4B3TF

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3tF00
5LMUF 4LFCF 4B3RF 4K0KF 4DV7F 2UUCF 4DUZF 4DR3F 5BR8F 1FJGF 1VMBA 1F60B 2RJZA 1IBMF 2F4VF 4JI2F 2UUAF 2KJWA 4LF5F 2B7BB 3R3TA 4DR6F 4DV3F 4JI0F 2KJVA 4LFAF 1GH8A 4GKJF 1G7CB 4LFBF 3ZZPA 2UXDF 2B7CB 1XMOF 1RISA 1N34F 1G1XA 4JI7F 4LF4F 5AJ3F 1N32F 3OTOF 4DR4F 4YHHF 4DR5F 4JV5F 4DR1F 1HNXF 1XNQF 4JI5F 4DV6F 2HHHF 5IWAF 4X66F 2ZM6F 4NXMF 4X65F 1CQMA 4JYAF 4X62F 4JI4F 1XNRF 4DV2F 1QJHA 4DV5F 2BXJA 2UUBF 5LMNF 4YY3F 2UXCF 4JI6F 4DUYF 1IBLF 1HNWF 3T1HF 1IBKF 1J5EF 4X64F 4KHPF 4LF8F 4JI8F 4B3TF 2J5AA 3T1YF 4JI1F 2VQFF 4B3MF 1IJEB 1N36F 2YY3A 4DV1F 1IJFB 1B64A 1LOUA 2E5LF 4AQYF 1HR0F 1FKAF 4LF6F 1XMQF 1HNZF 4OX9F 4LF7F 1CQNA 4LF9F 4B3SF 1I94F 4DR7F 2UXBF 2VQEF 2UU9F 1N33F 4DV4F 4DR2F 4NXNF 4GKKF 4JI3F 4DV0F 2BVZA
chains in the Genus database with same CATH superfamily
1FRKA 3FEZA 2DNMA 4ZP9A 3D2WA 1MWZA 2HNDB 1IBCB 4DV7F 1JXEA 3MDFA 2LXUA 1FNOA 2RMLA 4ZP7A 2C2DA 2F40A 3PXGa 3UR3C 2YH1A 2XMKA 1EP4A 2EBEA 1TL7B 2Q1LA 3KUEA 3TUJC 1UZDA 3I4PA 1NU4A 2ROPA 3K89A 2Y1RI 4X64J 3GPAA 3GFYA 4P9SA 1TKXA 5HJXA 2H51B 4M1KA 4FPRA 4KTQA 2R42A 4ES1A 1LXNA 1FESA 2OD6A 1Z4UA 2HIYA 2OEJA 3KJFB 3M1VB 4P72A 1T9YA 1B7YB 5KFSA 4OI3A 2V4JA 5C7PA 1WC6A 4TQSA 3GIMA 1RWKB 3R7NB 5J2QA 4URQU 2RNEA 4LT6A 1XQIA 2GX8A 5LJ3Y 2FVRA 5HBMA 2FHKA 3BO2A 2WBMA 5IFMA 1L3SA 3R6LB 1REVA 2HAFA 3Q2SC 4H4KA 4UOFA 2HNYB 4LVNP 4FXWA 4OZ2A 4WIIA 4WP9A 4ZP6A 5FIIA 3PIOQ 5KFMA 2JWNA 1BD6A 3R5GA 1TTHB 1YRTA 2CVIA 4PRFA 2DK2A 3I6PA 1I3OB 3M8PB 3M8PA 3F44A 1IKXA 3M2VB 1WF1A 2CPIA 2YWFA 1C4CA 3D6TB 1V3SA 4DUZJ 1LEOA 2DHAA 4MK7A 1TAUA 2HLUA 3FCVA 4ED8A 3D1QA 2OH2A 4JV5F 2LP4A 2JFDA 2OO4A 4KO0A 2K7KA 2RSQA 1QUVA 2J7WA 3OVAA 3MAQA 1JJCB 4ZCLA 3R7BB 2DTJA 3LTOA 5KT5A 3F41A 6FD1A 3BGFA 4NA1A 4OYIA 3CMAS 5ETOA 3GG1A 1RT1A 5HMYA 3BQ2A 2DNQA 2FQQB 5L9NA 3HM9A 3KG4A 1WC4A 2DRDA 4EYIB 4I0WA 1T9WA 4FBUA 4Y0FA 2DB1A 2AGPA 2VG6A 3PW5A 1RAJA 3R9LA 4C48A 4KSEB 1N5YA 1N5YB 3P49B 2L9NA 2ZJPQ 4Q7AA 3HD1A 1Y00A 5A6WA 1TL1B 2CDQA 4BWJA 3N6MA 3QO9B 1IQZA 2NYHA 3T5KA 1VISA 2FC8A 4W4MA 2CYYA 5GMEA 1IR0A 2CVEA 4RW4A 2MQQA 3ET6B 3FVYA 4G3IA 2I38A 1NSKL 1C0TB 4KGZB 2F9DA 6AT1B 2Q79A 2WONB 4DQPA 4J9OA 2BBEA 1VQLS 4K4TA 4ED4A 4B3TF 3SZ2A 1ZA1B 1HQEB 3Q8SB 2HHPA 3OXFA 3BDEA 3O8WA 4C8ZA 4AXIA 1FK9B 4Y00A 3OL9A 3GIJA 4Y2KA 3EVMA 1DQ9A 3OR1A 4AQYF 1YBUA 3OR1B 3ENQA 3VGSA 2M7SA 4I4BA 1XEZA 3IR6B 3DMJB 5DG8A 3DDNA 3DLEA 2OP5A 1NK0A 2HS3A 4CTAB 3FMBA 3D4JA 1REVB 3VR1A 5DDOC 2XO6A 3FJ2A 3OLBA 1LQ9A 1S7HA 2VDIA 3K5LA 3CCMS 1SUQA 2DGTA 4JI4J 2Y0BB 2HHSA 4F0KA 1R89A 4HI2A 4A8OA 2E1RA 2N3OA 2FGCA 1PYOB 3R27A 5E0OA 4DR7F 4ECRA 3AB4B 2B8QA 5M2PA 2UVVA 2XB2D 1PAEX 4NXNF 2HNYA 4LFBJ 4O3PA 2ILZA 4FXVA 3PR4A 1VQSA 4DUTA 3MR5A 3FQLA 1FCAA 4MIBA 1SKRA 3R2DJ 2F8HA 2RE1A 5EN1A 2UUWA 1AZSB 2GGPA 2HRYA 4ID8A 4WP8A 1NPPA 4K0KF 3HP6A 2GO9A 1FDDA 3IGNA 2GHWA 2YNGA 5A8RB 2LEBA 4K4ZA 1FJGF 4ZVUB 4NXMJ 1R8PA 1QAJA 3IS9A 2RD5C 5L39A 1U1RA 3V4IA 3U7JA 5DQIA 3OW2R 8AT1B 4JI8J 2MHEA 2BJ9A 1DTTB 2NREA 2P9EA 3M32A 1TL3B 1FDBA 2HHWA 4ZDNA 3MM6A 2Z58B 2DXEA 4M94A 1ULRA 1S7IA 4TU8A 2GMJA 2KXFA 3IRXB 2QO3A 5D3GA 2DHHA 3AA9A 3CULA 5CHCB 4CLWA 5LJ5Y 4DXLA 2E1PA 4KKOA 5B0BA 2RQCA 3TOQA 4LFAF 1RT7B 2NSBA 4DV4J 4ID5A 2B0GA 2FLOA 4PYAA 2G2ZA 2YNHA 3VQSA 4J9MA 3H90A 3V6KA 4LF7J 2OTLS 4N8NA 3ZTRA 5BXIA 4O0NA 2DNRA 3VTIA 3C2PA 1N0VC 3R5DA 3W63A 4K4VA 2W01A 1HQEA 2FJEB 3NAIA 3PZPA 1HBUB 4NZ0A 1MN7A 4BLGA 1HBUA 5AJ3F 4DR4F 1KVJA 2R8HA 2BJDA 2KG0A 1SJ1A 2BDPA 4ELVA 1PBAA 3R8YA 2W8LA 1CJTB 1WG4A 4KH1B 4J9LA 4DR1F 1YJRA 3IM9A 5I4MA 1GTHA 2AU0A 1RAEB 3D9BA 2EFQA 2VKZG 1TVRA 1WKLA 3DOKA 1VQ9S 3RG6A 4EGLA 4LQ3A 1KWMA 4OFZA 3DRXA 5GAEU 1LK7A 4JI4F 3CJTA 1RWNB 2N4DA 3G8QA 2IHR1 3JTPA 3NNAA 2V8PA 2F3JA 2EVZA 1Q7LB 2BXJA 5IQQA 4ILRA 2R9LA 3M30B 3DCAA 1BXNA 5KG1A 3W65A 5JXSA 1F9EB 4URGA 2J6SA 1IXKA 1WHYA 2OAUA 3PO4A 4WTYA 1ZBTA 2XWYA 3BR8A 1RWUA 4L74A 1QUPA 3K7RA 4ZVQB 4OZ5A 4BHQA 3BB5A 1U49A 5DM7Q 1K47A 1OIAA 4QIEA 1G3OA 1PILA 3IWXA 5ETQA 2YKAA 4WJBA 1S1TA 4F02A 1RHKB 3V4IB 2YH0A 3FBCA 3MUMP 2VA2A 2X1AA 3MM9B 1HNXJ 3IBCB 3HFZB 2KXHA 2HHUA 2XI3A 3LP0B 1TZ0A 4YFUA 1H3DA 1NK8A 1HMVB 1WEYA 1Y5NB 1HBOA 1S6QB 1YGYA 2CQPA 2O1PA 2PT0A 1F2HA 2L3MA 2YNFB 3MI7X 3NEKA 4RW7B 3TQEA 2J0SD 1BMQB 3HCXA 3VVTA 3Q8UA 1SJ4P 3SBMA 1PC4A 2XZTB 1HBNA 3DHWC 4UZBA 3T1YJ 1S99A 1C1BB 2PMZD 2BQRA 3AJ1A 3LF0A 1OQ3A 2GQQA 1PBUA 2AIRB 4DV4F 4DR2F 1X7VA 3QGPA 4B3RJ 1RCXB 3OTCA 3RTVA 4MT1A 2ACMA 5K8NA 3OL6A 1C0UA 4CLYA 3C66A 4NCGA 4KGMA 5KG2A 1VFJA 2UU9J 1H0HB 1JKHA 3MPYA 4CLUA 3KJQB 3I9V9 1IM6A 4ICLA 1U1MA 2MJNA 2UUCF 3UDVA 2XHWA 3NS7B 4RBVA 3UDEA 3V5RA 2IPOB 2UXBJ 3ZZ0A 4X4QA 1N88A 3M6VA 1L5UA 3QFHA 4MK9A 2LCWA 4TLQA 4C3MA 2YX7A 1NSAA 2CPZA 5IXUA 3GV8B 1XC9A 1HR0J 2NQPA 3T19A 1G6BA 1UL3A 1K73T 1Z1ZA 3HDSA 1T9UA 2B51A 2QTWA 3LP2A 2Z57B 4G1QB 5ADZA 5EGYA 5LSRA 2DRBA 1W2IA 1S1UB 5AJ3J 4GVBA 3PHEA 1N5SA 3FNNA 3VAGA 2AYBA 3TZXA 3DLKA 3LAKA 5HP1B 3PW7A 1F2GA 4C98A 4RX6A 2G0IA 4ZITA 5HQLA 1IR2A 1GX5A 3R1LA 1N56A 3X3UA 2FJVA 5CA5A 3L3CA 3THVA 2DBBA 2QYGA 3OVSA 4DX6A 3C6TA 3K8WA 2DR9A 3IO1A 3C6TB 1IKYA 1SH2A 3G2XA 3HZGA 3OFFA 2Y8YA 2HHHJ 4R5PA 3QNWB 2CNLB 4X2BA 3LA0A 1P27B 5CABA 3QT6A 4MAKA 1W26A 3RB4A 4A48A 5A2QY 4TY8A 5CYQB 1N32F 4OI0A 2QLXA 2JSXA 4A47A 4AUKA 2Y1JA 5E5NA 4U67Q 3P6YC 5A8WB 2GVZA 1RTHA 4RWWA 4P6QA 3W8GA 3QPIA 1X5TA 4OYMA 3M9MB 1WNEA 2HK2A 2H9ZA 5EUHA 1X5SA 2WAQD 4ZVTB 1OWXA 3ZFVA 3RRHA 1HNXF 4DPTA 5EWFA 1MSWD 1A6LA 2W1BA 2ZITA 3P45B 3CEDA 4FVCA 4J5OA 4NEZA 3GFXA 1X5PA 3RR8A 1JLGB 1Q8LA 1R8BA 2GCFA 2PFDA 1TV6B 2RB7A 5IWAF 3SV3A 3CE8A 3RUBL 1HBNB 4DU7A 2UUTA 2KVIA 2DR6A 3FBFA 3W2WB 4AL7A 4Y6IA 1TUGB 3MM7B 2JL9A 1KSPA 4A8WA 4DV2F 3J7YI 4GRSA 2QLJB 1T3NA 1MWYA 1XERA 2E44A 4DR5J 2QIFA 4BS2A 2ZHOA 1EETB 2CPHA 2DY9A 2B56A 2KB2A 3H2UB 1VIOA 1UEVA 1M5HA 1M5SA 2J7KA 2MKSA 4MMOA 1CSJA 4OYPA 5F3ZA 1H74A 4FPIA 2HHTA 2L9DA 3RAXA 2HRUA 4ANDA 2KT3A 4NYPA 2DJWA 2EC0A 1QSLA 4P71A 4PXEA 3TEHB 5DG9A 2PFFB 1R0AB 2CUYA 1DURA 2EEYA 2KT5A 2ZOFA 3T1YF 2FPHX 2HK3A 1S5ZA 5D0RA 3MCSA 3I4HX 1N48A 2DH7A 2L48A 2PI5A 1FA0A 1PSDA 3HSJA 4C8YA 2F4VJ 1U2CA 1X0PA 1FJCA 4OV6A 1OPIA 1WHWA 2HS4A 3B82A 5HAOA 3LWMA 1U25A 1NCLA 2DGXA 1S49A 3CDAA 3VCDA 3O5TB 4YHHJ 1HR0F 3ETMA 2DNPA 3RJMB 3I0RA 1WKKA 3OV7A 2FJWA 1FTCA 4R5PB 4M5DB 1H7XA 1T9VA 1KBRA 2LECA 1RSCA 3PRVA 2CJQA 3PYGA 5ETVA 2COLA 3TZYA 1LWFA 2H5IB 2ZUAA 5CYQA 5T7LA 3KG0A 5DZ6A 3R5CA 3SI8A 1N34J 1DRZA 2OSQA 3CCUS 3L7OA 1W25A 2DNHA 5GMKa 1YSJA 2B9WA 4Y2AA 1CC7A 5A8RA 1IKVB 3D6MB 5B7WA 1ZYQA 1VJQA 1J5OA 4TY8B 2Z0GA 3IS9B 1NHUA 3R6GB 1KDNA 2AZ1A 1Q95G 2ZWPA 5M2UA 3BGRA 2OIHA 2VOPA 4RPFA 2BKPA 3U1MA 2HQ3A 3EUNA 4NL5A 1VQ7S 1G4CA 2HQIA 2IDLA 2J9DE 4ECZA 5AT1B 4Z7YA 5L8RC 1T8EA 4L73A 3EZOA 1TL4A 2LU2A 2MQPA 5KT7A 3BR9A 4RL1A 5D0HA 4DL4A 2KO1A 1VQ6S 3T1AA 2CPDA 5LL6d 1NBEB 4LRBA 2KH9A 1BQNB 4ZVSB 5GAGI 1Q5YA 1NH7A 2GV1A 3H20A 2BR0A 1NKBA 1Z2LA 4B9SA 3GJSB 3VALA 1OPZA 1GMWD 1TFWA 4WKRA 2RRNA 4NLPA 4OZLA 3THPA 4DOZA 1SQGA 3GYXB 4DX5A 3DLHA 1CS4A 2XC9A 1IBMJ 3MM5A 1VQ5S 4OZJA 1SQEA 1GFWB 4LRFA 2K1RA 3CWJA 2QFJA 4U96A 3CC7S 2LXFA 1DQAA 5B0AA 1HKAA 1M5OC 2VG7B 4IFYB 5L46A 2XY5A 1UMJA 1XMOF 1T3OA 3BDPA 1FXLA 2HMIB 2NPIA 3TZWA 4C9DA 4GC6A 3G6VA 3DDKA 2MKCA 1HD0A 4ECQA 4JI2J 3OTOF 1U2RA 2KRBA 2D9PA 3W5ZA 4CM2A 1RLCL 5F8GA 4DBQA 2GIQA 4DR5F 3W3SA 3SQGA 2P8IA 4MFBB 1FE4A 4OHVA 4CWBA 2CADA 3CW2C 3T9ZA 5IT0A 5KFCA 3GWCA 1NAQA 4NLGA 1WSRA 2ZE2B 4F7VA 1T7PA 2R7TA 2I0XA 3L7PA 4DZDA 5LXRA 4YB6A 4ZS6A 3ZNJ1 4C0OC 3VAJA 4F3OA 3A8JA 4HDHA 4DG1A 5FD1A 3NBPA 4DG1B 3CXCR 3MPDA 1HIYA 5F3TA 2DRAA 2YNGB 1YIJS 2V0NA 4KR0B 1S9FA 3MM8A 1RWPB 4ZJOA 3MURP 2FVQA 2CJAA 5A0YA 4JUZA 5CYMB 2FB0A 3CJQA 3T1HJ 1VK8A 5KG0A 6FDRA 1F9FA 4QYRA 2VICA 2WTFA 1P1TA 2OD4A 1FX4A 4RKUC 1OMSA 3J80Y 4J9QA 3AAWB 4X84A 3KK3B 3TARA 3RB6A 4I6WA 4JV2A 1NPKA 2IJFA 3CD7A 2BABA 3N5BA 1LWEA 3IMQJ 5KFEA 3OL7A 1ITPA 3MUVP 1H73A 1P9QC 2HVZA 2BW2A 3EXYA 5F8LA 2F1FA 1Y10A 4GKJJ 3OFHA 1S0MA 1BQXA 2VC0A 3POTA 1JLQA 4CLTA 3LW5C 4F50A 3IR7B 1WDTA 2MEWA 3I32A 2FZGB 1TQLA 4I6AA 2WOMA 2L41A 1JXLA 1JLFB 4K8RA 1WG1A 3AD9C 5IZHA 5IOLA 3HHLD 1MMLA 2H4WB 3WX4A 2R7RA 1WACA 4LUBA 1H38A 3BN7A 4RW8B 1O0PA 3BQ1A 3IC1A 1F3VA 4YP3A 4OL8A 2HVIA 4KGKA 4F04B 1HNZF 1RABB 2V4JB 2ALYB 2W7PA 1NUEA 1NMEB 1XNRJ 1B4SA 1MWQA 3CJ2A 2YX4A 2RS2A 3J81j 4O44B 3RW6A 3ZZOA 1CS4B 1B0TA 1GX6A 2OHDA 4X4RA 1KC8T 2AGQA 3PX6A 2PO4A 2FJDB 3M7VA 1B3TA 1TK8A 2BMBA 4W98A 1Q78A 2OEKA 2XTJP 2RILA 3W8PA 4QU6A 4DSEA 3LPYA 2EG2A 2BZ2A 3FQKA 4NOHA 2IVFB 4PQUA 1IKXB 1E6YB 2YKMB 1JLBB 2V2KA 2AKWB 3CDEA 3NS6A 3P4UB 3UDCA 2AP6A 3N4WA 5LMUF 2E9ZA 4Z37A 3PIPQ 2QRRA 5HQMA 4FP9A 2W9BB 4X66J 1S9GA 1HW9A 1P8GA 1Y5LB 3AJ2A 3HX9A 4P2FA 3UQSA 3UR0A 4IH5A 3V6JA 4DR7J 2ZBQA 4WTOB 3HXMA 1CULB 2NZCA 1WWHA 2E7XA 3D66A 3DFEA 3B4MA 4EK2A 4IG3A 1VDHA 2EWHA 1RT1B 3M32B 2BRKA 1X8DA 1EQMA 3M2RA 4L76A 3JYTA 1RHUB 1ZM3A 1RYRA 2XCPA 4IR9A 3OHBA 3GJQB 2MZRA 4P2XA 4JI2F 4IO9Q 2GQCA 4P52A 5D3GB 3BKUA 4USTA 3GYNA 4Q2MA 3VHQA 2CQ2A 2YQ1A 4KKOB 1WELA 3W64A 4IG0B 3V6DB 3OPKA 3D7SB 3J7ZT 1HMVA 3NGKA 1LWEB 2GMHA 2HFOA 4ANCA 2RU3A 3MR6A 2KM8C 1U1NA 2E1MC 2EI5A 2W2QP 4MKYA 2QC3A 3GILA 4C8OA 2GHVC 4JI1J 2XS7A 3TAPA 5JVHQ 4CH0S 2ZNYA 3N01A 1FDAA 4U9RA 4RUCA 3SCIE 3POTB 5K20B 2ZWOA 5J1NA 4CLZA 4LF4F 2OPQB 5A76A 1UFWA 1Y11A 5C2GA 5CH7B 1U02A 3H25A 2VOOA 5D77A 3I55S 3Q22A 1KLNA 2CFXA 3HVWA 3KKFA 5KTQA 1KOOA 4C8KA 3UN2A 5J2MB 1I51B 4JI5F 2QLWA 1D3WA 4DL7A 1PC5A 3ILOA 5DG7A 1NXIA 5G0RA 4WP3A 3NMRA 4ETXA 4KHMA 4O44A 1EQ0A 2DNLA 4PQUB 1KQGB 1RT5A 4QIFA 3V2UC 4AFFA 4RNOA 2KYXA 3JSRA 3NKYA 3DC2A 3ITHB 4P75A 4J9SA 3UD4P 2BJ3A 3TAQA 1YJUA 4XO0A 4TXSA 2NUHA 2HAIA 2RT3A 4L3NA 5H9EK 2RQMA 2C42A 3M30A 2ZJQQ 4BDPA 2E5LJ 4ZOSA 4YUDA 3LP2B 4N76A 4J9UE 3TO8A 3IBWA 3V4MA 5C25A 1RT2B 4RO0A 3M9OB 3EZ5A 4TNOA 2QL5B 2FJAB 4HLBA 3SFGA 1S10A 1T03B 2IMOA 2YNIA 3H2VE 1S1XB 2BM1A 2KYZA 4USVA 5H1SV 4WFAQ 3OFGA 4ALZA 1JLCA 4LF8F 3Q0AA 3UCZP 1NJIT 1RTDA 2ZH2A 4ZVHA 3FMWA 2CQDA 4IR1A 3M8QA 5GADU 2EW9A 3QJPA 2J9EA 2PDAA 3W9HA 3D1HA 1KOHA 2VFRA 1OSCA 2HNZB 4CI0B 4CLFA 2B43A 3KJVB 4DV1J 3UE2A 2BJEA 5AXLA 3G87A 2B4UA 2AJ0A 2MSSA 1VR6A 3DYAB 2MKKA 3IFEA 2K7JA 4YQWA 4ZJQA 2N4CA 4PUOB 2CNNB 4KQZA 1M5KC 1PAUB 2F8EX 5KFPA 3ZTOA 2H3EB 4M5IA 4J9NA 1QVFR 4QYZJ 2E7VA 2F63A 2HQCA 3NCPA 2VG6B 2W7AA 4A46A 1VS3A 1R31A 2HBRB 4ZPCA 2HG4A 8ATCB 2WB1D 1B70B 1BGXT 2GJ2A 3Q89A 4IH6A 5GAGU 5I3PA 4DV0F 3MOJB 4RNMA 5IV3A 1VOMA 5D4LA 4ZLLA 2R8KA 3D0IE 2PIIA 4LIWA 1BY9A 3BN4A 3FRZA 3GFHA 1SL0A 5F8IA 4N77A 3HHLA 4XTTA 4NYOA 3Q8VA 3QT5A 3KK1A 4DUZF 1JB0C 4ZCIA 5IV4A 4QIWD 3CJKB 4C2MA 1JX4A 3PJWA 2B4OA 1XBWA 3NRBA 3M8SA 4G6VB 4HYKA 3JTNA 3PCOB 2NZ4A 1NJYA 4B9UA 3HFKA 1WC3A 1WOPA 4ZK7M 4X4TA 3HVTA 2PA3A 3ISND 1XMQJ 3AOBA 4X4PA 2DXDA 2DR8A 2RJZA 4M5MA 2AYGA 4XAKA 2FVCA 4PWWA 2AJ1A 3CDWA 3HSDA 4ZHRB 3CCJS 2XI2A 1RI7A 5T41A 2E9TA 2J6UA 5KFVA 1WI6A 4WE1B 1QE1B 4LR9A 2DNOA 1RA7A 1QAYA 3NAHA 4LF6J 5EWEA 3TZZA 3KLHB 2MXYA 4IH7A 4WXWA 1HQ2A 3NCRA 3W62A 3H5XA 4C3KA 1PJ6A 5CZVA 2D3OR 3JSMA 4LJMA 3D0GE 1K44A 3KFWX 4C7QA 2RAQA 3CJ4A 3A8IA 4K4XA 1NHKL 1YI2S 1LW2B 4ZVEA 4F0HA 4FVMA 4LFAJ 2M88A 5KFXA 3UCUP 2B6AA 2MKJA 3AXKA 2HGMA 2FLLA 4O3SA 1JXVA 2DNZA 3QIPA 2XLKA 3N0VA 3BPSP 3NOGA 5HANA 2E1AA 4WZMA 2EK6A 2F4FA 4QR2A 5F9LA 3G71S 4B9NA 1IR1A 4ED6A 2GVDB 2YKPA 4W92B 2BUNA 3H98A 1Q8KA 3OFEA 4PG7A 4CO5A 1U1OA 4I2PB 3NMAA 4UTGA 2QE5A 5KFIA 3GR1A 3TVYA 3NGUA 4QWCA 2W9CB 2FDNA 1RT3A 2RQ4A 2HHHF 1RT3B 2JOQA 3CTRA 2D9OA 3N6NA 2V5HG 2MZQA 5SUHA 4LF1A 1FE0A 5KFHA 4X65F 4RW6A 2OTJS 2AYMA 3CB4A 3EXCX 1GXUA 3OXLA 4YR2A 1N6QB 1K0VA 4CNZA 1NK5A 1RB0A 1FRXA 2KN4A 2M52A 1JLGA 2ZH9A 2C2KB 2Z2MA 3S01A 1GMWA 1RBOB 1S6OA 2MKHA 4NLOA 4RR5A 4RNFA 5C42B 3G8SA 2P6TA 3EM1A 4RW9A 3EX7B 3CCSS 3TW0A 4HR2A 5DGBA 5CCLA 3GQCA 1YZ6A 2ZOMA 3D67A 3W5YA 1XK8A 5IWAJ 4E2FB 3IWNC 1JLFA 1EAYC 2QA2A 3QGIA 2J0QD 3C14B 2XS5A 3BH7B 4X64F 1RWMB 5F0WA 1TK0A 1SQFA 3KOAA 1WC5A 2AQ4A 4FBTA 2HZAA 1VI7A 2RUGA 2VKRA 3M1VA 2EFGA 3O6QA 2NSCA 2XGQA 3JXOA 2HQGA 1HNIA 1FJGJ 1LW0A 2Q43A 5IC4B 1FHTA 1U09A 5H9EJ 4WE1A 2BM0A 2MQMA 2B9XA 2Z30B 3DGVA 3RAMA 4ZN3A 5ITHA 4Q0BB 2UUAJ 2AF6A 3DRPA 3HVRA 2W9AA 3SV4A 3GIRA 3P3DA 5HBMB 2KRRA 1XMQF 3DM2B 2H5JB 5DZ7A 4Q45A 3GJTB 1UVMA 1WF0A 2FHMA 3Q8PB 1M5VC 1N33J 5I42A 5DDQC 1Q7YT 2HFNA 3UNYA 2QG9B 1SKUB 2R8GA 2E5HA 1NK6A 1DTQA 4NA3A 2CJ9A 5LSLA 2VQEF 4C3LA 5KG5A 1IUJA 1RXOB 2JRSA 3BM7A 4HI1A 2XM3A 2GJFA 4M5DA 2LQ5A 2GW8A 2C3MA 2J0WA 5HVFA 4E98A 4FYDA 2W24A 2Q6BA 2KFYA 3AD8C 1ZAWA 1NDLA 4U95A 1KKHA 4B3RF 3A3NB 5CD4H 3FBEA 2XYPB 3G86A 3M2RB 3G6ES 1I6JA 4MYUA 5F9NA 4YS2A 3TNVA 2E7WA 1ROFA 2EKYA 2JC0A 4AL5A 2OFGX 5BYRA 4ITSA 2PSZA 2CG8A 3R2CJ 2UUCJ 1EB0A 2AW0A 4DS5A 2UXDJ 4F3QA 1DTTA 2F8MA 5KFQA 4QWAA 1BQNA 2W2OP 1ZM4A 2RQKA 3WIVA 1VYAA 3UD3P 2VA3A 2CQGA 1BQMA 3MM6B 5L38A 1GT8A 3KNGA 1G2EA 5D6GA 4LF9F 1U6BA 3LGHA 4Y34A 3C14A 1Y7PA 4NLDA 1TKZB 1UVKA 2GAHC 1K1QA 2PA8D 3SCLE 4CCHA 3TANA 4BCAA 2VONA 4DR6F 1BLUA 2A3JA 1SPBP 3M2UA 3LQVA 3CF5Q 3CUNA 4NWBA 1FEHA 3CJ0A 5DJBA 2V4RA 4P2MA 3GMGA 2DPIA 2GQ2A 2HKEA 4U8YA 3MEKA 3BBCA 1C2PA 1VBZA 4Q0BA 3B78A 2P9CA 3OR2A 2X51A 1EJ7L 4CYUB 4OI1A 5RUBA 5J2QB 5CCMA 3HPOA 3PNIA 5H9FK 2CQBA 1RKJA 4KFBB 3OLAA 2X3DA 2V4QA 2I6WA 3T5LA 3TYTA 1XMBA 2OPSA 3GP9A 4DL0C 2V2QA 5HVGA 2R7XA 1RTJB 2OFHX 4OIXA 4A8SA 2MLZA 1SI9A 3SSSA 4F8RA 1RAOA 5K8OA 3KG1A 3ELHA 2EK1A 4P10A 1KNZA 5IT4A 3WZ0A 3PFOA 2FY1A 1QTNB 1YWXA 1RT5B 1AXQA 3DOLA 3L7UA 3ISZA 2WBRA 3I0RB 1MU2B 4MIAA 4OX7A 2KDOA 3K5NA 3TUPA 2VPYB 3OHAA 1MROB 2ZBRA 1XMOJ 3KNAA 1N8RT 2LU1A 4K4YA 1IWGA 1NK4A 1RDRA 2A6MA 1U0HB 4I2QA 1BWVA 3AD7C 4OJHA 5DQGA 2C2EA 1HI0P 2BOPA 2C3PA 4AL6A 1KHVA 3QWPA 1IBLJ 3I5AA 4UY85 1VRTA 2D69A 2AX0A 2ZDOA 1NZ8A 2ZH3A 1EHWA 3ENVA 3VAFA 5ETMA 1ZPVA 4CH7A 1HLWA 1NRKA 4DCJB 2ZC4A 3G6XA 5LMNF 4Q8EA 4OZNA 2O3DA 1NK7A 3ENWA 4DUYF 1H2UX 2ZZNA 4YR0A 1S1TB 1JJ2R 2VBZA 1S9EA 1KTQA 2PEHA 1TL1A 4USJC 2EG1A 3PRDA 3FUYA 4JI8F 2D3ZA 2IRUA 1ICEB 1UETA 1BWEA 5HMWA 2FD2A 2VQFF 2E5JA 3NY0A 1WG5A 1FERA 3TAMA 2LQ8A 3ZZRA 3H42A 1TKZA 1X4AA 4RW8A 1S97A 1RYSA 5I3UA 2LKZA 5BJRA 1EIYB 4URSA 1BQMB 3K17A 1Q8IA 4KYZA 2RS8A 2QSWA 5DDRC 2ALZA 3MECA 1X9MA 1U1KA 2XSFA 3U02A 3FFIA 2ZHAA 3PO5A 4LF7F 4UOCA 2AJQA 4MKAA 1K0TA 4FF2A 4V19X 2MPUA 3M2UB 1S72S 3W2WA 3H7HB 4B9VA 4NX9A 2PC6A 1DLOB 2VDHA 3UWTA 2VD3A 4DR6J 3IM8A 3MMBA 4R25A 2QL7B 2WSFC 4Y3CA 4G1IA 1EKRA 4WU3A 5KG7A 2AD9A 2UXCJ 1U24A 1VC5A 2KZMA 3DN9A 3ONQA 1HWIA 2W2PP 4KFBA 4ATNA 2IM1A 4KV8A 7FDRA 3MUTP 4EBCA 1B7FA 5D8HB 2NXEA 3FEYB 5CXTA 1HWKA 1S6PB 2H4YB 2DNNA 3MFHA 4HACA 5IM0B 4DL6A 2C1EB 2W8KA 3M8ZA 1NEEA 3WQPA 4NLYA 3OQ2A 3UDLA 4UUWA 1A9NB 3AFGA 1H7WA 3D3BJ 3DI6A 4NYZA 1S1UA 4PZVA 1UW4A 4ES3A 2PD1A 5FDLB 1VBKA 4WCEQ 2ASJA 3CNQP 3K5OA 3K5MA 1YKWA 1ZS6A 1CG2A 4F0MA 1KRPA 2IBKA 2DH9A 4DPOA 1VMBA 3R97A 4DDFA 1F60B 3RZAA 5E2QA 4DHVA 3ZXWA 1LWCB 1VRQC 5KFDA 1F3FA 2P6SA 3RB3A 3ULHA 2ZH7A 2VJUA 3CC2S 1HA1A 3F56A 4I68A 4LBIA 2V67A 2Y3YA 1QAIA 1KR4A 4XPCA 3CJRA 4DLEA 2AJFE 1T0TV 2I9SA 2R3VA 3M05A 5J2NB 3KJVA 4IOAQ 3IR5B 4JI7J 2IAJA 2LVWA 4TY9A 2XG8A 2QMWA 3Q8YA 1R0CB 2JHEA 4BWMA 1NK9A 3MR2A 2R8IA 1VRUB 2BKOA 4QPTA 3FSYA 4OI4A 1RHMB 5AE1A 3A8EA 2P5VA 1Y3JA 3HKZD 4KPYA 3SSQA 2DHXA 4UUXA 3QRRA 1PIEA 3MZIA 1UKUA 2E5GA 1U7LA 2NCKL 4I2PA 4OHXA 2P9GA 2XLIA 3P5BP 2CJKA 3H5UA 1IWAA 2BOAA 3BS9A 4MTPA 4ZKAA 4ED0A 1RAIB 4IKAA 4U8VA 4DQSA 2WRMA 5KFLA 5E3RA 1BHNA 3E3XA 3MCOA 4WK3A 3IBFB 2I1RA 3G4SS 1K8AT 1MMNA 4TYAA 3TA2A 4P74A 3ADAC 1ZM2A 2B8PA 4O3OA 5GMDA 3HHLB 4OYBA 4EI2A 1T05B 1L3UA 4NXMF 4C4WA 1A7GE 4L6V3 4WU2A 4RBUA 5D78A 3K5PA 2IC3A 3ZZYA 4WF9Q 1R8CA 2UZAA 2AGOA 3J7AN 1M5PC 1PGZA 5KT2A 3AJDA 5CZXA 1UWBB 3D68A 3HVTB 4LBPA 4L72B 1RAHB 2HFSA 5F8NA 1RWOB 5KFOA 2N7YA 2LEAA 3A8KA 2GZOA 1VC6A 2UUBF 1SL1A 2XBPA 3UCGA 2M0GB 2CJXB 3PW0A 2UXCF 3T1HF 4NI2A 1FRLA 4ZHRA 4UOGA 2ASLA 1C4AA 2V63A 1WHVA 4HACB 2MQLA 1WJ9A 2VG7A 3OBIA 2CIMA 3J7Z5 2XNQA 2RHSB 3JTOA 4DL5A 4H54A 4LRCA 2E29A 3TVKA 1RK8A 1S57A 5HQ8A 2V9WA 4O23A 3TA1A 3AXMA 1H2VZ 3FEXB 3LALA 3FRYA 4DMZA 5JMNA 2WW4A 2BANB 3F73A 2L9WA 4NLXA 2Y1IA 2KTQA 2KHDA 1N52B 3Q23A 4I7FB 2O01C 4LQ9A 5CD4A 4QU7A 2E5LF 4NMXA 1SB6A 1FXRA 2HWIA 4QQBA 3MD3A 1U0SA 2E9RX 3DOMB 2FZKB 4H4MB 4MJKA 4ECUA 3QZ7A 1SCJB 2ERRA 9RUBA 5GADI 2DGUA 1UAWA 1JK9B 2CXEA 2VF3A 2HSEB 4ZMMA 1VLYA 3H5YA 3QZ8A 3M9NB 3RYLA 1NKEA 2V2ZA 4EFAC 2CPXA 5T7LB 1H2TZ 4DZ6A 3ZTSA 2MYFA 3OD2A 2LFVA 3GSIA 3MEEA 5HROB 2N7CA 3MEEB 2HZVA 4KB7A 4XDDA 4CO3A 1DAXA 3FSIA 5KFYA 4J9KA 4DJBA 3CJ5A 1C1BA 4DF4A 4RU2A 1F5AA 4IRKA 1J5OB 1LFWA 4QWBA 2OPRB 5A6PA 3T6JA 3TR5A 1VBYA 1UVLA 3D1OA 2DCUB 4QZVB 2ZHBA 1XJWB 1C0TA 3HI9A 3T5HA 2BJ7A 5B09A 1QM9A 1WC1A 3EPIA 1KS2A 5DO2A 1E6VA 3MR7A 1UVIA 4K4UA 5J2MA 4X4VA 2VODA 3CD0A 3SCJE 3V81A 4HT7A 2WCXA 3D28A 1X4GA 4A8YA 1O8BA 4N41A 2HW3A 5FLXU 4AXJA 3PM9A 2VIHA 4DSJA 4F4YA 3ENAA 3C46A 3Q8QB 1YZ7A 2KJWA 4RNHA 2DO4A 2AV5A 4O4GB 1FJEB 4ED1A 4IDKB 2EFOA 2HVHA 1O51A 3MEGB 5KG6A 4F4ZA 3L9ZA 5E41A 2OPSB 3TUIC 3VGUA 4F2RA 1P6TA 1UEKA 4IO1A 2V8GA 2YNIB 4YR3A 3W7BA 5HVHA 1SC3B 1N54B 4C11B 4QIGA 4OJ1A 3JAMY 3MR3A 4ECTA 4JV5J 1OYEA 1PCAA 1ZOTA 4ZVRB 1PYSB 2D3O1 2G1DA 2JVRA 1M1HA 4ZPTR 2NYIA 1R0BG 4O3NA 4Q2LA 5KG3A 1O6XA 1H6KX 2ZOGA 3K8VA 1KLMB 4YHHF 1FRMA 2VG5A 1KLMA 3PHTA 3BREA 1X4FA 4QR1A 4LF2A 2DGOA 3W2VA 2R2RA 4DFMA 1DZ5A 1RQ0A 3GV7B 5KT4A 1PKUA 1VLOA 1NDKA 2GHPA 1XNQF 3E01A 2CA9A 4I56A 1SV5A 1JLEA 5L1JA 1VK3A 2BE2B 2D1CA 1DBDA 1DARA 2RKIA 3EVWA 2ZM6F 2RKIB 3VAMA 1HNZJ 3K0JA 3RAQA 1AB8A 1NB2A 3I56S 2LYVA 3CO9A 3C6UB 3BYPA 1XNRF 2WVCA 4JI5J 2IRXA 3MM8B 4J9RA 2CKWA 2DHSA 2UVUA 1YRUA 3PEJA 1CVJA 2MSTA 2OI2A 2W9CA 3G96A 3OTEA 4KC5A 1J5EJ 3QSYB 2BJ1A 4X4SA 1KHWA 1CEZA 1DQ8A 4WWSA 3WBZA 4EU0A 3MPWA 2KXNB 1RBLA 2RHQB 1EP4B 3I5CA 3I82A 3MCMA 3BKFA 4ID5B 3PEHA 1D9DA 5T14A 2KZZA 3QRQA 1URNA 1FDNA 2QX0A 3ET6A 2N3LA 1Q16B 1EARA 3DGPA 3NGSA 4WYWA 5EHHA 3LO3A 3LOUA 3CCWA 1WSVA 2MJUA 2E66A 1E6VB 1LXJA 2FC9A 2XMTA 1S79A 2D7SA 2Z8QA 4L3KA 1Q82T 3T5JA 3QWUA 5F41A 2HHVA 3THTA 2DR7A 1V3ZA 4ECWA 4FNHA 3RRGA 4O4GA 4OX6A 3PY8A 1S4FA 4LSZB 2I8EA 3TEGA 3MMJA 1EX8A 1MNEA 3GONA 1RTIA 3DRRA 2HVDA 1WORA 1HNIB 2CZ9A 7AT1B 4FYYB 3KTQA 2VJVA 1KD1T 2C3YA 1CPZA 4BC9A 3W5XA 3IWLA 4KY3A 4GKKJ 3EMTA 4ZVGA 1U45A 3MEGA 1SJRA 3MD1A 1NJZA 1PJ5A 3US5A 4TQRA 3M2VA 4K4SA 1B99A 2E1CA 2ZD1B 4RWXA 1AFJA 2KU7A 1HFEL 3QAEA 1AYEA 2NXUA 3BBFA 3UN3A 3H59A 3OTOJ 2IVYA 1CJUB 2BA9A 3LGMA 3T6BA 2VZ9A 5DM6Q 3FZBA 4PG6A 1AUDA 1S0VA 3MHYA 4HH1A 3D0HE 3D6FB 5HLFB 2C22A 4B9MA 1AZSA 4RNNA 4U6PA 3PX0A 2V34A 1CLFA 1RKIA 2WB4A 3MPUB 3U27A 4RUHA 3MFIA 3W2VB 1ZM9A 2KI2A 5ETKA 2D74B 2V50A 1NB7A 2JEGA 5F8JA 1T02A 2DISA 2YKNB 3C6UA 4NLSA 1QDUB 2QYCA 3KHGA 2Z56B 1UFKA 3ICLA 2CQCA 4FS2A 2UV8A 2C2OB 1KQKA 4K0KJ 1SIWB 4LBHA 2WW8A 3D6HB 1NPRA 4PABA 3JYTB 1XIQA 1N6QA 5LT5A 4Q8FA 2MGZB 2BE9B 3IRXA 3BSNA 2NPFA 2IYIA 4FF4A 4YEAA 1RTZA 2RDIA 2FTRA 4GVLA 1RHQB 4ZPDA 2H54B 1OY8A 4ZPAA 4CLKA 3Q2TC 1YLXA 2ABYA 1Q5VA 2LQBA 4KHRA 2ZJRQ 7FD1A 1S77D 1HL6A 5DDPC 3R5BA 1Q86T 1WEXA 2Y0SD 5E3QA 2UXDF 2QMUB 2A2CA 2Q6CA 3S6EA 1U2FA 3SDEA 1OJ4A 2C3UA 3MTJA 3CCQS 4DR1J 3N5FA 3QGGA 4WFXA 2XY7A 2B9EA 2YWHA 4KGVB 2HS0A 3C8YA 4G65A 1LK5A 3SIPB 3ZZTA 5HJYA 2OJ3A 5C2CA 1D0EA 5FJ4A 1R6YA 2FJBB 2NXJA 5MAOA 5KAKA 1O5JA 1KFSA 1NM2A 2XMVA 2QA1A 1FXDA 3F0NA 3MF5A 3HMJG 4XPEA 1WC0A 3BQ0A 1QTMA 4I67A 2IC3B 3PJ9A 2OPPA 4KBIA 5C24B 1JJ4A 2HQFA 2M4MA 4ZIWA 4B3SJ 2DGQA 4ZLPA 4PWUA 2HVEA 3RW7A 2K2PA 3DXSX 5IM0A 2WSCC 3CMES 1FRIA 1FKOA 2F9JA 5DRKA 4ZVFA 2NLWA 2ZE2A 3BJYA 3NGTA 1NJXA 2VUGA 4C8LA 1MU2A 2G2OA 1SJFA 3OSNA 4J91A 3VAKA 1X9SA 2DIUA 2HFZA 3MAHA 3R5AA 4DQQA 2RDJA 4M8LA 1VGYA 4F4XA 1T03A 4JI0J 4BBYA 1QE1A 2R7UA 2CZVC 2WZ1A 4NASA 4R0JA 3QGHA 4ZP8A 3BO3A 3IAS9 3QJJA 1FVSA 4TYBA 5L1IA 1EZZB 4DV0J 4XIUA 1SJ3P 3NNHA 4N8OA 4EZ9A 3NWRA 4EO6A 3B54A 2BACA 3DLKB 3RB0A 4JP8A 4ZVPB 1S1WA 3AOCA 5K14A 3ILJA 4NLTA 3QT7A 2HNZA 3SSRA 1YBTA 5J2NA 3CPWR 4B3MF 1N36F 1OY6A 2LDIA 4P73A 1IKYB 2JLFA 2UVWA 1IJFB 1S6UA 5HMXA 4IOBA 1ZA2B 5I3UB 4WFBQ 2Y1LB 3DNCA 2GNKA 2KKHA 3TJAA 4NA2A 4ENOA 1YITS 1U4BA 1HYSB 1HD1A 1MN9A 3MECB 3TAMB 3PYFA 1YJTA 1HHQA 1S1VA 2QJ3A 2ZH8A 3NWGA 4Y2MA 4K4WA 3DLLQ 1HI1A 1ZH5A 4LMZA 2ZBIA 4FKYA 3KK2A 1NH8A 2GIRA 3DLGB 4USKA 5KFZA 2M3DA 2QV6A 3DLGA 1DLOA 4RW6B 3O2IA 4YN3B 3MPVA 4U7UK 5GAHI 2XCAA 2VQFJ 4EYHB 4M5JA 2VHGA 3CIMA 1QLNA 1GMUA 1RCOB 4HTIA 1N33F 2ATLA 1FFWB 3L09A 1OY9A 1UA0A 4LFCJ 1TUVA 2WSEC 3KXDA 3EDQB 3ZO7A 4DL2A 4WIQA 3SDEB 3PW4A 2JZ5A 3MM7A 5KOWA 1GTEA 1FWLA 5E7OB 2Q66A 3SYZA 2BQ3A 4OHZA 1J27A 4ICLB 1LKZA 4DR2J 2G2YA 3GB0A 1QAXA 2EKNA 1WDDA 5DETA 4LVOP 4PXBA 1V9OA 5BR8F 1D9AA 1L3TA 1T11A 2YX1A 3W60A 3K58A 4ED7A 3CGIA 2IA6A 3DOLB 3G9CA 1U6ZA 2LQJA 2B5JB 1UCNA 2R2UA 2B5JA 5ETRA 3DOKB 4F4WA 3GE9A 2J8SA 2W25A 3MMCA 5D4NA 1K9MT 1HW8A 3BGOP 1Y4ZB 4OMFG 4F25A 4FYWB 4YB7A 2HWTA 1JNZB 1FO1A 2VPZB 2W4CA 4HEA9 1L3KA 4CLPA 3KLHA 1RT2A 5L9XA 3S7RA 3UI3A 2ZVSA 4A8XA 2QSFA 3C16B 4AT1B 4CLLA 1VQNS 3UVJA 4ECVA 3V6HA 3MMAB 4QWDA 3AB2B 3KLGB 3IG1B 2CZ4A 2KJVA 4HT5A 3NP5A 2ZH5A 3RRKA 1URRA 2R7WA 4B3TJ 4C0BA 1DTQB 1SL2A 4JI3J 2VU5A 3CVKA 1RE1B 2B7CB 2VG5B 2VFTA 2CPFA 2ATCB 2VASA 2X1GA 3QT8A 4FZVA 4KAIA 3ZZZA 1RT4A 3DDIA 4NLUA 5I3QA 3I5BA 1TELA 3UFCX 2QA4G 2FIUA 1F5BA 2DKOB 1JLEB 2FGOA 2HIQA 2V8HA 3QIPB 3GFZA 1H72C 4FN5A 2XMMA 2WHOA 3EZUA 4N7TA 1AW0A 2GMLA 4OJ3A 3UN5A 3EGWB 3HT3A 4ED3A 1HWUA 1HYSA 1VC0A 4R8UA 2XULA 2JEIA 3VGTA 2OPQA 1UPMB 4HHHA 2ZBPA 2PMHA 4DV6F 2LLZA 2DXFA 2XEXA 5C42A 4NPOA 3QLHA 2DNYA 1YJVA 3ZTPA 5LSOA 3B6BA 5SZTA 4OX8A 4CIOA 2V8VA 3CCTA 1V3RA 4CDIA 2B9YA 3MMBB 5ETTA 2IRYA 3TA0A 5D0GA 4J90A 1FF2A 1FWPA 4LF9J 5KFBA 2ACYA 1IKWB 5J1EA 1RTDB 2JLGA 4USWA 4DX8H 1YRXA 3RBEA 3N9UC 1W7WA 3DGPB 1LFPA 3O3LA 1V5VA 2DO0A 2PMWA 2K1RB 2ZKTA 1FD2A 1JKHB 4CNYA 4K7QA 2DPJA 1WUUA 1GXTA 3MMCB 3QIDA 4N5SA 4MYTA 4CYUA 3RBXA 3CCLS 1FFGB 2XGPA 3A4TA 5LMNJ 4H4OB 2FZCB 1JWWA 2I5JA 3AQOA 4JI1F 4C6AA 1N5TA 2IBOA 3HO1A 3QATA 4LIRA 2EC2A 4CTAA 5EDWA 3VAHA 3Q86A 3JS9A 1HNVB 1B64A 2MQNA 2DVIA 2QGFB 2JX2A 2Z2YB 3CIZA 3EGVA 3DRPB 3PG9A 1I1GA 4FYXB 2W2MP 4YY3J 4G1QA 4DCOB 2PEBA 1M0SA 1V6HA 3MWBA 2CWXA 3PX4A 1FKAF 2F5GA 2CQ0A 3DOMA 3DM2A 1TKDA 4CLSA 2CQIA 2ZD1A 1GQEA 2GO8A 3PVXA 4I7FA 1S76D 4ZCKA 1N5VA 4FKXA 1Y0HA 5I42B 5K8PA 4DR3J 2RRBA 5BR8J 1U8SA 1JIHA 5DS7A 4ELUA 5HLFA 1R43A 4KT0C 1SKWA 5A8WA 2GGPB 2XMUA 4JV1A 3U1LA 4DR4J 4JI3F 1RT4B 2MZJA 1HNWJ 3WIUA 1RAFB 1VCTA 4YOEA 3HKWA 1FTRA 2BV3A 1DJ0A 1YDLA 3AH6A 4HL9A 4ZLJA 3PDNA 2XLJA 1YJWS 5CYMA 4B3OB 4DF8A 1MG7A 1YBAA 3DU5A 4ETZA 1ZTTA 3OUYB 1L3VA 4F36A 4FNIA 4EBEA 1RZMA 4EZ6A 5KT3A 3BGRB 4QBUA 4X4NA 1X4DA 2YKOA 4NZ6A 3CJSA 4DSLA 4NCAA 4IYQA 3PRBA 3KLEB 2Z4PA 2CPJA 2C2ZB 4M5HA 2HNDA 4B08A 2YPZA 3HZEA 4IFVB 4WYLA 4OLPA 3CJKA 1U6FA 4DV6J 2RUSA 3D5MA 4OHWA 4PPZA 4DCPB 1VQ4S 4BC7A 4CZCA 4UZCA 1IBMF 4E8UA 2W7OA 1X60A 2QLFB 4X4OA 3EGZA 4LSLA 1Y5IB 2XYGB 1NO8A 4J9VA 5M2RA 1KQSR 1FK9A 1KFDA 1XR5A 2GJIA 1BE4A 4AQYJ 2XY6A 3WX8A 1OQ6A 2QMXA 1N0UA 2HBZB 3P5TL 3PJXA 2G0CA 4DV3F 1QSYA 2I5JB 1S12A 2ASYA 3BSCA 1VBXA 2C3OA 1WD6A 3EWGA 3MM5B 3ZZUA 4PYDA 2XNRA 4J7CA 5KG4A 4Q43A 4NEYA 4DUYJ 3HHDA 3UNGC 3KLVA 2W4DA 4QYZK 1R0AA 4W90B 4ILMA 2DCLA 4JI7F 5AXMA 3ISNC 5C24A 4NXNJ 3DRSB 1S0NA 2KVQE 3EJMA 3LGNA 1NKCA 4QOTA 1LNQA 4ZA1A 1UJ6A 2JVOA 2AYEA 2RU9A 1IN0A 2DIVA 4MFBA 2W9BA 2G0JA 3EGNA 1KVKA 2R4FA 3ZC4A 4MIWA 4PG8A 1WKJA 2HLTA 3E01B 3MOZA 4YB1P 2HWHA 4I1TA 4OZ1A 2OSRA 4AE5A 1FKPB 3K59A 5K8MA 2C2NA 1FEEA 4H4MA 2H65B 4DN9A 4UQGA 1KN6A 3ILIA 4RJVA 4J37A 4DPXA 2FHJA 1TK5A 1JLAA 4KO0B 1DHMA 2YBVA 4Y28C 2HGLA 3BF4A 1LWCA 1JJHA 3IGVA 3C15A 4YMEA 1J2VA 2ROGA 4M5GA 4ZJLA 4CP5A 4DPWA 2X7IA 1QD1A 3GIIA 1IKVA 1S1WB 3ETOA 2M9KA 2W2NP 4Y2IA 2ZDPA 1Q4RA 3UPFA 5KFNA 4YY3F 3D3CJ 1VQYA 4FF3A 4JI6F 3KLEA 3W61A 3O1LA 1HNWF 1IQTA 1NZAA 1IBKF 3T9NA 4OI6A 2G13A 2ZM6J 2Z2ZA 4IFVA 3LUYA 4XDCA 4B9TA 3H8YA 1R6VA 4PR6A 1HQUB 1UWAA 4IG0A 3R1HA 1PG5B 1RT7A 3R7SB 5DQHA 1S0OA 2SXLA 4PAAA 2LMIA 1Q81T 2AEFA 1S1VB 2ZH6A 1TKXB 3J7A1 2VC1A 4OI2A 1RAAB 3AQPA 5AXNA 1RA6A 2HRTA 2KG1A 3MGJA 2K3IA 1Q79A 1RP5A 1UW9A 3J81U 4DQRA 4IQXA 5D15A 2XQCA 1REGX 2ZUGA 2MKIA 1UVNA 3NS5A 3G6YA 3PTWA 2B4PA 1UEUA 4IFYA 2C28A 2RF2A 5D0EA 1SUQB 1UZHA 5KFUA 4Q5VA 5JUMA 3H4DA 1CJTA 2QN6B 2IMWP 2XMJA 3FZ2A 3I0SA 2H1YA 4YDXA 1IVZA 3DMJA 4NCGB 4PG4A 5AXKA 3TX0A 2YKQA 1D8ZA 3AHPA 4EMDA 4DV3J 3HSZA 1M1KT 4DQIA 4FF1A 1MMDA 3EE3A 3PV8A 3JB9k 2XHCA 3T41A 1BUXA 2AEMA 4DV7J 3DRYA 2CQHA 3CDBA 5D4OA 5A8KA 3DHXA 1LV5A 4OYAA 2IM2A 1T95A 2YKMA 5KT6A 5JVGQ 4NLWA 3BSAA 5BYQA 2CJYB 2MDAA 1ZETA 2VFSA 4PWDB 1MROA 4PWDA 3NGRA 4DPUA 2JC1A 5LXYA 1VIXA 3EICA 2WVEA 2AT1B 4KIAA 1ZAVA 1QSSA 2CQ4A 2CWKA 2DNKA 3IP0A 3M6XA 1F5CA 1HPZB 3JQMA 5G4DA 4V19J 2CDRB 3M8RA 3I96A 4YB5A 2BE2A 5LMUJ 1FNXH 2DEIA 1RU2A 1UJ5A 5CQGA 3QRPA 2QL9B 1B0PA 5A2QU 3HD2A 4B17A 1WTFA 2ASDA 1YTYA 3M6UA 1APSA 3H5SA 2UUAF 2HZCA 1HHSA 4NRUA 5E3PA 4CH1A 2HYIB 2JEFA 2MLYA 2M8DB 2E5IA 2ZNZA 4WZQA 2YWGA 3GU0A 2DGWA 1F0XA 1JLQB 3H0PA 1PO6A 2M5YA 3BYRA 4RUBA 1KONA 4GMKA 4KGXB 4CRJA 2MLXA 2QZ8A 2WOMB 2X1BA 3ZZPA 3OSPA 4LFBF 2O67A 3ZTQA 1RWVB 1RACB 2BX6A 2F65A 2YPYA 4H4OA 3DYAA 1RTHB 1W2BR 4JI6J 1SJQA 4IQMA 1IBKJ 2V8DA 1G1XA 1GK8A 2GIFA 4QPXA 3QYYA 5B0GA 2OPRA 1X5OA 4CM0A 2WVBA 2P2CB 3OTDA 3OR2B 4RLEA 2YTCA 1CJVA 5KFTA 4EEYA 2DYAA 4U7CA 3KK1B 1RLDA 2PN6A 3J80U 4DS4A 2HQDA 1HHTP 1TUWA 3CCVS 3GLJA 2UV8G 1TKTB 2B3TB 2V68A 5D4PA 3DRRB 4K2XA 1TL7A 4TVAB 4ILLA 2VV5A 1RTJA 4G1PA 4NE9C 3NGDA 3MXHP 2R2SA 4C0HA 5G0RB 3QSIA 2YQ0A 4AD6A 3LP1A 1XNQJ 2XSJA 5DLFA 4F4KA 2VFVA 3ILLA 5KOXA 2LQ9A 1JLBA 4O4RA 4TU7A 4NI2B 4M63A 1TVRB 1KVIA 2RH3A 3VZHA 2Q3PA 4EUVA 2LA6A 3GR0A 2XMWA 1ACMB 4I2QB 3CD5A 4DFKA 3SMZA 3QJLA 5C25B 1E6YA 1N5QA 5FDLA 3KLIA 3M4XA 5HSPA 3FBBA 3KLIB 2LEPA 2POKA 3NLCA 1NSQA 1J5EF 4IRCA 3VVUA 4KH0B 2YKNA 3KUHA 1TAQA 2J5AA 4QJVA 1SIZA 2CG4A 3QBCA 2B6AB 2H48B 1KQFB 4JV0A 4DSFA 3C3LA 3SQOP 2YY3A 2VH7A 4DV1F 4HTJA 2BW7A 3JSMB 3OTBA 2IA0A 3ZNUA 3LP0A 4I69A 1CC8A 4CO0A 1N32J 3DXBA 3KHRA 4JOUA 2BYCA 1U1LA 3MTKA 3EYZA 1SV5B 4MKVA 3GYGA 3B4DA 4IUFA 4X62J 3WHIA 3OJSA 1CQNA 3KK2B 1RHJB 4JB8B 1YK9A 1S59A 2XZWA 5FLXY 3V6DA 2VPWB 5HI7A 2IFXA 2ZVIA 1HBOB 1S6QA 2R7OA 2X3GA 4USHA 4F3MA 3LH2S 1I94F 1D8YA 3KHHA 2MKYA 4A8KA 2G9OA 4D3HA 3NG8A 4Q44A 4F4AA 3KYLA 2R2TA 1QVGR 4GKKF 4HH0A 2MZSA 3PFEA 3KMSA 1BC6A 1T9TA 1F9HA 3TJ9A 1R27B 4OX9J 2A18A 2DR5A 1SH3A 1NNDA 1TR0A 4EWTA 1GAOA 1TMMA 2EFPA 2J76E 3P8BB 3GCXP 4WKYA 2WVFA 3BBBA 2R7VA 2BEFA 3CSKA 4C8MA 3VV2B 2RRAA 3N6LA 3J7YU 3G8TA 1KEKA 1B0VA 4P2SA 1UWBA 2AMCB 2JDJA 3JQJA 1U8WA 2AHOB 4MH8A 4WBFA 2CNOB 3Q83A 5LOQA 4WK1A 2IY5B 2F4VF 4ER8A 4V1Ak 1RWXB 1GNKA 1F6TA 2BRLA 4OZ0A 4RBTA 3CJ3A 3Q24A 1SXLA 4HHUA 3IRWP 3IA0A 3MMAA 2H5EA 2VL1A 3DU6A 2AEJA 2HMIA 4IDKA 3W1YC 4DX7A 1RHRB 1I5OB 2DD8S 1GH8A 2U1AA 4GKJF 5HK4A 2R7QA 1TU0B 3HK2A 3OVBA 4ELTA 1TFYA 2HBYB 2ADBA 2CAJA 3M8QB 3EPGA 3CJ8A 1CJKB 4WXOA 4O0IA 2ADCA 3WC2A 4A4JA 2XZDB 2CPEA 1N34F 1JLCB 3PKYA 2J7UA 1ZZNA 1TMJA 3DLJA 2IAJB 5L1LA 4NLQA 4K2JA 2ZBCA 4PEOA 3RU0A 4ZLNA 2MTLA 4CT8A 4ED2A 1WTBA 2OUGA 3P96A 1I94J 3TX8A 4PXDA 3M6WA 1FX2A 1T94A 2ZC3A 4K5SA 4MK8A 1HBMB 4ZPBA 1P1LA 4OYOA 1GMVA 2MY8A 3H2LA 3TJ8A 4Z2XA 4ZIVA 1SC4B 2V94A 3KDNA 1SC6A 3MEDA 2IJNA 2QFIA 3TP2A 1D9FA 1M1GA 2A1BA 2DEJA 4B9LA 1ZZFA 1JMTA 1YQHA 2QEXS 3AT1B 2G1HA 2HEKA 1AT1B 2YWWA 2DGVA 2DH8A 2DT9A 4GO5X 4ZPVR 4X62F 1FVQA 3BGUA 1M90T 3FC9A 4LF5J 3AODA 3IAM9 4QIVA 2WK4A 1WHXA 2IVMA 3A1YG 2AZ3A 3M8YA 5E33A 3W66A 4DV5F 1U47A 2ZEJA 1EKSA 3HSGA 1R8HA 1Y3KA 4FDFA 5E3AA 3TRGA 4I64A 2M8HA 2DNGA 1HI8A 2EFNA 4YDDB 2NR0A 4NLRA 1C0UB 1HQUA 1NDPA 1X4BA 3KDOA 3I87A 5ETNA 5F0UA 1SKSA 4NLVA 1VJWA 4HHJA 4LSLB 3V81B 1IKWA 1ELOA 3QFWA 5J1EB 1S4EA 5B0CA 2DY1A 2OEMA 2K06A 1HWLA 2GA7A 4K59A 1PJ7A 2MMYA 5HL7Q 1U48A 2WONA 1ZAXA 2MQOA 4QR0A 2B4VA 2CQ3A 5HN0A 3L4BC 1RTIB 4M5LA 1TP7A 2BE7D 3DLEB 3IN5A 2KHCA 1AUSL 1HNVA 3LWLA 4UY8T 3SCKE 1UPPA 4O3QA 2HPUA 2BQUA 1TL5A 5MLCV 2MHNA 1JNRB 1N36J 5GVQA 2OPPB 4UT4A 3NOCA 4KE5A 4GVBB 2HBQB 2VB6A 4HVZA 4OX9F 4DLGA 1GXLA 2BANA 3Q8RB 3H40A 2WVDA 1VQPS 3PW2A 4E0DA 3SQGB 3SXLA 4O3RA 4KHPJ 4CQ1A 5KFFA 2J0XA 4S0MA 4GC7A 1LWFB 2X1FA 1IM4A 5A8KB 3TUZC 1UP1A 4DFJA 3CO0P 1LWXA 3E8OA 1N4LA 4DI6A 1MW7A 3VWSA 2UU9F 4PPDA 5L1KA 2ZZMA 4QW9A 5B0DA 2EXUA 5HMZA 1CJKA 2AX1A 2BJ8A 3C19A 2FYXA 3QMQA 5HO4A 4NZ7A 3CD6S 1S9GB 2K3KA 1GEHA 2LXIA 2YWEA 2BVZA 3HLUA 9ATCB 1RT6A 3MEDB 4DPYA 4NCBA 3NCQA 5HROA 2CJBA 4N47A 4LFCF 4FXDA 3J81Y 2KFNA 1SBRA 4DR3F 2NXNA 3JSBA 4LSNA 5HATA 3WC0A 5EWGA 3HJFA 4DWIA 2U2FA 1V5IB 1YX2A 4R8UB 2CQ1A 2APOA 2KM8B 4TLRA 2JLEA 3JQKA 1FT8A 2FY8A 4C8NA 2HFUA 2GFFA 3FSXA 4Y65A 4WFNQ 1XR7A 3MM9A 2M70A 2OGUA 1FNMA 3HFVA 3I31A 4I6YA 5K9FA 3T3FA 1UVJA 4ECSA 1TL3A 1Q53A 4RW9B 1VHIA 2NXCA 4RW4B 2J9DA 3H4BA 4RW7A 4C97A 2CNKB 4F67A 1Z2ZA 4P7TA 1EETA 2AJ4A 4UW2A 4LF5F 3UD5A 1S48A 2B7BB 3CMQA 3QQCD 4NRTA 4A8MP 1SH0A 2JEJA 4JI0F 5EX3A 4IRDA 1JQGA 2ZFHA 3SEOA 3RBDA 2W4PA 2FLNA 2YXLA 1G7CB 2FHJD 2DITA 1WOOA 5KFGA 4USIA 3S8SA 4F26A 5J1PA 2NUUG 1XTZA 3FFIB 1RUSA 3K2YA 1Y9OA 1RISA 3VGVA 5THWA 2EFVA 3G82A 2ROEA 5IT9Y 4ZN1A 2G4BA 4KV8B 2JJ4D 4Z7CA 1F1BB 3TI0A 2RIJA 4DSIA 5F8MA 4DV5J 4B3MJ 4RUAA 1NHVA 1ZPWX 3AY0A 4C11A 4DEZA 2M2BA 2YWKA 3E2EA 3GV5B 1R3NA 1WI8A 2XSJB 4XK8C 2JH3A 3E51A 4QW8A 4DV2J 1RU1A 3W9IA 3EVOA 4X66F 4KJIA 2A6OA 1AFIA 3HULA 2VBXA 1CJUA 1YJNS 4U7UD 4PXCA 3GCWP 4ZPWR 3TVZA 5KFJA 4H4KC 1FKOB 4PG5A 3JAMU 5AE3A 1FFSB 5B0EA 1FKPA 1CULA 2IYGA 4WFZA 1RAGB 3NBPB 4K5RA 1U26A 1OYDA 2V2VA 3AOAA 1MLAA 1SVDA 4LSNB 1S1XA 3UVJB 1T9XA 4ZCMA 2ZH4A 4J9PA 2MZTA 1DFDA 3O44A 4B3OA 2A0FB 3TWZA 1IBLF 1AA1B 2IDEA 3C15B 2Z2LA 3OJUA 4ANEA 3W9JA 5ETLA 4KHPF 2N82B 1R7IA 2IIHA 2AWZA 1XN9A 2V9KA 4FYVB 2MGZA 1IJEB 4LR7A 3VQTA 1XR6A 3RR7A 3MAAA 4F2SA 4KPCA 4NMLA 3NL0A 2GVZB 2MZ1A 1VRUA 3DKDA 5CAAA 1FI4A 2OLWA 1WF2A 3U1NA 3OL8A 2I2YA 4LF4J 2OKQA 2J8AA 3GJRB 4RU9A 2A2DA 2UP1A 3RGIA 2UVRA 5DLGA 4ZVOB 4LF6F 1KP6A 2YNHB 3HHEA 3PR5B 1R8AA 4GO7X 4RZRA 4D3GA 3A13A 1VQKS 4JYAJ 3UW1A 1TV6A 1VQMS 3FDSA 4M95A 1CJVB 2KT2A 2RDDA 4TU9A 2GC8A 2PI4A 3I0SB 4USUA 1TKTA 8RUCA 1SC1B 4QWEA 2EPIA 2A10A 4TN2A 2VFUA 3S1TA 3UO0A 3HF5A 5E3CA 2UXBF 4KRWA 1X9WA 2V6AA 1X0FA 3MCNA 2F7VA 1NJWA 2HHQA 2XWXA 2C2MB 3KUGA 3BO4A 3CC4S 2VBWA 5J2PA 3G82B 3HVAA 4OV1A 4EO8A 1RADB 3BEGB 4WFYA 2JNJA 4LRAA 1H98A 3CDUA 3DRSA 4FS1A 3GG0A 3GTYX 2FJXA 3A3OB 2J6TA 1RWWB 5IC6B 2FLPA 3GIKA 2GS8A 2KL8A 1RBAA 1VQOS 2PGCA 3CCRS 1U0HA 1Q1KA 1WEZA 2HFVA 1HPZA 1UTAA 1A0OB 3BGLA 3FCWA 1HARA 3R5JB 4P7VA 5K5MA 3FKBA 1P9YA 4DU8A 4X65J 4A8QA 5IT9U 4DFPA 3DLBA 4LF8J 3C16A 2Y9HA 2K8GA 5HP1A 4USMA 2VBYA 2HHXA 1D09B 3CCZA 2O5DA 5KFAA 1NSPA 4CO2A 3N28A 5B08A 2FHOB 3LANA 4L75A 4PQAA 5A0YB 3CT9A 3HHLC 1X4CA 4N56A 1VRTB 4IG3B 4OYZA 4ES2A 3FGVA 1S9EB 5IS2A 5F8HA 2XO7A 1YHQS 4IOCQ 1UA1A 3GSDA 3R3TA 2RVJA 1YVFA 2MB0B 3KK3A 2YQ3A 1LW2A 1UFLA 3KLGA 2OMLA 3I9ZA 3JSYA 4OJGA 4OYWA 2CPYA 1VQ8S 3MAAB 4A8FA 3PYEA 2AJ2A 2IJRA 2OELA 5CYJA 2XMAA 2LDYA 3HT0A 1OSDA 2V69A 2ZKUA 2FVSA 2D41A 4LREA 4PUOA 2JFKA 3QAUA 3BH6B 3LAMA 2YNFA 4WPAA 4X4UA 1K1SA 2J9CA 1FJ7A 4TKTA 3VF0B 1YJ9S 1PYTA 2D3UA 2DGSA 1DY3A 4JBCA 4ECYA 2HURA 4LR8A 4LRDA 5BYSA 3QLHB 5IQ6A 1Q0NA 5KFKA 3K57A 5H9FJ 3TQ1A 1VHFA 1CBKA 3X1LB 3NNCA 3OT9A 2BKNA 2O66A 5GAHU 4Y2CA 2L08A 3FCHA 4ECXA 1HWJA 3NXZA 1WOSA 2RF2B 1U1PA 4MKBA 1QY7A 2DHGA 1X4EA 2XYHB 4OYXA 3RBZA 2VQEJ 1T05A 1CQMA 4JYAF 3LP1B 2R8JA 2UUBJ 3ITHA 4OQJA 1QJHA 5U47A 2ZH1A 2YVSA 2FVPA 2NS1B 4UQTA 1AROP 1NLKL 1XWLA 4PCQA 1KTVA 2EBGA 3D54A 3VAIA 3LPEA 2LA4A 5J2PB 5DGAA 5B0FA 1RJJA 3BKTA 3KJNB 2HGNA 1X31C 3VZIA 2QA4S 4AYBD 2R7SA 4OLOA 3DI6B 5C5JA 1Q8BA 1S6PA 4ERDA 2IM0A 5KFRA 1LW0B 2CRLA 1U1QA 3PACA 1YG0A 4HKQA 3FK4A 2VPXB 4HDGA 4PKDB 3A12A 1FRHA 1FRJA 4B02A 2QLBB 5GAEI 3EDRB 3KLFA 3KLFB 4OZ3A 3KHLA 4K50A 1D1UA 2C2RA 1X4HA 1FD8A 3B8HA 3WDOA 4QCLA 3IG1A 1LOUA 1UJ4A 4M5NA 5K14B 4DN0A 5ETSA 5JJBA 4DL3A 3PKMA 4EBDA 2Y8WA 5KFWA 1YJ7A 3IXQA 3PYDA 4M5KA 4ED5A 1OO0B 3BSOA 3KMQA 3BV8A 3GZ7A 3KWMA 3AA8A 4CO4A 5AE2A 5EX0A 1JLAB 3HHKA 1HBMA 3HJVA 2GAGC 3N79A 4B3SF 4OHYA 2GVDA 4UOHA 5LM7E 1ZTWA 1RT6B 4CO1A 3BPDA 3L95X 1NDCA 3OXGA 3SFUA 2XS2A 2ZZTA 1FWKA 3M8WA 1C1CB 2QT7A 2OMOA 2IM3A 1C1CA 4UF4A 4R0EA 3A3PB 3OUYA 3CCES 4CT9A 2KFZA 3QO9A 5ETPA 2MY7A 1RGVA 1OS5A 3BZQA 3HHNB 2ILYA 2PE8A 2MQ8A 4DSKA 2FUG9
chains in the Genus database with same CATH topology
1FRKA 3FEZA 2DNMA 4ZP9A 3D2WA 1MWZA 2HNDB 4DV7F 1JXEA 3MDFA 2LXUA 1FNOA 2RMLA 4ZP7A 2C2DA 2F40A 3PXGa 3UR3C 2YH1A 2XMKA 1EP4A 2EBEA 2Q1LA 3TUJC 3I4PA 1NU4A 2ROPA 2Y1RI 3GFYA 1TKXA 4M1KA 4FPRA 4KTQA 4ES1A 1LXNA 1FESA 2OD6A 1Z4UA 3M1VB 5KFSA 4DLGA 4OI3A 2V4JA 4TQSA 3GIMA 5J2QA 4URQU 2RNEA 4LT6A 2GX8A 5LJ3Y 2FVRA 5HBMA 2FHKA 3BO2A 2WBMA 5IFMA 1L3SA 1REVA 3Q2SC 4H4KA 5B09A 2HNYB 4LVNP 4FXWA 4ZP6A 4WIIA 5FIIA 3PIOQ 5KFMA 2JWNA 1BD6A 1YRTA 2CVIA 4PRFA 2DK2A 3I6PA 3M8PB 3M8PA 3F44A 1IKXA 3M2VB 1WF1A 2CPIA 2YWFA 1C4CA 1V3SA 2DHAA 4MK7A 1TAUA 2HLUA 2OH2A 3D1QA 4JV5F 2JFDA 2OO4A 4KO0A 2K7KA 2RSQA 1QUVA 2J7WA 3OVAA 3MAQA 4ZCLA 2DTJA 5KT5A 3F41A 6FD1A 3BGFA 4NA1A 3BQ2A 3CMAS 3GG1A 1RT1A 5HMYA 2DNQA 5L9NA 3HM9A 3KG4A 4EYIB 4I0WA 4FBUA 4Y0FA 2DB1A 2AGPA 2VG6A 3PW5A 1RAJA 1N5YA 3P49B 4KSEB 1N5YB 2L9NA 2ZJPQ 4Q7AA 1Y00A 5A6WA 1TL1B 2CDQA 4BWJA 3N6MA 3QO9B 1IQZA 2FC8A 2CYYA 1IR0A 2CVEA 4RW4A 2MQQA 3FVYA 4G3IA 2I38A 1C0TB 2F9DA 2Q79A 2WONB 4DQPA 4J9OA 2BBEA 1VQLS 4K4TA 4B3TF 3SZ2A 3Q8SB 1HQEB 2HHPA 3OXFA 3BDEA 3O8WA 4C8ZA 4AXIA 1FK9B 4Y00A 3OL9A 3GIJA 4Y2KA 1DQ9A 3OR1A 4AQYF 3OR1B 3ENQA 2M7SA 4I4BA 1XEZA 3IR6B 3DMJB 5DG8A 3DDNA 3DLEA 2OP5A 2HS3A 4CTAB 3FMBA 3VR1A 1REVB 5DDOC 3K5LA 3CCMS 3FJ2A 3OLBA 1LQ9A 1S7HA 2HHSA 1SUQA 2DGTA 1R89A 4HI2A 4A8OA 2E1RA 2N3OA 2FGCA 3R27A 5E0OA 4DR7F 4ECRA 3AB4B 5M2PA 2UVVA 2XB2D 4NXNF 2HNYA 4O3PA 2ILZA 4FXVA 3PR4A 1VQSA 3MR5A 3FQLA 1FCAA 4MIBA 1SKRA 2F8HA 2RE1A 5EN1A 2UUWA 2GGPA 2HRYA 4ID8A 4K0KF 3HP6A 2GO9A 1FDDA 3IGNA 2GHWA 2YNGA 5A8RB 2LEBA 4K4ZA 1FJGF 1R8PA 1QAJA 3IS9A 2RD5C 5L39A 1U1RA 3V4IA 3U7JA 5DQIA 3OW2R 2MHEA 1DTTB 2NREA 2P9EA 3M32A 1TL3B 1FDBA 2HHWA 4ZDNA 3MM6A 4M94A 1ULRA 4TU8A 2GMJA 2KXFA 3IRXB 2QO3A 5D3GA 3AA9A 3CULA 5CHCB 5LJ5Y 4KKOA 5B0BA 2RQCA 3TOQA 4LFAF 1RT7B 2NSBA 4ID5A 2B0GA 2FLOA 2YNHA 4J9MA 3VQSA 3V6KA 2OTLS 4N8NA 2DNRA 3VTIA 3C2PA 1N0VC 3R5DA 4K4VA 1HQEA 2FJEB 3NAIA 3PZPA 1HBUB 4NZ0A 5AJ3F 1HBUA 4DR4F 1KVJA 2R8HA 2BJDA 2KG0A 1SJ1A 2BDPA 2W8LA 4DR1F 1WG4A 4J9LA 1YJRA 5I4MA 1GTHA 2AU0A 2EFQA 2VKZG 1TVRA 3DOKA 1VQ9S 4EGLA 4LQ3A 4OFZA 3DRXA 5GAEU 1LK7A 4JI4F 2N4DA 3G8QA 2IHR1 3JTPA 3NNAA 2F3JA 2EVZA 1Q7LB 2BXJA 5IQQA 4ILRA 2R9LA 3M30B 3DCAA 5KG1A 5JXSA 4URGA 2J6SA 1IXKA 1WHYA 2OAUA 3PO4A 4WTYA 1ZBTA 2XWYA 3BR8A 1RWUA 1U49A 1QUPA 3K7RA 4BHQA 4OZ5A 5IT9Y 3BB5A 5DM7Q 1OIAA 4QIEA 1G3OA 1PILA 3IWXA 2YKAA 4WJBA 1S1TA 4F02A 3V4IB 2YH0A 3MUMP 2VA2A 2X1AA 3MM9B 2KXHA 2HHUA 2XI3A 3LP0B 1TZ0A 4YFUA 1H3DA 1HMVB 1WEYA 1Y5NB 1HBOA 1S6QB 1YGYA 2CQPA 2O1PA 2PT0A 2L3MA 2YNFB 3MI7X 4RW7B 3T5KA 2J0SD 1SJ4P 1PC4A 1HBNA 3DHWC 1S99A 1C1BB 2PMZD 2BQRA 3AJ1A 3LF0A 1OQ3A 2GQQA 4DV4F 4DR2F 1X7VA 3QGPA 3OTCA 3RTVA 5K8NA 3OL6A 1C0UA 3C66A 4NCGA 4KGMA 5KG2A 1VFJA 1H0HB 1JKHA 3MPYA 3I9V9 4ICLA 1U1MA 2MJNA 2UUCF 2XHWA 4RBVA 3V5RA 3ZZ0A 4X4QA 1N88A 3M6VA 1L5UA 4MK9A 2LCWA 4TLQA 4C3MA 2YX7A 2CPZA 3GV8B 5IXUA 1XC9A 2NQPA 3T19A 1G6BA 1UL3A 1K73T 1Z1ZA 3HDSA 2B51A 3LP2A 5LSRA 4G1QB 5ADZA 5EGYA 2DRBA 1W2IA 1S1UB 3PHEA 1N5SA 3FNNA 3VAGA 2AYBA 3DLKA 3LAKA 5HP1B 3PW7A 1F2GA 4C98A 4RX6A 1N56A 3R1LA 2FJVA 1GX5A 3X3UA 5CA5A 3L3CA 3THVA 2DBBA 3OVSA 3C6TA 3K8WA 2DR9A 3IO1A 3C6TB 1IKYA 1SH2A 3HZGA 3OFFA 4R5PA 4X2BA 1P27B 4MAKA 3RB4A 4A48A 5A2QY 4TY8A 5CYQB 1N32F 4OI0A 2QLXA 2JSXA 4A47A 4AUKA 2Y1JA 5E5NA 4U67Q 3P6YC 5A8WB 1RTHA 4RWWA 4P6QA 3QPIA 1X5TA 3M9MB 1WNEA 2H9ZA 5EUHA 1X5SA 2WAQD 3ZFVA 1OWXA 3RRHA 1HNXF 1MSWD 5EWFA 1A6LA 2ZITA 4FVCA 4J5OA 3CEDA 3GFXA 1X5PA 3RR8A 1JLGB 1Q8LA 1R8BA 2GCFA 2RB7A 1TV6B 5IWAF 3CE8A 1HBNB 2UUTA 2KVIA 3W2WB 4AL7A 4Y6IA 3MM7B 2JL9A 1KSPA 4A8WA 4DV2F 3J7YI 1T3NA 1MWYA 1XERA 2E44A 4BS2A 2QIFA 2ZHOA 1EETB 2CPHA 3H2UB 2B56A 2KB2A 1VIOA 1UEVA 1M5HA 1M5SA 2J7KA 2MKSA 4MMOA 1CSJA 5F3ZA 2HHTA 2L9DA 3RAXA 2HRUA 2KT3A 4NYPA 2DJWA 2EC0A 4PXEA 5DG9A 2PFFB 1R0AB 1DURA 2KT5A 2ZOFA 3T1YF 2FPHX 3MCSA 3I4HX 1N48A 2DH7A 2L48A 2PI5A 1FA0A 1PSDA 4C8YA 1X0PA 1FJCA 1OPIA 1WHWA 2HS4A 3B82A 3LWMA 1U25A 2DGXA 3CDAA 1S49A 1HR0F 3VCDA 3O5TB 2DNPA 3I0RA 3OV7A 2FJWA 1FTCA 4R5PB 4M5DB 1H7XA 2LECA 2CJQA 2COLA 1SJFA 1LWFA 3SI8A 5CYQA 5T7LA 1DRZA 3KG0A 3R5CA 2OSQA 3CCUS 3L7OA 1W25A 2DNHA 5GMKa 1YSJA 2B9WA 4Y2AA 1CC7A 5A8RA 1IKVB 5B7WA 1ZYQA 1J5OA 4TY8B 2Z0GA 3IS9B 1NHUA 2OIHA 5M2UA 3BGRA 3U1MA 2HQ3A 3EUNA 4NL5A 2HQIA 4ECZA 2J9DE 5L8RC 1T8EA 1TL4A 2LU2A 2MQPA 5KT7A 3BR9A 4DL4A 2KO1A 1VQ6S 3T1AA 2CPDA 5LL6d 2KH9A 1BQNB 5GAGI 1NH7A 2GV1A 3H20A 2BR0A 1NKBA 1Z2LA 4B9SA 3VALA 1OPZA 1TFWA 4WKRA 2RRNA 4NLPA 4OZLA 3THPA 4DOZA 3DLHA 3GYXB 2XC9A 1VQ5S 3MM5A 4OZJA 1SQEA 2K1RA 3CWJA 2QFJA 3CC7S 2LXFA 1DQAA 5B0AA 1M5OC 2VG7B 4IFYB 2XY5A 1UMJA 1XMOF 1T3OA 1FXLA 2HMIB 2NPIA 4C9DA 4GC6A 3G6VA 3DDKA 2MKCA 1HD0A 4ECQA 3OTOF 1U2RA 2KRBA 2D9PA 5F8GA 4DBQA 2GIQA 4DR5F 3W3SA 3SQGA 4MFBB 1FE4A 4OHVA 3T9ZA 5IT0A 5KFCA 3GWCA 1NAQA 4NLGA 2ZE2B 1T7PA 2R7TA 2I0XA 3L7PA 5LXRA 4YB6A 4ZS6A 3VAJA 4C0OC 4HDHA 4DG1A 5FD1A 3NBPA 4DG1B 3CXCR 5F3TA 2DRAA 2YNGB 1YIJS 2V0NA 4KR0B 1S9FA 3MM8A 3MURP 2FVQA 2CJAA 5A0YA 4JUZA 5CYMB 2FB0A 1VK8A 5KG0A 6FDRA 1F9FA 4QYRA 2BQ3A 2WTFA 1P1TA 2OD4A 3J80Y 4RKUC 4J9QA 1VQ7S 1NK4A 3AAWB 4X84A 3KK3B 3TARA 3RB6A 4I6WA 4JV2A 2IJFA 3N5BA 3CD7A 2BABA 5KFEA 1LWEA 3OL7A 3MUVP 1P9QC 2HVZA 2BW2A 3EXYA 5F8LA 2F1FA 3OFHA 1S0MA 1BQXA 2VC0A 3POTA 1JLQA 3LW5C 4F50A 3IR7B 3I32A 4I6AA 1TQLA 2WOMA 2L41A 1JXLA 1JLFB 1WG1A 5IZHA 3HHLD 1MMLA 3WX4A 2R7RA 1WACA 4LUBA 1H38A 3BN7A 4RW8B 1O0PA 3BQ1A 3IC1A 4YP3A 4OL8A 2HVIA 4KGKA 1HNZF 2V4JB 2W7PA 3CJ2A 2RS2A 2YX4A 3RW6A 4O44B 3ZZOA 1B0TA 1GX6A 4X4RA 1KC8T 2AGQA 3PX6A 2PO4A 2FJDB 1TK8A 1Q78A 2RILA 4QU6A 4DSEA 3LPYA 2EG2A 2BZ2A 3FQKA 4NOHA 2IVFB 4PQUA 1IKXB 1E6YB 2YKMB 1JLBB 2V2KA 3CDEA 3NS6A 1QSLA 5LMUF 3UDCA 2AP6A 3N4WA 2E9ZA 4Z37A 3PIPQ 2QRRA 4FP9A 2W9BB 1S9GA 1HW9A 1P8GA 1Y5LB 3AJ2A 3HX9A 3UQSA 3UR0A 4IH5A 3V6JA 1RTDB 3HXMA 1WWHA 2E7XA 3DFEA 3B4MA 4IG3A 2EWHA 1RT1B 3M32B 2BRKA 1X8DA 3M2RA 3JYTA 1RYRA 1ZM3A 4IR9A 2XCPA 3OHBA 2MZRA 4JI2F 4IO9Q 2GQCA 5D3GB 3GYNA 4Q2MA 2CQ2A 4KKOB 1WELA 4IG0B 3V6DB 3OPKA 3J7ZT 1HMVA 3NGKA 1LWEB 2GMHA 2HFOA 2RU3A 3MR6A 2KM8C 1U1NA 2E1MC 2EI5A 4MKYA 4C8OA 3GILA 2GHVC 2XS7A 3TAPA 5JVHQ 4CH0S 2ZNYA 3N01A 1FDAA 4U9RA 3SCIE 3POTB 5J1NA 4LF4F 2OPQB 1UFWA 5CH7B 3H25A 2VOOA 5D77A 3I55S 3Q22A 1KLNA 2CFXA 3HVWA 3KKFA 5KTQA 1KOOA 4C8KA 5J2MB 4JI5F 2QLWA 1D3WA 4DL7A 1PC5A 5DG7A 5G0RA 3NMRA 4ETXA 4KHMA 4O44A 2DNLA 4PQUB 1KQGB 1RT5A 4QIFA 3V2UC 4AFFA 4RNOA 2KYXA 3JSRA 3NKYA 3DC2A 3ITHB 2MKIA 4J9SA 3UD4P 3TAQA 1YJUA 4XO0A 4TXSA 2NUHA 2HAIA 2RT3A 4L3NA 4BDPA 2RQMA 2C42A 3M30A 2ZJQQ 4ZOSA 4YUDA 3LP2B 4N76A 3TO8A 3V4MA 3IBWA 5C25A 3M9OB 1RT2B 3EZ5A 4TNOA 4HLBA 2FJAB 3SFGA 1T03B 1S10A 2IMOA 2YNIA 3H2VE 1S1XB 2BM1A 2KYZA 5H1SV 4WFAQ 4LF8F 3OFGA 4ALZA 1JLCA 3Q0AA 3UCZP 1NJIT 1RTDA 2ZH2A 4ZVHA 3FMWA 2CQDA 4IR1A 3M8QA 5GADU 2EW9A 3QJPA 2J9EA 2PDAA 3D1HA 1KOHA 2VFRA 1OSCA 2HNZB 4CI0B 3KJVB 2B43A 3UE2A 2BJEA 5AXLA 2B4UA 2AJ0A 2MSSA 2MKKA 3DYAB 3IFEA 2K7JA 4YQWA 2N4CA 4PUOB 1M5KC 4KQZA 2F8EX 5KFPA 4QYZJ 4J9NA 1QVFR 3NCPA 2VG6B 2W7AA 4A46A 1VS3A 1R31A 4ZPCA 2HG4A 2WB1D 2GJ2A 1BGXT 4IH6A 5GAGU 4DV0F 3MOJB 5I3PA 4RNMA 1VOMA 5D4LA 2R8KA 3D0IE 2PIIA 4LIWA 1BY9A 3BN4A 3FRZA 3GFHA 1SL0A 5F8IA 4N77A 3HHLA 4NYOA 3KK1A 4DUZF 1JB0C 4ZCIA 4QIWD 3CJKB 4C2MA 1JX4A 3PJWA 2B4OA 1XBWA 3NRBA 3M8SA 4G6VB 4HYKA 3JTNA 2NZ4A 1NJYA 4B9UA 3HFKA 4ZK7M 4X4TA 3HVTA 2PA3A 3ISND 4X4PA 2DR8A 2RJZA 2AYGA 4XAKA 2FVCA 2AJ1A 3CDWA 4ZHRB 3CCJS 2XI2A 1RI7A 5T41A 2E9TA 2J6UA 5KFVA 1WI6A 4WE1B 1QE1B 2DNOA 1RA7A 1QAYA 3NAHA 5EWEA 3KLHB 2MXYA 4IH7A 4WXWA 3NCRA 3H5XA 4C3KA 5CZVA 2D3OR 3JSMA 4LJMA 3D0GE 3KFWX 4C7QA 3CJ4A 4K4XA 1YI2S 1LW2B 4ZVEA 4FVMA 5KFXA 2M88A 2B6AA 2MKJA 2FLLA 2HGMA 4O3SA 2DNZA 3QIPA 2XLKA 3N0VA 2E1AA 4WZMA 2EK6A 4QR2A 5F9LA 3G71S 4B9NA 4W92B 4ED6A 2YKPA 2BUNA 3H98A 4PG7A 3OFEA 4CO5A 1U1OA 3NMAA 4I2PB 2QE5A 5KFIA 3GR1A 3TVYA 4QWCA 2W9CB 2HHHF 2FDNA 1RT3A 2RQ4A 1RT3B 2JOQA 3CTRA 2D9OA 3N6NA 2V5HG 2MZQA 5SUHA 5KFHA 1FE0A 4X65F 2OTJS