4B3TF

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b3tF00
4B3TF 4OX9F 1IBMF 4DR2F 4NXNF 4YY3F 2UXBF 1QJHA 4LF9F 2B7CB 1RISA 2VQFF 1N34F 1IJEB 2E5LF 4B3SF 2UUAF 1IBLF 4DR1F 1I94F 4B3RF 1N32F 1CQNA 4DUYF 2J5AA 4LF4F 2YY3A 4DV1F 2RJZA 4DUZF 1HNWF 5BR8F 4DV6F 1VMBA 1IBKF 4JI1F 4DR5F 4JI3F 1XNRF 1LOUA 4GKKF 5LMUF 5LMNF 4LFCF 1XMQF 4LF8F 4GKJF 1G7CB 1F60B 2HHHF 4DV3F 1FJGF 4JYAF 4JI8F 3T1HF 1FKAF 2UU9F 4JI4F 2UUCF 4YHHF 4DR7F 2KJVA 1J5EF 2F4VF 4X65F 3OTOF 1CQMA 4JI2F 4DV2F 2BXJA 1B64A 4B3MF 4X64F 2ZM6F 1XNQF 4NXMF 2B7BB 4JI6F 4DR6F 4LF6F 4JI0F 4JI5F 4DV5F 4LF5F 3R3TA 4LFAF 4JV5F 1GH8A 4DR4F 1HNXF 2KJWA 1HR0F 1G1XA 5AJ3F 4K0KF 4X66F 4DV7F 3T1YF 1XMOF 1HNZF 4KHPF 2UXDF 4LF7F 2BVZA 4LFBF 1IJFB 5IWAF 2UXCF 4DV0F 4X62F 3ZZPA 4AQYF 4DV4F 4DR3F 2UUBF 4JI7F 1N33F 1N36F 2VQEF
chains in the Genus database with same CATH superfamily
3OUYA 3J7AN 1SUQA 2KN4A 1ZOTA 2KKHA 4ES3A 3KLIA 1VQ9S 1N56A 5M2RA 3MEDB 1HHSA 1QDUB 1CQNA 3UWTA 5GADI 1S57A 2QL5B 2K06A 3KTQA 2AT1B 1H3DA 1UVJA 1RAHB 4BDPA 2BJDA 2JJ4D 2RF2B 3BQ2A 2HHSA 1R7IA 3WIVA 5A2QY 1N88A 1WDDA 1TL3B 3PJXA 2J7KA 1VQOS 4ZCIA 4BWJA 4LSLB 2GFFA 1Y9OA 1JMTA 5E41A 2LA6A 1VBXA 4TXSA 5CXTA 4PG7A 1RWOB 3SFUA 2ZDPA 3KLEA 4YOEA 1C4AA 3UD5A 4TLRA 4DS4A 2YKOA 1N5SA 3PKMA 2D9PA 4C0BA 2PMZD 1Q16B 1Y5LB 5D78A 2L9WA 3ZXWA 5A8KB 1FWPA 2LA4A 3PRDA 5G0RA 3K2YA 4I69A 2R7SA 1U09A 4DQPA 1DHMA 4DZ6A 3D0GE 2MQMA 4K4TA 2CQGA 1X4FA 3DLGB 3RAMA 2I6WA 3MM5B 3HK2A 2JVOA 2P2CB 1WKKA 1UWBB 2H9ZA 2IRXA 1NZ8A 2WBRA 1JXLA 4JI1F 2XO6A 3IBCB 2AYMA 1S6OA 4PABA 1L3TA 3MPWA 2KXHA 3M05A 1SV5B 2FZGB 2DY9A 2EK6A 3ZZYA 3IXQA 5IS2A 2DJWA 2MKYA 3MCOA 2LXFA 3SDEB 3GR0A 4ECRA 3TZZA 1FXDA 2RSQA 3AT1B 3C15B 2EEYA 4YDXA 3QMQA 4C2MA 3MD3A 1NO8A 3R9LA 4YDDB 1VK3A 2DY1A 4FF1A 2WVFA 3RBXA 3CUNA 4ZN1A 2A6OA 1FKPA 2A2CA 2DH7A 2AD9A 4L75A 1VQKS 1KKHA 2G2OA 3GV8B 5HMZA 4DFJA 3HI9A 5FLXU 3BS9A 4DU8A 1TVRA 2EKNA 2WBMA 2HHQA 1WG1A 1IQZA 4F67A 1RACB 2DPJA 2OSQA 1RJJA 4G6VB 5F9NA 3KUGA 3MPUB 4RNNA 1JLGA 2CUYA 3N01A 2R9LA 3IR6B 4WU3A 1QAJA 5A0YA 2ZJPQ 1T9UA 4Q8FA 4WTYA 4EMDA 4YHHF 4KE5A 1IKWB 1HW8A 4EBCA 2C3MA 5KFDA 4OZ1A 1KNZA 1NKCA 4M5GA 4Y2CA 3SBMA 2L48A 4P73A 2E1CA 1K8AT 3R1HA 2OP5A 4PQAA 2BJ8A 3PJWA 2BQ3A 4KGMA 2XNQA 3AQOA 5L1KA 1HNIA 4ED0A 1P1TA 3C14A 3BZQA 4DN0A 3PIPQ 4KT0C 2OKQA 1F5CA 3QT8A 4IQXA 4C4WA 4IUFA 3AH6A 1IBMF 1RWVB 3RB0A 2HZAA 4ICLA 1PBUA 4CDIA 3E8OA 3DM2A 3S8SA 2MKJA 3D28A 4K8RA 1N32F 2RU3A 2C2DA 1FO1A 3L7UA 3DOMB 3KHGA 5DLFA 4L72B 2VJVA 1RADB 4D3HA 3R7NB 5C42B 2K3IA 4GVBA 5HLFA 3KWMA 4RW7B 5IXUA 1CC8A 2ZBRA 3DLKB 3I87A 4B9MA 3JQKA 1IXKA 3M6WA 3MM7A 2VG7A 2F8HA 4ZJOA 3GJRB 2RRAA 2D41A 1FI4A 2QGFB 3OXFA 3IRXA 1NK6A 2MJUA 4ZVOB 3GV5B 4MKYA 2F8EX 2FHJD 1N32J 1GTEA 5F0WA 4IRKA 5C2GA 4A46A 3G6XA 1DRZA 4A8SA 2V8GA 4AE5A 1NSKL 2MXYA 2KG0A 4WZMA 1PJ5A 4JI0J 1PAUB 3ADAC 1S9GB 3M2RB 5I4MA 4CTAA 3CVKA 3MI7X 1NK5A 4DCOB 4ERDA 1S1TA 2KZZA 3DRPA 2UUAF 4FKYA 4EUVA 2MLXA 2ZJQQ 3FBEA 4ECZA 2CYYA 5IT9Y 4Q45A 2NXJA 3ZNJ1 2J0XA 2FDNA 4PWWA 3N9UC 2W4DA 2WZ1A 3FMWA 1SL2A 2C28A 3RG6A 4HH0A 2R2UA 3BN4A 4ZJQA 1RAFB 2GVDA 4E0DA 4ECWA 1N6QB 5DDOC 4J9PA 5A8WB 3I31A 3RBEA 1N54B 3R3TA 3PDNA 3DYAA 2ATCB 1HR0F 2Q79A 2AJ2A 3AOAA 1VIOA 1N0UA 1C4CA 1DTTB 3P3DA 1VQ6S 1U24A 3OHBA 3T6JA 2BANB 2OFHX 3OT9A 1KWMA 3KJVA 3WC0A 4KYZA 2CPFA 4RNOA 4H4OB 3BQ1A 2NZ4A 2JEGA 1SQFA 1T3OA 2GW8A 1AUDA 2XNRA 1PYTA 1KFDA 2OD4A 1HR0J 3NMRA 1UA1A 3FMBA 3HSDA 4LRBA 3C19A 1U48A 1TTHB 2VA3A 5GAEI 2DHSA 3DLBA 4TY8A 2BUNA 2DD8S 4OHWA 1NK0A 1RBLA 3POTA 2ZDOA 2DR9A 2DISA 1B64A 1LQ9A 3TVYA 2L9DA 2VG6B 3WZ0A 3ILJA 4CZCA 2DR5A 3PY8A 1DLOA 1FRHA 1MU2A 4JUZA 3I9V9 3GJQB 3MAAA 2AX1A 1H98A 4ES1A 3CD6S 2MZ1A 3T9NA 1S7HA 2B9WA 3ICLA 1IR1A 2VUGA 1ZETA 2DGUA 2XC9A 5A2QU 2DNZA 3UN3A 1BLUA 3VZIA 2W9CB 3QRQA 1JXEA 2NUHA 3BREA 2QIFA 1DZ5A 3MMAA 5LXRA 2DRDA 1JLQA 1L5UA 2X1FA 5ETPA 2VOOA 2YH0A 2G2ZA 4YR3A 1W26A 2WONA 1RHJB 1SL1A 1CULA 3LAMA 5D3GA 2VFTA 4USMA 3CJTA 2E1PA 1NHUA 2DR7A 3H4BA 1NHKL 4LQ3A 3B8HA 1N5YB 1HWIA 5HP1A 4X64F 5LSRA 2IC3A 3UCZP 4MFBB 3VWSA 3CC4S 1TL1A 1HLWA 2KZMA 1TFYA 3ET6B 1KS2A 3VCDA 4RW6A 4Q44A 1M5OC 3WX4A 2RUGA 2VJUA 4U95A 3RBDA 2HK2A 1NSPA 4DFKA 2G4BA 2YNFB 2VKRA 4WK1A 4M5NA 2JNJA 2GGPA 1PAEX 3HKWA 2ZZTA 4J9VA 5SUHA 3TA2A 3IBWA 4X4VA 2WSCC 1Q8IA 2HHPA 4MKVA 3SV4A 4X64J 4B3RF 3BH6B 2LXIA 2AEMA 3CSKA 1N36J 1T94A 3THTA 4FYXB 2IM2A 1SKUB 2WTFA 2HZCA 4DQRA 2BE7D 1SJ4P 2F40A 4XDCA 3HFKA 2DITA 1V3ZA 2FGCA 4UT4A 2WSEC 5T41A 2N4DA 4E8UA 3T6BA 5HBMB 2UZAA 1OY9A 2LU2A 2J0QD 1Q8LA 1M90T 3GIMA 4CLYA 3GONA 1RWNB 2RHQB 4IQMA 5A8RB 2C1EB 2K2PA 4IG0A 3V6KA 4B3RJ 3CJ3A 2HNZA 5GAGU 5MLCV 3A12A 4JI4J 4UZBA 4DCJB 1ZH5A 2ZZNA 2IM3A 4G1IA 3MECB 5LOQA 3PHEA 2H48B 4FXVA 4K4SA 2LMIA 1UJ4A 2P9CA 4UOCA 1YRXA 3FEYB 3ZTRA 3THVA 4OX9F 4FPIA 2JEJA 2XS2A 4HT7A 4MYUA 1U1RA 3TUPA 1N34F 4IH7A 1ZBTA 1LWEA 1U6ZA 1RT7B 4BWMA 3QLHA 5E7OB 3PZPA 3S6EA 2YVSA 2C2MB 1N0VC 1NH8A 3R6GB 3JXOA 4WP8A 1VBYA 2I1RA 5F8MA 1J5OA 8AT1B 4PXEA 2CXEA 2KFNA 3I5BA 4NX9A 4QOTA 4QW8A 1AFIA 4CO4A 1D9DA 3R5DA 2RKIB 2I0XA 2OAUA 2MQPA 2HW3A 1NNDA 2NLWA 3AJDA 1ZPVA 4NXMF 1Y5NB 3H5UA 1Y11A 1VS3A 4ZVFA 3QZ7A 1N34J 3HDSA 4OV1A 1RCXB 3FRYA 4HI1A 4LFAF 2K7KA 2ZFHA 1GXTA 1R31A 2M8HA 3BSOA 1HBMB 2OTJS 1VLYA 4I7FA 2OFGX 3AOCA 3U1NA 4DZDA 3MM9B 1U47A 1RHRB 4X62F 3CCLS 4ZMMA 4ZCKA 1UEKA 2QMWA 5F8HA 4YB7A 2FJVA 1WDTA 2E5JA 3ITHB 3DGPA 2MQLA 2JWNA 2LEAA 2X7IA 3KK3A 4NXMJ 3BGLA 5KFWA 4LFAJ 4NPOA 5D0GA 1S9EB 2XSFA 1OIAA 1W25A 4PG4A 3M9OB 3K5LA 5DZ7A 1Q8BA 1T3NA 4X62J 2HNDB 3ZZOA 2YKPA 1G2EA 4QWBA 4CLLA 3L9ZA 4ES2A 1M1KT 2B56A 3QRRA 3MR7A 2B4OA 3GU0A 4CLWA 2O01C 3QNWB 5ETTA 3ILOA 1JQGA 2R7TA 2Y0SD 3MMCA 2Q43A 2UUCJ 4RW8B 2HVHA 4MMOA 5IT9U 1CJKB 3QT5A 1SI9A 2YPYA 4LRAA 4K4UA 2HGLA 3PNIA 1K0VA 3LQVA 4K4VA 1JLAB 1NDKA 2GZOA 2MY8A 3RB3A 4W90B 3DI6B 1NLKL 3CCRS 3R7SB 2YWHA 3KJFB 1AXQA 1FKOA 4LT6A 2DHXA 2R42A 5AT1B 4P2FA 2PO4A 1RU1A 2HVEA 2DK2A 2IHR1 1GX5A 2LU1A 2XZWA 4ZVGA 5I3UB 1OPIA 1E6YA 3TOQA 2H4YB 1V3RA 1HHTP 4LQ9A 3EUNA 1I6JA 2HQCA 2Z56B 1A6LA 3MCSA 3HX9A 4LIRA 2HFUA 3M30A 5KFXA 4ZPCA 3OVSA 3ETMA 2CJAA 3H98A 3OLAA 3HT0A 2FD2A 2KJWA 1SKRA 3J7ZT 5KFHA 2FC8A 2ZKUA 1HMVA 4YP3A 4A8KA 2HS4A 1RT4A 5B08A 1T7PA 4EWTA 3E01A 2MJNA 4AXIA 4URSA 4USTA 4DQQA 1UVIA 2CPYA 1VRTA 4NCGA 2MZRA 2XHCA 1VRUA 2G1DA 4MT1A 3KLFB 3V81A 3BBFA 5HN0A 5BR8F 1URRA 4I6WA 4WTOB 4FS2A 2ZZMA 5HANA 1EKSA 3EM1A 1UVKA 2DNPA 5CA5A 1IM6A 1SJQA 3CT9A 4N77A 4NLOA 5L46A 2JH3A 4TYAA 3QIPB 2K7JA 5HMYA 3Q2TC 1WOOA 1FX2A 4DSJA 3FZBA 4PYDA 1Q7LB 1WSRA 4ZIWA 3GB0A 5B09A 1EP4B 3IC1A 3BJYA 4HHUA 1X4GA 3OLBA 2CJBA 4DSIA 4PXBA 4DR7J 2I9SA 1XMBA 5BR8J 2V8DA 2IJRA 3ZTPA 2B0GA 1Z1ZA 1WACA 2HS0A 2YQ1A 1YJVA 1KOOA 3I5AA 1NAQA 3MM6B 2CADA 3W8PA 3G8SA 5T7LB 5AE2A 2E5GA 1HBNB 4CO0A 3JSBA 3HHLB 3UD4P 5CYJA 1WKJA 4USWA 2V0NA 2JC0A 4JI7J 1BXNA 3CCWA 1NJWA 3C6UA 3KNGA 3OVAA 3BKUA 4K4ZA 4Y2MA 2GVZA 4KH0B 3DLEA 4DLEA 4QWEA 3CJKA 4QR1A 5DETA 5CABA 2NSBA 3C46A 5CCLA 2A10A 3HVWA 2GCFA 5AXKA 4H4MA 4X65F 1SJFA 2XSJA 4ATNA 3ZTOA 1ZA2B 4LF5F 4K50A 4OQJA 2PFDA 2VC0A 5E3AA 2DRAA 4IOAQ 2V4RA 1IKXB 1FF2A 2CIMA 2KXFA 2GJ2A 1GEHA 4DOZA 4ED4A 2HYIB 2AZ1A 3NGRA 2ZOFA 3KLGA 3RTVA 1GQEA 1S76D 2IMWP 1NPPA 1Q8KA 2J0WA 4C8OA 5CAAA 3PW5A 1IWGA 4RNMA 1B0VA 1IN0A 3LALA 5KFQA 4IFVB 1RTHA 3HJVA 3H2LA 2Z2ZA 3K8VA 4DR1F 2HEKA 4ZKAA 4LF5J 4R8UA 1ICEB 1CC7A 1CSJA 3L09A 4CT8A 3E2EA 3QO9A 4KKOA 5H9FK 3RGIA 2HHWA 4S0MA 4LF9J 2R8HA 1RWKB 4OYBA 2M70A 5KFOA 3JS9A 3SSRA 1UFWA 3MCMA 4Z7YA 1TKDA 3MURP 1S12A 1ELOA 4B17A 4C8YA 5F8JA 3UVJA 4DR6F 1TELA 2Y1LB 4HLBA 5FJ4A 1WC5A 1KOHA 4NYZA 1X31C 3DLJA 5L8RC 5DQIA 1VQYA 4WK3A 2VPWB 2F1FA 4MKAA 3EYZA 2JLGA 4USJC 3TAMA 3NL0A 2XLJA 5J2MA 1HQ2A 3OTDA 3IAM9 2CPDA 1CPZA 1LW2B 1HPZB 5KT5A 5ETMA 4A8OA 1EETA 3LP0A 3B4MA 2RRNA 3ONQA 4U7UK 5FDLA 2DTJA 3D6MB 2XCPA 3AQPA 1F1BB 4FYWB 3W9JA 2BOAA 4CLTA 1YKWA 4ZLLA 4EFAC 4C3KA 4USUA 1EKRA 4NYPA 1FE0A 4ZP8A 3RB6A 4A48A 1FFSB 4DF8A 4WFNQ 3VAIA 1SH0A 5GVQA 1SQEA 4K5RA 1JXVA 3OSNA 1X4CA 2CJXB 4HHJA 3CXCR 3A1YG 2DGTA 4LIWA 1TUWA 2YKMA 2DGVA 1X60A 3FQKA 1JLCB 2BZ2A 2QG9B 3LH2S 1NPKA 3H2VE 4YUDA 4JI5J 3JTOA 4KQZA 4L76A 1LV5A 1C0TB 1FEEA 4O23A 2N3LA 4F4WA 3HFZB 1Y4ZB 2QZ8A 3I0RA 2XM3A 3M2UA 2VFRA 2JEIA 2DXDA 3K5NA 1CS4B 2W7AA 1DTQB 2ROGA 2V2QA 1YQHA 1XNRF 1VQSA 3MEEA 3JQJA 1WEYA 1NDCA 2IRYA 4PKDB 1UPMB 1S7IA 5C24B 4OX6A 2R3VA 2RQ4A 4QR0A 1S9FA 2HVZA 1MLAA 4A8XA 1T9VA 1U0HA 2FGOA 1HNXF 4YB1P 1SH3A 1WSVA 4FNIA 3PRVA 3L7PA 4F2SA 4ZPWR 1XNRJ 2HGMA 3W63A 1BQNA 3DRYA 3M32B 2V94A 2LFVA 2QO3A 2BKOA 4PWDA 4P74A 4QJVA 2AJQA 4ANCA 1FERA 3OTEA 1MN7A 1X9WA 1RWXB 2DKOB 3DHWC 4DG1B 4IFYB 4CLZA 1GAOA 1W2IA 4LJMA 2ZHBA 1AA1B 2HZVA 2DNKA 2BE2B 2HMIA 3BH7B 1WHVA 2GHVC 2RNEA 4ZIVA 3BPSP 1U1KA 2YNGB 3EZ5A 4DFMA 2NR0A 1VMBA 3PYGA 3M8PA 3NNAA 4I2PB 4EBEA 1AZSA 2HNYA 1TAQA 3UN2A 3TUIC 1SC4B 2P8IA 1S0MA 3GFZA 5HQ8A 1RTIB 1GT8A 2ZH1A 1CQMA 5I42B 2G2YA 3H25A 5HL7Q 2ZH3A 1T0TV 2B7BB 2EPIA 1RA7A 1TV6A 1SL0A 4KB7A 2H4WB 2ZH6A 3R1LA 3V6DA 3H20A 2BYCA 1NRKA 4O4GB 1XMOF 4F26A 1L3VA 1VK8A 2CNOB 1ZAXA 2FJWA 3OQ2A 2VBYA 3MEGB 2IJFA 1CG2A 2WSFC 1S6PA 5EWFA 4QU7A 4AXJA 4U6PA 3MPYA 2YNHA 2MYFA 5A76A 5F8LA 2HFZA 4HACB 3N0VA 2V63A 1M5SA 2J9CA 2YNIA 1U6FA 2HHTA 3EZUA 2J5AA 3BSAA 3PW7A 2FLNA 1M5PC 3THPA 2XCAA 5DDRC 2V4JB 4NASA 6FDRA 1P9YA 1E6VB 3EWGA 4OMFG 2DEIA 3OFGA 4DV3F 3KK2B 1PO6A 2RMLA 5GMDA 2OPRB 3IS9A 1ZA1B 3GR1A 1HBUA 3KKFA 2FJXA 3SCJE 2WAQD 4F04B 5KT6A 3NCPA 4JI2F 1AUSL 3TP2A 3GCWP 4I67A 1TL7B 3LGHA 1KVKA 3PJ9A 4Q8EA 5DS7A 4HTJA 4J91A 4B9NA 1S1VA 4WXOA 1WHXA 2J8AA 1RKIA 2BJ7A 5JJBA 1IUJA 3M9NB 2P6SA 2WVDA 1IWAA 3I5CA 3F56A 2VKZG 5B0AA 1TKZA 4G1PA 3ZZ0A 3H5SA 3C16A 3FJ2A 3QQCD 2V2ZA 2WB4A 4NZ7A 4DV3J 3PR5B 4FYYB 3GFHA 4FF3A 1KQGB 2D9OA 3Q8SB 4ZPBA 5K8NA 1WTFA 5B0BA 4B9LA 4JI2J 1VQ4S 2DCUB 1IJEB 1S5ZA 1I94F 4AUKA 3VHQA 4IG3A 1CEZA 3CDEA 5KG0A 5CYQA 2W25A 3MTJA 3NCRA 4ZP9A 3W5XA 4WP3A 5CD4H 3QJLA 1OMSA 2V69A 4NI2B 3MMBA 3FSXA 3EMTA 3CGIA 1HYSA 5JMNA 2HBZB 1NHVA 1Q95G 1PIEA 1ZM9A 2C2RA 4KV8A 3W64A 1XJWB 4ED6A 7FD1A 4G1QB 4D3GA 3FK4A 1R8BA 5F9LA 1P8GA 3W62A 5DM6Q 1TMMA 3DRSA 3DOKB 4DF4A 2IBKA 4PUOB 4J90A 4LVNP 2AYBA 4RKUC 4B3MJ 1XNQJ 3RUBL 1HBOA 1M5HA 5KFRA 1HWLA 1QAIA 5DGAA 3D66A 1WOSA 4X4UA 1DQAA 1HQEB 4QPXA 4KHPJ 3K0JA 1V5IB 2BJ1A 3UDLA 3JTPA 5D8HB 3AHPA 2NREA 4P72A 2MHNA 2M5YA 4ELTA 4HVZA 5HROB 2R8KA 3FEZA 2B6AB 3GILA 2YTCA 3TQEA 2R7UA 5LMNF 4M5MA 1QUPA 3MZIA 4NA3A 4KPYA 2EFGA 3VGTA 3G8QA 5AXMA 2H54B 3NS6A 5THWA 2CDRB 1RWWB 4O44A 2G1HA 2IAJB 2HSEB 2ASYA 2DHGA 4ED2A 5KFYA 5KT3A 5GADU 1XMQJ 1ZZFA 1VGYA 4DL3A 2DGQA 4OLPA 4ZK7M 3NLCA 2EG2A 2HWTA 3BGRB 1S10A 2YWWA 2FHKA 1TKXB 3NG8A 3M1VB 2KFYA 2OH2A 3M8QB 3MEDA 5LMNJ 1WG4A 5KFMA 4IH5A 3QIDA 1MROB 2CNNB 2LP4A 1YSJA 4H54A 1SC3B 1C2PA 3TX8A 3W7BA 1QSSA 2E5HA 2J6UA 1H7WA 3Q8RB 5A6PA 4M5IA 2RF2A 4J9NA 3K58A 4Y2KA 3JAMY 2F8MA 1TL3A 3TZYA 3D68A 4J9MA 3VGSA 4X4OA 1KHWA 4MIBA 4LSLA 5K9FA 3CPWR 4WE1B 4B08A 4FDFA 4U67Q 3JB9k 2HHHF 3HD1A 1FDDA 4LF2A 2DGOA 3S1TA 3V5RA 3L4BC 3NXZA 5C2CA 2ZBQA 3CJ8A 4UTGA 5A8KA 3M8SA 1KLNA 1K1SA 3Q8PB 4KAIA 4Q0BB 2GHWA 4QPTA 2ZBPA 4M5JA 3GJSB 1RTDB 3BKTA 3IO1A 1U2CA 1VOMA 3M4XA 4OYOA 4F4ZA 2E9RX 3DLGA 3MM5A 1R6YA 3RRHA 2HHHJ 3DDNA 2XI2A 2XS7A 4C97A 5KG1A 1UWBA 4DUTA 3QBCA 2HAIA 2L3MA 4LFBJ 1VRQC 2X1GA 5E3CA 3CCSS 4OHVA 1SV5A 2EWHA 3I9ZA 4IR1A 1D9FA 3SDEA 1RT5B 5LMUF 3NAIA 3WC2A 3R5AA 1DBDA 4LBIA 1G7CB 4B9SA 1F60B 4U9RA 3C15A 1WD6A 3KYLA 1RT3B 4KH1B 1GTHA 2DNHA 5CZVA 5G4DA 3EXCX 2VIHA 1A0OB 1V9OA 4NZ0A 5ETOA 4V1Ak 1KEKA 4RW4B 1QSYA 4DV5F 4ZCLA 4PQUB 2VBXA 2Y9HA 3C3LA 4OLOA 3P8BB 2ZH2A 1HNZF 3NWGA 2CPZA 1WC6A 3GYGA 4NRTA 2HHXA 2CZVC 3BGFA 3PW4A 2FQQB 5LMUJ 5RUBA 2DO0A 1RBOB 3NGTA 1Q4RA 1CJVB 3R27A 2BOPA 5GAHU 3PKYA 2J9EA 2VPYB 1S99A 2D3O1 3Q0AA 1VC0A 2FLLA 3FEXB 4B3SF 2HBRB 1CJUB 1XR5A 1RWUA 2PI5A 1QLNA 3OFHA 2DBBA 5DQGA 1IKYB 4DV5J 5KFVA 2VICA 5BYSA 2GQQA 1SJRA 1IKWA 2ILZA 4A8MP 3S01A 3PW2A 1SKWA 5K5MA 3EGNA 4WYLA 2YQ3A 3TUZC 1RWMB 3KDNA 4PR6A 4USVA 3OJUA 1OJ4A 4BBYA 2CQ0A 2A18A 4AL5A 4BHQA 3IWXA 3CDBA 2HVDA 2B8PA 3GLJA 4B3SJ 2J9DA 5J1EB 5K20B 2ZD1A 3IAS9 4PWUA 1NPRA 4KHRA 3Q89A 3AD9C 4AL6A 5ETVA 2MZJA 3PFEA 4ECVA 3MUTP 4MAKA 2QC3A 4IOCQ 4LRDA 4FN5A 1Q82T 4OI1A 1LW0B 2Y1RI 3CDUA 3DOMA 1NB7A 2PMHA 3HCXA 5KFIA 2UXBF 1FRIA 1X4HA 5C42A 2CJYB 4DCPB 3OV7A 2XHWA 1G6BA 4RW7A 3QATA 4OI0A 2CQCA 3DLKA 4TQSA 4HI2A 3M6VA 2GV1A 1F9FA 2JEFA 2PA8D 3A3PB 1NK8A 4LSNB 2FZCB 3X1LB 2HK3A 1QM9A 3ZO7A 4JYAF 1FK9B 3RRGA 4UOGA 4ZVRB 5E3RA 2VHGA 3VGUA 3IM8A 1SH2A 1YGYA 4DUZJ 5J2QB 1FDBA 4YR0A 3UDCA 2WB1D 2H5JB 3BGUA 3Q8VA 5DQHA 1KHVA 3FCWA 4NA1A 2Q1LA 3KOAA 3H59A 2RS2A 4Z2XA 4OZ2A 4L73A 1S9GA 3M2RA 2HRUA 3O2IA 2BMBA 2GQCA 4DV0F 3JYTB 2HQ3A 4LF1A 4MYTA 3NGKA 3J7A1 3D6HB 3NKYA 2LKZA 2QMXA 3KJNB 2LLZA 1FD8A 3M8RA 2GHPA 5F41A 1D1UA 4NLWA 3V2UC 4DUYF 4NLUA 3EPGA 3HJFA 2XBPA 2VF3A 3SCIE 3G71S 1TK8A 3VVUA 1SC6A 4O3QA 2EW9A 1N6QA 4WZQA 4WF9Q 5A8WA 1HQUB 1IQTA 3HVRA 2PT0A 1FJGF 2GO9A 2MY7A 4DV0J 3FDSA 1H0HB 1R8HA 3IG1B 4DPWA 2GGPB 5LM7E 3N6NA 1UFKA 3BR9A 4ILLA 3CJ2A 3CCZA 4O0NA 5H1SV 4A8QA 3T1AA 1BUXA 2CPIA 2VDHA 5IZHA 1DTTA 4OZJA 4K4XA 4AL7A 3OTBA 3GZ7A 2UU9J 2BANA 2AJ4A 2OPQB 2QL7B 1FA0A 4IKAA 2QMUB 3FCHA 3EVWA 4H4OA 3W1YC 2BVZA 1VCTA 1K47A 5IWAF 2R7WA 3DXSX 4DR3F 2QV6A 2QLWA 3VAKA 3H4DA 2YWEA 1J27A 1MWYA 1FJGJ 2CVIA 3KK1B 1T9XA 1VQMS 2VH7A 3T5LA 3QRPA 2FHOB 1RBAA 4ZVEA 2VPZB 2ASJA 3RR7A 5D0RA 4V19X 1KTVA 2GAHC 4P71A 1U1MA 4ZDNA 3NY0A 5D4OA 1S48A 2EK1A 5ITHA 3LWMA 4EEYA 1B7YB 3RU0A 2ALYB 3ZZRA 2QA4G 3AOBA 2DGXA 1VBZA 5DDPC 1DY3A 4UY8T 2VG6A 2U1AA 1U8SA 5EHHA 3HP6A 4OI3A 2M0GB 1JLEB 2KFZA 1MN9A 4YB6A 2E1AA 2R2SA 5GAGI 2KTQA 1RAGB 4L3KA 2ZITA 3L3CA 1S6QB 2CQPA 4JBCA 2RH3A 3PIOQ 4N76A 4MK8A 4CRJA 3BB5A 2KT3A 1NUEA 4R5PB 2W9CA 5HQLA 4W92B 4I6AA 2OI2A 3AJ1A 3G2XA 4DL5A 3NGSA 1UETA 1NCLA 1X5OA 1WI6A 4NXNF 3ILIA 2M52A 3AD7C 4OJ3A 3CC7S 1HD1A 4Q7AA 2FVQA 1FFWB 1TKTB 1REVB 1U25A 1GFWB 4OV6A 3ENAA 1SIWB 1S59A 3C6TB 1N5YA 2I8EA 4Y00A 3QWPA 4ANDA 2OEMA 2XYHB 1HHQA 3P5TL 5F0UA 4MFBA 4FYDA 3DNCA 2JRSA 1JX4A 3ET6A 1TL5A 2ZM6F 1WF2A 4QIVA 3A8EA 1M0SA 2BW7A 1YWXA 2YNFA 5E5NA 1KLMB 1LWCB 5AJ3F 2PSZA 1FRKA 4CO2A 3KG1A 3NGDA 1SKSA 2UXCF 5M2UA 3J80U 3HSJA 1UEVA 4TN2A 2IVFB 1NK7A 4Q2LA 1RB0A 4F4KA 5E33A 1RI7A 3NP5A 2PMWA 2B51A 1RAJA 4K0KJ 4QYZJ 4DV7J 2XMMA 3B82A 2ZOMA 4CQ1A 3G96A 4U8YA 1JKHB 3QJJA 4HT5A 3MWBA 2ERRA 3U1MA 3CF5Q 2KRRA 5HBMA 2MQNA 4LF8F 1TUVA 2IA6A 3KUEA 2ROEA 5A8RA 1RK8A 4ZP7A 4Y3CA 3BEGB 2RD5C 3KJQB 3MECA 1XN9A 4EGLA 2YBVA 4JV1A 4JP8A 3J7Z5 1GMWA 3ZTSA 3JTNA 1NSQA 2IRUA 1H72C 3IM9A 3KDOA 4LF8J 4NMLA 3JSYA 3G6VA 1BE4A 1B70B 4Y65A 2RT3A 1NKBA 5H9EJ 2ZNZA 2XS5A 1PJ6A 1VBKA 4RW9B 1IVZA 3FUYA 2R7QA 1T8EA 2XGPA 1IBLF 2R8GA 2FVSA 2KO1A 4CCHA 4OHYA 3SXLA 2F4FA 2XYGB 2DVIA 1EX8A 1HI8A 4UUWA 2RKIA 5KOWA 3HVTB 1UAWA 3KG4A 2E1MC 3CCMS 2F4VF 2DNNA 2ZE2B 2QEXS 4QBUA 3TJAA 4Q43A 1HBMA 3T5KA 4JI1J 3MMJA 3MM9A 1F9HA 4I0WA 1RP5A 2KM8C 1WEZA 1R0AB 1LWFB 1NMEB 3T41A 1N4LA 4N7TA 2E1RA 4X2BA 5ETQA 2BM0A 3GQCA 1OS5A 5IC6B 3D3BJ 2NXNA 1WWHA 5L9NA 3G86A 3ITHA 2LQ8A 1MSWD 1U1LA 3UE2A 2ZH5A 4M5DB 3CJ0A 3TAPA 4K2XA 3GYNA 2F4VJ 1S9EA 2G0IA 3BV8A 2IJNA 2Y0BB 3ULHA 3TARA 3N79A 3CD7A 4DSKA 2HNDA 3IFEA 1TP7A 3HHLD 4QIWD 1JLBB 4EI2A 3H7HB 4ZVQB 2OTLS 4KGZB 2D69A 3OTCA 3TW0A 2EFPA 1X9MA 2WOMB 3VAGA 4C8NA 1VI7A 3W66A 4RW8A 2Y1IA 2U2FA 1MNEA 4OYMA 3A3NB 1CJKA 4XPEA 3KG0A 1DQ8A 1U6BA 3D6TB 5KG2A 2GNKA 2HFVA 3I0SB 5EX0A 5IV4A 2XMWA 4YHHJ 5IOLA 3US5A 1JLAA 4DJBA 3PX0A 5LSOA 4K4WA 2WW4A 3DI6A 1PC5A 3R5CA 4DPYA 1IM4A 2DNLA 2V50A 3AD8C 3D1QA 3VAMA 4LMZA 1FNOA 5C25B 3P6YC 3JSRA 2MB0B 5I3UA 1I51B 3M7VA 1OWXA 4JI3F 1IBMJ 4J9UE 4L74A 1FJ7A 3J7YU 1XTZA 1KP6A 1ZAVA 3CMES 4EK2A 2EFQA 1I5OB 2FLPA 4I4BA 4PXDA 3CIMA 4WFYA 2X1AA 1QE1B 4ILMA 4FZVA 4Y6IA 4TU8A 4M94A 2MLYA 1GXUA 4YR2A 2E7WA 2RVJA 2NS1B 2LCWA 3D0HE 2MEWA 5C7PA 4X4PA 3IN5A 4JI3J 1OPZA 4O0IA 4CNYA 3CEDA 1Q78A 2FLOA 3RR8A 4TU9A 4R25A 2C2NA 2R2TA 2B4VA 3KLFA 2YWFA 2IM1A 3VTIA 2B3TB 2F9DA 2FJAB 2C3OA 4U7UD 2LEPA 4MIWA 2QTWA 2QLBB 4I1TA 4M5LA 1WC3A 3QIPA 2F3JA 3EVMA 2YX1A 4KO0B 2C2EA 2XMVA 2N82B 1RTJB 1Y0HA 2W2NP 3AY0A 2UUAJ 1QTMA 1EP4A 1P27B 4DPUA 2PI4A 5KG4A 4XPCA 2N4CA 3EGWB 2DH8A 2NXEA 2YH1A 1NZAA 4FXWA 3HSGA 3OPKA 4YMEA 3RJMB 1JJ4A 4PXCA 2AF6A 4MK7A 4CLUA 4LRCA 1QUVA 3MM6A 4WCEQ 2ZKTA 1IR2A 2B9YA 1H2VZ 1URNA 1J2VA 4P2MA 1T9YA 2UXDF 3R2DJ 5T7LA 1VQNS 1HBNA 2O3DA 3HHLA 4YEAA 5B7WA 4N47A 4XTTA 5LL6d 2FUG9 3Q22A 3FBFA 4ZPDA 3NOCA 2NSCA 3VR1A 2KYZA 3GIKA 1T11A 3HULA 4F36A 3KHRA 1T05B 4N5SA 3W2WB 4O4RA 2CKWA 3OBIA 2V8HA 3NAHA 1DURA 4USIA 3BQ0A 1SC1B 2OPPB 2V9WA 3MAQA 2CNLB 2UXDJ 2GIQA 1KVJA 2JFDA 3OSPA 5HMXA 1C1BB 2MQ8A 4O3SA 3CCQS 1IKXA 1LXJA 1HIYA 4OYAA 1WJ9A 4CO1A 1X9SA 4UOHA 4LF6F 2BEFA 2A1BA 2D7SA 2POKA 3UD3P 3F73A 3TQ1A 4DL0C 4IYQA 1RT2B 1WELA 2OO4A 5L1LA 3GCXP 3QZ8A 4ECTA 1ROFA 2Y8WA 4RUBA 4IFVA 2QLFB 4LBHA 4RJVA 5J2NB 3GSDA 1R8AA 3RAQA 1Z2LA 4ZPTR 3LP2B 2HLUA 2O1PA 2AX0A 3DRRB 4OL8A 1BQMB 2R7VA 4ED3A 4RNHA 4NLYA 2E5LF 4LF6J 5HATA 3W2VB 2MZSA 3Q23A 5ETNA 2HS3A 3CMQA 4PCQA 4X4TA 4USHA 1M5KC 4CLSA 1A9NB 4OYXA 1KVIA 4IDKB 4G3IA 4QYZK 4DS5A 1NH7A 2K3KA 1EQMA 5KAKA 1RLDA 1Y5IB 4Y28C 1T9TA 4CWBA 3T19A 2NUUG 1S1UB 3AA8A 2B4PA 4OZLA 4F3QA 2BRLA 5FLXY 2E5LJ 3RAXA 2PE8A 1M1GA 2HGNA 2BBEA 2RILA 1SIZA 4I2QB 1LW2A 1HPZA 2P9EA 1FJCA 4F8RA 4BC7A 1N33F 2MTLA 2VQEF 3VAHA 1YK9A 1BY9A 2X1BA 4BLGA 4ED5A 2IY5B 3W65A 4EU0A 4QWDA 4ZHRB 2JVRA 2HQIA 4HR2A 1H2TZ 5B0GA 3S7RA 2BACA 4FVCA 1EB0A 2ZVIA 3BSNA 2ACYA 3UPFA 2V4QA 4AD6A 3SMZA 4YS2A 1G3OA 5HJXA 4CH0S 3MGJA 3PEJA 4C0HA 2HAFA 3PV8A 1ZAWA 4F0MA 1T03B 1PSDA 1T9WA 1RT6B 1YJTA 5H9EK 2J8SA 4P2SA 1MWQA 4ITSA 5B0DA 5JXSA 1YI2S 1N33J 4UW2A 2VQEJ 1H74A 4DV2F 1UL3A 3SCKE 2KHDA 3K7RA 4CIOA 1B3TA 1DAXA 2KHCA 2VPXB 4NMXA 4NLVA 3KLVA 1JLCA 1HWJA 4RUCA 3Q8YA 2GC8A 2C22A 1C0TA 3N6LA 2FHMA 2MZQA 1RQ0A 4DSFA 2ZUGA 4RBTA 4NLXA 2MKSA 4DDFA 2ZH7A 5E3PA 3ENVA 4ED7A 4YY3F 2XMJA 3B6BA 3B4DA 2Z2MA 2UV8G 1CS4A 3RW6A 3HKZD 1DTQA 2ABYA 3M9MB 3NGUA 1QD1A 1S1VB 4DV2J 3O3LA 1TR0A 2CQHA 3LANA 1ZZNA 2VFUA 1FRMA 3KNAA 3HSZA 2VG5B 1G4CA 2PN6A 1HNWF 4MH8A 3KHHA 1APSA 2UUWA 1IBKF 4OX9J 2A0FB 5C24A 1RDRA 5L9XA 5D4PA 1FRJA 4NEZA 2B9EA 3DFEA 4BCAA 3MUVP 3DMJB 2Z30B 2VOPA 1B0TA 2XO7A 1FXRA 3A4TA 4YY3J 1S79A 2EFVA 1OY6A 1WOPA 2DGWA 4RBVA 3CC2S 3UW1A 3M32A 3G82B 4DLGA 2DT9A 1RHQB 3GWCA 2MGZB 1HNWJ 1R89A 5EX3A 4DG1A 4IFYA 1WORA 1IBKJ 2J0SD 4B9TA 1QVFR 2O67A 1JNZB 4N56A 2BE2A 5DLGA 3BO3A 1RCOB 1U1NA 3U7JA 3MOJB 2YNGA 5HK4A 2DNGA 3T9ZA 4IH6A 1PYOB 2W2PP 4I2PA 4UQGA 3U27A 1KD1T 2VZ9A 2GMHA 3LTOA 3V4MA 4A8WA 1ITPA 2CJ9A 3MF5A 4X4SA 1LKZA 3Q8QB 5HI7A 2BM1A 3TA1A 3GTYX 3TNVA 8RUCA 3CCVS 1VHIA 4I56A 3W8GA 1RTIA 5I42A 1MMNA 1X8DA 3D5MA 2CZ9A 2ZHAA 5IT0A 3GIJA 4EO8A 1SQGA 3Q24A 4O3PA 1S1XB 3AB2B 5ETRA 2BXJA 4HTIA 4ALZA 4O4GA 4J9SA 1YBTA 2HVIA 3MEGA 1TMJA 3RYLA 5DO2A 4HL9A 2F7VA 1S4EA 1ZM3A 3AA9A 2KDOA 1IR0A 4A47A 3O6QA 1PC4A 1S0VA 4HACA 4K59A 2LXUA 2GAGC 2VD3A 2CQDA 3K5OA 2VA2A 4F3MA 3A13A 1NU4A 3G9CA 1SJ1A 3IGNA 1YJ9S 4F0KA 2LYVA 2MHEA 4ECQA 3DXBA 2AKWB 3BBCA 5J2PB 2W01A 2IDEA 2V4JA 3AXKA 2JSXA 2V2VA 4QZVB 1E6VA 1FRXA 4GO5X 3H8YA 5AXNA 3EX7B 3KK2A 4ZVTB 2NYHA 4CM2A 5KFZA 2OPRA 1YX2A 1IKVB 2QRRA 1QAYA 4BC9A 4DL4A 2RQCA 2QL9B 5I3PA 1EJ7L 1TL7A 2XMUA 1VHFA 2XY5A 4C3LA 4P7TA 2QLJB 4ID8A 1DFDA 2B5JB 2C3PA 2HQFA 3G6YA 1SJ3P 3DRXA 1FRLA 3D3CJ 5K8PA 4J7CA 2WHOA 3QT7A 1C0UB 3KHLA 3FC9A 3B78A 4UF4A 4X4RA 3LP1B 5KFPA 4DWIA 2KH9A 5D6GA 3C8YA 2DXFA 2Y1JA 3GYXB 2HRTA 2RUSA 3R8YA 3PACA 4FBUA 4F4AA 3NNHA 2J7UA 3BYPA 5KFEA 1D9AA 7AT1B 1YRUA 2N3OA 2FVPA 1YVFA 4QU6A 3QGHA 2CPHA 1EQ0A 4OHZA 4GVLA 3JSMB 2QN6B 1JJCB 2NXUA 3VZHA 3R2CJ 3HM9A 4PG8A 3K5PA 4NI2A 2CZ4A 2BV3A 2RS8A 2VB6A 3HZEA 1L3UA 2FPHX 2CFXA 4LR7A 4F50A 1Q7YT 4I6YA 1YTYA 1UVLA 4A8YA 4LR8A 1SXLA 3D54A 1HD0A 4G1QA 4HYKA 1X5TA 3GPAA 4P75A 2EG1A 2M9KA 3OR2B 3OFFA 4MIAA 3H2UB 2OIHA 3V6JA 5IC4B 3DOKA 1B4SA 1FESA 1YHQS 1JK9B 4HEA9 3BN7A 5IM0B 2CPXA 4PUOA 3DU5A 3EJMA 4ZLJA 1NJIT 3I6PA 2HG4A 5K14B 3CO9A 4KFBB 2HRYA 4CO5A 1HQEA 4MJKA 4PRFA 2YKQA 2YX4A 2O66A 3UR3C 2LEBA 2JX2A 1JWWA 1DJ0A 3DCAA 2AV5A 3H42A 2HWIA 3PTWA 2V8PA 3H5YA 2ZVSA 1RE1B 3QSIA 3LGNA 5HROA 1BC6A 2B6AA 1CJTB 1SB6A 1XERA 2Z8QA 5JUMA 4KJIA 4M1KA 3TYTA 1YJ7A 3V4IB 3NMAA 4WP9A 5KFSA 2HIQA 4PPDA 4Z37A 4ZOSA 3AODA 2I5JB 2IAJA 5HO4A 3CJ4A 2HBQB 2IIHA 3LW5C 2ZWOA 4K7QA 1S0NA 4C6AA 3HPOA 5KG6A 3BGRA 2RU9A 2VODA 1U8WA 4HDGA 3MUMP 5LT5A 4JI6F 1TKXA 3GG1A 4B3OB 3M1VA 1GMUA 3M8QA 4NCAA 3ZZTA 2JC1A 4Q5VA 3PFOA 3DKDA 3AFGA 3GE9A 3QGIA 2J7WA 3NCQA 2JHEA 2V2KA 2W9BB 1MROA 3IA0A 4H4KA 3TZWA 1QY7A 2IYGA 4RWWA 4X65J 5GAHI 1O6XA 1BD6A 4KIAA 3H90A 3SEOA 1H6KX 4LBPA 5E0OA 3ISND 2IBOA 2D3OR 1Q0NA 1SVDA 9RUBA 2OELA 4M95A 3RRKA 4WE1A 4DBQA 1KBRA 1PJ7A 4EO6A 4JI6J 2ZD1B 2X51A 2K1RB 3OR1B 3SQGB 1KQFB 3MPVA 4TY9A 1HWKA 4DV6F 5KG7A 2E9TA 1P6TA 4TNOA 4LFCF 3FRZA 1HNVB 1T95A 2RDDA 4DR1J 4Q0BA 3ZC4A 1FTCA 3OL9A 5LXYA 1RTDA 4ZCMA 4F4XA 2IA0A 4CYUB 5CCMA 5D77A 2UUTA 4JI0F 2LVWA 2HWHA 3M8ZA 4R0JA 3VVTA 4N41A 1NKEA 1KDNA 4DFPA 4DV6J 1TAUA 5F8GA 1VR6A 2Y3YA 2NCKL 4USKA 4WYWA 4FPRA 3HHLC 4LFCJ 5JVHQ 3C2PA 3MAHA 4DR6J 2DIUA 2KT5A 1MW7A 5E3QA 3DOLB 2ZEJA 4JV2A 5KFTA 1HKAA 4ID5B 2DNRA 2OHDA 1RT1B 4E98A 4IO9Q 1RT5A 1RHMB 3CDWA 1FDAA 1R27B 3FFIB 2M7SA 4QIGA 3BKFA 1RT3A 4DV1F 3O8WA 2Z58B 4J9QA 2UVUA 4NLPA 2HIYA 2EC2A 2FYXA 2E66A 1O5JA 3IR7B 5CYMB 4EZ6A 4FYVB 4F02A 1CBKA 4RW4A 3NRBA 2R2RA 2XMAA 1TQLA 2Q66A 4PQUA 2CJQA 4KGVB 5L39A 1UZHA 1PGZA 2YPZA 3BDEA 1NJZA 3PO4A 1PG5B 2C2KB 3TR5A 4KRWA 1W2BR 2BE9B 1BWVA 1F2GA 4URQU 4DL6A 4RLEA 3OXLA 1R6VA 4DR4F 1YLXA 4OHXA 1CJVA 4DV1J 5K8OA 4G65A 1RHKB 3A3OB 3MDFA 4ZITA 3EZOA 2DR6A 1CJUA 5F8IA 5D4LA 1F0XA 2ZNYA 2FVCA 1YBAA 1IKYA 4DL7A 2OPSB 5EDWA 4A4JA 1RGVA 3UQSA 2CDQA 3QYYA 2AEJA 3PXGa 2XI3A 4LSZB 4DN9A 5JVGQ 3DLHA 3FSYA 5KFGA 4DR4J 1F9EB 2NXCA 2YWKA 3I96A 3MM8B 2JLEA 3O5TB 4UY85 3OL8A 1YBUA 3P4UB 5J1EA 1AYEA 1LNQA 2NPFA 2KI2A 3Q86A 4DEZA 1UPPA 1KRPA 2R7OA 1ZTWA 2BJ9A 2M4MA 3TZXA 2VFSA 2CQ3A 3BYRA 3DGVA 1LW0A 1YDLA 1OO0B 2XQCA 4FF4A 4C8LA 3PR4A 3JQMA 3B54A 2UUBF 3QFWA 4B3TF 3CD5A 1H38A 2OEKA 2OGUA 5KFFA 4HKQA 1HNXJ 4XIUA 4NEYA 1WF0A 3TUJC 2MQQA 5D15A 3M2VB 4LSNA 1HI1A 1X5PA 4JB8B 2JFKA 4I68A 1FK9A 1WHWA 4URGA 4CLKA 4C3MA 3MR5A 4C9DA 5J2QA 2B43A 1MWZA 5KFAA 4OZ3A 3G4SS 2BJEA 4RBUA 2F9JA 2YKAA 1S1WB 3NBPB 1JLFB 2UUBJ 1UJ5A 1EIYB 5DG7A 2Z4PA 4B3TJ 1Q5VA 2G0CA 2FHJA 2G13A 2NZCA 1XIQA 2VDIA 3LF0A 3PM9A 4C11B 1R0BG 2BJ3A 3JYTA 4MTPA 3IBFB 3QGPA 4FP9A 3IWLA 1WC4A 3KLHB 1NEEA 4OX8A 3TJ9A 4PG6A 1TUGB 2ZBCA 2YKNB 1PYSB 3LGMA 3KFWX 1DQ9A 4TVAB 4F3OA 1XC9A 1V5VA 1LFWA 1N36F 1GNKA 4ZVUB 4RX6A 4ILRA 1XMOJ 1C1CB 1U49A 2DRBA 2DIVA 2CQ1A 1HQUA 1XEZA 2KRBA 3MCNA 5KFLA 3OUYB 1UCNA 4LF4F 1KQKA 1VLOA 5H9FJ 1SUQB 3IG1A 5KFUA 1BHNA 2AW0A 3KLIB 4DU7A 2W8LA 1KFSA 1X4BA 4DSLA 2B9XA 1U45A 4J9KA 2DXEA 1HWUA 4JI4F 1EARA 3CW2C 2V5HG 4YB5A 4ZJLA 2D3ZA 2OPQA 3TJ8A 2XMKA 3G6ES 1UZDA 1XBWA 3QJPA 1RTZA 3SQOP 2JZ5A 2G0JA 1VJQA 1SBRA 4LF4J 4DQSA 3KK1A 3HHDA 3KLEB 3FCVA 3LA0A 2H3EB 2OUGA 1S6UA 4OJGA 2HHVA 4UQTA 4QYRA 2AJ0A 1Y3JA 3N6MA 3HO1A 5G0RB 3VAJA 1OQ3A 3TA0A 2MPUA 2E29A 3O1LA 2GS8A 4FNHA 3QGGA 3CTRA 4J5OA 1JLEA 2QJ3A 5J1NA 2CPJA 3CIZA 4RU9A 2XY6A 2EC0A 5KFCA 3FKBA 3PCOB 1I94J 1S6QA 2GX8A 2VV5A 4PAAA 1V6HA 4ZPAA 3P45B 1P1LA 2CG4A 4R5PA 3QPIA 1F5AA 2WK4A 4KC5A 2QYCA 4U7CA 5EGYA 3Q2SC 2V67A 2YWGA 2Z2YB 3PX6A 3WQPA 3HT3A 3WX8A 4EZ9A 3I55S 2XULA 3PYFA 4WIIA 3QAUA 1FKPB 2KVQE 4LRFA 3QFHA 1TKTA 1REVA 1JB0C 1QJHA 2IM0A 2M88A 2E9ZA 3T3FA 3DC2A 3C6TA 2A2DA 4R0EA 2ILYA 3T5HA 3P49B 1KC8T 5LSLA 2CA9A 1VQLS 3EGZA 1TVRB 5KG3A 2RQKA 5LJ5Y 1NK9A 2CQ4A 2ZWPA 1FCAA 1JLGB 2UUCF 3KUHA 4C8ZA 2V6AA 5BYQA 1KLMA 1LWCA 4OYZA 5A0YB 1S97A 1ZTTA 4ETXA 2RDIA 4RO0A 3ZNUA 1DARA 4QIFA 1X0PA 1UW9A 3ISZA 2ZH9A 2AGOA 1KQSR 3TAQA 2UV8A 5KT7A 2DNOA 3KMSA 4IOBA 1YITS 4WPAA 4KR0B 3H40A 3NWRA 4QW9A 2ZH4A 3ZZUA 2BRKA 3SZ2A 3RB4A 1JKHA 2RIJA 1X5SA 2AP6A 4TLQA 3DN9A 2FTRA 1HNIB 6FD1A 3C14B 3N4WA 4FVMA 3HFVA 3IWNC 2HHUA 5DDQC 1NB2A 3NS7B 4ICLB 3CJSA 3DM2B 3LO3A 1LOUA 4RU2A 4WJBA 3FSIA 1TK5A 4B02A 1UFLA 5KT2A 4LVOP 4JI8F 2KVIA 4A8FA 4ECUA 5CQGA 4GVBB 2ROPA 5HLFB 1OY8A 2C2ZB 4NLGA 2W2OP 3DDIA 2W7OA 3MM7B 5DM7Q 4OI2A 1HL6A 4ANEA 2BQUA 2VG7B 3CCUS 4YFUA 5BYRA 3IRXB 4WFBQ 2PEHA 4ZN3A 4RW9A 4DMZA 2DNYA 4CLFA 3D1HA 4JI8J 5F3ZA 2QT7A 4WU2A 2PDAA 2GMJA 3CJQA 3UFCX 3EVOA 2CWXA 3GIRA 1GX6A 3J7YI 3HVTA 3IP0A 2W9AA 4CTAB 5KTQA 2CG8A 2UVWA 3QAEA 2UVRA 1S1TB 2R8IA 2ZE2A 3DRPB 2HFOA 2PEBA 3U1LA 3OXGA 1FWLA 4NRUA 1D0EA 2QSWA 2I2YA 4DR7F 2KJVA 1UEUA 4BS2A 1R0AA 1LWFA 1S72S 2NPIA 3HMJG 5KFJA 1TZ0A 2GJFA 3E3XA 2GVDB 5ETLA 3HF5A 3VV2B 3N5FA 3BDPA 3ZZZA 4M5DA 4X66F 1VC5A 4H4KC 3BR8A 1H2UX 3CCTA 4JI7F 3DYAB 5GMKa 5ETKA 2WVBA 1LXNA 2EKYA 1GMVA 1JLBA 1HNZJ 1VQ5S 5BXIA 2FJBB 3KJVB 1Q5YA 4WBFA 4L3NA 4C8KA 2WOMA 3L7OA 1HARA 2P9GA 2HQGA 1UVMA 1ULRA 4X66J 1FVQA 3I4HX 4JOUA 3IGVA 2OJ3A 5DRKA 4LR9A 2CQBA 2E7VA 4PPZA 4GC7A 4NLDA 1X4DA 3I0SA 2L41A 1YIJS 2AGPA 3F44A 2LDYA 4QCLA 3ETOA 2IPOB 4TY8B 2GQ2A 3MEKA 2XYPB 2W4CA 2ZH8A 1NJXA 2RDJA 3POTB 5A6WA 2D74B 4F4YA 1V3SA 3SSSA 5FIIA 4ZVSB 5C25A 1N5VA 4XAKA 1DLOB 1MU2B 3K57A 1L3KA 4ZVHA 2BDPA 1WC1A 3MAAB 2DB1A 4LF9F 1REGX 2H51B 1VQPS 2N7CA 4XO0A 2FY8A 4GRSA 5F8NA 1N48A 5BJRA 1D09B 2J6TA 3HZGA 2MKCA 2YY3A 2RJZA 2K8GA 2HQDA 1H7XA 1X0FA 2RQMA 4DXLA 4M63A 3VQTA 3UNYA 4ETZA 1QE1A 2UXBJ 4NZ6A 4P2XA 3CMAS 3MMAB 3K8WA 1KTQA 1JLQB 2VBWA 2I38A 1FKAF 2DO4A 4OJ1A 2AQ4A 5SZTA 1Z2ZA 3UCGA 4WFAQ 2WONB 4TKTA 1CULB 1L3SA 4X4QA 4CI0B 1WHYA 2W24A 1XR6A 4K2JA 1F5BA 5D3GB 1RAOA 1EZZB 4F0HA 3D4JA 2RE1A 4RNFA 4JYAJ 1ZPWX 3M6UA 1K73T 3LPYA 3I4PA 5HP1B 5CZXA 2IC3B 5ETSA 4RUHA 1NXIA 1PILA 3VGVA 3TX0A 1TL1B 1QVGR 4J9LA 4U96A 4Y0FA 2CWKA 4RW6B 4ZVPB 1K0TA 2BA9A 1F6TA 2VL1A 3FVYA 2O5DA 1TL4A 3HD2A 2XEXA 2GIFA 3U02A 3MR3A 2V8VA 2EBEA 5AXLA 4CLPA 4QWCA 4KO0A 5DJBA 1RTJA 2WVEA 2J9DE 2VC1A 3FBBA 1IBCB 1ZM2A 2R7XA 5KT4A 3MFHA 3P96A 2VFVA 1N5TA 1RKJA 3OFEA 3E51A 4DUYJ 2SXLA 1RWPB 3CNQP 4CP5A 3A8JA 4DI6A 4KY3A 2AJFE 2PFFB 4NYOA 5GAEU 2FC9A 2ADCA 3ISNC 1Y7PA 4JI5F 2MSTA 3GSIA 4JV5F 3TO8A 3N5BA 1G1XA 2MQOA 3D7SB 3WIUA 1RABB 4LF7F 3W61A 4IG0B 2R4FA 1UJ6A 1WKLA 1GMWD 1T05A 2HNZB 2ZOGA 3W2WA 1U4BA 2LQJA 2M2BA 4ELUA 2R7RA 5KG5A 2BKPA 1RU2A 1RISA 2FZKB 2Z57B 4FF2A 1U2RA 3TRGA 1OSCA 2OPPA 1R3NA 5IWAJ 4DSEA 3V6HA 4ZP6A 4RUAA 4DR3J 2CVEA 4P10A 1NM2A 2ASDA 2JDJA 3WBZA 1C1BA 2BR0A 2PC6A 4KPCA 5EWEA 4JV5J 3OL6A 4DX7A 5DG8A 1YRTA 1LWEB 5IV3A 3BPDA 3PVXA 4LF7J 3QLHB 2AIRB 1UP1A 3HVAA 2CPEA 2M3DA 1U1PA 6AT1B 2M8DB 1UA0A 3UN5A 1R8PA 5CHCB 3MPDA 1RT2A 3JAMU 3D9BA 3NEKA 3D6FB 2BKNA 3TEHB 1ACMB 1J5OB 3TEGA 5EWGA 3BO4A 5J2NA 1I1GA 3PEHA 4AFFA 4QR2A 5E2QA 3LP2A 1FFGB 5I3QA 5HJYA 4IRDA 3DRRA 1GK8A 3K17A 4UUXA 2UVVA 1BQMA 3HHNB 1YJWS 1U02A 4RR5A 2LECA 4WXWA 5IFMA 1UW4A 1RYRA 2IFXA 3HLUA 3W2VA 4I7FB 3NOGA 4DR2F 2DYAA 2ZC3A 3ENQA 5D4NA 3PW0A 2PD1A 2FJEB 5EN1A 4IDKA 1R0CB 4YQWA 1P9QC 2IMOA 3UDEA 2ZC4A 2B8QA 3DGPB 3MXHP 1XQIA 3KK3B 4NXNJ 2AMCB 4UZCA 1HFEL 1S1UA 3GFXA 3FBCA 2DPIA 4M5KA 1VC6A 3UNGC 1R43A 5D0HA 1BGXT 4NLTA 4DR2J 4PYAA 2HKEA 1QSLA 1MMLA 1RUSA 3AB4B 2D3UA 1F3VA 4J37A 2G9OA 4I2QA 3GV7B 2EVZA 3PO5A 2H5EA 4IRCA 3TVKA 9ATCB 2XZTB 1VIXA 5GMEA 4HH1A 2EBGA 1WTBA 2KU7A 5DG9A 4ZHRA 3ZZPA 1LK5A 2ZM6J 2UP1A 1PBAA 4DQIA 3MMCB 5C5JA 5L1IA 1U26A 5HMWA 5CD4A 1B7FA 5AJ3J 3WDOA 1AFJA 3M8WA 2X3DA 2HURA 1NDLA 2UXCJ 1T03A 3CCJS 1RT6A 3I32A 2DNMA 8ATCB 2DNQA 1KN6A 3D67A 4ZLNA 4JV0A 3J81Y 1FKOB 3BSCA 3X3UA 5K8MA 3FGVA 4OZ5A 4ZS6A 3L95X 2EI5A 3OTOF 2OMOA 1RLCL 1YZ6A 5D0EA 1OYEA 2FY1A 4J9RA 5HQMA 4F25A 1K1QA 2P5VA 2FVRA 4WIQA 1RT7A 1Q53A 1E6YB 2AYGA 3UR0A 4CNZA 2F63A 4AYBD 1FVSA 1NSAA 3G87A 3M30B 4AQYF 4C7QA 3TWZA 4ENOA 2J76E 1RZMA 2XWXA 5AE1A 3AXMA 2KL8A 1HMVB 2A6MA 2VG5A 3CDAA 4L6V3 3Q83A 1RT4B 2IVYA 3OTOJ 2ADBA 2R8JA 2QA2A 3W5ZA 4ED1A 4ECXA 3E01B 3DMJA 1VJWA 4E2FB 3K89A 1VRTB 4GMKA 2CNKB 4NCGB 1D8ZA 2KB2A 2MLZA 4GKJF 4OIXA 2MZTA 3BO2A 1VRUB 2LQBA 4EYIB 4AQYJ 1IBLJ 3T1HF 1S49A 3V81B 2V68A 2ZUAA 1BMQB 3ELHA 1U7LA 4OX7A 3ZTQA 3G82A 3IRWP 4B3MF 2MGZA 1XNQF 2DHAA 1AW0A 2IVMA 3OVBA 3KXDA 1RA6A 2WCXA 1BWEA 3VF0B 1Y10A 3W5YA 5M2PA 2VASA 4TU7A 2BW2A 4Y34A 1Q1KA 2HLTA 1N5QA 1LFPA 5B0CA 4KHPF 2WRMA 3R5JB 4OZ0A 3LUYA 1YJNS 4GKJJ 2EFOA 4ECYA 2GIRA 1JJHA 2AU0A 3T1HJ 5U47A 4Y2AA 2VBZA 4QQBA 2OEJA 2MDAA 2XWYA 2DEJA 2IYIA 3A8IA 4P6QA 5HVGA 1K9MT 1WI8A 2ALZA 3IMQJ 2VONA 2Z0GA 1LWXA 2AEFA 4DR5F 4OYWA 1FD2A 1AB8A 1S1XA 1UMJA 4NA2A 1XMQF 2JL9A 1KSPA 2H1YA 3R7BB 2Q3PA 5J1PA 3C6UB 2CRLA 2GVZB 3GMGA 3DLEB 1K44A 2GO8A 3MD1A 3H0PA 2COLA 2OLWA 1WNEA 4F2RA 3CJKB 1NDPA 4ZPVR 2DH9A 3LWLA 5FD1A 1QTNB 4GC6A 1O51A 2OSRA 4H4MB 2X3GA 1HW9A 1O0PA 2QA1A 4WKYA 2XSJB 2ZBIA 3R97A 2XLIA 5J2PA 4DPTA 4DR5J 4WKRA 2W2MP 1FWKA 4OI6A 4B9VA 3BBBA 1CLFA 3FNNA 4C8MA 4TYBA 1R8CA 2PGCA 2XGQA 1OYDA 4OI4A 1LEOA 1RAAB 1IKVA 3KLGB 3GJTB 2HFNA 3EXYA 4KBIA 3R6LB 2VQFF 2XZDB 3W9HA 1S4FA 2DCLA 2YQ0A 3FQLA 2XG8A 4DHVA 2ACMA 3AAWB 2QFIA 2DR8A 1RTHB 4KSEB 1YZ7A 2LDIA 1XK8A 2B5JA 1X4AA 3PX4A 3OL7A 3GIIA 1VDHA 3GFYA 5F3TA 5L1JA 3T5JA 1Q86T 4R8UB 2KT2A 4P52A 1JIHA 3QO9B 4NOHA 1C0UA 4KKOB 2XTJP 1SCJB 1VISA 3LP1A 5B0EA 4PG5A 3CCES 1VFJA 3QT6A 3K59A 2VQFJ 1HI0P 2E5IA 3EPIA 1M5VC 3ZFVA 1KONA 2F5GA 5HSPA 2JLFA 1WG5A 2WW8A 4U8VA 4K5SA 3EGVA 4IO1A 3UVJB 4LFBF 3SSQA 2C42A 2C3UA 4DV4F 4ZA1A 3JSMA 3DHXA 3RW7A 4AT1B 4RPFA 1SPBP 3KMQA 1UVNA 3EDRB 1UKUA 4I64A 1GXLA 2ZHOA 1FTRA 3OW2R 3LPEA 2MKIA 3TAMB 3EICA 4DX6A 5J2MB 4MK9A 1FE4A 1WF1A 2Q6CA 1F2HA 3M6XA 3OR2A 1FEHA 2NYIA 1EETB 1WUUA 3LP0B 3H5XA 1RYSA 1HA1A 3PYDA 5FDLB 4ZLPA 2F65A 1VYAA 1EAYC 1M1HA 4DX8H 5IM0A 2V9KA 4DV4J 3CWJA 3Q8UA 3IR5B 3J80Y 4YN3B 1FXLA 4NLSA 5K14A 4KFBA 5DGBA 5ADZA 3RZAA 2PA3A 1W7WA 3MTKA 4CH7A 3VALA 1GH8A 3N28A 2DHHA 3UCUP 3SYZA 3MFIA 1NBEB 1U1QA 1CJTA 1XR7A 3M8YA 2RB7A 3MR6A 1OSDA 4EBDA 4NLQA 2J6SA 2YKMB 3V4IA 4C98A 3VAFA 1F3FA 3R5GA 1FDNA 5IQQA 2FJDB 2CQ2A 2EXUA 3NNCA 2I5JA 4X4NA 1AT1B 1RXOB 3BM7A 2QA4S 4XK8C 4C0OC 1YJRA 2W7PA 4NLRA 3SCLE 2L9NA 5KFNA 3I0RB 4Y2IA 3M2UB 1MG7A 3I82A 4OYIA 4B3OA 1KR4A 4WFXA 2B4UA 4F7VA 4LREA 4NE9C 4Q2MA 4ER8A 3MEEB 4RWXA 2W9BA 3W9IA 1FJEB 1MMDA 1S77D 4DL2A 5HVFA 1I3OB 3G8TA 1LK7A 4TQRA 3R5BA 4DPXA 3ILLA 2GJIA 3GP9A 3T1YF 3QWUA 2N7YA 2CAJA 2H65B 4OYPA 1EHWA 4KHMA 3TANA 1U0HB 3W3SA 1X7VA 4C48A 4LUBA 4V19J 3C66A 5AE3A 4M8LA 3A8KA 2OMLA 2K1RA 4RL1A 3DLLQ 3J81U 3OR1A 3SQGA 1RSCA 1QAXA 4UOFA 1S0OA 2NQPA 1BQNB 3P5BP 4PWDB 3NS5A 3RBZA 1PCAA 1B99A 4CM0A 4NL5A 2AZ3A 4HHHA 2DGSA 1UWAA 1HNVA 2VU5A 4DUZF 2LQ9A 1TU0B 3UI3A 1U1OA 4GKKF 3CE8A 3T1YJ 4DX5A 1B0PA 3UO0A 2HMIB 2BABA 1ZS6A 4CYUA 5DZ6A 5HVHA 2MMYA 4O3OA 3BF4A 3M8PB 3CJRA 1AZSB 2HNYB 2HFSA 5B0FA 4WWSA 4IR9A 1O8BA 3SI8A 2AHOB 3OHAA 4M5HA 2AYEA 3DOLA 2W2QP 5HAOA 1YJUA 4ID5A 1RT1A 4GKKJ 3DDKA 1TV6B 1ZM4A 3V6DB 4CT9A 4CO3A 3O44A 3FFIA 3HXMA 2EFNA 2ZJRQ 3GG0A 2OD6A 2B7CB 1FHTA 1S6PB 2LQ5A 2W1BA 2YNHB 5CYMA 4KTQA 3OD2A 3CJ5A 4HDHA 4B9UA 2YNIB 1JJ2R 2XLKA 4J9OA 1Q79A 3SFGA 5IT4A 4QWAA 2E7XA 2FIUA 1AROP 3UDVA 1PKUA 3PYEA 2H5IB 1BQXA 3PHTA 3SV3A 2UU9F 5KOXA 4RZRA 3D1OA 3WHIA 3F0NA 4N8NA 3J81j 2V34A 1FNXH 2BX6A 1FT8A 1OQ6A 3MR2A 3IS9B 3D2WA 2A3JA 1U0SA 4O3RA 4P7VA 2QLXA 4GO7X 3MOZA 1D3WA 1HBUB 1T02A 5MAOA 2RAQA 1NK4A 2QFJA 2GA7A 3SIPB 1ZYQA 4EYHB 3LOUA 1FNMA 4ECSA 2QE5A 2OPSA 1FX4A 4DPOA 5LJ3Y 3D0IE 3F41A 3LAKA 1CVJA 1TKZB 2KYXA 2C3YA 4FS1A 3C16B 2AWZA 4W98A 2MKHA 3MM8A 1TFWA 1RAIB 2PIIA 2YX7A 3ENWA 4NCBA 1VQ8S 2QX0A 4NWBA 4O3NA 1Y00A 5EUHA 4N8OA 2IDLA 2WVCA 4KGXB 2W4PA 4OFZA 4IG3B 2E44A 3TVZA 4PZVA 4QIEA 5CYQB 3CD0A 1UTAA 1J5EF 3PG9A 3OJSA 4ED8A 3BGOP 1RAEB 2MKKA 3VQSA 1TK0A 2JOQA 1RHUB 2L08A 3MMBB 4KGKA 2XY7A 1HYSB 4W4MA 3FZ2A 1WEXA 1N52B 2C2OB 4WFZA 5T14A 2APOA 3QSYB 2HBYB 1A7GE 4KV8B 2Z2LA 4OJHA 4X84A 3MHYA 2GMLA 4MKBA 2YXLA 4OZNA 1VQ7S 2AJ1A 5KFKA 1IJFB 2FB0A 4ELVA 1U2FA 2P6TA 3AJ2A 2QYGA 4FBTA 2RHSB 3M2VA 3DRSB 4P9SA 2XB2D 2QSFA 5CH7B 1X4EA 1D8YA 3HHKA 1J5EJ 1WC0A 3W60A 3TI0A 1HBOB 1H73A 4Z7CA 3CO0P 2Q6BA 1S1WA 3NBPA 1Z4UA 1JLFA 2ATLA 2D1CA 4K4YA 2KXNB 3PRBA 2AGQA 4FKXA 4CH1A 3DU6A 1Y3KA 2KG1A 3I56S 4C11A 7FDRA 2XMTA 4FXDA 3HHEA 2RRBA 3CULA 3EE3A 2HPUA 2CJKA 3CB4A 3KLHA 2Y8YA 1NJYA 2YKNA 1Q81T 3EDQB 2BQRA 4O44B 4K0KF 4DV7F 4PEOA 5KFBA 1JNRB 1YG0A 1N8RT 2MSSA 2W8KA 2KM8B 1C1CA 1XWLA 3K5MA 4XDDA 5IQ6A 5L38A 2CQIA 2ASLA
chains in the Genus database with same CATH topology
4QJVA 2DNYA 2AJQA 2NSCA 3D1HA 1FERA 3OTEA 5F3ZA 1X9WA 3VR1A 3OUYA 2QT7A 4WU2A 2PDAA 2GMJA 3UFCX 3DHWC 1SUQA 2KN4A 1ZOTA 4DG1B 4IFYB 1GAOA 2KKHA 2KYZA 4ES3A 1W2IA 3GIKA 4LJMA 2ZHBA 3KLIA 1VQ9S 1N56A 5M2RA 3MEDB 3KHRA 2DNKA 2BE2B 1GX6A 1HHSA 1T05B 3J7YI 2HMIA 1WHVA 4N5SA 1CQNA 3HVTA 3UWTA 5GADI 2GHVC 3W2WB 2RNEA 4O4RA 2CKWA 1U1KA 3OBIA 2W9AA 3KTQA 2YNGB 3EZ5A 4CTAB 5KTQA 2V8HA 4DFMA 3NAHA 2W9BB 2UVWA 1DURA 2NR0A 4USIA 1VMBA 1H3DA 3QAEA 3BQ0A 2UVRA 1UVJA 1S1TB 3M8PA 2ZE2A 2R8IA 3DRPB 4I2PB 4BDPA 2BJDA 3NNAA 2JJ4D 2OPPB 2V9WA 2RF2B 3BQ2A 2HHSA 4EBEA 3MAQA 2HNYA 2HFOA 1R7IA 2GIQA 1TAQA 3U1LA 3OXGA 5A2QY 1N88A 1D0EA 1TL3B 3PJXA 4NRUA 1KVJA 2J7KA 2JFDA 2QSWA 3OSPA 1VQOS 5HMXA 1C1BB 2I2YA 4ZCIA 4DR7F 3TUIC 4BWJA 4LSLB 2KJVA 2GFFA 1Y9OA 1S0MA 1UEUA 3GFZA 4BS2A 1JMTA 4O3SA 1R0AA 1LWFA 5HQ8A 5E41A 3CCQS 1IKXA 1LXJA 1RTIB 1GT8A 2ZH1A 1CQMA 5I42B 2LA6A 1S72S 3H25A 2NPIA 5HL7Q 1VBXA 4CO1A 1X9SA 4TXSA 2ZH3A 5CXTA 2B7BB 4PG7A 3HMJG 5KFJA 1TZ0A 3SFUA 2ZDPA 4LF6F 2EPIA 3E3XA 2A1BA 3KLEA 2D7SA 1C4AA 1RA7A 1TV6A 1SL0A 3HF5A 4KB7A 4YOEA 2POKA 3UD3P 2ZH6A 3N5FA 4TLRA 3ZZZA 4DL0C 2YKOA 3F73A 1N5SA 4DS4A 3TQ1A 3V6DA 3PKMA 3H20A 2D9PA 4M5DA 4C0BA 4IYQA 2BYCA 1RT2B 1WELA 2OO4A 4X66F 5L1LA 2PMZD 1NRKA 4O4GB 1XMOF 1VC5A 1Q16B 1Y5LB 5D78A 4F26A 4H4KC 1VK8A 3QZ8A 1L3VA 2L9WA 3BR8A 5A8KB 4ECTA 1ROFA 1ZAXA 2FJWA 3OQ2A 2LA4A 1H2UX 2VBYA 2IJFA 3MEGB 3CCTA 3PRDA 5G0RA 4IFVA 1CG2A 3K2YA 4I69A 5J2NB 2WSFC 2R7SA 4JI7F 3GSDA 1R8AA 3RAQA 1S6PA 1Z2LA 3DYAB 5EWFA 4QU7A 1U09A 4AXJA 5GMKa 4DQPA 4ZPTR 4U6PA 1DHMA 3MPYA 2YNHA 3LP2B 3D0GE 2HLUA 2O1PA 2AX0A 2MQMA 3DRRB 1LXNA 2MYFA 5F8LA 4OL8A 4K4TA 2CQGA 2HFZA 1BQMB 2EKYA 2R7VA 1X4FA 3N0VA 4ED3A 3DLGB 1JLBA 4RNHA 3RAMA 1M5SA 2J9CA 3MM5B 3HK2A 1VQ5S 2JVOA 2YNIA 4NLYA 1U6FA 2E5LF 2FJBB 2HHTA 3EZUA 3KJVB 2J5AA 3BSAA 4L3NA 3W2VB 3PW7A 2FLNA 4C8KA 2MZSA 3Q23A 1UWBB 1M5PC 2WOMA 2H9ZA 3THPA 2XCAA 5DDRC 2IRXA 3L7OA 1HARA 2P9GA 2HS3A 2WBRA 1JXLA 2V4JB 1UVMA 1ULRA 4JI1F 2AYMA 6FDRA 4PCQA 1FVQA 1S6OA 4X4TA 4USHA 1M5KC 1E6VB 3I4HX 4OMFG 4JOUA 3OFGA 3IGVA 1L3TA 3MPWA 4DV3F 2KXHA 1A9NB 1KVIA 4IDKB 2OJ3A 3M05A 5DRKA 1SV5B 3KK2B 1PO6A 2RMLA 4G3IA 4DS5A 2CQBA 2OPRB 2EK6A 3ZZYA 1NH7A 3IS9A 3IXQA 5IS2A 2DJWA 2K3KA 3GR1A 4PPZA 4GC7A 1HBUA 2LXFA 3SDEB 3KKFA 5KAKA 2FJXA 4NLDA 1X4DA 2WAQD 3GR0A 3I0SA 3SCJE 5KT6A 2L41A 1Y5IB 3NCPA 4JI2F 4Y28C 3TP2A 2AGPA 3F44A 1YIJS 4I67A 2LDYA 4Q8EA 1FXDA 5DS7A 3T19A 4HTJA 2RSQA 4QCLA 2NUUG 4B9NA 1S1UB 4YDXA 3ETOA 3AA8A 1S1VA 2B4PA 4OZLA 4TY8B 4F3QA 3QMQA 4WXOA 4C2MA 2BRLA 2GQ2A 3MEKA 5FLXY 3MD3A 3RAXA 1WHXA 2J8AA 2W4CA 2ZH8A 1NJXA 1NO8A 2PE8A 1RKIA 4YDDB 2RDJA 1VK3A 3POTB 1IUJA 5JJBA 3M9NB 5A6WA 2D74B 2P6SA 4F4YA 4FF1A 1V3SA 2HGNA 3SSSA 3I5CA 3F56A 5FIIA 2VKZG 5B0AA 2BBEA 3CUNA 1FKPA 1TKZA 2A2CA 2RILA 4G1PA 1SIZA 5C25A 3ZZ0A 4I2QB 2DH7A 2AD9A 1LW2A 1HPZA 2P9EA 3H5SA 3FJ2A 1FJCA 1N5VA 4XAKA 1DLOB 2WB4A 4NZ7A 1VQKS 1MU2B 3K57A 4F8RA 1L3KA 4ZVHA 4BC7A 3PR5B 1N33F 2VQEF 2BDPA 3VAHA 3GFHA 3GV8B 1BY9A 4FF3A 2X1BA 5HMZA 4DFJA 4ED5A 3HI9A 4EU0A 4QWDA 1KQGB 2D9OA 3BS9A 3Q8SB 4ZPBA 2DB1A 4ZHRB 5K8NA 4LF9F 1WTFA 1TVRA 2JVRA 2HQIA 5B0BA 4B9LA 1VQPS 2WBMA 2HHQA 1VQ4S 2DCUB 1WG1A 1IJEB 1H2TZ 1IQZA 2N7CA 4F67A 5B0GA 3S7RA 4XO0A 2BACA 4FVCA 1I94F 2DPJA 4AUKA 5F8NA 1N48A 5BJRA 2J6TA 2OSQA 3HZGA 3BSNA 2ACYA 4IG3A 1RJJA 2MKCA 3UPFA 4G6VB 2YY3A 5F9NA 2V4QA 2RJZA 3SMZA 4RNNA 1G3OA 1JLGA 3CDEA 2K8GA 3N01A 3IR6B 4WU3A 5KG0A 5CYQA 4CH0S 2R9LA 1H7XA 2W25A 1QAJA 3MGJA 3PEJA 1X0FA 2RQMA 3MTJA 3NCRA 4M63A 4ZP9A 3VQTA 4C0HA 4ETZA 1QE1A 3PV8A 4NZ6A 5A0YA 5CD4H 1ZAWA 3CMAS 2ZJPQ 1T03B 3QJLA 1PSDA 3MMBA 1RT6B 1YJTA 4Q8FA 3FSXA 3MMAB 3K8WA 1KTQA 4WTYA 1JLQB 3CGIA 1HYSA 2VBWA 2I38A 4P2SA 1FKAF 2DO4A 1NHVA 4OJ1A 4YHHF 2AQ4A 5SZTA 4ITSA 5B0DA 1Z2ZA 1ZM9A 2C2RA 4KE5A 5JXSA 1YI2S 4UW2A 1IKWB 3UCGA 4WFAQ 2WONB 4TKTA 4KV8A 4ED6A 1HW8A 4EBCA 4DV2F 4X4QA 1L3SA 4CI0B 1UL3A 7FD1A 2W24A 1WHYA 2C3MA 3SCKE 2KHDA 3K7RA 5KFDA 4CIOA 1XR6A 1F5BA 1DAXA 2KHCA 2VPXB 4G1QB 4OZ1A 5D3GB 4D3GA 1NKCA 4NLVA 1KNZA 1R8BA 4Y2CA 5F9LA 3KLVA 1JLCA 2L48A 2RE1A 2E1CA 1P8GA 4RNFA 1HWJA 1ZPWX 3M6UA 1K73T 1K8AT 4RUCA 3R1HA 5DM6Q 2OP5A 4PQAA 3LPYA 2GC8A 3I4PA 3DRSA 2C22A 1C0TA 3DOKB 5HP1B 3PJWA 2BQ3A 3N6LA 4KGMA 2XNQA 5CZXA 3AQOA 2FHMA 4DF4A 2IBKA 2IC3B 4RUHA 5L1KA 1PILA 2MZQA 1HNIA 4PUOB 4ED0A 1RQ0A 4LVNP 1P1TA 4DSFA 4RKUC 2AYBA 1TL1B 2ZUGA 3BZQA 4RBTA 1QVGR 4J9LA 4NLXA 2MKSA 1HBOA 1M5HA 5E3PA 4DDFA 4Y0FA 2ZH7A 4DN0A 3ENVA 3PIPQ 4KT0C 2OKQA 4ED7A 1F5CA 4YY3F 4IQXA 4RW6B 4C4WA 2XMJA 5KFRA 1HWLA 4IUFA 1QAIA 1K0TA 2BA9A 5DGAA 3B4DA 2Z2MA 3AH6A 1IBMF 2VL1A 4X4UA 3FVYA 2O5DA 2UV8G 1TL4A 1DQAA 3RB0A 4ICLA 2XEXA 3RW6A 3HKZD 3U02A 3MR3A 1DTQA 1HQEB 2ABYA 3M9MB 3E8OA 2V8VA 3DM2A 4QPXA 3S8SA 1S1VB 2EBEA 3K0JA 3O3LA 1TR0A 2CQHA 2MKJA 3LANA 3D28A 5AXLA 1ZZNA 4QWCA 4KO0A 3UDLA 2VFUA 1N32F 1FRMA 2RU3A 3KNAA 3JTPA 5DJBA 1RTJA 2C2DA 1FO1A 5D8HB 3AHPA 2J9DE 2VC1A 2NREA 1ZM2A 2MHNA 2VG5B 2R7XA 2PN6A 5KT4A 3KHGA 1HNWF 4MH8A 5DLFA 2M5YA 4L72B 4ELTA 4HVZA 4D3HA 3KHHA 5HROB 2R8KA 2UUWA 3FEZA 5C42B 1IBKF 1APSA 2K3IA 2B6AB 3MFHA 3GILA 5C24A 2YTCA 1RDRA 5L9XA 2R7UA 5LMNF 3P96A 1QUPA 5D4PA 3MZIA 1FRJA 3DFEA 4NA3A 5HLFA 4KPYA 3KWMA 4BCAA 3MUVP 2VFVA 4RW7B 3DMJB 5IXUA 1CC8A 1N5TA 1RKJA 3OFEA 2EFGA 3DLKB 3I87A 4B9MA 2VOPA 3G8QA 3E51A 5AXMA 1B0TA 3NS6A 2SXLA 5THWA 2XO7A 1IXKA 1FXRA 3M6WA 3MM7A 1S79A 4O44A 2AJFE 2EFVA 2IAJB 2PFFB 2ASYA 4NYOA 2DHGA 2VG7A 2F8HA 2RRAA 2D41A 2FC9A 5GAEU 4ED2A 2DGWA 3OXFA 4RBVA 2ADCA 5KFYA 3IRXA 5KT3A 5GADU 3ISNC 1NK6A 2MJUA 1ZZFA 1VGYA 3CC2S 1Y7PA 4JI5F 4DL3A 2DGQA 2MSTA 3UW1A 3M32A 4OLPA 4ZK7M 3GV5B 3NLCA 4MKYA 2EG2A 2F8EX 2FHJD 4DLGA 1GTEA 2DT9A 5F0WA 4IRKA 3TO8A 3N5BA 2HWTA 1G1XA 4A46A 3BGRB 3GWCA 2MQOA 3G6XA 2MGZB 1DRZA 1S10A 2FHKA 1R89A 5EX3A 4A8SA 2V8GA 4AE5A 1TKXB 4DG1A 4LF7F 4IFYA 3NG8A 2MXYA 3M1VB 2KFYA 2J0SD 4B9TA 2OH2A 2KG0A 1QVFR 4IG0B 2O67A 3M8QB 4WZMA 2R4FA 3MEDA 1JNZB 1UJ6A 4N56A 1WG4A 5KFMA 2BE2A 4IH5A 1T05A 2HNZB 3QIDA 2ZOGA 5DLGA 3BO3A 1U1NA 3W2WA 1U4BA 1MROB 3U7JA 3MOJB 2LQJA 4H54A 1YSJA 1S9GB 2M2BA 2YNGA 3M2RB 5I4MA 4CTAA 4ELUA 1C2PA 2R7RA 2DNGA 3CVKA 3T9ZA 3MI7X 4IH6A 3TX8A 5KG5A 1NK5A 3W7BA 1RISA 4ERDA 1QSSA 1S1TA 1H7WA 2E5HA 2J6UA 2KZZA 3DRPA 1U2RA 4I2PA 3TRGA 3Q8RB 5A6PA 2UUAF 4UQGA 4FF2A 1OSCA 2OPPA 3U27A 1KD1T 1R3NA 2RF2A 2VZ9A 4EUVA 4J9NA 4DSEA 3V6HA 2ZJQQ 4ZP6A 4RUAA 2GMHA 3K58A 2CVEA 3V4MA 4A8WA 4ECZA 2CYYA 5IT9Y 2CJ9A 4Y2KA 3MF5A 4X4SA 1LKZA 3JAMY 2F8MA 2JDJA 4Q45A 2ASDA 1TL3A 3Q8QB 3WBZA 5HI7A 1C1BA 2BM1A 2J0XA 3TA1A 4J9MA 2BR0A 2PC6A 5EWEA 4X4OA 1KHWA 4MIBA 4LSLA 5K9FA 3TNVA 2FDNA 3CCVS 3N9UC 4I56A 2W4DA 3OL6A 3FMWA 3CPWR 1RTIA 4WE1B 5DG8A 1SL2A 1YRTA 4B08A 2C28A 4JV5F 5I42A 1LWEB 4U67Q 1MMNA 1X8DA 3D5MA 3JB9k 4HH0A 2R2UA 3PVXA 2HHHF 3QLHB 1FDDA 1UP1A 3HVAA 3BN4A 2CPEA 2M3DA 2ZHAA 1U1PA 2DGOA 5IT0A 2M8DB 1UA0A 3S1TA 1R8PA 3GIJA 3V5RA 4E0DA 4EO8A 5CHCB 3Q24A 4ECWA 1N6QB 4O3PA 5DDOC 1S1XB 5A8WB 3AB2B 4J9PA 1RT2A 2BXJA 4HTIA 4ALZA 3I31A 4O4GA 3RBEA 5A8KA 1J5OB 3M8SA 4J9SA 1KLNA 5EWGA 2HVIA 1N54B 1K1SA 3Q8PB 3MEGA 3BO4A 4KAIA 4Q0BB 3RYLA 5J2NA 1I1GA 5DO2A 4HL9A 2GHWA 3PEHA 3R3TA 4QPTA 3PDNA 4QR2A 2F7VA 4AFFA 3DYAA 1ZM3A 1RTDB 3AA9A 2KDOA 1HR0F 1IR0A 4A47A 2Q79A 1VIOA 3O6QA 5E2QA 1N0UA 3IO1A 3LP2A 5I3QA 4IRDA 3DRRA 1VOMA 1PC4A 1S0VA 4UUXA 2UVVA 1BQMA 4K59A 2LXUA 3M4XA 2VD3A 4F4ZA 1C4CA 2CQDA 2E9RX 3DLGA 3K5OA 3HHNB 1DTTB 3MM5A 3P3DA 2VA2A 4F3MA 1YJWS 1SKWA 1NU4A 1VQ6S 1R6YA 3RRHA 3G9CA 1SJ1A 3IGNA 1YJ9S 2LECA 1U24A 3OHBA 3T6JA 2BANB 2LYVA 2OFHX 2MHEA 4WXWA 3DDNA 5IFMA 4ECQA 3DXBA 1UW4A 3KJVA 1RYRA 3WC0A 2XI2A 2IFXA 3HLUA 2XS7A 3W2VA 2CPFA 4I7FB 5KG1A 4C97A 4DR2F 4RNOA 1UWBA 4H4OB 5J2PB 3BQ1A 2ZC3A 2V4JA 2NZ4A 2JEGA 3ENQA 2HAIA 2JSXA 5D4NA 2L3MA 3PW0A 4QZVB 1E6VA 1FRXA 2X1GA 5E3CA 4GO5X 3H8YA 2PD1A 1T3OA 2FJEB 5AXNA 3EX7B 5EN1A 2GW8A 3CCSS 4OHVA 4IDKA 3KK2A 1SV5A 4YQWA 1AUDA 2XNRA 2EWHA 5KFZA 1P9QC 2OPRA 3I9ZA 1IKVB 1KFDA 2QRRA 4IR1A 1QAYA 2IMOA