3VR8A 2YU1A 1H7CA 2E5VA 1YD8G 3TLWA 2NW7A 4TZ4C 1HNZT 2CEAA 2MYSA 4TV8E 3RQUA 2VKJA 3ONJA 2WY2A 1WCRA 2LOSA 4ILUA 2IUBA 4LF4T 4ZI2C 3SWHA 2LHNA 2W00A 3EVYA 3VKGA 5LHGB 2E9XA 2KWIB 3AAAB 3RRCA 5FY1A 1D0YA 4OK0A 1M7KA 1UCUA 3N2OA 4O2BE 3N5LA
chains in the Genus database with same CATH topology
2UU9T 4JI6T 4DR6T 2UXBT 4DR1T 1N34T 4JI0T 2UUBT 4DR2T 4KHPT 4JI1T 1HNWT 5IWAT 3T1YT 4DR5T 2VQET 2UUAT 2HHHT 1N33T 5LMUT 2E5LT 1XNRT 4DV4T 4GKKT 1J5ET 4NXNT 4JI8T 4X66T 4X62T 4DV2T 4LF6T 4GKJT 3T1HT 3OTOT 1XNQT 4LF5T 4B3TT 2VQFT 4B3ST 4LF8T 1N36T 4YY3T 4LFAT 4LF9T 2UXDT 4JI2T 5BR8T 4B3RT 4NXMT 2UUCT 4DV1T 4X65T 2F4VT 1N32T 4OX9T 1XMOT 4DV3T 1IBMT 1XMQT 4DUYT 2ZM6T 4AQYT 4JV5T 1HNZT 4DR4T 4DV5T 4DV0T 1HNXT 4K0KT 1FJGT 4DUZT 4DR7T 4JI3T 1HR0T 4JYAT 4LF4T 5LMNT 4LFBT 4DV6T 4B3MT 4JI5T 4DV7T 4LFCT 4X64T 1IBKT 4YHHT 1I94T 4JI4T 2UXCT 4LF7T 4DR3T 1IBLT 4JI7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 T;  4JI6 T;  4DR6 T;  2UXB T;  4DR1 T;  1N34 T;  4JI0 T;  2UUB T;  4DR2 T;  4KHP T;  4JI1 T;  1HNW T;  5IWA T;  3T1Y T;  4DR5 T;  2VQE T;  2UUA T;  2HHH T;  1N33 T;  5LMU T;  2E5L T;  1XNR T;  4DV4 T;  4GKK T;  1J5E T;  4NXN T;  4JI8 T;  4X66 T;  4X62 T;  4DV2 T;  4LF6 T;  4GKJ T;  3T1H T;  3OTO T;  1XNQ T;  4LF5 T;  4B3T T;  2VQF T;  4B3S T;  4LF8 T;  1N36 T;  4YY3 T;  4LFA T;  4LF9 T;  2UXD T;  4JI2 T;  5BR8 T;  4B3R T;  4NXM T;  2UUC T;  4DV1 T;  4X65 T;  2F4V T;  1N32 T;  4OX9 T;  1XMO T;  4DV3 T;  1IBM T;  1XMQ T;  4DUY T;  2ZM6 T;  4AQY T;  4JV5 T;  1HNZ T;  4DR4 T;  4DV5 T;  4DV0 T;  1HNX T;  4K0K T;  1FJG T;  4DUZ T;  4DR7 T;  4JI3 T;  1HR0 T;  4JYA T;  4LF4 T;  5LMN T;  4LFB T;  4DV6 T;  4B3M T;  4JI5 T;  4DV7 T;  4LFC T;  4X64 T;  1IBK T;  4YHH T;  1I94 T;  4JI4 T;  2UXC T;  4LF7 T;  4DR3 T;  1IBL T;  4JI7 T; 
#chains in the Genus database with same CATH topology
 3PJA A;  2DLR A;  5DJQ C;  3I0O A;  2NW9 A;  2V6Y A;  2W66 A;  4I43 B;  4QH4 A;  5HEJ A;  2VKH A;  3GA8 A;  3LDQ B;  2WP9 A;  4Z90 A;  3HL6 A;  4TUY E;  2YOE A;  1L0V A;  3FZL B;  3PU8 A;  4GK0 E;  3T1Y T;  2DCF A;  2X0Y A;  3EAB A;  2VQE T;  3I1A A;  3P4S A;  5HEH A;  5KXJ A;  2XAH B;  3WAJ A;  2YU2 A;  3QNU A;  3ZCI A;  1WYB A;  3CPZ A;  3B13 A;  4IDN A;  4YSY A;  3AE4 A;  2LKH A;  5ABG A;  2NTY A;  3SRZ A;  3ZKR A;  4LF8 T;  2BBJ A;  4YY3 T;  3MK7 C;  5JRE A;  2KSR A;  4PAG A;  2V7K A;  4B3R T;  3KV4 A;  2J47 A;  4U2Y A;  3CWZ B;  5HXH A;  4H9S E;  2XQY A;  4YTP A;  4UXN B;  4A56 A;  4J2C A;  2H88 A;  4UV9 B;  4QWN B;  3E22 E;  4GIW A;  4DR4 T;  2UXX B;  4E7Z A;  5FNV E;  4DUZ T;  2XQ7 A;  4BJN A;  2IDO B;  4NIQ A;  5JVD E;  3OKQ A;  4U2Z A;  3ETV A;  1D0X A;  4DBQ A;  2LOP A;  3RF1 A;  2Y48 B;  3O4X E;  2ZM2 A;  2X9X A;  4H9Q C;  3L09 A;  1E1H B;  3AED A;  1LVK A;  4OYJ A;  3UU6 A;  4YSX A;  5HWY A;  3AEA A;  2X67 A;  2KMF A;  5AQL B;  4DVD A;  5IYZ E;  1MIW A;  4NXN T;  3PTR B;  3KIN B;  2VQF T;  3SFE A;  2DL1 A;  3AA7 B;  3RGL A;  4AKL A;  3UQ7 A;  3ETU A;  3N9L A;  2UUC T;  3CIR A;  2V7I A;  2V5C A;  3P7I A;  5FVL A;  3RYI E;  3KV6 A;  3UUM A;  3OPC A;  2CWO A;  3A5X A;  5HEU A;  2LM2 A;  3JCF A;  3K8P C;  4AIS A;  1WFD A;  4HGA A;  2W0G A;  3RIA A;  2R6G F;  4K0K T;  2CM0 A;  4UF0 B;  4ZI2 D;  5LGU B;  3KBU A;  3NKZ A;  3E0Z A;  3ZJ1 A;  3ZCJ A;  2X0H A;  4IE7 A;  2XSB A;  5LG3 A;  4ERR A;  4DV6 T;  4DV7 T;  4IE0 A;  1OXZ A;  2XQ4 A;  1MMD A;  2V8S V;  1UX4 A;  2VL0 A;  4QH5 A;  1KK7 A;  3DP7 A;  4V1A v;  2E9X B;  3RIU C;  4O4L E;  3I9W A;  3UU8 A;  3RRW A;  2MOZ A;  1VCS A;  1QUU A;  3CX7 B;  5HCM A;  3JAF A;  5H6Q B;  3UUN A;  1MMN A;  4C90 A;  3N2K E;  3RHW A;  4DV2 T;  2FJD A;  3Q2M A;  3P8C D;  3VRB A;  2JQQ A;  2M67 A;  4GYS A;  2QRX A;  2B76 A;  3C4X A;  4QX8 B;  1ZOY A;  5LBQ B;  2BZB A;  2BS3 A;  1XMO T;  1IAP A;  2VL8 A;  4O4H E;  2E8I A;  3PUS A;  3EHZ A;  4EZH A;  4IE5 A;  1D1C A;  2XQ3 A;  5JTG A;  2CA5 A;  1D0Z A;  4LMJ A;  4ILB A;  4FI5 A;  5AQH B;  4GOU A;  1KFY A;  2QVA A;  4ZZB A;  4DR7 T;  5FMN A;  2W4X A;  4IST A;  2BBH A;  3ESL A;  2ZMA A;  2MPK A;  3EI0 A;  4CN4 A;  2QA7 A;  3AA1 B;  3RI5 A;  3ANW B;  4ASK A;  3C4Z A;  2W67 A;  3OBV E;  1X9B A;  2V7L A;  4WBO A;  5L3G B;  4DR1 T;  3X1D A;  4IE4 A;  2IW5 B;  4U31 A;  2XQ9 A;  1G8X A;  1JNR A;  1VOM A;  4TV9 E;  2QYW A;  1HF8 A;  2LM9 A;  2CXF A;  5IHY A;  3KBT A;  5CJ5 A;  3OVU A;  2FJB A;  1SHZ C;  4UVC B;  2BKN A;  3HKE E;  1S94 A;  1W0A A;  3AE3 A;  3MJX A;  2YDS A;  1WRD A;  5LOV E;  1O3X A;  1M62 A;  4NUV A;  4AQF C;  2ZLY A;  2MTQ A;  3AEF A;  3AEG A;  3LSV A;  3PUZ F;  3EDU A;  5F5W A;  4A5X A;  3V5S A;  2H7O A;  2XY8 B;  3RH3 A;  4HKA A;  4ANJ A;  3Q5E A;  2XHE B;  5KMG P;  4Z8X A;  1AJ3 A;  3ONL C;  2XAG B;  3AE6 A;  3N2G E;  2XUE A;  4EIW A;  2SPC A;  2OV9 A;  4OHF A;  3AE7 A;  4JI5 T;  4I4T E;  2X66 A;  2MAW A;  4CXW A;  4A97 A;  1IBK T;  4ZI7 E;  3F31 A;  3G06 A;  2V5D A;  1W9R A;  2FUP A;  4K0U A;  4OYK A;  3B57 A;  3VRA A;  3Q9D A;  5LBM A;  2ODV A;  2YEV C;  3BK9 A;  3FZH B;  2I6H A;  5LP6 E;  2CMR A;  4IDQ A;  4YLH A;  3QC9 A;  3ZC1 A;  3Q5X A;  3HKB E;  4PFO A;  1KNZ A;  4X20 E;  4JLE A;  4TWH A;  1N33 T;  2XAQ B;  3AE8 A;  3IEE A;  4ZHQ E;  4I55 E;  4KMC A;  5AQP B;  4TWF A;  2AXD S;  5E0O A;  4UEL A;  5HWX A;  1XNQ T;  4OFZ A;  4IGU A;  2KXP B;  2K48 A;  5L2L A;  3ZJ2 A;  3RIU A;  3DTO A;  4OX9 T;  5HXR A;  5DQV A;  2CLY B;  5LJN A;  4H9O C;  5LG4 A;  1HX1 B;  3LBX B;  1HCI A;  1MND A;  1ZV4 X;  2CHO A;  2X0L B;  4PJJ A;  1NAF A;  5LHI B;  1GQE A;  4Z91 A;  4ZEY A;  4XBF B;  4UF0 A;  5ABF A;  5LJM A;  4HWI B;  3FZM B;  2V26 A;  1I94 T;  4JI4 T;  5HXC A;  4PK6 A;  4MHC A;  5FXZ A;  5AFU L;  2UXB T;  4G2A A;  2RP4 A;  4KX6 A;  3LJC A;  4DND A;  2VUR A;  4U72 A;  4MAL A;  2D0U A;  5JR9 B;  5L3E B;  2DHR A;  4IDZ A;  2V7M A;  4QX7 B;  2CLY C;  3VHL A;  2WZH A;  4IT4 A;  4PJL A;  4JI8 T;  2CRB A;  3BQL A;  4HE8 A;  4IL9 A;  3K1S A;  4KP3 C;  2XTL A;  3HKC E;  2YKS A;  4H9R C;  4U74 A;  2CHN A;  5L4E A;  3D0T A;  4DMW A;  3CQC B;  1YQ4 A;  3ZT7 A;  4EGW A;  2CCQ A;  3NZQ A;  1FJG T;  4GYR A;  1HG5 A;  2LKG A;  4QHO A;  1Z8U A;  2FJA A;  2N2N A;  1T7S A;  2WMO A;  4ZZC A;  3JAD A;  5JDL A;  4EED A;  4AQF A;  2MBG A;  5JR9 C;  1X79 A;  2NOX A;  3VU7 H;  4LFC T;  4ZI3 C;  4X64 T;  2XAS B;  1LKX A;  2WBL A;  1WYC A;  2PBI A;  3ANW A;  4ADZ A;  1IZN B;  3AXJ B;  3H37 A;  3HI2 A;  3U3I A;  1IJ6 A;  4HFI A;  2XPK A;  4DID B;  1T8B A;  3CK6 A;  5AQU B;  3ZT6 A;  2BKO A;  5LGT B;  5C8Y E;  3UU5 A;  4QKN A;  2LE8 A;  3ZMU B;  3UUB A;  1OED B;  3ZSS A;  4UVB B;  5AQJ B;  4DV4 T;  4ISS A;  5AQN B;  2WM9 A;  4LF6 T;  4GKJ T;  2X9H A;  3CQG B;  4NUU A;  3T1H T;  4CI1 B;  5FL1 A;  2YDQ A;  3TLU A;  5AQG B;  4UEM A;  3BQI A;  2DNX A;  2PFV A;  5EK3 A;  3AAI A;  4WNK A;  5HAX A;  3N9O A;  2BS2 A;  3KDS E;  1YKE B;  1FEW A;  1N32 T;  3EUH A;  1I6Z A;  1YQ3 A;  5FYM A;  2BKP A;  3ZMV B;  1NEK A;  1SA0 E;  2P9B A;  2ZM6 T;  2VKO A;  3FBL A;  4PJM A;  4CXY A;  3BQK A;  4DV5 T;  2LSI A;  4P09 A;  4DV0 T;  5FXV A;  4ILC A;  4KBM B;  4L0R A;  5EZY E;  5HEO A;  4WW0 A;  2W2U A;  4YFS A;  4JYA T;  3QB5 A;  4KI0 F;  2YK0 A;  3FB2 A;  2WWV A;  2W63 A;  4L5G A;  3MXZ A;  5L3D B;  5FKY A;  2L8K A;  5JRC B;  2C5K T;  1OED C;  3AA0 B;  4NPP A;  4YHH T;  2KND A;  1UK5 A;  2XQA A;  4ZOL E;  2M6B A;  2HPJ A;  2VWA A;  3KVA A;  5ABF B;  4H63 V;  3AEE A;  3H3A A;  5HYA A;  1YKH B;  2LSG A;  3MZK B;  3LFM A;  1N34 T;  4UV8 B;  2X51 A;  2JQ9 A;  5GON E;  2J1D G;  5HEG A;  3CKD A;  2BS4 A;  4UIG A;  4ZXL A;  1NEN A;  3UU4 A;  2ACX A;  3AE5 A;  4DO0 A;  4CN1 A;  4AKR B;  4X1Y E;  1LRZ A;  3KV5 A;  3NRX A;  5JDN A;  3L39 A;  2KWH A;  4X62 T;  3Q5D A;  4AKH A;  3CVR A;  3LK3 B;  2FBW A;  3PUA A;  4MFR A;  3L3P A;  2XSA A;  4JUY A;  4X5T A;  3FBZ A;  3P4P A;  4JI2 T;  4BA9 A;  2I0M A;  3C51 A;  2NR4 A;  2BVM A;  5H6R B;  3U78 A;  3SOL A;  5L3F B;  5AQF B;  2YIN A;  2WSS V;  5L4H A;  2DWG A;  5TAO A;  1BR1 A;  3ZMZ B;  5EK4 A;  4ZS2 A;  2N1G A;  4WYV A;  2VB6 A;  3C4W A;  3TLS A;  3LBX A;  1UUR A;  5CFB A;  4TN7 B;  3O9X A;  3RYC E;  4LMK A;  4ZI3 D;  2A72 A;  1KF6 A;  2L3L A;  2NP9 A;  5JDF A;  2RPA A;  4B3M T;  5AQQ B;  5JDM A;  2KT9 A;  5AQK B;  3OYZ A;  3RKG A;  4LF7 T;  2HN1 A;  2X68 A;  4DR3 T;  2WS3 A;  2V6X A;  2ACZ A;  2KLQ A;  2JQH A;  1T72 A;  2GK9 A;  5FXX A;  1HS7 A;  1BR4 A;  4CQI A;  4JI1 T;  1HNW T;  1W0B A;  1V9D A;  2N9D A;  4EV6 A;  5JR9 A;  4AIU A;  1R8I A;  2KIN B;  3PUR A;  4HWH A;  3ZC0 A;  3OJA A;  3RYH E;  3K3Q C;  4UVA B;  4B3S T;  4AXP A;  4LF9 T;  3PUQ A;  5LXT E;  4NXM T;  3JAE A;  3ZEF B;  2OA5 A;  1NWM X;  2JMK A;  1S35 A;  1YW0 A;  3IA3 A;  4WZX A;  2CXD A;  1OWA A;  4CXX A;  3K3N A;  3QOF A;  2V1D B;  3J9X 1;  3RC3 A;  3RLF F;  4HFE A;  4JBW F;  3IF8 B;  2KZ7 B;  3C98 B;  2Q9Q D;  5ADX L;  3ZPO A;  5C3J A;  3HA4 A;  3P4Q A;  3RYF E;  3KV9 A;  2UXC T;  3J7Y q;  1IBL T;  4JI7 T;  3JC6 C;  2C0S A;  2JQK A;  5F3J A;  3VR9 A;  2IML A;  3AXJ A;  3AAE B;  2LRK A;  4HTE A;  3Q5W A;  2UUA T;  2B1E A;  3W15 B;  4HEA A;  4O4J E;  1G73 A;  2WDQ A;  2PJQ A;  2E5L T;  2CXL A;  2X9W A;  2K5B B;  4H9N C;  3EDV A;  2W62 A;  4P1N A;  1OED A;  4EEB A;  2HN2 A;  3PV0 F;  1MIY A;  4PW8 A;  3S4U A;  5AQR B;  1WR0 A;  1ZP0 A;  4GK5 E;  2BG9 B;  3ZYL A;  2UXN B;  4MLK A;  4DV3 T;  1Y01 A;  3AEC A;  2JJ9 A;  4COF A;  1J5W A;  4JV5 T;  4YTN A;  2J4G A;  4HFV A;  1HNX T;  3EAM A;  4HWD A;  1QSD A;  2CE7 A;  3M3Z B;  2WAU A;  1WLX A;  2WMN A;  2LLY A;  2VVN A;  4A98 A;  4HWF A;  2A2F X;  2WZI A;  3WI3 A;  5IUX A;  4QH1 A;  1UGO A;  4O8S A;  5JRC A;  5FY0 A;  2M6I A;  2CBI A;  3TKL B;  5L3B B;  4E7S A;  2CWY A;  4X1I E;  1YXR A;  2Y8D A;  5LHH B;  2D5U A;  2D9D A;  2BG9 C;  1WR6 A;  4U7Y A;  4AI6 A;  3H3M A;  2WWU A;  2HHH T;  4AKI A;  4I0U A;  4B6X A;  2IIU A;  4IDP A;  3GWH A;  2K9A A;  4EZ4 A;  4LML A;  1D1B A;  3HR0 A;  2EHO B;  2I59 A;  3ZST A;  4G63 A;  1US7 B;  5AQS B;  3P4W A;  3AVR A;  2X9Y A;  5AQM B;  3NVO A;  4IIJ E;  2FJE A;  3UUL A;  2LT3 A;  2LHR A;  3OYX A;  1IBM T;  5AQO B;  3ZLI A;  2RA1 A;  5M4Y A;  4PK5 A;  2D0T A;  3PUY F;  5HXS A;  1UX5 A;  2JPF A;  3UU3 A;  1VRB A;  3FXE B;  4TNW A;  2LEH A;  2YN6 A;  3F57 A;  2WQY A;  3PJA J;  4IDO A;  2WU2 A;  4LFB T;  4C91 A;  4KUM B;  2XM2 A;  2YDR A;  3JC6 D;  4QXC B;  3E08 A;  4YT0 A;  4YTM A;  3ZYM A;  4QXH B;  1ZHC A;  2EHO C;  5LA6 E;  1XZY A;  5AQI B;  5IWA T;  3PU3 A;  1MNE A;  3MKD A;  4YHJ A;  2XZE A;  2H3R A;  1MMA A;  1XNR T;  1HFA A;  3ZYK A;  3LK2 B;  1J5E T;  5FVK A;  4Q25 A;  4F8H A;  5J1G A;  5HXE A;  1N36 T;  3T8O A;  4DBR A;  4TNV A;  3UFG A;  2D2S A;  2OLT A;  1CUN A;  2ZM0 A;  2Q9Q B;  4EOZ B;  3QK6 A;  3ABV A;  1XMQ T;  4EYU A;  4AQY T;  3MAC A;  1FMW A;  1E7P A;  3M65 A;  4FJO A;  2PG8 A;  5LB7 B;  4EB6 E;  5BMV E;  2JRK A;  2Z6E A;  2L9Q A;  2W61 A;  2K3W A;  3AA6 B;  2ODU A;  1XDP A;  4H63 H;  3V5U A;  5LCY A;  2XQ5 A;  4U7I A;  2BG9 E;  2VVS A;  4WBN E;  4EXT A;  2AE9 A;  2WCA A;  3GN5 B;  3N9P A;  3UQ4 A;  2UU9 T;  5FL0 A;  3R6N A;  4JI6 T;  2J62 A;  2WDV A;  4U33 A;  2NW8 A;  3UTK A;  4CZZ B;  1ZEE A;  4AQG A;  4JI0 T;  1HX8 A;  4M1P A;  1U4Q A;  4KHP T;  4IHJ E;  4YSZ A;  3RX6 A;  5ETW A;  3A8Y C;  1FMV A;  2DI4 A;  2Q9Q C;  5LMU T;  5FY7 A;  3NZP A;  5FXW A;  1IJ5 A;  2IAK A;  2LSJ A;  1B7T A;  2VAS A;  1MMG A;  4O4I E;  1DU2 A;  1ZKE A;  2LRL A;  4U3C A;  2LSK A;  5J0Z A;  3O1J A;  4P0A A;  3NRY A;  4LFA T;  3LK4 2;  3NBX X;  1JNZ A;  2F4V T;  3PDY A;  5CA0 E;  3VKH A;  4YJ3 E;  2BG9 A;  2VKD A;  4TX5 A;  1KEY A;  4DUY T;  4CI2 B;  2XQ6 A;  3NWI A;  4TWD A;  1XDO A;  3AVS A;  3P50 A;  2A3D A;  3ZT5 A;  3I9Y A;  2WU5 A;  5AQT B;  1VCT A;  3AEB A;  2CPT A;  3HKD E;  1W09 A;  5HCJ A;  5EK2 A;  2V6Y B;  3WAK A;  3CX8 B;  2EHO D;  4DR6 T;  2G0U A;  3AE2 A;  2IC9 A;  3AB3 B;  3PUX F;  3AE1 A;  4DR2 T;  3RC8 A;  5ABH A;  2LSY A;  3DJB A;  3MA9 A;  2XAJ B;  5JDQ A;  4DR5 T;  4YJ2 E;  4PNI A;  4P0B A;  1BR2 A;  5KDM C;  4EAH A;  4GKK T;  5CGM A;  1Z0P A;  1QLB A;  3SS1 A;  5L47 A;  4LF5 T;  4B3T T;  3TLV A;  4HFB A;  2XJ7 A;  1FIO A;  1UUS A;  2HPL A;  1EZ3 A;  2E9X C;  3FHN A;  3K3O A;  5JQG E;  2JIW A;  5DAB A;  2EHO A;  3UUX B;  1KNP A;  3L8R A;  2QGS A;  4HN9 A;  2H7V C;  3SFD A;  1XWM A;  4F6R C;  3O1I A;  4IL4 A;  2C5I T;  5C2T A;  2DWK A;  4H9P C;  3CX6 B;  3C64 A;  1D1A A;  2IHR 1;  3RPU A;  3C50 A;  4I50 E;  1J1J A;  2V7J A;  5A1L A;  5LMN T;  1BR0 A;  3N9Q A;  3O1H A;  3UFE A;  1CHU A;  1OED E;  3PE0 A;  5ABE A;  3R84 B;  4ZS3 A;  3N9N A;  5CB4 E;  4EYY R;  4HFD A;  3TLT A;  2ZM8 A;  2A9U A;  2VK9 A;  5FP3 A;  4BJM A;  2K24 A;  4L9I A;  1LVF A;  3AE9 A;  4YXD A;  3I0Q A;  4ILA A;  3P4R A;  3CQX C;  5L3C B;  5JH7 E;  1E2A A;  1Y64 B;  3N9M A;  3PUG A;  2BVL A;  5JDG A;  3LG7 A;  4XZC A;  3ZMS B;  3A7M A;  2E2A A;  5BR8 T;  1SE7 A;  3ZMT B;  4DV1 T;  4X65 T;  1HG2 A;  4HFC A;  4UR9 A;  2NWB A;  3KFW X;  3ONX A;  5LYJ E;  2Q9Q A;  2H89 A;  3IHR A;  4IRE A;  4PFP A;  4JI3 T;  2PTF A;  2WB5 A;  4KHZ F;  1HR0 T;  4HWC A;  2CBJ A;  3FZF B;  3ZN0 B;  1KNR A;  3PUW F;  2BDE A;  4QXB B;  4XAX B;  3RIF A;  3F2E A;  1SUM B;  5CA1 E;  5JDH A;  5DQW A;  5J2U E;  3QUJ A;  4AKG A;  2HH7 A;  4CI3 B;  3FXD B;  2Y6X A;  3GN5 A;  4N78 D;  5J2T E;  2NTX A;  4PK4 A;  3UT5 E;  3KVB A;  2UUB T;  3ZN1 B;  4HFH A;  2XQ8 A;  3CML A;  1U5P A;  3FZK B;  5LNK A;  1HTJ F;  2LJL A;  2C5J A;  2ES0 A;  2XM1 A;  4PJN A;  4JEH B;  1T98 A;  2IC6 A;  3RKO A;  4X66 T;  2E9X D;  4JEU B;  3IBP A;  3GMI A;  3OTO T;  2WDR A;  4MBQ A;  4O2A E;  1MIV A;  5KX5 E;  4DMV A;  5LGN B;  2UXD T;  3QB5 K;  3B5M A;  4CN6 A;  3PUV F;  4BAY B;  5AQV B;  3RQW A;  2XAF B;  5F8P A;  2JMH A;  4X1K E;  4IE6 A;  3VR8 A;  2YU1 A;  1H7C A;  2E5V A;  1YD8 G;  3TLW A;  2NW7 A;  4TZ4 C;  1HNZ T;  2CEA A;  2MYS A;  4TV8 E;  3RQU A;  2VKJ A;  3ONJ A;  2WY2 A;  1WCR A;  2LOS A;  4ILU A;  2IUB A;  4LF4 T;  4ZI2 C;  3SWH A;  2LHN A;  2W00 A;  3EVY A;  3VKG A;  5LHG B;  2E9X A;  2KWI B;  3AAA B;  3RRC A;  5FY1 A;  1D0Y A;  4OK0 A;  1M7K A;  1UCU A;  3N2O A;  4O2B E;  3N5L A; 
#chains in the Genus database with same CATH homology
 2UU9 T;  4JI6 T;  4DR6 T;  2UXB T;  4DR1 T;  1N34 T;  4JI0 T;  2UUB T;  4DR2 T;  4KHP T;  4JI1 T;  1HNW T;  5IWA T;  3T1Y T;  4DR5 T;  2VQE T;  2UUA T;  2HHH T;  1N33 T;  5LMU T;  2E5L T;  1XNR T;  4DV4 T;  4GKK T;  1J5E T;  4NXN T;  4JI8 T;  4X66 T;  4X62 T;  4DV2 T;  4LF6 T;  4GKJ T;  3T1H T;  3OTO T;  1XNQ T;  4LF5 T;  4B3T T;  2VQF T;  4B3S T;  4LF8 T;  1N36 T;  4YY3 T;  4LFA T;  4LF9 T;  2UXD T;  4JI2 T;  5BR8 T;  4B3R T;  4NXM T;  2UUC T;  4DV1 T;  4X65 T;  2F4V T;  1N32 T;  4OX9 T;  1XMO T;  4DV3 T;  1IBM T;  1XMQ T;  4DUY T;  2ZM6 T;  4AQY T;  4JV5 T;  1HNZ T;  4DR4 T;  4DV5 T;  4DV0 T;  1HNX T;  4K0K T;  1FJG T;  4DUZ T;  4DR7 T;  4JI3 T;  1HR0 T;  4JYA T;  4LF4 T;  5LMN T;  4LFB T;  4DV6 T;  4B3M T;  4JI5 T;  4DV7 T;  4LFC T;  4X64 T;  1IBK T;  4YHH T;  1I94 T;  4JI4 T;  2UXC T;  4LF7 T;  4DR3 T;  1IBL T;  4JI7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...