4B3TJ

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4b3tJ00
4GKKJ 4DV2J 1XNQJ 2UUAJ 3IMQJ 2MEWA 2UU9J 5LMNJ 2KVQE 4JI6J 1XNRJ 3T1YJ 2E5LJ 4GKJJ 2MQ8A 1IBKJ 4LF4J 4NXNJ 1N33J 3D3CJ 4LF8J 4KY3A 4DV5J 2F4VJ 2UXCJ 4JI4J 1HNZJ 2UUBJ 1J5EJ 4JI3J 4NEZA 4JI1J 5LMUJ 3J7AN 5LM7E 4KHPJ 4DV6J 4PWWA 5IT9U 4JV5J 1HR0J 3W1YC 2ZM6J 1I94J 2KL8A 4YHHJ 1HNXJ 5FLXU 4DV7J 4DR4J 3J80U 4AQYJ 1XMOJ 3JAMU 4DUYJ 3J81U 1N36J 4K0KJ 4LFCJ 4B3RJ 1N34J 2VQFJ 4NEYA 4B3SJ 5BR8J 4LFAJ 4DR6J 4OX9J 2HHHJ 4LFBJ 4DR1J 4HHUA 4JI5J 2UXBJ 4YY3J 4JI2J 4RJVA 4JI0J 5IWAJ 1IBLJ 1N32J 4X62J 3D3BJ 4X64J 4V1Ak 4LF6J 3R2DJ 4JI8J 4JI7J 4DV0J 4DR7J 5AJ3J 4DR2J 4X65J 3OTOJ 2VQEJ 4B3MJ 4LF7J 2UXDJ 4KYZA 4DV1J 5A2QU 1FJGJ 1IBMJ 4DUZJ 4B3TJ 2MTLA 4NXMJ 4X66J 4DR3J 1HNWJ 4JYAJ 4DR5J 4LF5J 2UUCJ 3T1HJ 1XMQJ 3R2CJ 4DV4J 4DV3J 4LF9J
chains in the Genus database with same CATH superfamily
4H54A 4WKRA 1F9FA 4UOGA 4OYPA 1SQEA 2IRYA 3KYLA 2GIQA 1FRMA 1U1QA 3PJWA 4Y6IA 2KN4A 4HI2A 4ZA1A 2Y3YA 1CC7A 3RAQA 2BACA 4I67A 2MB0B 2V0NA 2XY6A 3D9BA 2HNYA 3P45B 4QOTA 2ZM6J 2C3MA 3CB4A 1RT6A 3RG6A 4WE1A 2VV5A 3HO1A 5J1NA 3J81U 1TZ0A 4B3SJ 3QT8A 3MUMP 2JWNA 5HBMB 2IVMA 2BE9B 3QBCA 3FRZA 2HFNA 5HVGA 1YJ7A 4K8RA 5GAGU 2EVZA 1U1KA 4AXJA 5LXRA 3PW4A 2R7UA 4NCGA 1RAAB 2M9KA 3OTDA 4F0KA 2ZUAA 1QSSA 1SKWA 1PJ7A 3SIPB 5SUHA 4UQTA 2D7SA 4DUZJ 4A8YA 2DGWA 3W3SA 3K5MA 3J7YU 4Z37A 4R5PB 3FRYA 2AYGA 4EZ6A 2D3UA 1T9UA 4YB7A 3QWUA 1FFWB 2C42A 2IMWP 1JKHB 4RUHA 5KG7A 1N33J 1IJEB 2C22A 2NS1B 5KFVA 2OPPB 4LBPA 1OQ3A 4OHZA 4IQXA 2BEFA 3HSZA 4WK1A 1LWCB 3BV8A 4DV2F 1G3OA 3C16B 4NA1A 4QR2A 4C8OA 1LXJA 5L1JA 5T14A 1KVKA 3KLGA 3BM7A 4JV0A 2IYIA 3BBBA 2KYXA 2XULA 3HFZB 5KFXA 3HZEA 1QUPA 2VG5B 1WEZA 1HA1A 3PYGA 2E1RA 1NDCA 1U02A 2V4JA 4PYAA 4ZVHA 5ETTA 5HJXA 4P74A 1YVFA 1U26A 1EB0A 3MR6A 4CTAB 4E0DA 2DY9A 3EGVA 1WNEA 1KONA 1X4GA 2J0QD 3KLFA 1BLUA 1N48A 3MR5A 1LW0A 3E01B 2CJ9A 3HHLD 1TVRA 1GXLA 3ZTRA 4U8YA 4HHJA 1SL1A 3PIOQ 4FPIA 1N8RT 3EZUA 3LP0B 5FLXY 3KLHA 3DM2B 1RK8A 3J7AN 4JV2A 4AUKA 4EU0A 1C1BA 1AT1B 3H5SA 2KFNA 3A8JA 2HMIB 3NEKA 1Q7YT 4ECQA 1UJ5A 1AXQA 3PO4A 5F8HA 1SC4B 4PG4A 5CYJA 2V50A 2ZC3A 5C5JA 5IWAJ 2FJVA 1TKDA 2DR6A 3TP2A 3M2VB 4K7QA 4ILMA 1DY3A 1EHWA 3EZOA 4RW6A 4DV0J 4FXWA 3FBCA 1D0EA 3PW5A 3WIVA 4IH5A 2YWKA 3CSKA 2XYPB 1X31C 2HBRB 4QZVB 4OYBA 4URGA 3JS9A 3PJ9A 4QBUA 2CA9A 3A3PB 3C6UA 4PUOB 4RW7A 4J9PA 3M8RA 4CYUA 1HQEB 2XQCA 3IRXA 2HQCA 3EE3A 3ZNJ1 1I6JA 5EWEA 2B56A 3N5FA 2KT3A 4UZCA 2UUAJ 3HSGA 2HFZA 3PYFA 3NLCA 4LREA 2ZBIA 3FEYB 1Q1KA 1HHQA 2VPWB 2F3JA 4CLWA 2CDQA 3RZAA 1NK0A 2MZJA 1NSKL 3VCDA 1HNZF 3CMES 1F5CA 2BR0A 2IA0A 3HKZD 1PYTA 5ETKA 4R8UB 1Y4ZB 3J80U 1KOOA 3AB2B 5MLCV 1S9EA 2J9EA 3PKYA 4LSNA 3GLJA 4IYQA 3KHHA 3G86A 3IR7B 3R1HA 5BJRA 4P2XA 3QFHA 3FGVA 4XTTA 1JLFB 3Q8YA 4LF7J 3TQEA 4DV1J 4CO5A 1RAGB 1A6LA 4O4GB 2Y1JA 3EX7B 1TP7A 5B0EA 4HT5A 4DR5J 4OX8A 2V6AA 2CPZA 4DLEA 2HSEB 2ADBA 2ZVIA 1UVJA 1UVKA 1KN6A 2WBMA 4MKBA 2IA6A 4ED7A 3ETOA 1DTQA 1S1VA 2LVWA 1LWEB 2HFOA 3J81j 4ED0A 1M5SA 1MWYA 5HATA 2GAGC 3SYZA 5C2GA 2WVEA 2RSQA 3UCUP 5KFCA 3KK3B 4U7CA 2F8EX 2RF2B 3AXKA 3P4UB 2YNGA 4K4YA 3GIIA 2RIJA 4LBIA 3MUTP 4X4OA 2XHWA 1HI8A 2R2SA 1IBLF 4EK2A 5KTQA 2C2KB 2Y1LB 4ED8A 1NHUA 4CO0A 4IOBA 2ZJQQ 3AAWB 3M30B 1ITPA 4M5LA 2HQDA 3F41A 2WOMA 4KC5A 5HLFB 4FS1A 3DLHA 4JI0F 2E44A 2B8PA 5G0RB 4L76A 5IV4A 2OEJA 1MW7A 2QMWA 2CQ0A 3IC1A 3R7NB 2XS5A 3T3FA 2WVBA 2KTQA 2KVQE 4QWCA 1WG4A 3SCLE 4H4MB 3HD1A 2F5GA 1R8HA 4EBDA 2XMJA 3RRHA 3ZZ0A 5AXKA 2L48A 3U1LA 2A2CA 3VAHA 2V8HA 3ULHA 1D8YA 1BE4A 4NE9C 3EGWB 3K59A 3IWNC 2HHSA 3NGKA 2PI5A 2W9CA 2DNHA 5LSLA 3GMGA 2BQ3A 1S76D 1URRA 3UCGA 2AX1A 4AXIA 2AGPA 2HHHJ 2FHKA 1Q5YA 2H51B 5AE1A 2EI5A 5THWA 1K1SA 1HHTP 4W92B 4OYAA 2XY7A 2XZWA 4USJC 3UE2A 3W2VA 3BO2A 3BREA 1VI7A 4JYAJ 3I6PA 2EKNA 1JNZB 3G71S 3KLIA 1H0HB 2XMMA 3SSQA 1VBYA 2W2PP 3UDCA 3M32B 2LQ8A 4NCAA 3Q24A 1NHKL 4ED1A 2YVSA 2G2OA 3W65A 4B3MF 2H1YA 2Q6CA 1QLNA 4OZ0A 4L6V3 2RU9A 1RT4A 1WC0A 2VG7A 3VAFA 1R31A 3MAAB 5K8MA 1F2HA 5IC6B 2Y8YA 3ILLA 3ONQA 2GAHC 3VV2B 2CQ4A 1ZBTA 2HFSA 2IIHA 1CJVA 1S1TA 1ZYQA 3MI7X 2HAFA 2B9WA 3PX0A 2AMCB 2EFNA 3FEXB 1NKBA 5E2QA 2EK1A 4NRUA 5CH7B 2M7SA 3QZ8A 4DL0C 1G4CA 5I3PA 5F8JA 1YGYA 3MEGA 1FKPB 2RUGA 1YZ7A 4M94A 2V2VA 2HFUA 4A48A 4DLGA 1SQGA 3DLKA 2CZ9A 2RS2A 1Z2LA 3TZYA 3V4IB 4QWEA 3EJMA 3M6XA 3OVBA 1T9YA 1J27A 5ETSA 5BYSA 1M5KC 2FIUA 4ETXA 4U6PA 2GMHA 3QJLA 2LKZA 4URSA 5EWGA 2VDHA 1XNQF 1QTNB 1TAUA 2HS3A 5U47A 1DTTB 1SUQA 4F4YA 2OH2A 1X4CA 3UN2A 3D1QA 3IRWP 3GV5B 1M5PC 5EUHA 3ILOA 1X0FA 2DITA 1EJ7L 4R25A 2FLPA 1R6YA 3ZTPA 1MN7A 4WYLA 3FSXA 4Y28C 4DV7J 1X7VA 1VFJA 2KB2A 4DG1A 4J9QA 3AJ2A 4TU8A 1H98A 2UXCF 3K5NA 3MECB 1IWGA 4RJVA 3ILJA 4DR6F 2WVFA 3FBEA 3SQOP 1AUSL 2E7XA 2KJWA 4WWSA 1TAQA 3FQLA 4C11A 4CRJA 3L4BC 1SIZA 2VFRA 2IDLA 4YFUA 1K8AT 2KT2A 3MPVA 1SC3B 3TWZA 4TQRA 4LR8A 2NPFA 1PSDA 1H38A 2GJFA 3KLEA 3VGTA 2DCUB 2E1CA 2OFGX 1Q95G 1ZM3A 3K57A 1HI0P 3I9V9 5KT7A 3CJKB 5HP1B 2XGPA 4DV5J 1RA7A 5JVHQ 1FXRA 3SDEB 4CCHA 2QMUB 2W24A 2PA3A 8RUCA 5IT9U 5HJYA 1N5YB 1XBWA 1RTDB 4XIUA 4RNHA 4KV8B 1S12A 4M5HA 4NLVA 2GHWA 1NDLA 1RWOB 2DNMA 4PWUA 4MT1A 2MMYA 1C0UA 1NDKA 2VG6B 4HH0A 3KUEA 2LECA 4ZVFA 3BO4A 3QATA 4CH0S 1S10A 2B7CB 3L95X 1SJ1A 4KTQA 2B4OA 4IO9Q 1RWKB 1UFWA 2CPIA 4Y0FA 1VBZA 1H74A 1X5SA 3K7RA 3O3LA 2E1PA 4E8UA 3TJAA 4KQZA 4DOZA 1VJWA 2G9OA 3FSYA 1KRPA 2W7OA 2V68A 2VKRA 1QJHA 4PG7A 2B3TB 2B7BB 1NK7A 1UKUA 5GMDA 3GR0A 2P9GA 3H2UB 2G1HA 5I3QA 5ETLA 3VAJA 4QU7A 3HHDA 4BBYA 1BC6A 1NZ8A 4OQJA 2DIUA 4G1IA 5A8RB 2E29A 2XSJA 3NCRA 2YKAA 2C3PA 4RR5A 4C9DA 1O51A 4G6VB 3T5HA 4UUWA 1C1CB 2ZH9A 5EX0A 4I2QB 2GJIA 2BRKA 2QL5B 3QRRA 3BN7A 3D67A 3GYXB 5KFEA 4B3RJ 1HFEL 2PEBA 2J9CA 3SEOA 3OJUA 4J9LA 1QM9A 4YR0A 3L7UA 4URQU 5J2PB 2KHCA 2ASYA 3CF5Q 1KQFB 4DUYF 4WJBA 3OD2A 1VRUA 3IBFB 1E6VB 2DNGA 1RTHB 2A2DA 4B02A 3W61A 3OT9A 3T5JA 4DSKA 4YY3F 1D09B 1AZSB 4AD6A 5HAOA 4DV2J 2RQMA 4Q0BB 2E5GA 1OIAA 4QYZJ 2ZDPA 4LJMA 2XMTA 3T1YJ 2LYVA 4F2RA 1IKXB 2C1EB 2WZ1A 2XMUA 1NK4A 4HI1A 1FTCA 1U2CA 2I38A 4PXEA 3IR6B 3CC4S 1AROP 1U1PA 2FHOB 1NM2A 2XYHB 4X4PA 2YKNA 2HQFA 3F44A 1VQ5S 5KT5A 1XNRF 2C2DA 1BQNA 2PFDA 4NPOA 1OYDA 2F4FA 5B0FA 4DR4F 3KK1B 3TAPA 2O3DA 1S97A 2BQRA 4W90B 1GQEA 3R5BA 3ZTSA 4F7VA 3NCQA 3DRRA 3R2DJ 3I4HX 2HURA 1CEZA 3IAM9 1X5TA 3MM8A 1HNXF 1Y9OA 1IKVB 1Q8KA 2GO9A 5KFGA 4NI2B 5FDLA 3OQ2A 4DPUA 4JBCA 1FNMA 1KFSA 2J7KA 1IN0A 1DQ8A 1PBAA 3VHQA 2DH9A 3P5BP 2XLIA 2HNDA 4P52A 5D0HA 4GKKJ 4DR7F 3HFVA 4DR2F 4P2FA 2AHOB 3QT5A 3JYTA 1VQLS 1PIEA 3A8KA 3UVJB 4RL1A 3SSRA 2MZSA 1RWPB 2R8HA 3BQ2A 2MY7A 4LF4F 1OO0B 4DWIA 3G6YA 2XY5A 2WONB 3LWMA 2IBKA 2ALYB 2M88A 1B0VA 3P5TL 2ROGA 1IBKF 3WBZA 1MROB 2NZCA 3UD5A 3BBFA 2XCPA 1ZA1B 1HQUA 5EWFA 3M8QB 1YIJS 3MEDA 4X65J 1K73T 2FLNA 3SMZA 3QSYB 3TRGA 5DRKA 1OY8A 1IR2A 3I0RA 4NLSA 1G1XA 2FVCA 3R97A 3G6VA 1VHIA 1O8BA 1GNKA 4YB5A 3DLBA 1W7WA 3ZTOA 4A46A 4QWDA 2HGMA 3DYAA 4DFJA 5GADI 4JI4F 2VDIA 3IXQA 1U1LA 3D7SB 1T9XA 4DL6A 5K8OA 4WU2A 3FDSA 3EYZA 3V6DA 4IRDA 1NPKA 2PMWA 5GMEA 4YDDB 4NMLA 4A8QA 4M5NA 3UDVA 1N4LA 2R7XA 4QIVA 2ZH6A 2DISA 3JSMB 3GFHA 5AJ3J 1UEUA 4FS2A 3NKYA 3CJ0A 2ZNYA 5H9EJ 5HI7A 5D15A 1EX8A 3JSBA 3ZTQA 4J9RA 2OEMA 3OHBA 1RT2A 2IM3A 2HEKA 5I4MA 2EG2A 3GTYX 4DR1F 2K1RB 1HNVA 2DK2A 4C2MA 3R5DA 1WDTA 3BS9A 3FBBA 1T05B 3OR2B 5ETQA 1A0OB 1WOPA 4DV4F 2C2EA 1WOSA 1UP1A 4TQSA 4OL8A 4ID5A 3H20A 1YTYA 1NJIT 4QYZK 4CM2A 4X66F 2QFIA 1WSRA 2NYHA 4ICLA 2Y1IA 2R7QA 3P8BB 2GGPA 2QTWA 4ZVSB 3VWSA 1RHQB 2RU3A 3ISNC 2W7AA 3BSAA 3LP2A 1QVFR 3BQ0A 4Y2AA 1GTHA 4MH8A 2OPSB 4LF1A 2HNYB 4FF3A 2XTJP 2G0IA 1RT6B 1KP6A 4WE1B 3TAMA 3PR4A 3SV3A 2HRUA 4ZPAA 1R27B 1FRIA 4V19J 2PE8A 1S99A 4JI0J 1TL3A 3I56S 1H72C 4OX9F 1ZAXA 2JVOA 4NRTA 2MZRA 4NCGB 3RB6A 4O4RA 4WXOA 2XGQA 4CO4A 3LPYA 3C14A 1BWEA 5AXMA 5C25A 5DZ7A 4TKTA 2R7WA 1RSCA 1AUDA 4CI0B 4O3NA 5B09A 4X62F 3T1AA 2R7OA 4J90A 2YKPA 3SQGB 2JRSA 2JFDA 2R2UA 3NP5A 4I6YA 1SH2A 3CW2C 1GMWD 2JLFA 4WIIA 2UU9F 5HO4A 2K3IA 3NMAA 1LKZA 4KBIA 3QRQA 3VTIA 1CJTA 1HL6A 3AHPA 4FKXA 3BSOA 1FVSA 1X60A 3D54A 2C2RA 2OI2A 2YWEA 5GMKa 2COLA 3WHIA 3GSDA 2B43A 2VD3A 4ZMMA 1LFWA 4D3HA 4LBHA 4C0OC 2MXYA 1S72S 1EIYB 3KLGB 4FF4A 2GO8A 5D78A 4Q44A 4ER8A 3KMSA 5HMXA 1Q79A 2E66A 2P9CA 4RBVA 2LQBA 2B4UA 3KG4A 2MQOA 4UY85 3PHTA 4WXWA 4C8MA 4B3MJ 2VBZA 2OD4A 2YKOA 2V4JB 2QGFB 3MFIA 1CJUA 1GMWA 1URNA 4UTGA 3BGLA 1YJRA 1S6PA 1UWAA 3FNNA 4B9SA 1TL7A 4AL6A 3KLFB 2IVFB 2BKNA 3RAXA 1LW0B 2ZKTA 1UVIA 1TVRB 3BB5A 1LWCA 3A3NB 3CMAS 3EXYA 5E5NA 1EQMA 3UN3A 2XNRA 5KFTA 2FJXA 2BKOA 2F8MA 3MZIA 3KLHB 2AEJA 2QLBB 4C0HA 2WSCC 1C1BB 4ES2A 1KVIA 1FJ7A 1YX2A 2EFOA 3UD3P 3OVAA 1KFDA 4OI3A 1I3OB 4MIAA 1NK8A 2K06A 2VQFJ 4ELTA 3D1OA 5A8KB 3GPAA 5DG8A 3LA0A 2QA4S 3MAHA 1SCJB 2A18A 1WHVA 1NLKL 2ZITA 5L9NA 4RW6B 2KO1A 3PNIA 1VQKS 1JB0C 1P6TA 2YXLA 2H5IB 5H9EK 4JV1A 4NZ0A 2Q3PA 4ZPWR 3C6UB 1HHSA 2VC1A 3KKFA 4RW7B 3NRBA 2RQ4A 4CYUB 2MKJA 1KQSR 3IRXB 1FEEA 3BDEA 3RW6A 4TVAB 2ZOGA 3MTKA 3GG1A 3LUYA 4JI6J 2OEKA 4A8WA 1M1HA 2EK6A 4KY3A 2NXEA 2UXCJ 3FZ2A 3CJ2A 4HVZA 2JEGA 2R7SA 3T1HF 2HPUA 5K5MA 1C4AA 4YOEA 1OWXA 4KHPF 1R0AB 4C8YA 4X4QA 5KFNA 1YBTA 3IBCB 1X9WA 3M7VA 2J6UA 2W2OP 1S0NA 5B0CA 3HVRA 5L38A 2NUHA 2FUG9 4F4ZA 2BM1A 2ZOFA 1RT1A 1H7XA 4IOAQ 2CUYA 2OAUA 2FVQA 1CG2A 2V8VA 3ENVA 2CQGA 2YPYA 1NB2A 4N77A 2CIMA 4ITSA 3W62A 3NGRA 5E3AA 2C3UA 2A3JA 1XIQA 6FDRA 4C8ZA 3WZ0A 2A10A 3ZC4A 1LQ9A 1BXNA 3TQ1A 1B70B 1NHVA 1ZS6A 3MM6A 4DEZA 1DTQB 1RWVB 4J5OA 4J9UE 3J7YI 4CT9A 5F3TA 3AA9A 4B9UA 4ZP7A 4BLGA 2W9BA 2LEPA 3B4MA 3M8YA 3UR0A 2DNRA 1S4FA 5C24A 1W26A 1PC5A 2HW3A 1JLFA 2YNGB 4FKYA 3MMJA 4DU8A 2B9XA 2IJFA 4QW8A 3CJ8A 3GU0A 2MLZA 2YWFA 2QN6B 3N01A 3FSIA 3WX4A 1XR6A 4OIXA 3MHYA 1F0XA 2QYGA 1S49A 2DNNA 2WOMB 2ZE2A 4L74A 5LT5A 1WC4A 4FPRA 2F9DA 1BWVA 2K2PA 2VPZB 4KKOA 3NWGA 3DC2A 2FHJD 3LQVA 4ZVTB 2E7WA 5LOQA 2ZDOA 2N4DA 3M6UA 4ZLLA 2P5VA 3HHEA 2XCAA 3PYDA 4TYBA 1S9GA 4LF5F 4NEZA 4G1PA 2FQQB 2G1DA 5KFIA 4IRKA 3W5ZA 1SL2A 4Q8FA 3HJVA 4NLUA 1WG1A 2ZBCA 2ZM6F 4DUYJ 3RB0A 1ZZNA 1RHKB 2CNKB 5KOXA 1U6ZA 3BGUA 3CCRS 4YY3J 4B3SF 4N76A 1TQLA 1AYEA 4ZKAA 4IO1A 4X4RA 4QIWD 5D4OA 3ZZYA 2R8GA 2OUGA 3BJYA 5M2PA 3KJNB 4R0EA 2E9ZA 4DDFA 4OJGA 2KHDA 3W2VB 4MKVA 2G4BA 1FK9B 3HULA 2BDPA 2I6WA 3PVXA 3T41A 3KLIB 1NSQA 2JC0A 3IN5A 4Y2KA 4WF9Q 5KFRA 1NO8A 5A8WA 2QLXA 1O6XA 1XNRJ 1RWNB 1RT4B 2VG7B 2FGCA 3KK2A 4FBTA 1NKEA 4PG8A 4I64A 4IOCQ 4DN0A 1FKAF 3MGJA 2ZOMA 1CJVB 2DGSA 1NPRA 1Q82T 2KL8A 1HNXJ 1S1TB 2DGTA 2BE7D 2YX1A 1SKUB 5E41A 4XAKA 4Y2IA 4J9KA 4J9OA 2J5AA 3SCKE 3H5YA 3BR9A 2WW8A 1NUEA 4MAKA 3AOBA 3MDFA 2JLGA 3EGNA 4C98A 2FY8A 4CQ1A 3MEGB 1NNDA 1AFIA 4DR7J 3EDQB 4KGZB 4DR2J 1TKXA 3JSRA 3DLKB 4ZVQB 2DEIA 1WF1A 4EO6A 2R7TA 2WK4A 1YRTA 1B3TA 2JX2A 1RABB 2IJNA 2XB2D 2YH1A 3GJSB 3VF0B 2IRXA 3ENWA 1H2VZ 1QAXA 4YB1P 1QD1A 2HK2A 3IM9A 5AXLA 3K5PA 1IBKJ 4AE5A 3A12A 1SUQB 4CLLA 4LUBA 2DNPA 4DSLA 1S6QA 5CXTA 1F9HA 2PD1A 4PZVA 4ZJQA 2G2YA 2YWWA 3RR8A 2B8QA 2CJXB 2YX4A 4ZPBA 3C15A 3H40A 4DG1B 4C8LA 3J80Y 2VPXB 3CJ4A 3SV4A 1NPPA 2BW2A 5GAEI 5KT2A 3V4IA 5LMUF 1U2FA 2RB7A 4CO3A 2PDAA 4XDCA 4Y3CA 5HANA 1XTZA 4ZN1A 3D66A 2JC1A 5CZVA 1R8AA 1N6QA 4FXVA 4DV0F 1GXTA 4C11B 2RAQA 3M05A 4H4KA 1KTQA 3GV7B 4MFBA 4LR7A 2ASDA 3VAMA 3PZPA 4PWDA 4CNYA 1GFWB 2XWYA 2HQ3A 3POTA 4JUZA 4HL9A 3H4DA 3VAKA 1KNZA 4G3IA 3KLEB 3IBWA 4MJKA 4PPZA 1UZHA 3AQPA 1FNOA 4H4KC 2N7YA 3QIDA 3HVAA 2IRUA 4ANEA 3Q8UA 2KZZA 3RTVA 3QNWB 4ED3A 3RAMA 5D0RA 2ZFHA 2BXJA 2GQQA 3TOQA 2ZVSA 4OZJA 4M5DB 2A6OA 3FEZA 1HD1A 2F63A 2RUSA 4DR1J 3RYLA 2L9DA 1C0UB 4FYWB 3EUNA 3GZ7A 5J2QA 5ADZA 2HZVA 4AL5A 3PFEA 5LXYA 2DO4A 4KGKA 5A2QU 4V19X 5HVFA 2RVJA 1RHMB 1WI8A 4OHXA 4X66J 1F5AA 3EM1A 2NXJA 4LFBF 3CJKA 5HP1A 3GG0A 3SDEA 1D9DA 4FF2A 3NY0A 2R8JA 2HWIA 2MSSA 3CUNA 2FVRA 4DSJA 3H42A 1N5YA 1UVMA 3R5CA 1WACA 4R0JA 2QLWA 3BQ1A 2FC9A 3EMTA 1RT7A 3UW1A 1HBUA 2KJVA 1XMBA 2XSJB 5HROA 5LJ5Y 3N6MA 3SZ2A 2RDJA 1HR0J 2VBWA 5DETA 1NU4A 2VFVA 1S79A 5FLXU 4ETZA 1RT5A 1CSJA 4E2FB 1HLWA 4KIAA 3PYEA 5BYQA 2XZTB 2E1MC 1YK9A 4X62J 4N5SA 4F8RA 2R4FA 4WFXA 2RQKA 4KHMA 4I0WA 4ED2A 4ZN3A 4K4SA 2JEFA 1U8SA 2MKCA 4AQYF 2ERRA 5LL6d 1RHJB 1VRUB 1PAUB 2I1RA 2LA4A 4JI5F 2L9WA 4J91A 4YEAA 3PACA 3CXCR 4P2SA 3TVYA 2ZH8A 3QGGA 3ADAC 3G9CA 5KG1A 3OXFA 3HSJA 1U1OA 4GRSA 3TYTA 3NAIA 1WUUA 4KGXB 1RHUB 5ETOA 3VQTA 1FDBA 2ASLA 1ULRA 4JI3J 1JQGA 4C48A 4DX7A 4OFZA 2HKEA 4MYTA 4WK3A 4DCOB 4DFKA 2B9YA 3PV8A 2YKNB 1LWXA 5D4NA 1BQNB 1C4CA 4GC7A 1TFYA 2KFYA 2Z0GA 1RA6A 3M2RA 1ZAVA 3B8HA 4WYWA 3BZQA 1EAYC 1FDNA 2RILA 2M5YA 3DRRB 4NCBA 3Q83A 4A8KA 2AF6A 2K8GA 1UJ4A 5FDLB 3OSNA 3FZBA 3KOAA 1WORA 2UVVA 2V2ZA 3GYGA 1VOMA 4DN9A 5F0WA 4JYAF 2CWXA 1TL5A 1XN9A 3M8SA 2HNDB 1L3VA 2BKPA 1VHFA 3OPKA 1N54B 3X1LB 2OELA 4I2PA 3K2YA 4RBUA 3CJ3A 2UUCF 4LF2A 4ZP9A 3W8PA 1ICEB 5L1KA 5KFWA 2NSCA 2ZH5A 2GQCA 2D3OR 2IBOA 2C3YA 3I0SA 3IWLA 2VL1A 5F8MA 4LFCJ 2MQPA 2CQPA 3MD3A 1KEKA 1U6FA 2CPFA 1WOOA 2O01C 1VRTB 2PA8D 1MMNA 2HVDA 3GJTB 1WKKA 3D6TB 2IVYA 5KFYA 1HQUB 2LLZA 4JI8J 4QWAA 2ABYA 3MEDB 1TUGB 4ZPVR 5KOWA 4OI4A 2YNIA 3GP9A 1SBRA 3I0RB 1P27B 4AYBD 3KJQB 2M52A 3ILIA 3T1HJ 1KKHA 2DT9A 2RRAA 1T3OA 5KFDA 5GAHI 5F9NA 5KG6A 4DZ6A 3WX8A 4M1KA 3MCNA 1JK9B 4B3OA 4LRCA 1J5OB 2FLOA 2AW0A 2B9EA 1RACB 3HSDA 2WVCA 1K9MT 3OUYA 1WF0A 3DYAB 2QIFA 3ZFVA 1KC8T 2WB4A 3TAQA 1FKOA 3Q2SC 1KLMA 2Q79A 3HVWA 1QSLA 1GAOA 3MOJB 2XO7A 2HQGA 4RW8A 4B9NA 2RDDA 4L75A 5IT9Y 4NZ6A 2Y9HA 2AJ0A 4DJBA 3Q0AA 3QIPB 3V6DB 1BGXT 2HAIA 4DV7F 1DJ0A 2RH3A 3MD1A 1N56A 4IR9A 4WFAQ 2Z2YB 4F4XA 3GILA 2LU1A 4IH6A 4HDGA 1RCOB 4KH1B 3K17A 1XERA 5KG0A 3QJPA 4DMZA 2Z2ZA 3LH2S 3GFXA 1U1RA 1NAQA 3A3OB 1CVJA 3GFZA 4ECYA 4OLOA 1VLYA 1RT2B 2N4CA 4DX6A 1LWFA 3V5RA 4MYUA 1CLFA 2V4QA 1HNVB 1YJNS 1HWLA 4RLEA 1NZAA 2JNJA 2OO4A 1DLOB 3CDBA 2RNEA 1SJ4P 2J0SD 1TUVA 4ID5B 3UFCX 1TFWA 4QQBA 4ZCKA 1WG5A 4ICLB 4DFMA 2GGPB 1QDUB 4IQMA 3VAGA 2PMZD 3LP2B 3K5OA 1X4DA 1N0VC 2ZH7A 4CLUA 1NBEB 3RU0A 1VQ7S 5E7OB 1KD1T 3C2PA 2OMLA 2QYCA 1MSWD 2ZZNA 4KR0B 4GVBA 4NOHA 1T03A 1PBUA 4UOCA 3FCWA 2CG4A 2D1CA 1TL3B 2HQIA 2FB0A 5CCMA 2HZCA 3H0PA 4ATNA 1T05A 4K4XA 3B82A 3PX4A 5DQGA 2D3ZA 2QA1A 4CH7A 4IDKA 2R8IA 2I0XA 2JEIA 3OXGA 3VVUA 1EARA 2Z56B 3PM9A 3C14B 1SQFA 5C25B 2MLYA 1RADB 4LF5J 1IQZA 2HVHA 2Z58B 1EKSA 1L5UA 3BKFA 3NNAA 4LVNP 4Q2MA 3M1VA 2BZ2A 3KWMA 3PKMA 2OPSA 5DLFA 2CPXA 2GFFA 3NBPB 3W9HA 1HWUA 8AT1B 4USVA 2UV8G 3P49B 2JHEA 5D3GA 1YBUA 2QA4G 3MTJA 4RPFA 1CJTB 1S59A 2ATCB 4WP8A 4X4NA 1SVDA 2HIQA 2H5JB 4P2MA 1FD8A 1UAWA 3MCOA 2NSBA 3K8WA 1X4EA 2RDIA 1PO6A 4FVMA 3S01A 3US5A 1DQ9A 1QAYA 2CVIA 4ZPDA 4OI2A 4ECWA 4B3RF 1A9NB 3TZXA 4ZCIA 1Y3JA 2E1AA 5CCLA 3G8TA 1K0VA 5CAAA 1M5VC 3SQGA 1XMOF 3DLLQ 5DGBA 3D28A 1CJUB 1DRZA 2EPIA 4RNNA 2DR7A 4ECTA 1RXOB 2R7VA 1S6PB 4HEA9 5G4DA 4USTA 4DL3A 1TL7B 1S1UA 3QO9A 2HWHA 1FFGB 3FBFA 3UNYA 4OZ1A 4CLYA 3CVKA 4PAAA 1B7YB 1FE4A 3T1YF 4LR9A 3F0NA 1SJRA 3EVOA 3GV8B 2F7VA 2Y8WA 3DDNA 2X1BA 1JLGA 4F04B 1RBOB 3VQSA 5C42A 1VYAA 1MU2A 2F40A 1Y5IB 4NWBA 4PQAA 2HGNA 3MPYA 1U49A 4C0BA 1K47A 2V94A 5BR8J 2IAJA 1B99A 5E3QA 2R7RA 4YB6A 3CDAA 2PI4A 1FEHA 3C66A 1PGZA 2FJBB 1HBOA 1IJFB 3KUGA 1KVJA 4O44B 1YG0A 2BV3A 5JXSA 1S6OA 3CULA 2E5HA 4DPOA 5C2CA 3QZ7A 1E6YA 1VGYA 1S48A 3DLEA 3HHKA 1Y11A 3RRKA 2MSTA 1RAFB 4F3QA 4ZVPB 1Q8LA 1IKWA 3DOMB 4UF4A 2X3GA 2VFTA 4KT0C 4YN3B 3WQPA 4GKKF 4ZPCA 2XEXA 4O3OA 3AH6A 3HX9A 1G2EA 1I5OB 3JSYA 3D1HA 4N7TA 4ZVUB 5LMUJ 2D41A 5A8KA 1JX4A 4TY8A 2SXLA 2MDAA 5L1IA 2HFVA 3G6XA 5DDPC 2VHGA 4YHHJ 3TUIC 4DX5A 3ZNUA 3HHLA 1TMMA 3KHGA 2RQCA 4DFPA 3NG8A 1VDHA 3FUYA 3RB3A 2Z2LA 2VODA 3OFGA 1X4FA 5L1LA 1Q8BA 2VC0A 3HK2A 2X7IA 4EBCA 4RUBA 2BANB 2ROPA 4AFFA 4JV5F 2OSQA 1CULA 5KT3A 1RT1B 2VQEJ 3PW0A 3PTWA 1RAEB 3PR5B 4ANDA 4FYVB 3HHLC 1SJ3P 2X3DA 3H98A 4X65F 4PABA 4KFBA 2GCFA 1TV6A 2K3KA 2XLKA 2M8HA 3CJSA 2KXNB 1R43A 4ZDNA 3NNCA 4OHVA 2C2MB 2ZBRA 1X5OA 4WP9A 1VQ9S 5DS7A 3M9OB 4F4AA 1NK9A 2RD5C 5HQLA 5B0AA 1KHVA 2UVRA 1S5ZA 2DPJA 2UXDF 1HBMA 3TUPA 3MM6B 3TUZC 1R0AA 3HXMA 2V67A 5ETVA 3D6FB 3BF4A 3GSIA 5FIIA 2NZ4A 5JVGQ 2LFVA 3LGNA 4G1QA 1FRJA 4CO2A 3CJTA 5H9FJ 1T0TV 4CWBA 2W9BB 3HLUA 2O66A 3EVMA 5C24B 3T5KA 3U27A 2JVRA 5ITHA 2VFSA 1OY6A 2UVUA 2EBGA 1FFSB 2QSFA 3D6MB 4LFBJ 2FD2A 1LK7A 3W7BA 2GVZA 4RWWA 3C46A 4TYAA 1JJ2R 2XHCA 5AJ3F 2F9JA 3QFWA 3DMJA 2HHXA 2JOQA 3PCOB 6AT1B 4DR3J 4Y65A 2XLJA 2ADCA 2ZE2B 1TL1A 2LXFA 4KGMA 1T9VA 5A76A 3R8YA 1M5HA 4KKOB 1U1NA 3HT3A 2ILYA 2L3MA 4IG3A 3CCJS 5A0YA 3CO9A 3JQJA 3PRVA 4ENOA 3KUHA 3R7SB 3P3DA 1X4AA 3G82A 3HJFA 1S9GB 4BC9A 1ZOTA 2CRLA 2EBEA 1DURA 4USUA 4DZDA 1JLCA 4LF9F 5D8HB 2VJUA 2PFFB 5KFOA 2ZD1A 4AQYJ 1MMDA 1VQPS 2XMAA 5IC4B 4CLZA 4PKDB 5LJ3Y 4ZIVA 4JI5J 4RU2A 1BY9A 1JXVA 2QT7A 1HMVA 2GHPA 4P7TA 1FVQA 1RGVA 2HLUA 5L9XA 3QQCD 2V4RA 3G2XA 4MK8A 2MGZA 1QVGR 1FNXH 1D9FA 2R2TA 1REGX 4A4JA 2YQ3A 3CCZA 4DSFA 3FVYA 1N34F 1XR5A 4ZVEA 2IM2A 3GWCA 4Y2MA 1OQ6A 4C97A 1YKWA 3N79A 3KNGA 1RYSA 3FCVA 2AKWB 3W63A 5KAKA 1V5IB 5A8WB 3AD9C 3A8IA 1K0TA 1NJWA 4LIWA 4NLOA 1IBMF 3H59A 2Q1LA 4C7QA 3B4DA 5KFBA 1LV5A 1OS5A 2H4YB 3KK2B 4PRFA 2UUBJ 1QAJA 2IJRA 2BE2A 2FGOA 1RI7A 1YJUA 2V63A 1UPPA 1HI1A 3FMBA 2LA6A 3VVTA 2DGXA 3JAMU 4OHYA 4ZOSA 2QZ8A 3MM5A 3CE8A 2DY1A 1R8CA 1CBKA 4K5RA 1FK9A 2GA7A 1WHXA 4HKQA 2Z4PA 2G0CA 1TKXB 3ENQA 5D4PA 2MPUA 2F8HA 2OIHA 3AOCA 3Q86A 4OI6A 2N7CA 4B3TJ 2HS0A 2YWGA 1BQMA 3MEKA 4CLFA 2HRTA 1QSYA 2UUCJ 2AIRB 2CG8A 3D2WA 1SJQA 2BJ1A 5HVHA 3VR1A 4NZ7A 2MY8A 3C8YA 4C3MA 5IZHA 4QIFA 1T9TA 1RKIA 3DDIA 3DOLA 5GADU 1K1QA 1SJFA 1S6QB 2KVIA 3CD6S 3G87A 3TO8A 2CPEA 2RKIA 4DL5A 1Q0NA 1VQ6S 2W2QP 3VGUA 1N5TA 2MQNA 1GMUA 2JZ5A 5H9FK 4IR1A 5CA5A 3C15B 1ELOA 3MM9B 1KDNA 5CQGA 3R6LB 3UR3C 4UZBA 4JI1F 2VQFF 4DQPA 5J2NB 3I4PA 2KKHA 2XSFA 2P6TA 3H8YA 2CKWA 2IYGA 4KGVB 4KYZA 1N6QB 4ELVA 1SKSA 1LNQA 3M8PA 4MFBB 1N32F 4PWDB 1X9SA 9RUBA 2I9SA 3R2CJ 3DN9A 1R3NA 3OTEA 4LF6F 1R0BG 2XC9A 2EG1A 3POTB 1RT3A 2ACYA 2AJ2A 2LP4A 3IM8A 1REVB 4JI6F 1V3ZA 2MZTA 4NX9A 2WHOA 3K89A 1F1BB 4X4UA 3D5MA 1B7FA 2ACMA 2NLWA 2WCXA 4DV6J 4LSZB 1K44A 3UD4P 3BKTA 2JH3A 4GO7X 1I51B 4DX8H 4NYOA 2XI2A 1DQAA 1N36J 2HHWA 1VRQC 1MLAA 3CCUS 4UOHA 5LSOA 1VQOS 3H5XA 3ZZZA 3GCWP 1VMBA 4OMFG 4Z7CA 2BBEA 2QFJA 5J2QB 4M5JA 4NLGA 1UW4A 2V34A 4YR3A 5EX3A 4PXCA 5D6GA 4MIBA 5IQQA 2ASJA 5M2RA 3HVTA 1YSJA 2BYCA 4KO0A 2HVIA 4H4OA 1AA1B 5DM6Q 1PKUA 1HD0A 3V6HA 3QYYA 3MR2A 1B0TA 3KNAA 1EZZB 3DOKA 1D3WA 3UCZP 1M1GA 1GK8A 4M5DA 3I82A 1RT7B 1HBUB 2PSZA 5HROB 3U7JA 2GC8A 4RUCA 1T11A 5B08A 2CFXA 4M5MA 1W2IA 3KLVA 4DS4A 1RT5B 4CLSA 4TU9A 3H2VE 1YI2S 2F4VF 2DNLA 3D6HB 4HACB 2YWHA 4JOUA 2B0GA 4OX7A 2DRAA 1T9WA 5IFMA 2E5IA 2UUWA 3H2LA 2DR8A 4NA3A 3Q8PB 1OPZA 2YNHA 3CCWA 5I42A 4MIWA 3AJ1A 4USMA 2HK3A 3CJ5A 5KFPA 5K14A 3QAUA 1RAJA 2GQ2A 4I7FA 1UVLA 2VASA 3CJQA 1Q53A 1T8EA 3DHXA 1V6HA 2G13A 1EP4A 3ET6A 3RBDA 5DZ6A 5HL7Q 5KG5A 2NXCA 1TMJA 4WZQA 4O3SA 7FDRA 4OI0A 2FJDB 2MKSA 1RAHB 5GVQA 5SZTA 5KFZA 4B9MA 4M5IA 4M63A 3R27A 4X4SA 1HIYA 3OTBA 1UMJA 2BX6A 3IWXA 3W2WB 1I1GA 5IT0A 1S7IA 3CO0P 4TN2A 1H73A 1XMOJ 2CNNB 2QA2A 4QJVA 4ED5A 3N6LA 3UDLA 2AD9A 1TUWA 3M2RB 1U45A 3OL9A 3NGDA 1OY9A 2FTRA 3LAMA 2LXIA 4Y34A 1CS4A 1P1TA 4MMOA 4I4BA 2ZKUA 1N5SA 2GX8A 2RRNA 2VH7A 4BC7A 2VFUA 1Z1ZA 3KDNA 2AYEA 3TANA 2ROEA 3TJ9A 1TR0A 1JMTA 4PYDA 4XPEA 3MUVP 2ZZMA 3PEHA 4CM0A 2POKA 4HT7A 3LTOA 1IQTA 1IBCB 3KJFB 3CCQS 1VQ4S 4DPTA 4USIA 1UA0A 4I2PB 5AT1B 3OLAA 4USKA 4YMEA 4O0NA 4F26A 4WZMA 1HQ2A 1JJHA 4DV3F 2UV8A 3AJDA 4WFZA 4F4WA 4CIOA 4I69A 2DPIA 2O1PA 1V3SA 5KFHA 3I0SB 1RTIA 1HYSA 1JNRB 5BXIA 3K58A 3DLGA 2EXUA 1UVNA 4I6WA 1R0CB 3NCPA 1KR4A 2DJWA 2LQJA 1JLAA 3DGPB 1ZM2A 4L72B 3IGVA 3Q22A 7AT1B 1L3UA 4NMXA 1WF2A 1Y10A 1UEVA 4J9SA 2UZAA 3OBIA 5DO2A 1DFDA 3BGFA 1WEXA 4RW9A 2YNIB 4C8NA 1PILA 5HMYA 3OW2R 1WKJA 1NKCA 1SIWB 3ICLA 5MAOA 1VCTA 4X64F 3OSPA 2QL7B 2C2NA 3QSIA 4IH7A 1FXDA 2WRMA 4P72A 4K59A 2BMBA 2MEWA 4DI6A 4OX6A 2MJNA 2DHSA 2RS8A 4B3OB 3H5UA 1ACMB 2XYGB 2DR5A 2XS2A 2LDYA 2KDOA 2LXUA 3AD7C 3OUYB 1FXLA 2BJDA 4USWA 4A47A 4ELUA 2FZKB 1FKOB 3UN5A 1ZA2B 2MKKA 1VRTA 1C2PA 5F8IA 1KLMB 4JV5J 5I3UB 2D9PA 2RHQB 4RW8B 2DXEA 2HYIB 4C3KA 2MZQA 3IO1A 3C19A 4NASA 1JLEA 3G4SS 1NEEA 3CGIA 1SV5A 4NLDA 5T7LB 1JLQA 3BGOP 4Q45A 1J5EF 1GH8A 2M4MA 1XK8A 2HBQB 3RGIA 2MZ1A 2QLFB 1F2GA 3JQMA 2UXDJ 5DGAA 3M2UB 3MWBA 3SCIE 2CDRB 1YDLA 5A2QY 2LQ9A 2HHPA 1J5OA 4IG0A 1LWFB 1U0SA 1M90T 4KH0B 2C3OA 4JI7F 1WC6A 3THPA 3K5LA 4OHWA 5J2MA 4ECXA 2CQCA 5LMNJ 2HHTA 3KJVA 2U1AA 2DO0A 2RT3A 1VK8A 2JDJA 4M95A 1FRXA 3QIPA 4NXNJ 4O3QA 4K2XA 3MR3A 1UL3A 2NPIA 1SXLA 2XMVA 2HRYA 1VJQA 3I5CA 3E3XA 2XO6A 5J1EA 3G8SA 1O5JA 1U1MA 4QPXA 3QJJA 1XC9A 2L08A 3CCES 3AODA 4GVBB 1RWXB 1T03B 3K0JA 3OTCA 4ANCA 3CCSS 3CCLS 2QG9B 1QY7A 3CWJA 3TA0A 1FT8A 1DLOA 3E8OA 2BA9A 1I94F 1Q78A 2HG4A 5IM0B 1VC0A 2R8KA 1HNIA 1OPIA 4IDKB 4F25A 3TA2A 4ZJLA 3OL8A 2FHMA 4LFAF 2CPYA 1HNWJ 1N5QA 4UY8T 3B78A 4U9RA 3K8VA 4FYXB 4WIQA 3ISZA 4LF9J 3M1VB 2VONA 3G8QA 1IXKA 2KI2A 2ZJPQ 2ZWOA 3NOCA 5B0BA 2H65B 3IS9A 4P9SA 5D3GB 2XNQA 3R5JB 4I1TA 2QE5A 1Q4RA 2HGLA 2MHEA 1NSAA 2KU7A 1RCXB 3DRXA 2CQ3A 4N56A 1KQKA 1GEHA 1HR0F 5HMWA 2YTCA 3CC7S 3QGIA 2HIYA 2CNLB 1N34J 1AW0A 2YBVA 4WPAA 3NGUA 2D69A 6FD1A 2DNZA 5IQ6A 1UEKA 2H5EA 3MCMA 2W1BA 4KE5A 4V1Ak 1FX2A 2NXNA 1IUJA 3MURP 2H54B 3LGMA 2BJ9A 3V81A 1DAXA 2APOA 3DGVA 4ECZA 1IBMJ 4P10A 3NBPA 1Y0HA 1YQHA 1PJ5A 1SC1B 3VALA 2DHAA 2HLTA 4LRDA 2QV6A 1KLNA 3DRSA 1WWHA 3BBCA 1S1UB 3QO9B 1YJTA 2DGOA 2BJ3A 1EQ0A 4DS5A 5KFMA 3RB4A 3L7OA 3AD8C 4NL5A 4X2BA 1T94A 4DF4A 1TL4A 5LM7E 1XMQF 4DF8A 1VQNS 1JLGB 4JI3F 2CNOB 3NWRA 2BVZA 2QJ3A 5C42B 3VGVA 5KFAA 1MU2B 1N5VA 4QIGA 3RBEA 4JB8B 1BMQB 4HLBA 2A0FB 5GAEU 2CJKA 4ZHRA 2VA2A 4ZLPA 2IAJB 2UXBJ 4JI2J 4B08A 3Q8QB 2AYMA 4ZLJA 4A8FA 4D3GA 3DRPA 2BOPA 4DL7A 1HBOB 3FFIA 3BYPA 1E6YB 3P6YC 1SPBP 2DGUA 3DLEB 1S9FA 2F65A 5J1PA 1IKYA 2FJWA 5DLGA 7FD1A 3LGHA 1IKWB 3O2IA 2M70A 8ATCB 1X0PA 3LALA 4ALZA 3IP0A 2QSWA 4TU7A 1FJGF 3NAHA 3SSSA 2GVDA 3UPFA 3OR1A 5IXUA 4ZCMA 1NH8A 4LF8J 4OYOA 5C7PA 4JI1J 4Y00A 4HTIA 1TELA 4DPWA 4TY8B 4LT6A 4MTPA 3T9ZA 3DU5A 2GMJA 1NSPA 4O44A 4QIEA 4EO8A 2V8PA 3TUJC 2OKQA 3HHLB 2FC8A 3LAKA 2DGVA 2CVEA 2DCLA 3CD7A 4LFCF 4XK8C 4PG6A 3JQKA 1N32J 2VJVA 2R2RA 2MQLA 4X4TA 4M8LA 1MG7A 4LF6J 3L7PA 1Q8IA 2WW4A 4DL4A 1FA0A 3JTPA 3DOMA 1CULB 1R8BA 2FY1A 1LFPA 2ZEJA 4HDHA 4JI8F 1EETA 2JSXA 2EEYA 2AV5A 3H4BA 4NXMJ 4KFBB 4Y2CA 1TV6B 3KDOA 1CQNA 3Q2TC 2DTJA 5KFJA 2ZC4A 2EW9A 2EFGA 2MKHA 2OFHX 2AX0A 3GQCA 1U24A 2O5DA 5B0GA 4DQSA 5D4LA 3FKBA 1YRXA 1RHRB 2H3EB 3D68A 3IMQJ 2EKYA 4K4VA 4Q7AA 1HBMB 1KSPA 2HVEA 4OV1A 3U1MA 2WTFA 4EZ9A 2KXHA 3GR1A 3TVZA 4LSLA 4G1QB 3R7BB 2XZDB 1SC6A 4W98A 3HMJG 2B6AA 4ZVGA 3AB4B 1RTZA 2BANA 1T7PA 1FHTA 3NGSA 1W25A 2UVWA 2LQ5A 1WD6A 4LIRA 1FWKA 4CZCA 3HD2A 5DDQC 1RWUA 3I9ZA 1WHWA 5A6PA 1DARA 3SBMA 1X4HA 2VICA 2B4VA 2V9WA 3FK4A 3W60A 4Q43A 2GNKA 2IHR1 5GAGI 2GVZB 3CDEA 2VPYB 4BWMA 3JB9k 4Q5VA 5IS2A 3DMJB 4PPDA 1TKZA 1VQ8S 2CQDA 3MEEA 4NA2A 4U67Q 4EYIB 1TL1B 5LSRA 2CADA 5EGYA 1H6KX 2IMOA 1V3RA 4IG3B 2VBYA 5A0YB 4ILRA 1S0VA 1VIXA 2PT0A 3GE9A 3G82B 4WBFA 2F4VJ 4UOFA 2B5JA 4FDFA 4A8MP 1RYRA 4Z7YA 4QR0A 3J81Y 1O0PA 3HF5A 4FNIA 3M8ZA 1BUXA 1JLCB 4UW2A 3ITHB 2J9DE 2ZD1B 3M9NB 1NMEB 3MFHA 1UW9A 2MYFA 2A1BA 1FWPA 4FF1A 3GCXP 2OPRA 4YP3A 2GV1A 2J0XA 1HMVB 4GO5X 1LOUA 2YQ1A 1GMVA 2YX7A 2RE1A 3HHNB 2DNYA 4TLQA 2WSFC 4F3OA 1YWXA 2MGZB 3RBXA 1QE1B 2VA3A 1BQXA 2QL9B 2JEJA 3CDUA 3QT7A 3TARA 4HHHA 2AEMA 1S1XB 1WI6A 1TTHB 4OZ3A 5KFKA 1T95A 1R6VA 2PN6A 1JWWA 1RTJA 2AQ4A 1S0OA 2DHGA 3PX6A 3GJRB 3UQSA 2CJAA 1TK8A 4WFBQ 2W25A 3QGHA 1UETA 5L39A 1S0MA 2AJ1A 2XMWA 3L9ZA 3T19A 3GJQB 4XDDA 3UWTA 2VZ9A 2BE2B 5B7WA 3CT9A 2GZOA 1VBXA 2I2YA 4OJ3A 2PC6A 1Z4UA 4DQIA 5AE3A 5AE2A 4K4TA 2HBZB 2FHJA 4QCLA 2OD6A 4PQUA 3MM5B 3HKWA 4WFNQ 3Q8SB 4GC6A 3MM7A 4LRBA 2WB1D 4LQ3A 3CIZA 3D3BJ 3ZZOA 4ERDA 3CTRA 1FDAA 2NR0A 2GHVC 3ZZPA 4EGLA 3HPOA 4EYHB 4FXDA 3N5BA 3ZXWA 4TY9A 4NLXA 4CO1A 1YZ6A 3I87A 4X84A 2V5HG 1WKLA 3HT0A 3IG1A 1UTAA 1BQMB 2OPQA 1YHQS 3AFGA 2VIHA 4M5KA 4DV3J 3LANA 2KG1A 3H7HB 5GAHU 3R9LA 1XQIA 5DJBA 4FZVA 4IFYA 2QEXS 1JXLA 3DOLB 4UT4A 1TK5A 3KXDA 1U7LA 5D0GA 1D1UA 1WEYA 4KJIA 3TW0A 1L3KA 2E9TA 4OLPA 3SI8A 1CQMA 1MWQA 2DGQA 3GIMA 2RKIB 1XWLA 1RAOA 1RU1A 1XEZA 3BN4A 1C0TA 1WDDA 1M0SA 2CQ2A 4HR2A 5BR8F 1J2VA 1ZZFA 4X64J 2GW8A 2M3DA 4J9MA 4PR6A 2LMIA 5F41A 3NXZA 1JLBA 3THTA 2E7VA 2UP1A 4ZS6A 1S1WA 4F3MA 1Y7PA 3S6EA 3M8PB 4EBEA 2FJAB 1X9MA 2CQ1A 4QR1A 3HI9A 2X1AA 3B54A 2Z2MA 1NK6A 1P9QC 2EFPA 1RT3B 2AJFE 2C28A 3PO5A 3I5BA 3O1LA 1V5VA 3G96A 4UUXA 2Q43A 4ZK7M 3W8GA 4A8XA 1ZETA 2W4CA 1VC6A 5CYQA 2VB6A 2HNZA 1HBNA 2OSRA 3MM9A 3MMCA 1FCAA 2AGQA 1J5EJ 4EUVA 2M8DB 2WSEC 3CJRA 2ZBQA 2DHXA 1ROFA 1T3NA 2DB1A 4O3RA 5IOLA 5J2NA 4WKYA 3QLHA 1CJKA 1X8DA 2QX0A 1HPZA 1U8WA 4YQWA 4ES1A 3AXMA 3ENAA 2WVDA 3O5TB 3V6JA 1YJWS 4YHHF 1VQSA 1IWAA 4BS2A 2CJYB 4DQRA 2M2BA 4C6AA 3MCSA 3DI6A 2MHNA 4JI7J 3TEGA 2DXFA 2KG0A 3QWPA 4ZITA 2VQEF 1UWBA 3N6NA 3NMRA 1REVA 4CLKA 1RLDA 1RQ0A 3M8WA 3T6BA 5EN1A 3HVTB 3O8WA 5HN0A 2ZZTA 4KO0B 2YKMA 4P6QA 4K5SA 1WC3A 1Q86T 4H4OB 1Z2ZA 3OTOF 2KRRA 3CCTA 1S77D 4QWBA 3DOKB 4F4KA 3SXLA 1WC5A 2DNOA 3MMBA 1Q81T 4U96A 1RP5A 3DU6A 2W01A 4EEYA 1U4BA 3RRGA 4NYPA 3OFHA 2ZBPA 3CMQA 2LEBA 1ZM4A 1I94J 1PYSB 2FYXA 2IFXA 4ZP8A 4LFAJ 5DDRC 3MMAB 1WTFA 3Q23A 3LW5C 4NYZA 3MF5A 3LP1A 3BGRA 4J7CA 5BYRA 4RX6A 2KM8C 3W9IA 2GIRA 4NLYA 5ETPA 4O0IA 2DH7A 2YNHB 3ZZRA 4I68A 5I42B 4B9VA 5ETRA 4YUDA 3TR5A 4OI1A 3I96A 4P75A 4DR3F 4IFVA 2XBPA 5K14B 2DYAA 1LW2B 2Y0SD 5KFUA 3SCJE 5CYMA 2IDEA 3PXGa 4I7FB 1P1LA 1RE1B 2QO3A 5KT6A 1EP4B 3ET6B 2R9LA 1U0HA 4G65A 3C6TB 4DPYA 2IC3A 1P8GA 1HNZJ 5CD4H 4F2SA 2C2OB 2X1FA 4HACA 3KHRA 3RUBL 4B9LA 3OV7A 3OHAA 4DUTA 3EPIA 2AEFA 2P2CB 1H7WA 2YQ0A 2W7PA 1YITS 4RKUC 2YNFA 4IRCA 3F73A 3Q89A 3FJ2A 1F3FA 2DIVA 2V2KA 4OZNA 4NLQA 3JAMY 3ISND 2I5JA 4OYXA 3RJMB 1VC5A 1APSA 1PAEX 3BPSP 4L3NA 2VUGA 2W4DA 1CS4B 1KHWA 3D4JA 4K0KF 1TKTA 2AYBA 1RKJA 3OXLA 2NREA 1XMQJ 2G0JA 4LVOP 1T02A 2KH9A 2L41A 2VKZG 4LRFA 4L3KA 2I8EA 3EPGA 3W64A 4YS2A 2HS4A 1HWJA 2Q6BA 2ATLA 5JJBA 3W2WA 1M5OC 2P6SA 2BJEA 1U47A 3PHEA 2OHDA 1OJ4A 2DNQA 3A13A 4DQQA 5KG3A 3BSNA 1DBDA 3S1TA 2UUBF 3S7RA 1M1KT 1PCAA 4RW4A 3QPIA 2X1GA 1F5BA 4I6AA 1FJCA 3GB0A 5H1SV 4K4ZA 2E5LF 4GKJF 1RTIB 4RNMA 1HYSB 2V2QA 3DLGB 2ZWPA 3TVKA 4HHUA 1U48A 1WELA 4DBQA 1IBLJ 2BJ8A 1PC4A 5L8RC 1JLAB 2BJ7A 4P73A 1NB7A 4OYZA 4CNZA 3JXOA 4QPTA 1UJ6A 2CPHA 4QYRA 2XWXA 2FJEB 1FJGJ 4RW9B 2X51A 1FERA 4ED4A 2IM0A 4B3TF 2LDIA 3EICA 5DDOC 2LCWA 1OSCA 4OV6A 3BDPA 2BOAA 3R5AA 2LEAA 1GT8A 3O6QA 1WHYA 2LU2A 4XO0A 3NS5A 1D9AA 1VQYA 1KS2A 1OSDA 3V4MA 3O44A 5M2UA 1UZDA 1CPZA 3M6VA 1IVZA 4A8SA 3DGPA 4F36A 1WJ9A 4TXSA 2ILZA 4MKYA 3NS6A 4DCPB 1JLEB 4X4VA 2N3OA 2HWTA 5T41A 3VZHA 1SV5B 1FTRA 1JLQB 5HBMA 2R3VA 3V2UC 3EGZA 4HTJA 1TU0B 2W2NP 2JJ4D 4FVCA 2RHSB 3MXHP 5FD1A 2DEJA 1R8PA 2KXFA 2MTLA 5FJ4A 3W66A 4IG0B 4CH1A 4J9VA 4R5PA 2FDNA 2DR9A 3RW7A 3M4XA 1RB0A 1DZ5A 4ILLA 2CZ4A 5HK4A 5J2MB 5I3UA 1JKHA 2AWZA 2W4PA 4WCEQ 3KJVB 2VOOA 2MQ8A 3BH6B 1RWWB 2J7WA 2AGOA 3CC2S 4RWXA 2OPPA 3HM9A 3JTNA 1KTVA 5T7LA 4U7UD 3TX8A 3I32A 1P9YA 5J1EB 3C16A 2CZVC 4DV6F 1R7IA 2M0GB 4XPCA 4NLWA 4WU3A 2WBRA 5HMZA 4QW9A 3TZWA 3N4WA 3M2UA 3MPUB 4CLPA 2AZ3A 5F0UA 3JTOA 1N36F 3DRYA 5F9LA 3KG1A 4ZVRB 4P7VA 5HQMA 1NJYA 4IUFA 3T6JA 2HVZA 1FESA 2VG5A 2Z57B 3U1NA 1HNIB 3UDEA 3EDRB 4USHA 3AQOA 3IA0A 4CTAA 4FNHA 3KMQA 4OYWA 4PXBA 1SH0A 2GMLA 3R6GB 3E01A 3X3UA 4F0MA 2ZH4A 3WIUA 1XNQJ 1KQGB 3ELHA 2FZCB 4K50A 3BH7B 3IS9B 2XS7A 3LP0A 3ETMA 3DM2A 4RNOA 2CQBA 2W9AA 2BQUA 1GTEA 1H2UX 2J0WA 5D0EA 4O23A 3NS7B 3DDKA 1B0PA 2PO4A 2HMIA 1IR1A 1EKRA 3PY8A 1ZPWX 2XI3A 5IM0A 1ZPVA 5K9FA 3OFEA 4NEYA 1MN9A 3TEHB 1H2TZ 1S57A 4DR6J 3CCMS 4ID8A 1SB6A 5D77A 1V9OA 2J8AA 2NUUG 3Q8VA 2QMXA 3M2VA 2YY3A 2GS8A 4ED6A 4NLRA 3H90A 2Z8QA 3CNQP 3V81B 1RISA 3AY0A 1S9EB 3DNCA 1UPMB 4LSNB 3EWGA 4C8KA 2HHUA 4PUOA 5HSPA 2IY5B 1HQEA 4FBUA 2BM0A 1U2RA 4BHQA 5CHCB 1FDDA 3DRSB 3CD5A 5KG2A 2AU0A 4YDXA 1UFLA 2AJ4A 4J37A 3I55S 1RDRA 4ZIWA 4BDPA 4CDIA 3PW2A 5K8PA 1F6TA 3BYRA 4WFYA 3TNVA 4PWWA 1N52B 4AT1B 1Y5NB 1NCLA 1RUSA 3NNHA 2NCKL 1S1VB 4A8OA 4R8UA 1IM4A 3OFFA 4GVLA 4GMKA 1JJCB 1CC8A 2QLJB 1HARA 2E5JA 4ZHRB 2K7JA 3IGNA 3QRPA 2EFQA 3GYNA 3DRPB 1X5PA 2EFVA 3ZO7A 3FFIB 4FYYB 3P96A 1ZAWA 4LQ9A 2OLWA 4O4GA 3QT6A 1GX6A 4ECUA 1MWZA 2NQPA 2IPOB 2JL9A 4YR2A 2ALZA 1IKYB 1Q7LB 2MKIA 4FYDA 3C3LA 4NLTA 2U2FA 2N3LA 3T9NA 3A4TA 1FO1A 5KFSA 1LWEA 2GVDB 2ZNZA 3OR1B 3W5YA 1G7CB 3PEJA 3E2EA 3HDSA 1SL0A 4K2JA 2DBBA 1Y3KA 3KK3A 1Y00A 3HZGA 3W1YC 2QRRA 2RF2A 2VU5A 4N47A 4ECRA 4F67A 3VZIA 4EI2A 2VF3A 2O67A 3S8SA 3A1YG 2W9CB 2W2MP 2J6SA 3BEGB 4PEOA 1MMLA 2A6MA 4ZVOB 2OJ3A 2BRLA 1LEOA 3PFOA 2VBXA 1EETB 3M30A 4CP5A 2BUNA 5HLFA 3R3TA 3CDWA 1PG5B 5G0RA 2XMKA 2MQQA 1UCNA 3M6WA 1RU2A 3UNGC 2Z30B 4H4MA 1IM6A 1FI4A 4DUZF 2DXDA 3LPEA 4DL2A 4K4UA 2ZH1A 4ECVA 4LSLB 3FC9A 2C2ZB 4WP3A 1QAIA 2B6AB 4EWTA 4FN5A 1RLCL 4N8OA 4KPCA 5JMNA 4PG5A 4DR4J 1S6UA 3BR8A 1N33F 4DCJB 1LK5A 4TLRA 3GIKA 3KHLA 2Y0BB 2IM1A 2ZHAA 1QTMA 3GIJA 3DCAA 3OTOJ 4S0MA 1HW8A 3KG0A 1NRKA 1FE0A 1TKZB 5DG7A 1FJEB 3N0VA 4B9TA 3MEEB 4RZRA 1L3TA 5KT4A 3M32A 2KFZA 4WTYA 2W8KA 3TX0A 2J7UA 4RUAA 5B0DA 3OL7A 4I56A 2K7KA 3RBZA 5LMNF 4LF4J 4QU6A 4IKAA 1DHMA 3MAAA 4F50A 4NXNF 2D3O1 2B5JB 2RMLA 3AA8A 2D9OA 3W9JA 1RBLA 2N82B 1Q16B 2ZHOA 2ZH2A 4DSEA 2DRBA 4OYIA 2BW7A 3QGPA 2FVSA 3AOAA 5F8LA 3DXBA 4RBTA 3DKDA 1TK0A 2OPRB 2Q66A 1F3VA 5EDWA 3TZZA 1FKPA 1U09A 3GONA 2OGUA 4Z2XA 2RRBA 3G6ES 4MKAA 4B17A 4UQGA 2H4WB 3WC2A 5IWAF 1HNWF 1U6BA 2CXEA 3D0IE 1L3SA 1RTJB 3D0HE 3THVA 2DRDA 1B4SA 5K20B 4C3LA 4Q8EA 4RU9A 3ITHA 1S4EA 1DTTA 2FZGB 2ZUGA 2OTLS 5KFLA 4DSIA 4KPYA 2CJQA 4JI4J 1WC1A 4L73A 3R5GA 1NXIA 3PRBA 1FD2A 2MLXA 3GFYA 2QC3A 3N28A 4RO0A 2UUAF 3CEDA 1QUVA 4CT8A 5F3ZA 2R42A 3V6KA 4U95A 9ATCB 4K0KJ 1QE1A 4KHRA 5JUMA 4O3PA 4PQUB 2G2ZA 3MECA 2OMOA 3MM7B 3TI0A 5ETNA 2B4PA 2KZMA 3MPDA 4C4WA 1S1XA 3ZZTA 4J9NA 2HBYB 5ETMA 2CPDA 2MKYA 4OYMA 5E3CA 3HP6A 3SFGA 2BABA 3U02A 2F1FA 4ZLNA 2CQIA 3IG1B 1X4BA 1RBAA 2OPQB 3LOUA 5E3PA 4N41A 2YH0A 1RWMB 3N9UC 4PCQA 2V8DA 4DV4J 4EMDA 3OL6A 1FRKA 1VR6A 4OZ5A 4LF7F 1WSVA 2V69A 4DV1F 2NYIA 3BO3A 2E5LJ 4IFYB 4GKJJ 4OZLA 3IR5B 4DR5F 2OTJS 3I5AA 2DH8A 2KT5A 5E3RA 1D8ZA 2HHQA 1FWLA 1HW9A 5CZXA 1RTDA 3OJSA 3PIPQ 4WTOB 4KV8A 4ZP6A 2YPZA 1C0TB 4OX9J 4OZ2A 4F0HA 1KOHA 1HKAA 2VG6A 3MR7A 1LXNA 3E51A 2UXBF 3CCVS 4JI2F 3TA1A 2DKOB 1VK3A 4EFAC 1JLBB 2OP5A 1AFJA 1GXUA 1NDPA 1S1WB 2CJBA 3NGTA 1NH7A 1VLOA 3I31A 4PXDA 1NJZA 3LO3A 4OJ1A 1KBRA 3A8EA 5F8GA 2UU9J 3TJ8A 4DHVA 3L3CA 4LRAA 2NXUA 2VOPA 3DHWC 3GIRA 1VISA 4JP8A 2XM3A 5CYQB 4MK7A 1ZM9A 2HNZB 1HBNB 1SI9A 3MMCB 2ZHBA 3CIMA 5A8RA 4LF8F 5HQ8A 1JJ4A 3MPWA 4ECSA 3DFEA 4U7UK 1F60B 5RUBA 1YRUA 3QLHB 1CJKB 5CABA 3MAQA 1C1CA 5DG9A 4I2QA 3M9MB 1HPZB 4M5GA 1RZMA 1FRHA 3BSCA 5KG4A 4ZJOA 4P71A 2CWKA 1UFKA 2UUTA 3QMQA 3DI6B 1PYOB 1R89A 4Q2LA 1VQMS 4TNOA 4NLPA 3UO0A 5J2PA 2J76E 5KFFA 5A6WA 3PDNA 5L46A 2DD8S 3QAEA 1UWBB 1E6VA 4OJHA 1RTHA 2EWHA 3FCHA 1HWKA 2EC0A 2PGCA 2HHHF 4NXMF 1XR7A 4N8NA 4F02A 1NK5A 1AZSA 1VBKA 1S7HA 5KFQA 2AZ1A 3MM8B 2YKMB 3PJXA 4Q0BA 2CQHA 3J7A1 2V8GA 5E33A 4LMZA 1ZTWA 2YKQA 1IKXA 2PMHA 3FMWA 3EXCX 1Q5VA 3MMBB 4KRWA 2HHVA 2ZJRQ 3Q8RB 3FQKA 5IT4A 1BD6A 5F8NA 3JYTB 2KRBA 2W8LA 3R1LA 3H25A 4DXLA 2KM8B 3CPWR 1AB8A 3KK1A 5AXNA 2CAJA 2FPHX 4E98A 3NOGA 2AJQA 3EVWA 2E9RX 3LP1B 3BGRB 2J8SA 1YJVA 4ZCLA 1VIOA 1JXEA 1IKVA 3MOZA 4NI2A 1F9EB 4KAIA 1PJ6A 1Y5LB 5DM7Q 4AL7A 5DQIA 3VAIA 3VGSA 3DXSX 1MNEA 3OVSA 2FLLA 4KSEB 2WAQD 3LWLA 1BHNA 2J6TA 2D74B 3SFUA 1N0UA 1SH3A 4IFVB 1G6BA 2CYYA 5CYMB 5CD4A 4HYKA 3BKUA 2DHHA 4BWJA 4ES3A 3D0GE 3HCXA 3PW7A 3UVJA 3J7ZT 2AT1B 1U0HB 3KFWX 2PIIA 2IC3B 2HZAA 3ZZUA 4BCAA 1RJJA 1FX4A 3MMAA 2PEHA 1WTBA 4KHPJ 2WONA 3BPDA 4W4MA 3RR7A 2P9EA 1NJXA 2YNFB 4K4WA 3T5LA 1YBAA 2V9KA 1A7GE 1HWIA 1MROA 1KWMA 2L9NA 3AT1B 1YJ9S 2I5JB 3PRDA 4U8VA 3NL0A 3W5XA 2JFKA 1GX5A 3HFKA 3UI3A 5DQHA 3M8QA 1LW2A 1H3DA 2DVIA 1FRLA 4ZPTR 5EHHA 2GJ2A 3KTQA 1UA1A 2H9ZA 2XG8A 2JLEA 1TKTB 2CPJA 3C6TA 2DNKA 2FVPA 1YLXA 2Y1RI 1IR0A 1ZTTA 3F56A 1RAIB 1VS3A 3D3CJ 1XJWB 2AP6A 1FF2A 2MQMA 2MJUA 2J9DA 4RW4B 5K8NA 1U25A 5E0OA 2P8IA 4CLTA 3L09A 3IAS9 1OYEA 4FP9A 2KYZA 3IFEA 3WC0A 3CD0A 2B51A 3WDOA 4DV5F 1B64A 3OLBA 3EZ5A 1ZH5A 2EC2A 1OMSA 3J7Z5 3JSMA 5IV3A 1JIHA 4HH1A 4KB7A 1SKRA 3TAMB 3DLJA 2H48B 4RNFA 2GIFA 4DU7A 2RJZA 1N88A 3PG9A 2ZH3A 4DPXA 2K1RA 4MK9A 3B6BA 1W2BR 3LF0A 3OR2A
chains in the Genus database with same CATH topology
4GKKJ 4DV2J 1XNQJ 2UUAJ 3IMQJ 2MEWA 2UU9J 5LMNJ 2KVQE 4JI6J 1XNRJ 3T1YJ 2E5LJ 4GKJJ 2MQ8A 1IBKJ 4LF4J 4NXNJ 1N33J 3D3CJ 4LF8J 4KY3A 4DV5J 2F4VJ 2UXCJ 4JI4J 1HNZJ 2UUBJ 1J5EJ 4JI3J 4NEZA 4JI1J 5LMUJ 3J7AN 5LM7E 4KHPJ 4DV6J 4PWWA 5IT9U 4JV5J 1HR0J 3W1YC 2ZM6J 1I94J 2KL8A 4YHHJ 1HNXJ 5FLXU 4DV7J 4DR4J 3J80U 4AQYJ 1XMOJ 3JAMU 4DUYJ 3J81U 1N36J 4K0KJ 4LFCJ 4B3RJ 1N34J 2VQFJ 4NEYA 4B3SJ 5BR8J 4LFAJ 4DR6J 4OX9J 2HHHJ 4LFBJ 4DR1J 4HHUA 4JI5J 2UXBJ 4YY3J 4JI2J 4RJVA 4JI0J 5IWAJ 1IBLJ 1N32J 4X62J 3D3BJ 4X64J 4V1Ak 4LF6J 3R2DJ 4JI8J 4JI7J 4DV0J 4DR7J 5AJ3J 4DR2J 4X65J 3OTOJ 2VQEJ 4B3MJ 4LF7J 2UXDJ 4KYZA 4DV1J 5A2QU 1FJGJ 1IBMJ 4DUZJ 4B3TJ 2MTLA 4NXMJ 4X66J 4DR3J 1HNWJ 4JYAJ 4DR5J 4LF5J 2UUCJ 3T1HJ 1XMQJ 3R2CJ 4DV4J 4DV3J 4LF9J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK J;  4DV2 J;  1XNQ J;  2UUA J;  3IMQ J;  2MEW A;  2UU9 J;  5LMN J;  2KVQ E;  4JI6 J;  1XNR J;  3T1Y J;  2E5L J;  4GKJ J;  2MQ8 A;  1IBK J;  4LF4 J;  4NXN J;  1N33 J;  3D3C J;  4LF8 J;  4KY3 A;  4DV5 J;  2F4V J;  2UXC J;  4JI4 J;  1HNZ J;  2UUB J;  1J5E J;  4JI3 J;  4NEZ A;  4JI1 J;  5LMU J;  3J7A N;  5LM7 E;  4KHP J;  4DV6 J;  4PWW A;  5IT9 U;  4JV5 J;  1HR0 J;  3W1Y C;  2ZM6 J;  1I94 J;  2KL8 A;  4YHH J;  1HNX J;  5FLX U;  4DV7 J;  4DR4 J;  3J80 U;  4AQY J;  1XMO J;  3JAM U;  4DUY J;  3J81 U;  1N36 J;  4K0K J;  4LFC J;  4B3R J;  1N34 J;  2VQF J;  4NEY A;  4B3S J;  5BR8 J;  4LFA J;  4DR6 J;  4OX9 J;  2HHH J;  4LFB J;  4DR1 J;  4HHU A;  4JI5 J;  2UXB J;  4YY3 J;  4JI2 J;  4RJV A;  4JI0 J;  5IWA J;  1IBL J;  1N32 J;  4X62 J;  3D3B J;  4X64 J;  4V1A k;  4LF6 J;  3R2D J;  4JI8 J;  4JI7 J;  4DV0 J;  4DR7 J;  5AJ3 J;  4DR2 J;  4X65 J;  3OTO J;  2VQE J;  4B3M J;  4LF7 J;  2UXD J;  4KYZ A;  4DV1 J;  5A2Q U;  1FJG J;  1IBM J;  4DUZ J;  4B3T J;  2MTL A;  4NXM J;  4X66 J;  4DR3 J;  1HNW J;  4JYA J;  4DR5 J;  4LF5 J;  2UUC J;  3T1H J;  1XMQ J;  3R2C J;  4DV4 J;  4DV3 J;  4LF9 J; 
#chains in the Genus database with same CATH topology
 4H54 A;  4WKR A;  1F9F A;  4UOG A;  4OYP A;  1SQE A;  2IRY A;  3KYL A;  2GIQ A;  1FRM A;  1U1Q A;  3PJW A;  4Y6I A;  2KN4 A;  4HI2 A;  4ZA1 A;  2Y3Y A;  1CC7 A;  3RAQ A;  2BAC A;  4I67 A;  2MB0 B;  2V0N A;  2XY6 A;  3D9B A;  2HNY A;  3P45 B;  4QOT A;  2ZM6 J;  2C3M A;  3CB4 A;  1RT6 A;  3RG6 A;  4WE1 A;  2VV5 A;  3HO1 A;  5J1N A;  3J81 U;  1TZ0 A;  4B3S J;  3QT8 A;  3MUM P;  2JWN A;  5HBM B;  2IVM A;  2BE9 B;  3QBC A;  3FRZ A;  2HFN A;  5HVG A;  1YJ7 A;  4K8R A;  5GAG U;  2EVZ A;  1U1K A;  4AXJ A;  5LXR A;  3PW4 A;  2R7U A;  4NCG A;  1RAA B;  2M9K A;  3OTD A;  4F0K A;  2ZUA A;  1QSS A;  1SKW A;  1PJ7 A;  3SIP B;  5SUH A;  4UQT A;  2D7S A;  4DUZ J;  4A8Y A;  2DGW A;  3W3S A;  3K5M A;  3J7Y U;  4Z37 A;  4R5P B;  3FRY A;  2AYG A;  4EZ6 A;  2D3U A;  1T9U A;  4YB7 A;  3QWU A;  1FFW B;  2C42 A;  2IMW P;  1JKH B;  4RUH A;  5KG7 A;  1N33 J;  1IJE B;  2C22 A;  2NS1 B;  5KFV A;  2OPP B;  4LBP A;  1OQ3 A;  4OHZ A;  4IQX A;  2BEF A;  3HSZ A;  4WK1 A;  1LWC B;  3BV8 A;  4DV2 F;  1G3O A;  3C16 B;  4NA1 A;  4QR2 A;  4C8O A;  1LXJ A;  5L1J A;  5T14 A;  1KVK A;  3KLG A;  3BM7 A;  4JV0 A;  2IYI A;  3BBB A;  2KYX A;  2XUL A;  3HFZ B;  5KFX A;  3HZE A;  1QUP A;  2VG5 B;  1WEZ A;  1HA1 A;  3PYG A;  2E1R A;  1NDC A;  1U02 A;  2V4J A;  4PYA A;  4ZVH A;  5ETT A;  5HJX A;  4P74 A;  1YVF A;  1U26 A;  1EB0 A;  3MR6 A;  4CTA B;  4E0D A;  2DY9 A;  3EGV A;  1WNE A;  1KON A;  1X4G A;  2J0Q D;  3KLF A;  1BLU A;  1N48 A;  3MR5 A;  1LW0 A;  3E01 B;  2CJ9 A;  3HHL D;  1TVR A;  1GXL A;  3ZTR A;  4U8Y A;  4HHJ A;  1SL1 A;  3PIO Q;  4FPI A;  1N8R T;  3EZU A;  3LP0 B;  5FLX Y;  3KLH A;  3DM2 B;  1RK8 A;  3J7A N;  4JV2 A;  4AUK A;  4EU0 A;  1C1B A;  1AT1 B;  3H5S A;  2KFN A;  3A8J A;  2HMI B;  3NEK A;  1Q7Y T;  4ECQ A;  1UJ5 A;  1AXQ A;  3PO4 A;  5F8H A;  1SC4 B;  4PG4 A;  5CYJ A;  2V50 A;  2ZC3 A;  5C5J A;  5IWA J;  2FJV A;  1TKD A;  2DR6 A;  3TP2 A;  3M2V B;  4K7Q A;  4ILM A;  1DY3 A;  1EHW A;  3EZO A;  4RW6 A;  4DV0 J;  4FXW A;  3FBC A;  1D0E A;  3PW5 A;  3WIV A;  4IH5 A;  2YWK A;  3CSK A;  2XYP B;  1X31 C;  2HBR B;  4QZV B;  4OYB A;  4URG A;  3JS9 A;  3PJ9 A;  4QBU A;  2CA9 A;  3A3P B;  3C6U A;  4PUO B;  4RW7 A;  4J9P A;  3M8R A;  4CYU A;  1HQE B;  2XQC A;  3IRX A;  2HQC A;  3EE3 A;  3ZNJ 1;  1I6J A;  5EWE A;  2B56 A;  3N5F A;  2KT3 A;  4UZC A;  2UUA J;  3HSG A;  2HFZ A;  3PYF A;  3NLC A;  4LRE A;  2ZBI A;  3FEY B;  1Q1K A;  1HHQ A;  2VPW B;  2F3J A;  4CLW A;  2CDQ A;  3RZA A;  1NK0 A;  2MZJ A;  1NSK L;  3VCD A;  1HNZ F;  3CME S;  1F5C A;  2BR0 A;  2IA0 A;  3HKZ D;  1PYT A;  5ETK A;  4R8U B;  1Y4Z B;  3J80 U;  1KOO A;  3AB2 B;  5MLC V;  1S9E A;  2J9E A;  3PKY A;  4LSN A;  3GLJ A;  4IYQ A;  3KHH A;  3G86 A;  3IR7 B;  3R1H A;  5BJR A;  4P2X A;  3QFH A;  3FGV A;  4XTT A;  1JLF B;  3Q8Y A;  4LF7 J;  3TQE A;  4DV1 J;  4CO5 A;  1RAG B;  1A6L A;  4O4G B;  2Y1J A;  3EX7 B;  1TP7 A;  5B0E A;  4HT5 A;  4DR5 J;  4OX8 A;  2V6A A;  2CPZ A;  4DLE A;  2HSE B;  2ADB A;  2ZVI A;  1UVJ A;  1UVK A;  1KN6 A;  2WBM A;  4MKB A;  2IA6 A;  4ED7 A;  3ETO A;  1DTQ A;  1S1V A;  2LVW A;  1LWE B;  2HFO A;  3J81 j;  4ED0 A;  1M5S A;  1MWY A;  5HAT A;  2GAG C;  3SYZ A;  5C2G A;  2WVE A;  2RSQ A;  3UCU P;  5KFC A;  3KK3 B;  4U7C A;  2F8E X;  2RF2 B;  3AXK A;  3P4U B;  2YNG A;  4K4Y A;  3GII A;  2RIJ A;  4LBI A;  3MUT P;  4X4O A;  2XHW A;  1HI8 A;  2R2S A;  1IBL F;  4EK2 A;  5KTQ A;  2C2K B;  2Y1L B;  4ED8 A;  1NHU A;  4CO0 A;  4IOB A;  2ZJQ Q;  3AAW B;  3M30 B;  1ITP A;  4M5L A;  2HQD A;  3F41 A;  2WOM A;  4KC5 A;  5HLF B;  4FS1 A;  3DLH A;  4JI0 F;  2E44 A;  2B8P A;  5G0R B;  4L76 A;  5IV4 A;  2OEJ A;  1MW7 A;  2QMW A;  2CQ0 A;  3IC1 A;  3R7N B;  2XS5 A;  3T3F A;  2WVB A;  2KTQ A;  2KVQ E;  4QWC A;  1WG4 A;  3SCL E;  4H4M B;  3HD1 A;  2F5G A;  1R8H A;  4EBD A;  2XMJ A;  3RRH A;  3ZZ0 A;  5AXK A;  2L48 A;  3U1L A;  2A2C A;  3VAH A;  2V8H A;  3ULH A;  1D8Y A;  1BE4 A;  4NE9 C;  3EGW B;  3K59 A;  3IWN C;  2HHS A;  3NGK A;  2PI5 A;  2W9C A;  2DNH A;  5LSL A;  3GMG A;  2BQ3 A;  1S76 D;  1URR A;  3UCG A;  2AX1 A;  4AXI A;  2AGP A;  2HHH J;  2FHK A;  1Q5Y A;  2H51 B;  5AE1 A;  2EI5 A;  5THW A;  1K1S A;  1HHT P;  4W92 B;  4OYA A;  2XY7 A;  2XZW A;  4USJ C;  3UE2 A;  3W2V A;  3BO2 A;  3BRE A;  1VI7 A;  4JYA J;  3I6P A;  2EKN A;  1JNZ B;  3G71 S;  3KLI A;  1H0H B;  2XMM A;  3SSQ A;  1VBY A;  2W2P P;  3UDC A;  3M32 B;  2LQ8 A;  4NCA A;  3Q24 A;  1NHK L;  4ED1 A;  2YVS A;  2G2O A;  3W65 A;  4B3M F;  2H1Y A;  2Q6C A;  1QLN A;  4OZ0 A;  4L6V 3;  2RU9 A;  1RT4 A;  1WC0 A;  2VG7 A;  3VAF A;  1R31 A;  3MAA B;  5K8M A;  1F2H A;  5IC6 B;  2Y8Y A;  3ILL A;  3ONQ A;  2GAH C;  3VV2 B;  2CQ4 A;  1ZBT A;  2HFS A;  2IIH A;  1CJV A;  1S1T A;  1ZYQ A;  3MI7 X;  2HAF A;  2B9W A;  3PX0 A;  2AMC B;  2EFN A;  3FEX B;  1NKB A;  5E2Q A;  2EK1 A;  4NRU A;  5CH7 B;  2M7S A;  3QZ8 A;  4DL0 C;  1G4C A;  5I3P A;  5F8J A;  1YGY A;  3MEG A;  1FKP B;  2RUG A;  1YZ7 A;  4M94 A;  2V2V A;  2HFU A;  4A48 A;  4DLG A;  1SQG A;  3DLK A;  2CZ9 A;  2RS2 A;  1Z2L A;  3TZY A;  3V4I B;  4QWE A;  3EJM A;  3M6X A;  3OVB A;  1T9Y A;  1J27 A;  5ETS A;  5BYS A;  1M5K C;  2FIU A;  4ETX A;  4U6P A;  2GMH A;  3QJL A;  2LKZ A;  4URS A;  5EWG A;  2VDH A;  1XNQ F;  1QTN B;  1TAU A;  2HS3 A;  5U47 A;  1DTT B;  1SUQ A;  4F4Y A;  2OH2 A;  1X4C A;  3UN2 A;  3D1Q A;  3IRW P;  3GV5 B;  1M5P C;  5EUH A;  3ILO A;  1X0F A;  2DIT A;  1EJ7 L;  4R25 A;  2FLP A;  1R6Y A;  3ZTP A;  1MN7 A;  4WYL A;  3FSX A;  4Y28 C;  4DV7 J;  1X7V A;  1VFJ A;  2KB2 A;  4DG1 A;  4J9Q A;  3AJ2 A;  4TU8 A;  1H98 A;  2UXC F;  3K5N A;  3MEC B;  1IWG A;  4RJV A;  3ILJ A;  4DR6 F;  2WVF A;  3FBE A;  3SQO P;  1AUS L;  2E7X A;  2KJW A;  4WWS A;  1TAQ A;  3FQL A;  4C11 A;  4CRJ A;  3L4B C;  1SIZ A;  2VFR A;  2IDL A;  4YFU A;  1K8A T;  2KT2 A;  3MPV A;  1SC3 B;  3TWZ A;  4TQR A;  4LR8 A;  2NPF A;  1PSD A;  1H38 A;  2GJF A;  3KLE A;  3VGT A;  2DCU B;  2E1C A;  2OFG X;  1Q95 G;  1ZM3 A;  3K57 A;  1HI0 P;  3I9V 9;  5KT7 A;  3CJK B;  5HP1 B;  2XGP A;  4DV5 J;  1RA7 A;  5JVH Q;  1FXR A;  3SDE B;  4CCH A;  2QMU B;  2W24 A;  2PA3 A;  8RUC A;  5IT9 U;  5HJY A;  1N5Y B;  1XBW A;  1RTD B;  4XIU A;  4RNH A;  4KV8 B;  1S12 A;  4M5H A;  4NLV A;  2GHW A;  1NDL A;  1RWO B;  2DNM A;  4PWU A;  4MT1 A;  2MMY A;  1C0U A;  1NDK A;  2VG6 B;  4HH0 A;  3KUE A;  2LEC A;  4ZVF A;  3BO4 A;  3QAT A;  4CH0 S;  1S10 A;  2B7C B;  3L95 X;  1SJ1 A;  4KTQ A;  2B4O A;  4IO9 Q;  1RWK B;  1UFW A;  2CPI A;  4Y0F A;  1VBZ A;  1H74 A;  1X5S A;  3K7R A;  3O3L A;  2E1P A;  4E8U A;  3TJA A;  4KQZ A;  4DOZ A;  1VJW A;  2G9O A;  3FSY A;  1KRP A;  2W7O A;  2V68 A;  2VKR A;  1QJH A;  4PG7 A;  2B3T B;  2B7B B;  1NK7 A;  1UKU A;  5GMD A;  3GR0 A;  2P9G A;  3H2U B;  2G1H A;  5I3Q A;  5ETL A;  3VAJ A;  4QU7 A;  3HHD A;  4BBY A;  1BC6 A;  1NZ8 A;  4OQJ A;  2DIU A;  4G1I A;  5A8R B;  2E29 A;  2XSJ A;  3NCR A;  2YKA A;  2C3P A;  4RR5 A;  4C9D A;  1O51 A;  4G6V B;  3T5H A;  4UUW A;  1C1C B;  2ZH9 A;  5EX0 A;  4I2Q B;  2GJI A;  2BRK A;  2QL5 B;  3QRR A;  3BN7 A;  3D67 A;  3GYX B;  5KFE A;  4B3R J;  1HFE L;  2PEB A;  2J9C A;  3SEO A;  3OJU A;  4J9L A;  1QM9 A;  4YR0 A;  3L7U A;  4URQ U;  5J2P B;  2KHC A;  2ASY A;  3CF5 Q;  1KQF B;  4DUY F;  4WJB A;  3OD2 A;  1VRU A;  3IBF B;  1E6V B;  2DNG A;  1RTH B;  2A2D A;  4B02 A;  3W61 A;  3OT9 A;  3T5J A;  4DSK A;  4YY3 F;  1D09 B;  1AZS B;  4AD6 A;  5HAO A;  4DV2 J;  2RQM A;  4Q0B B;  2E5G A;  1OIA A;  4QYZ J;  2ZDP A;  4LJM A;  2XMT A;  3T1Y J;  2LYV A;  4F2R A;  1IKX B;  2C1E B;  2WZ1 A;  2XMU A;  1NK4 A;  4HI1 A;  1FTC A;  1U2C A;  2I38 A;  4PXE A;  3IR6 B;  3CC4 S;  1ARO P;  1U1P A;  2FHO B;  1NM2 A;  2XYH B;  4X4P A;  2YKN A;  2HQF A;  3F44 A;  1VQ5 S;  5KT5 A;  1XNR F;  2C2D A;  1BQN A;  2PFD A;  4NPO A;  1OYD A;  2F4F A;  5B0F A;  4DR4 F;  3KK1 B;  3TAP A;  2O3D A;  1S97 A;  2BQR A;  4W90 B;  1GQE A;  3R5B A;  3ZTS A;  4F7V A;  3NCQ A;  3DRR A;  3R2D J;  3I4H X;  2HUR A;  1CEZ A;  3IAM 9;  1X5T A;  3MM8 A;  1HNX F;  1Y9O A;  1IKV B;  1Q8K A;  2GO9 A;  5KFG A;  4NI2 B;  5FDL A;  3OQ2 A;  4DPU A;  4JBC A;  1FNM A;  1KFS A;  2J7K A;  1IN0 A;  1DQ8 A;  1PBA A;  3VHQ A;  2DH9 A;  3P5B P;  2XLI A;  2HND A;  4P52 A;  5D0H A;  4GKK J;  4DR7 F;  3HFV A;  4DR2 F;  4P2F A;  2AHO B;  3QT5 A;  3JYT A;  1VQL S;  1PIE A;  3A8K A;  3UVJ B;  4RL1 A;  3SSR A;  2MZS A;  1RWP B;  2R8H A;  3BQ2 A;  2MY7 A;  4LF4 F;  1OO0 B;  4DWI A;  3G6Y A;  2XY5 A;  2WON B;  3LWM A;  2IBK A;  2ALY B;  2M88 A;  1B0V A;  3P5T L;  2ROG A;  1IBK F;  3WBZ A;  1MRO B;  2NZC A;  3UD5 A;  3BBF A;  2XCP A;  1ZA1 B;  1HQU A;  5EWF A;  3M8Q B;  1YIJ S;  3MED A;  4X65 J;  1K73 T;  2FLN A;  3SMZ A;  3QSY B;  3TRG A;  5DRK A;  1OY8 A;  1IR2 A;  3I0R A;  4NLS A;  1G1X A;  2FVC A;  3R97 A;  3G6V A;  1VHI A;  1O8B A;  1GNK A;  4YB5 A;  3DLB A;  1W7W A;  3ZTO A;  4A46 A;  4QWD A;  2HGM A;  3DYA A;  4DFJ A;  5GAD I;  4JI4 F;  2VDI A;  3IXQ A;  1U1L A;  3D7S B;  1T9X A;  4DL6 A;  5K8O A;  4WU2 A;  3FDS A;  3EYZ A;  3V6D A;  4IRD A;  1NPK A;  2PMW A;  5GME A;  4YDD B;  4NML A;  4A8Q A;  4M5N A;  3UDV A;  1N4L A;  2R7X A;  4QIV A;  2ZH6 A;  2DIS A;  3JSM B;  3GFH A;  5AJ3 J;  1UEU A;  4FS2 A;  3NKY A;  3CJ0 A;  2ZNY A;  5H9E J;  5HI7 A;  5D15 A;  1EX8 A;  3JSB A;  3ZTQ A;  4J9R A;  2OEM A;  3OHB A;  1RT2 A;  2IM3 A;  2HEK A;  5I4M A;  2EG2 A;  3GTY X;  4DR1 F;  2K1R B;  1HNV A;  2DK2 A;  4C2M A;  3R5D A;  1WDT A;  3BS9 A;  3FBB A;  1T05 B;  3OR2 B;  5ETQ A;  1A0O B;  1WOP A;  4DV4 F;  2C2E A;  1WOS A;  1UP1 A;  4TQS A;  4OL8 A;  4ID5 A;  3H20 A;  1YTY A;  1NJI T;  4QYZ K;  4CM2 A;  4X66 F;  2QFI A;  1WSR A;  2NYH A;  4ICL A;  2Y1I A;  2R7Q A;  3P8B B;  2GGP A;  2QTW A;  4ZVS B;  3VWS A;  1RHQ B;  2RU3 A;  3ISN C;  2W7A A;  3BSA A;  3LP2 A;  1QVF R;  3BQ0 A;  4Y2A A;  1GTH A;  4MH8 A;  2OPS B;  4LF1 A;  2HNY B;  4FF3 A;  2XTJ P;  2G0I A;  1RT6 B;  1KP6 A;  4WE1 B;  3TAM A;  3PR4 A;  3SV3 A;  2HRU A;  4ZPA A;  1R27 B;  1FRI A;  4V19 J;  2PE8 A;  1S99 A;  4JI0 J;  1TL3 A;  3I56 S;  1H72 C;  4OX9 F;  1ZAX A;  2JVO A;  4NRT A;  2MZR A;  4NCG B;  3RB6 A;  4O4R A;  4WXO A;  2XGQ A;  4CO4 A;  3LPY A;  3C14 A;  1BWE A;  5AXM A;  5C25 A;  5DZ7 A;  4TKT A;  2R7W A;  1RSC A;  1AUD A;  4CI0 B;  4O3N A;  5B09 A;  4X62 F;  3T1A A;  2R7O A;  4J90 A;  2YKP A;  3SQG B;  2JRS A;  2JFD A;  2R2U A;  3NP5 A;  4I6Y A;  1SH2 A;  3CW2 C;  1GMW D;  2JLF A;  4WII A;  2UU9 F;  5HO4 A;  2K3I A;  3NMA A;  1LKZ A;  4KBI A;  3QRQ A;  3VTI A;  1CJT A;  1HL6 A;  3AHP A;  4FKX A;  3BSO A;  1FVS A;  1X60 A;  3D54 A;  2C2R A;  2OI2 A;  2YWE A;  5GMK a;  2COL A;  3WHI A;  3GSD A;  2B43 A;  2VD3 A;  4ZMM A;  1LFW A;  4D3H A;  4LBH A;  4C0O C;  2MXY A;  1S72 S;  1EIY B;  3KLG B;  4FF4 A;  2GO8 A;  5D78 A;  4Q44 A;  4ER8 A;  3KMS A;  5HMX A;  1Q79 A;  2E66 A;  2P9C A;  4RBV A;  2LQB A;  2B4U A;  3KG4 A;  2MQO A;  4UY8 5;  3PHT A;  4WXW A;  4C8M A;  4B3M J;  2VBZ A;  2OD4 A;  2YKO A;  2V4J B;  2QGF B;  3MFI A;  1CJU A;  1GMW A;  1URN A;  4UTG A;  3BGL A;  1YJR A;  1S6P A;  1UWA A;  3FNN A;  4B9S A;  1TL7 A;  4AL6 A;  3KLF B;  2IVF B;  2BKN A;  3RAX A;  1LW0 B;  2ZKT A;  1UVI A;  1TVR B;  3BB5 A;  1LWC A;  3A3N B;  3CMA S;  3EXY A;  5E5N A;  1EQM A;  3UN3 A;  2XNR A;  5KFT A;  2FJX A;  2BKO A;  2F8M A;  3MZI A;  3KLH B;  2AEJ A;  2QLB B;  4C0H A;  2WSC C;  1C1B B;  4ES2 A;  1KVI A;  1FJ7 A;  1YX2 A;  2EFO A;  3UD3 P;  3OVA A;  1KFD A;  4OI3 A;  1I3O B;  4MIA A;  1NK8 A;  2K06 A;  2VQF J;  4ELT A;  3D1O A;  5A8K B;  3GPA A;  5DG8 A;  3LA0 A;  2QA4 S;  3MAH A;  1SCJ B;  2A18 A;  1WHV A;  1NLK L;  2ZIT A;  5L9N A;  4RW6 B;  2KO1 A;  3PNI A;  1VQK S;  1JB0 C;  1P6T A;  2YXL A;  2H5I B;  5H9E K;  4JV1 A;  4NZ0 A;  2Q3P A;  4ZPW R;  3C6U B;  1HHS A;  2VC1 A;  3KKF A;  4RW7 B;  3NRB A;  2RQ4 A;  4CYU B;  2MKJ A;  1KQS R;  3IRX B;  1FEE A;  3BDE A;  3RW6 A;  4TVA B;  2ZOG A;  3MTK A;  3GG1 A;  3LUY A;  4JI6 J;  2OEK A;  4A8W A;  1M1H A;  2EK6 A;  4KY3 A;  2NXE A;  2UXC J;  3FZ2 A;  3CJ2 A;  4HVZ A;  2JEG A;  2R7S A;  3T1H F;  2HPU A;  5K5M A;  1C4A A;  4YOE A;  1OWX A;  4KHP F;  1R0A B;  4C8Y A;  4X4Q A;  5KFN A;  1YBT A;  3IBC B;  1X9W A;  3M7V A;  2J6U A;  2W2O P;  1S0N A;  5B0C A;  3HVR A;  5L38 A;  2NUH A;  2FUG 9;  4F4Z A;  2BM1 A;  2ZOF A;  1RT1 A;  1H7X A;  4IOA Q;  2CUY A;  2OAU A;  2FVQ A;  1CG2 A;  2V8V A;  3ENV A;  2CQG A;  2YPY A;  1NB2 A;  4N77 A;  2CIM A;  4ITS A;  3W62 A;  3NGR A;  5E3A A;  2C3U A;  2A3J A;  1XIQ A;  6FDR A;  4C8Z A;  3WZ0 A;  2A10 A;  3ZC4 A;  1LQ9 A;  1BXN A;  3TQ1 A;  1B70 B;  1NHV A;  1ZS6 A;  3MM6 A;  4DEZ A;  1DTQ B;  1RWV B;  4J5O A;  4J9U E;  3J7Y I;  4CT9 A;  5F3T A;  3AA9 A;  4B9U A;  4ZP7 A;  4BLG A;  2W9B A;  2LEP A;  3B4M A;  3M8Y A;  3UR0 A;  2DNR A;  1S4F A;  5C24 A;  1W26 A;  1PC5 A;  2HW3 A;  1JLF A;  2YNG B;  4FKY A;  3MMJ A;  4DU8 A;  2B9X A;  2IJF A;  4QW8 A;  3CJ8 A;  3GU0 A;  2MLZ A;  2YWF A;  2QN6 B;  3N01 A;  3FSI A;  3WX4 A;  1XR6 A;  4OIX A;  3MHY A;  1F0X A;  2QYG A;  1S49 A;  2DNN A;  2WOM B;  2ZE2 A;  4L74 A;  5LT5 A;  1WC4 A;  4FPR A;  2F9D A;  1BWV A;  2K2P A;  2VPZ B;  4KKO A;  3NWG A;  3DC2 A;  2FHJ D;  3LQV A;  4ZVT B;  2E7W A;  5LOQ A;  2ZDO A;  2N4D A;  3M6U A;  4ZLL A;  2P5V A;  3HHE A;  2XCA A;  3PYD A;  4TYB A;  1S9G A;  4LF5 F;  4NEZ A;  4G1P A;  2FQQ B;  2G1D A;  5KFI A;  4IRK A;  3W5Z A;  1SL2 A;  4Q8F A;  3HJV A;  4NLU A;  1WG1 A;  2ZBC A;  2ZM6 F;  4DUY J;  3RB0 A;  1ZZN A;  1RHK B;  2CNK B;  5KOX A;  1U6Z A;  3BGU A;  3CCR S;  4YY3 J;  4B3S F;  4N76 A;  1TQL A;  1AYE A;  4ZKA A;  4IO1 A;  4X4R A;  4QIW D;  5D4O A;  3ZZY A;  2R8G A;  2OUG A;  3BJY A;  5M2P A;  3KJN B;  4R0E A;  2E9Z A;  4DDF A;  4OJG A;  2KHD A;  3W2V B;  4MKV A;  2G4B A;  1FK9 B;  3HUL A;  2BDP A;  2I6W A;  3PVX A;  3T41 A;  3KLI B;  1NSQ A;  2JC0 A;  3IN5 A;  4Y2K A;  4WF9 Q;  5KFR A;  1NO8 A;  5A8W A;  2QLX A;  1O6X A;  1XNR J;  1RWN B;  1RT4 B;  2VG7 B;  2FGC A;  3KK2 A;  4FBT A;  1NKE A;  4PG8 A;  4I64 A;  4IOC Q;  4DN0 A;  1FKA F;  3MGJ A;  2ZOM A;  1CJV B;  2DGS A;  1NPR A;  1Q82 T;  2KL8 A;  1HNX J;  1S1T B;  2DGT A;  2BE7 D;  2YX1 A;  1SKU B;  5E41 A;  4XAK A;  4Y2I A;  4J9K A;  4J9O A;  2J5A A;  3SCK E;  3H5Y A;  3BR9 A;  2WW8 A;  1NUE A;  4MAK A;  3AOB A;  3MDF A;  2JLG A;  3EGN A;  4C98 A;  2FY8 A;  4CQ1 A;  3MEG B;  1NND A;  1AFI A;  4DR7 J;  3EDQ B;  4KGZ B;  4DR2 J;  1TKX A;  3JSR A;  3DLK B;  4ZVQ B;  2DEI A;  1WF1 A;  4EO6 A;  2R7T A;  2WK4 A;  1YRT A;  1B3T A;  2JX2 A;  1RAB B;  2IJN A;  2XB2 D;  2YH1 A;  3GJS B;  3VF0 B;  2IRX A;  3ENW A;  1H2V Z;  1QAX A;  4YB1 P;  1QD1 A;  2HK2 A;  3IM9 A;  5AXL A;  3K5P A;  1IBK J;  4AE5 A;  3A12 A;  1SUQ B;  4CLL A;  4LUB A;  2DNP A;  4DSL A;  1S6Q A;  5CXT A;  1F9H A;  2PD1 A;  4PZV A;  4ZJQ A;  2G2Y A;  2YWW A;  3RR8 A;  2B8Q A;  2CJX B;  2YX4 A;  4ZPB A;  3C15 A;  3H40 A;  4DG1 B;  4C8L A;  3J80 Y;  2VPX B;  3CJ4 A;  3SV4 A;  1NPP A;  2BW2 A;  5GAE I;  5KT2 A;  3V4I A;  5LMU F;  1U2F A;  2RB7 A;  4CO3 A;  2PDA A;  4XDC A;  4Y3C A;  5HAN A;  1XTZ A;  4ZN1 A;  3D66 A;  2JC1 A;  5CZV A;  1R8A A;  1N6Q A;  4FXV A;  4DV0 F;  1GXT A;  4C11 B;  2RAQ A;  3M05 A;  4H4K A;  1KTQ A;  3GV7 B;  4MFB A;  4LR7 A;  2ASD A;  3VAM A;  3PZP A;  4PWD A;  4CNY A;  1GFW B;  2XWY A;  2HQ3 A;  3POT A;  4JUZ A;  4HL9 A;  3H4D A;  3VAK A;  1KNZ A;  4G3I A;  3KLE B;  3IBW A;  4MJK A;  4PPZ A;  1UZH A;  3AQP A;  1FNO A;  4H4K C;  2N7Y A;  3QID A;  3HVA A;  2IRU A;  4ANE A;  3Q8U A;  2KZZ A;  3RTV A;  3QNW B;  4ED3 A;  3RAM A;  5D0R A;  2ZFH A;  2BXJ A;  2GQQ A;  3TOQ A;  2ZVS A;  4OZJ A;  4M5D B;  2A6O A;  3FEZ A;  1HD1 A;  2F63 A;  2RUS A;  4DR1 J;  3RYL A;  2L9D A;  1C0U B;  4FYW B;  3EUN A;  3GZ7 A;  5J2Q A;  5ADZ A;  2HZV A;  4AL5 A;  3PFE A;  5LXY A;  2DO4 A;  4KGK A;  5A2Q U;  4V19 X;  5HVF A;  2RVJ A;  1RHM B;  1WI8 A;  4OHX A;  4X66 J;  1F5A A;  3EM1 A;  2NXJ A;  4LFB F;  3CJK A;  5HP1 A;  3GG0 A;  3SDE A;  1D9D A;  4FF2 A;  3NY0 A;  2R8J A;  2HWI A;  2MSS A;  3CUN A;  2FVR A;  4DSJ A;  3H42 A;  1N5Y A;  1UVM A;  3R5C A;  1WAC A;  4R0J A;  2QLW A;  3BQ1 A;  2FC9 A;  3EMT A;  1RT7 A;  3UW1 A;  1HBU A;  2KJV A;  1XMB A;  2XSJ B;  5HRO A;  5LJ5 Y;  3N6M A;  3SZ2 A;  2RDJ A;  1HR0 J;  2VBW A;  5DET A;  1NU4 A;  2VFV A;  1S79 A;  5FLX U;  4ETZ A;  1RT5 A;  1CSJ A;  4E2F B;  1HLW A;  4KIA A;  3PYE A;  5BYQ A;  2XZT B;  2E1M C;  1YK9 A;  4X62 J;  4N5S A;  4F8R A;  2R4F A;  4WFX A;  2RQK A;  4KHM A;  4I0W A;  4ED2 A;  4ZN3 A;  4K4S A;  2JEF A;  1U8S A;  2MKC A;  4AQY F;  2ERR A;  5LL6 d;  1RHJ B;  1VRU B;  1PAU B;  2I1R A;  2LA4 A;  4JI5 F;  2L9W A;  4J91 A;  4YEA A;  3PAC A;  3CXC R;  4P2S A;  3TVY A;  2ZH8 A;  3QGG A;  3ADA C;  3G9C A;  5KG1 A;  3OXF A;  3HSJ A;  1U1O A;  4GRS A;  3TYT A;  3NAI A;  1WUU A;  4KGX B;  1RHU B;  5ETO A;  3VQT A;  1FDB A;  2ASL A;  1ULR A;  4JI3 J;  1JQG A;  4C48 A;  4DX7 A;  4OFZ A;  2HKE A;  4MYT A;  4WK3 A;  4DCO B;  4DFK A;  2B9Y A;  3PV8 A;  2YKN B;  1LWX A;  5D4N A;  1BQN B;  1C4C A;  4GC7 A;  1TFY A;  2KFY A;  2Z0G A;  1RA6 A;  3M2R A;  1ZAV A;  3B8H A;  4WYW A;  3BZQ A;  1EAY C;  1FDN A;  2RIL A;  2M5Y A;  3DRR B;  4NCB A;  3Q83 A;  4A8K A;  2AF6 A;  2K8G A;  1UJ4 A;  5FDL B;  3OSN A;  3FZB A;  3KOA A;  1WOR A;  2UVV A;  2V2Z A;  3GYG A;  1VOM A;  4DN9 A;  5F0W A;  4JYA F;  2CWX A;  1TL5 A;  1XN9 A;  3M8S A;  2HND B;  1L3V A;  2BKP A;  1VHF A;  3OPK A;  1N54 B;  3X1L B;  2OEL A;  4I2P A;  3K2Y A;  4RBU A;  3CJ3 A;  2UUC F;  4LF2 A;  4ZP9 A;  3W8P A;  1ICE B;  5L1K A;  5KFW A;  2NSC A;  2ZH5 A;  2GQC A;  2D3O R;  2IBO A;  2C3Y A;  3I0S A;  3IWL A;  2VL1 A;  5F8M A;  4LFC J;  2MQP A;  2CQP A;  3MD3 A;  1KEK A;  1U6F A;  2CPF A;  1WOO A;  2O01 C;  1VRT B;  2PA8 D;  1MMN A;  2HVD A;  3GJT B;  1WKK A;  3D6T B;  2IVY A;  5KFY A;  1HQU B;  2LLZ A;  4JI8 J;  4QWA A;  2ABY A;  3MED B;  1TUG B;  4ZPV R;  5KOW A;  4OI4 A;  2YNI A;  3GP9 A;  1SBR A;  3I0R B;  1P27 B;  4AYB D;  3KJQ B;  2M52 A;  3ILI A;  3T1H J;  1KKH A;  2DT9 A;  2RRA A;  1T3O A;  5KFD A;  5GAH I;  5F9N A;  5KG6 A;  4DZ6 A;  3WX8 A;  4M1K A;  3MCN A;  1JK9 B;  4B3O A;  4LRC A;  1J5O B;  2FLO A;  2AW0 A;  2B9E A;  1RAC B;  3HSD A;  2WVC A;  1K9M T;  3OUY A;  1WF0 A;  3DYA B;  2QIF A;  3ZFV A;  1KC8 T;  2WB4 A;  3TAQ A;  1FKO A;  3Q2S C;  1KLM A;  2Q79 A;  3HVW A;  1QSL A;  1GAO A;  3MOJ B;  2XO7 A;  2HQG A;  4RW8 A;  4B9N A;  2RDD A;  4L75 A;  5IT9 Y;  4NZ6 A;  2Y9H A;  2AJ0 A;  4DJB A;  3Q0A A;  3QIP B;  3V6D B;  1BGX T;  2HAI A;  4DV7 F;  1DJ0 A;  2RH3 A;  3MD1 A;  1N56 A;  4IR9 A;  4WFA Q;  2Z2Y B;  4F4X A;  3GIL A;  2LU1 A;  4IH6 A;  4HDG A;  1RCO B;  4KH1 B;  3K17 A;  1XER A;  5KG0 A;  3QJP A;  4DMZ A;  2Z2Z A;  3LH2 S;  3GFX A;  1U1R A;  1NAQ A;  3A3O B;  1CVJ A;  3GFZ A;  4ECY A;  4OLO A;  1VLY A;  1RT2 B;  2N4C A;  4DX6 A;  1LWF A;  3V5R A;  4MYU A;  1CLF A;  2V4Q A;  1HNV B;  1YJN S;  1HWL A;  4RLE A;  1NZA A;  2JNJ A;  2OO4 A;  1DLO B;  3CDB A;  2RNE A;  1SJ4 P;  2J0S D;  1TUV A;  4ID5 B;  3UFC X;  1TFW A;  4QQB A;  4ZCK A;  1WG5 A;  4ICL B;  4DFM A;  2GGP B;  1QDU B;  4IQM A;  3VAG A;  2PMZ D;  3LP2 B;  3K5O A;  1X4D A;  1N0V C;  2ZH7 A;  4CLU A;  1NBE B;  3RU0 A;  1VQ7 S;  5E7O B;  1KD1 T;  3C2P A;  2OML A;  2QYC A;  1MSW D;  2ZZN A;  4KR0 B;  4GVB A;  4NOH A;  1T03 A;  1PBU A;  4UOC A;  3FCW A;  2CG4 A;  2D1C A;  1TL3 B;  2HQI A;  2FB0 A;  5CCM A;  2HZC A;  3H0P A;  4ATN A;  1T05 A;  4K4X A;  3B82 A;  3PX4 A;  5DQG A;  2D3Z A;  2QA1 A;  4CH7 A;  4IDK A;  2R8I A;  2I0X A;  2JEI A;  3OXG A;  3VVU A;  1EAR A;  2Z56 B;  3PM9 A;  3C14 B;  1SQF A;  5C25 B;  2MLY A;  1RAD B;  4LF5 J;  1IQZ A;  2HVH A;  2Z58 B;  1EKS A;  1L5U A;  3BKF A;  3NNA A;  4LVN P;  4Q2M A;  3M1V A;  2BZ2 A;  3KWM A;  3PKM A;  2OPS A;  5DLF A;  2CPX A;  2GFF A;  3NBP B;  3W9H A;  1HWU A;  8AT1 B;  4USV A;  2UV8 G;  3P49 B;  2JHE A;  5D3G A;  1YBU A;  2QA4 G;  3MTJ A;  4RPF A;  1CJT B;  1S59 A;  2ATC B;  4WP8 A;  4X4N A;  1SVD A;  2HIQ A;  2H5J B;  4P2M A;  1FD8 A;  1UAW A;  3MCO A;  2NSB A;  3K8W A;  1X4E A;  2RDI A;  1PO6 A;  4FVM A;  3S01 A;  3US5 A;  1DQ9 A;  1QAY A;  2CVI A;  4ZPD A;  4OI2 A;  4ECW A;  4B3R F;  1A9N B;  3TZX A;  4ZCI A;  1Y3J A;  2E1A A;  5CCL A;  3G8T A;  1K0V A;  5CAA A;  1M5V C;  3SQG A;  1XMO F;  3DLL Q;  5DGB A;  3D28 A;  1CJU B;  1DRZ A;  2EPI A;  4RNN A;  2DR7 A;  4ECT A;  1RXO B;  2R7V A;  1S6P B;  4HEA 9;  5G4D A;  4UST A;  4DL3 A;  1TL7 B;  1S1U A;  3QO9 A;  2HWH A;  1FFG B;  3FBF A;  3UNY A;  4OZ1 A;  4CLY A;  3CVK A;  4PAA A;  1B7Y B;  1FE4 A;  3T1Y F;  4LR9 A;  3F0N A;  1SJR A;  3EVO A;  3GV8 B;  2F7V A;  2Y8W A;  3DDN A;  2X1B A;  1JLG A;  4F04 B;  1RBO B;  3VQS A;  5C42 A;  1VYA A;  1MU2 A;  2F40 A;  1Y5I B;  4NWB A;  4PQA A;  2HGN A;  3MPY A;  1U49 A;  4C0B A;  1K47 A;  2V94 A;  5BR8 J;  2IAJ A;  1B99 A;  5E3Q A;  2R7R A;  4YB6 A;  3CDA A;  2PI4 A;  1FEH A;  3C66 A;  1PGZ A;  2FJB B;  1HBO A;  1IJF B;  3KUG A;  1KVJ A;  4O44 B;  1YG0 A;  2BV3 A;  5JXS A;  1S6O A;  3CUL A;  2E5H A;  4DPO A;  5C2C A;  3QZ7 A;  1E6Y A;  1VGY A;  1S48 A;  3DLE A;  3HHK A;  1Y11 A;  3RRK A;  2MST A;  1RAF B;  4F3Q A;  4ZVP B;  1Q8L A;  1IKW A;  3DOM B;  4UF4 A;  2X3G A;  2VFT A;  4KT0 C;  4YN3 B;  3WQP A;  4GKK F;  4ZPC A;  2XEX A;  4O3O A;  3AH6 A;  3HX9 A;  1G2E A;  1I5O B;  3JSY A;  3D1H A;  4N7T A;  4ZVU B;  5LMU J;  2D41 A;  5A8K A;  1JX4 A;  4TY8 A;  2SXL A;  2MDA A;  5L1I A;  2HFV A;  3G6X A;  5DDP C;  2VHG A;  4YHH J;  3TUI C;  4DX5 A;  3ZNU A;  3HHL A;  1TMM A;  3KHG A;  2RQC A;  4DFP A;  3NG8 A;  1VDH A;  3FUY A;  3RB3 A;  2Z2L A;  2VOD A;  3OFG A;  1X4F A;  5L1L A;  1Q8B A;  2VC0 A;  3HK2 A;  2X7I A;  4EBC A;  4RUB A;  2BAN B;  2ROP A;  4AFF A;  4JV5 F;  2OSQ A;  1CUL A;  5KT3 A;  1RT1 B;  2VQE J;  3PW0 A;  3PTW A;  1RAE B;  3PR5 B;  4AND A;  4FYV B;  3HHL C;  1SJ3 P;  2X3D A;  3H98 A;  4X65 F;  4PAB A;  4KFB A;  2GCF A;  1TV6 A;  2K3K A;  2XLK A;  2M8H A;  3CJS A;  2KXN B;  1R43 A;  4ZDN A;  3NNC A;  4OHV A;  2C2M B;  2ZBR A;  1X5O A;  4WP9 A;  1VQ9 S;  5DS7 A;  3M9O B;  4F4A A;  1NK9 A;  2RD5 C;  5HQL A;  5B0A A;  1KHV A;  2UVR A;  1S5Z A;  2DPJ A;  2UXD F;  1HBM A;  3TUP A;  3MM6 B;  3TUZ C;  1R0A A;  3HXM A;  2V67 A;  5ETV A;  3D6F B;  3BF4 A;  3GSI A;  5FII A;  2NZ4 A;  5JVG Q;  2LFV A;  3LGN A;  4G1Q A;  1FRJ A;  4CO2 A;  3CJT A;  5H9F J;  1T0T V;  4CWB A;  2W9B B;  3HLU A;  2O66 A;  3EVM A;  5C24 B;  3T5K A;  3U27 A;  2JVR A;  5ITH A;  2VFS A;  1OY6 A;  2UVU A;  2EBG A;  1FFS B;  2QSF A;  3D6M B;  4LFB J;  2FD2 A;  1LK7 A;  3W7B A;  2GVZ A;  4RWW A;  3C46 A;  4TYA A;  1JJ2 R;  2XHC A;  5AJ3 F;  2F9J A;  3QFW A;  3DMJ A;  2HHX A;  2JOQ A;  3PCO B;  6AT1 B;  4DR3 J;  4Y65 A;  2XLJ A;  2ADC A;  2ZE2 B;  1TL1 A;  2LXF A;  4KGM A;  1T9V A;  5A76 A;  3R8Y A;  1M5H A;  4KKO B;  1U1N A;  3HT3 A;  2ILY A;  2L3M A;  4IG3 A;  3CCJ S;  5A0Y A;  3CO9 A;  3JQJ A;  3PRV A;  4ENO A;  3KUH A;  3R7S B;  3P3D A;  1X4A A;  3G82 A;  3HJF A;  1S9G B;  4BC9 A;  1ZOT A;  2CRL A;  2EBE A;  1DUR A;  4USU A;  4DZD A;  1JLC A;  4LF9 F;  5D8H B;  2VJU A;  2PFF B;  5KFO A;  2ZD1 A;  4AQY J;  1MMD A;  1VQP S;  2XMA A;  5IC4 B;  4CLZ A;  4PKD B;  5LJ3 Y;  4ZIV A;  4JI5 J;  4RU2 A;  1BY9 A;  1JXV A;  2QT7 A;  1HMV A;  2GHP A;  4P7T A;  1FVQ A;  1RGV A;  2HLU A;  5L9X A;  3QQC D;  2V4R A;  3G2X A;  4MK8 A;  2MGZ A;  1QVG R;  1FNX H;  1D9F A;  2R2T A;  1REG X;  4A4J A;  2YQ3 A;  3CCZ A;  4DSF A;  3FVY A;  1N34 F;  1XR5 A;  4ZVE A;  2IM2 A;  3GWC A;  4Y2M A;  1OQ6 A;  4C97 A;  1YKW A;  3N79 A;  3KNG A;  1RYS A;  3FCV A;  2AKW B;  3W63 A;  5KAK A;  1V5I B;  5A8W B;  3AD9 C;  3A8I A;  1K0T A;  1NJW A;  4LIW A;  4NLO A;  1IBM F;  3H59 A;  2Q1L A;  4C7Q A;  3B4D A;  5KFB A;  1LV5 A;  1OS5 A;  2H4Y B;  3KK2 B;  4PRF A;  2UUB J;  1QAJ A;  2IJR A;  2BE2 A;  2FGO A;  1RI7 A;  1YJU A;  2V63 A;  1UPP A;  1HI1 A;  3FMB A;  2LA6 A;  3VVT A;  2DGX A;  3JAM U;  4OHY A;  4ZOS A;  2QZ8 A;  3MM5 A;  3CE8 A;  2DY1 A;  1R8C A;  1CBK A;  4K5R A;  1FK9 A;  2GA7 A;  1WHX A;  4HKQ A;  2Z4P A;  2G0C A;  1TKX B;  3ENQ A;  5D4P A;  2MPU A;  2F8H A;  2OIH A;  3AOC A;  3Q86 A;  4OI6 A;  2N7C A;  4B3T J;  2HS0 A;  2YWG A;  1BQM A;  3MEK A;  4CLF A;  2HRT A;  1QSY A;  2UUC J;  2AIR B;  2CG8 A;  3D2W A;  1SJQ A;  2BJ1 A;  5HVH A;  3VR1 A;  4NZ7 A;  2MY8 A;  3C8Y A;  4C3M A;  5IZH A;  4QIF A;  1T9T A;  1RKI A;  3DDI A;  3DOL A;  5GAD U;  1K1Q A;  1SJF A;  1S6Q B;  2KVI A;  3CD6 S;  3G87 A;  3TO8 A;  2CPE A;  2RKI A;  4DL5 A;  1Q0N A;  1VQ6 S;  2W2Q P;  3VGU A;  1N5T A;  2MQN A;  1GMU A;  2JZ5 A;  5H9F K;  4IR1 A;  5CA5 A;  3C15 B;  1ELO A;  3MM9 B;  1KDN A;  5CQG A;  3R6L B;  3UR3 C;  4UZB A;  4JI1 F;  2VQF F;  4DQP A;  5J2N B;  3I4P A;  2KKH A;  2XSF A;  2P6T A;  3H8Y A;  2CKW A;  2IYG A;  4KGV B;  4KYZ A;  1N6Q B;  4ELV A;  1SKS A;  1LNQ A;  3M8P A;  4MFB B;  1N32 F;  4PWD B;  1X9S A;  9RUB A;  2I9S A;  3R2C J;  3DN9 A;  1R3N A;  3OTE A;  4LF6 F;  1R0B G;  2XC9 A;  2EG1 A;  3POT B;  1RT3 A;  2ACY A;  2AJ2 A;  2LP4 A;  3IM8 A;  1REV B;  4JI6 F;  1V3Z A;  2MZT A;  4NX9 A;  2WHO A;  3K89 A;  1F1B B;  4X4U A;  3D5M A;  1B7F A;  2ACM A;  2NLW A;  2WCX A;  4DV6 J;  4LSZ B;  1K44 A;  3UD4 P;  3BKT A;  2JH3 A;  4GO7 X;  1I51 B;  4DX8 H;  4NYO A;  2XI2 A;  1DQA A;  1N36 J;  2HHW A;  1VRQ C;  1MLA A;  3CCU S;  4UOH A;  5LSO A;  1VQO S;  3H5X A;  3ZZZ A;  3GCW P;  1VMB A;  4OMF G;  4Z7C A;  2BBE A;  2QFJ A;  5J2Q B;  4M5J A;  4NLG A;  1UW4 A;  2V34 A;  4YR3 A;  5EX3 A;  4PXC A;  5D6G A;  4MIB A;  5IQQ A;  2ASJ A;  5M2R A;  3HVT A;  1YSJ A;  2BYC A;  4KO0 A;  2HVI A;  4H4O A;  1AA1 B;  5DM6 Q;  1PKU A;  1HD0 A;  3V6H A;  3QYY A;  3MR2 A;  1B0T A;  3KNA A;  1EZZ B;  3DOK A;  1D3W A;  3UCZ P;  1M1G A;  1GK8 A;  4M5D A;  3I82 A;  1RT7 B;  1HBU B;  2PSZ A;  5HRO B;  3U7J A;  2GC8 A;  4RUC A;  1T11 A;  5B08 A;  2CFX A;  4M5M A;  1W2I A;  3KLV A;  4DS4 A;  1RT5 B;  4CLS A;  4TU9 A;  3H2V E;  1YI2 S;  2F4V F;  2DNL A;  3D6H B;  4HAC B;  2YWH A;  4JOU A;  2B0G A;  4OX7 A;  2DRA A;  1T9W A;  5IFM A;  2E5I A;  2UUW A;  3H2L A;  2DR8 A;  4NA3 A;  3Q8P B;  1OPZ A;  2YNH A;  3CCW A;  5I42 A;  4MIW A;  3AJ1 A;  4USM A;  2HK3 A;  3CJ5 A;  5KFP A;  5K14 A;  3QAU A;  1RAJ A;  2GQ2 A;  4I7F A;  1UVL A;  2VAS A;  3CJQ A;  1Q53 A;  1T8E A;  3DHX A;  1V6H A;  2G13 A;  1EP4 A;  3ET6 A;  3RBD A;  5DZ6 A;  5HL7 Q;  5KG5 A;  2NXC A;  1TMJ A;  4WZQ A;  4O3S A;  7FDR A;  4OI0 A;  2FJD B;  2MKS A;  1RAH B;  5GVQ A;  5SZT A;  5KFZ A;  4B9M A;  4M5I A;  4M63 A;  3R27 A;  4X4S A;  1HIY A;  3OTB A;  1UMJ A;  2BX6 A;  3IWX A;  3W2W B;  1I1G A;  5IT0 A;  1S7I A;  3CO0 P;  4TN2 A;  1H73 A;  1XMO J;  2CNN B;  2QA2 A;  4QJV A;  4ED5 A;  3N6L A;  3UDL A;  2AD9 A;  1TUW A;  3M2R B;  1U45 A;  3OL9 A;  3NGD A;  1OY9 A;  2FTR A;  3LAM A;  2LXI A;  4Y34 A;  1CS4 A;  1P1T A;  4MMO A;  4I4B A;  2ZKU A;  1N5S A;  2GX8 A;  2RRN A;  2VH7 A;  4BC7 A;  2VFU A;  1Z1Z A;  3KDN A;  2AYE A;  3TAN A;  2ROE A;  3TJ9 A;  1TR0 A;  1JMT A;  4PYD A;  4XPE A;  3MUV P;  2ZZM A;  3PEH A;  4CM0 A;  2POK A;  4HT7 A;  3LTO A;  1IQT A;  1IBC B;  3KJF B;  3CCQ S;  1VQ4 S;  4DPT A;  4USI A;  1UA0 A;  4I2P B;  5AT1 B;  3OLA A;  4USK A;  4YME A;  4O0N A;  4F26 A;  4WZM A;  1HQ2 A;  1JJH A;  4DV3 F;  2UV8 A;  3AJD A;  4WFZ A;  4F4W A;  4CIO A;  4I69 A;  2DPI A;  2O1P A;  1V3S A;  5KFH A;  3I0S B;  1RTI A;  1HYS A;  1JNR B;  5BXI A;  3K58 A;  3DLG A;  2EXU A;  1UVN A;  4I6W A;  1R0C B;  3NCP A;  1KR4 A;  2DJW A;  2LQJ A;  1JLA A;  3DGP B;  1ZM2 A;  4L72 B;  3IGV A;  3Q22 A;  7AT1 B;  1L3U A;  4NMX A;  1WF2 A;  1Y10 A;  1UEV A;  4J9S A;  2UZA A;  3OBI A;  5DO2 A;  1DFD A;  3BGF A;  1WEX A;  4RW9 A;  2YNI B;  4C8N A;  1PIL A;  5HMY A;  3OW2 R;  1WKJ A;  1NKC A;  1SIW B;  3ICL A;  5MAO A;  1VCT A;  4X64 F;  3OSP A;  2QL7 B;  2C2N A;  3QSI A;  4IH7 A;  1FXD A;  2WRM A;  4P72 A;  4K59 A;  2BMB A;  2MEW A;  4DI6 A;  4OX6 A;  2MJN A;  2DHS A;  2RS8 A;  4B3O B;  3H5U A;  1ACM B;  2XYG B;  2DR5 A;  2XS2 A;  2LDY A;  2KDO A;  2LXU A;  3AD7 C;  3OUY B;  1FXL A;  2BJD A;  4USW A;  4A47 A;  4ELU A;  2FZK B;  1FKO B;  3UN5 A;  1ZA2 B;  2MKK A;  1VRT A;  1C2P A;  5F8I A;  1KLM B;  4JV5 J;  5I3U B;  2D9P A;  2RHQ B;  4RW8 B;  2DXE A;  2HYI B;  4C3K A;  2MZQ A;  3IO1 A;  3C19 A;  4NAS A;  1JLE A;  3G4S S;  1NEE A;  3CGI A;  1SV5 A;  4NLD A;  5T7L B;  1JLQ A;  3BGO P;  4Q45 A;  1J5E F;  1GH8 A;  2M4M A;  1XK8 A;  2HBQ B;  3RGI A;  2MZ1 A;  2QLF B;  1F2G A;  3JQM A;  2UXD J;  5DGA A;  3M2U B;  3MWB A;  3SCI E;  2CDR B;  1YDL A;  5A2Q Y;  2LQ9 A;  2HHP A;  1J5O A;  4IG0 A;  1LWF B;  1U0S A;  1M90 T;  4KH0 B;  2C3O A;  4JI7 F;  1WC6 A;  3THP A;  3K5L A;  4OHW A;  5J2M A;  4ECX A;  2CQC A;  5LMN J;  2HHT A;  3KJV A;  2U1A A;  2DO0 A;  2RT3 A;  1VK8 A;  2JDJ A;  4M95 A;  1FRX A;  3QIP A;  4NXN J;  4O3Q A;  4K2X A;  3MR3 A;  1UL3 A;  2NPI A;  1SXL A;  2XMV A;  2HRY A;  1VJQ A;  3I5C A;  3E3X A;  2XO6 A;  5J1E A;  3G8S A;  1O5J A;  1U1M A;  4QPX A;  3QJJ A;  1XC9 A;  2L08 A;  3CCE S;  3AOD A;  4GVB B;  1RWX B;  1T03 B;  3K0J A;  3OTC A;  4ANC A;  3CCS S;  3CCL S;  2QG9 B;  1QY7 A;  3CWJ A;  3TA0 A;  1FT8 A;  1DLO A;  3E8O A;  2BA9 A;  1I94 F;  1Q78 A;  2HG4 A;  5IM0 B;  1VC0 A;  2R8K A;  1HNI A;  1OPI A;  4IDK B;  4F25 A;  3TA2 A;  4ZJL A;  3OL8 A;  2FHM A;  4LFA F;  2CPY A;  1HNW J;  1N5Q A;  4UY8 T;  3B78 A;  4U9R A;  3K8V A;  4FYX B;  4WIQ A;  3ISZ A;  4LF9 J;  3M1V B;  2VON A;  3G8Q A;  1IXK A;  2KI2 A;  2ZJP Q;  2ZWO A;  3NOC A;  5B0B A;  2H65 B;  3IS9 A;  4P9S A;  5D3G B;  2XNQ A;  3R5J B;  4I1T A;  2QE5 A;  1Q4R A;  2HGL A;  2MHE A;  1NSA A;  2KU7 A;  1RCX B;  3DRX A;  2CQ3 A;  4N56 A;  1KQK A;  1GEH A;  1HR0 F;  5HMW A;  2YTC A;  3CC7 S;  3QGI A;  2HIY A;  2CNL B;  1N34 J;  1AW0 A;  2YBV A;  4WPA A;  3NGU A;  2D69 A;  6FD1 A;  2DNZ A;  5IQ6 A;  1UEK A;  2H5E A;  3MCM A;  2W1B A;  4KE5 A;  4V1A k;  1FX2 A;  2NXN A;  1IUJ A;  3MUR P;  2H54 B;  3LGM A;  2BJ9 A;  3V81 A;  1DAX A;  2APO A;  3DGV A;  4ECZ A;  1IBM J;  4P10 A;  3NBP A;  1Y0H A;  1YQH A;  1PJ5 A;  1SC1 B;  3VAL A;  2DHA A;  2HLT A;  4LRD A;  2QV6 A;  1KLN A;  3DRS A;  1WWH A;  3BBC A;  1S1U B;  3QO9 B;  1YJT A;  2DGO A;  2BJ3 A;  1EQ0 A;  4DS5 A;  5KFM A;  3RB4 A;  3L7O A;  3AD8 C;  4NL5 A;  4X2B A;  1T94 A;  4DF4 A;  1TL4 A;  5LM7 E;  1XMQ F;  4DF8 A;  1VQN S;  1JLG B;  4JI3 F;  2CNO B;  3NWR A;  2BVZ A;  2QJ3 A;  5C42 B;  3VGV A;  5KFA A;  1MU2 B;  1N5V A;  4QIG A;  3RBE A;  4JB8 B;  1BMQ B;  4HLB A;  2A0F B;  5GAE U;  2CJK A;  4ZHR A;  2VA2 A;  4ZLP A;  2IAJ B;  2UXB J;  4JI2 J;  4B08 A;  3Q8Q B;  2AYM A;  4ZLJ A;  4A8F A;  4D3G A;  3DRP A;  2BOP A;  4DL7 A;  1HBO B;  3FFI A;  3BYP A;  1E6Y B;  3P6Y C;  1SPB P;  2DGU A;  3DLE B;  1S9F A;  2F65 A;  5J1P A;  1IKY A;  2FJW A;  5DLG A;  7FD1 A;  3LGH A;  1IKW B;  3O2I A;  2M70 A;  8ATC B;  1X0P A;  3LAL A;  4ALZ A;  3IP0 A;  2QSW A;  4TU7 A;  1FJG F;  3NAH A;  3SSS A;  2GVD A;  3UPF A;  3OR1 A;  5IXU A;  4ZCM A;  1NH8 A;  4LF8 J;  4OYO A;  5C7P A;  4JI1 J;  4Y00 A;  4HTI A;  1TEL A;  4DPW A;  4TY8 B;  4LT6 A;  4MTP A;  3T9Z A;  3DU5 A;  2GMJ A;  1NSP A;  4O44 A;  4QIE A;  4EO8 A;  2V8P A;  3TUJ C;  2OKQ A;  3HHL B;  2FC8 A;  3LAK A;  2DGV A;  2CVE A;  2DCL A;  3CD7 A;  4LFC F;  4XK8 C;  4PG6 A;  3JQK A;  1N32 J;  2VJV A;  2R2R A;  2MQL A;  4X4T A;  4M8L A;  1MG7 A;  4LF6 J;  3L7P A;  1Q8I A;  2WW4 A;  4DL4 A;  1FA0 A;  3JTP A;  3DOM A;  1CUL B;  1R8B A;  2FY1 A;  1LFP A;  2ZEJ A;  4HDH A;  4JI8 F;  1EET A;  2JSX A;  2EEY A;  2AV5 A;  3H4B A;  4NXM J;  4KFB B;  4Y2C A;  1TV6 B;  3KDO A;  1CQN A;  3Q2T C;  2DTJ A;  5KFJ A;  2ZC4 A;  2EW9 A;  2EFG A;  2MKH A;  2OFH X;  2AX0 A;  3GQC A;  1U24 A;  2O5D A;  5B0G A;  4DQS A;  5D4L A;  3FKB A;  1YRX A;  1RHR B;  2H3E B;  3D68 A;  3IMQ J;  2EKY A;  4K4V A;  4Q7A A;  1HBM B;  1KSP A;  2HVE A;  4OV1 A;  3U1M A;  2WTF A;  4EZ9 A;  2KXH A;  3GR1 A;  3TVZ A;  4LSL A;  4G1Q B;  3R7B B;  2XZD B;  1SC6 A;  4W98 A;  3HMJ G;  2B6A A;  4ZVG A;  3AB4 B;  1RTZ A;  2BAN A;  1T7P A;  1FHT A;  3NGS A;  1W25 A;  2UVW A;  2LQ5 A;  1WD6 A;  4LIR A;  1FWK A;  4CZC A;  3HD2 A;  5DDQ C;  1RWU A;  3I9Z A;  1WHW A;  5A6P A;  1DAR A;  3SBM A;  1X4H A;  2VIC A;  2B4V A;  2V9W A;  3FK4 A;  3W60 A;  4Q43 A;  2GNK A;  2IHR 1;  5GAG I;  2GVZ B;  3CDE A;  2VPY B;  4BWM A;  3JB9 k;  4Q5V A;  5IS2 A;  3DMJ B;  4PPD A;  1TKZ A;  1VQ8 S;  2CQD A;  3MEE A;  4NA2 A;  4U67 Q;  4EYI B;  1TL1 B;  5LSR A;  2CAD A;  5EGY A;  1H6K X;  2IMO A;  1V3R A;  4IG3 B;  2VBY A;  5A0Y B;  4ILR A;  1S0V A;  1VIX A;  2PT0 A;  3GE9 A;  3G82 B;  4WBF A;  2F4V J;  4UOF A;  2B5J A;  4FDF A;  4A8M P;  1RYR A;  4Z7Y A;  4QR0 A;  3J81 Y;  1O0P A;  3HF5 A;  4FNI A;  3M8Z A;  1BUX A;  1JLC B;  4UW2 A;  3ITH B;  2J9D E;  2ZD1 B;  3M9N B;  1NME B;  3MFH A;  1UW9 A;  2MYF A;  2A1B A;  1FWP A;  4FF1 A;  3GCX P;  2OPR A;  4YP3 A;  2GV1 A;  2J0X A;  1HMV B;  4GO5 X;  1LOU A;  2YQ1 A;  1GMV A;  2YX7 A;  2RE1 A;  3HHN B;  2DNY A;  4TLQ A;  2WSF C;  4F3O A;  1YWX A;  2MGZ B;  3RBX A;  1QE1 B;  2VA3 A;  1BQX A;  2QL9 B;  2JEJ A;  3CDU A;  3QT7 A;  3TAR A;  4HHH A;  2AEM A;  1S1X B;  1WI6 A;  1TTH B;  4OZ3 A;  5KFK A;  1T95 A;  1R6V A;  2PN6 A;  1JWW A;  1RTJ A;  2AQ4 A;  1S0O A;  2DHG A;  3PX6 A;  3GJR B;  3UQS A;  2CJA A;  1TK8 A;  4WFB Q;  2W25 A;  3QGH A;  1UET A;  5L39 A;  1S0M A;  2AJ1 A;  2XMW A;  3L9Z A;  3T19 A;  3GJQ B;  4XDD A;  3UWT A;  2VZ9 A;  2BE2 B;  5B7W A;  3CT9 A;  2GZO A;  1VBX A;  2I2Y A;  4OJ3 A;  2PC6 A;  1Z4U A;  4DQI A;  5AE3 A;  5AE2 A;  4K4T A;  2HBZ B;  2FHJ A;  4QCL A;  2OD6 A;  4PQU A;  3MM5 B;  3HKW A;  4WFN Q;  3Q8S B;  4GC6 A;  3MM7 A;  4LRB A;  2WB1 D;  4LQ3 A;  3CIZ A;  3D3B J;  3ZZO A;  4ERD A;  3CTR A;  1FDA A;  2NR0 A;  2GHV C;  3ZZP A;  4EGL A;  3HPO A;  4EYH B;  4FXD A;  3N5B A;  3ZXW A;  4TY9 A;  4NLX A;  4CO1 A;  1YZ6 A;  3I87 A;  4X84 A;  2V5H G;  1WKL A;  3HT0 A;  3IG1 A;  1UTA A;  1BQM B;  2OPQ A;  1YHQ S;  3AFG A;  2VIH A;  4M5K A;  4DV3 J;  3LAN A;  2KG1 A;  3H7H B;  5GAH U;  3R9L A;  1XQI A;  5DJB A;  4FZV A;  4IFY A;  2QEX S;  1JXL A;  3DOL B;  4UT4 A;  1TK5 A;  3KXD A;  1U7L A;  5D0G A;  1D1U A;  1WEY A;  4KJI A;  3TW0 A;  1L3K A;  2E9T A;  4OLP A;  3SI8 A;  1CQM A;  1MWQ A;  2DGQ A;  3GIM A;  2RKI B;  1XWL A;  1RAO A;  1RU1 A;  1XEZ A;  3BN4 A;  1C0T A;  1WDD A;  1M0S A;  2CQ2 A;  4HR2 A;  5BR8 F;  1J2V A;  1ZZF A;  4X64 J;  2GW8 A;  2M3D A;  4J9M A;  4PR6 A;  2LMI A;  5F41 A;  3NXZ A;  1JLB A;  3THT A;  2E7V A;  2UP1 A;  4ZS6 A;  1S1W A;  4F3M A;  1Y7P A;  3S6E A;  3M8P B;  4EBE A;  2FJA B;  1X9M A;  2CQ1 A;  4QR1 A;  3HI9 A;  2X1A A;  3B54 A;  2Z2M A;  1NK6 A;  1P9Q C;  2EFP A;  1RT3 B;  2AJF E;  2C28 A;  3PO5 A;  3I5B A;  3O1L A;  1V5V A;  3G96 A;  4UUX A;  2Q43 A;  4ZK7 M;  3W8G A;  4A8X A;  1ZET A;  2W4C A;  1VC6 A;  5CYQ A;  2VB6 A;  2HNZ A;  1HBN A;  2OSR A;  3MM9 A;  3MMC A;  1FCA A;  2AGQ A;  1J5E J;  4EUV A;  2M8D B;  2WSE C;  3CJR A;  2ZBQ A;  2DHX A;  1ROF A;  1T3N A;  2DB1 A;  4O3R A;  5IOL A;  5J2N A;  4WKY A;  3QLH A;  1CJK A;  1X8D A;  2QX0 A;  1HPZ A;  1U8W A;  4YQW A;  4ES1 A;  3AXM A;  3ENA A;  2WVD A;  3O5T B;  3V6J A;  1YJW S;  4YHH F;  1VQS A;  1IWA A;  4BS2 A;  2CJY B;  4DQR A;  2M2B A;  4C6A A;  3MCS A;  3DI6 A;  2MHN A;  4JI7 J;  3TEG A;  2DXF A;  2KG0 A;  3QWP A;  4ZIT A;  2VQE F;  1UWB A;  3N6N A;  3NMR A;  1REV A;  4CLK A;  1RLD A;  1RQ0 A;  3M8W A;  3T6B A;  5EN1 A;  3HVT B;  3O8W A;  5HN0 A;  2ZZT A;  4KO0 B;  2YKM A;  4P6Q A;  4K5S A;  1WC3 A;  1Q86 T;  4H4O B;  1Z2Z A;  3OTO F;  2KRR A;  3CCT A;  1S77 D;  4QWB A;  3DOK B;  4F4K A;  3SXL A;  1WC5 A;  2DNO A;  3MMB A;  1Q81 T;  4U96 A;  1RP5 A;  3DU6 A;  2W01 A;  4EEY A;  1U4B A;  3RRG A;  4NYP A;  3OFH A;  2ZBP A;  3CMQ A;  2LEB A;  1ZM4 A;  1I94 J;  1PYS B;  2FYX A;  2IFX A;  4ZP8 A;  4LFA J;  5DDR C;  3MMA B;  1WTF A;  3Q23 A;  3LW5 C;  4NYZ A;  3MF5 A;  3LP1 A;  3BGR A;  4J7C A;  5BYR A;  4RX6 A;  2KM8 C;  3W9I A;  2GIR A;  4NLY A;  5ETP A;  4O0I A;  2DH7 A;  2YNH B;  3ZZR A;  4I68 A;  5I42 B;  4B9V A;  5ETR A;  4YUD A;  3TR5 A;  4OI1 A;  3I96 A;  4P75 A;  4DR3 F;  4IFV A;  2XBP A;  5K14 B;  2DYA A;  1LW2 B;  2Y0S D;  5KFU A;  3SCJ E;  5CYM A;  2IDE A;  3PXG a;  4I7F B;  1P1L A;  1RE1 B;  2QO3 A;  5KT6 A;  1EP4 B;  3ET6 B;  2R9L A;  1U0H A;  4G65 A;  3C6T B;  4DPY A;  2IC3 A;  1P8G A;  1HNZ J;  5CD4 H;  4F2S A;  2C2O B;  2X1F A;  4HAC A;  3KHR A;  3RUB L;  4B9L A;  3OV7 A;  3OHA A;  4DUT A;  3EPI A;  2AEF A;  2P2C B;  1H7W A;  2YQ0 A;  2W7P A;  1YIT S;  4RKU C;  2YNF A;  4IRC A;  3F73 A;  3Q89 A;  3FJ2 A;  1F3F A;  2DIV A;  2V2K A;  4OZN A;  4NLQ A;  3JAM Y;  3ISN D;  2I5J A;  4OYX A;  3RJM B;  1VC5 A;  1APS A;  1PAE X;  3BPS P;  4L3N A;  2VUG A;  2W4D A;  1CS4 B;  1KHW A;  3D4J A;  4K0K F;  1TKT A;  2AYB A;  1RKJ A;  3OXL A;  2NRE A;  1XMQ J;  2G0J A;  4LVO P;  1T02 A;  2KH9 A;  2L41 A;  2VKZ G;  4LRF A;  4L3K A;  2I8E A;  3EPG A;  3W64 A;  4YS2 A;  2HS4 A;  1HWJ A;  2Q6B A;  2ATL A;  5JJB A;  3W2W A;  1M5O C;  2P6S A;  2BJE A;  1U47 A;  3PHE A;  2OHD A;  1OJ4 A;  2DNQ A;  3A13 A;  4DQQ A;  5KG3 A;  3BSN A;  1DBD A;  3S1T A;  2UUB F;  3S7R A;  1M1K T;  1PCA A;  4RW4 A;  3QPI A;  2X1G A;  1F5B A;  4I6A A;  1FJC A;  3GB0 A;  5H1S V;  4K4Z A;  2E5L F;  4GKJ F;  1RTI B;  4RNM A;  1HYS B;  2V2Q A;  3DLG B;  2ZWP A;  3TVK A;  4HHU A;  1U48 A;  1WEL A;  4DBQ A;  1IBL J;  2BJ8 A;  1PC4 A;  5L8R C;  1JLA B;  2BJ7 A;  4P73 A;  1NB7 A;  4OYZ A;  4CNZ A;  3JXO A;  4QPT A;  1UJ6 A;  2CPH A;  4QYR A;  2XWX A;  2FJE B;  1FJG J;  4RW9 B;  2X51 A;  1FER A;  4ED4 A;  2IM0 A;  4B3T F;  2LDI A;  3EIC A;  5DDO C;  2LCW A;  1OSC A;  4OV6 A;  3BDP A;  2BOA A;  3R5A A;  2LEA A;  1GT8 A;  3O6Q A;  1WHY A;  2LU2 A;  4XO0 A;  3NS5 A;  1D9A A;  1VQY A;  1KS2 A;  1OSD A;  3V4M A;  3O44 A;  5M2U A;  1UZD A;  1CPZ A;  3M6V A;  1IVZ A;  4A8S A;  3DGP A;  4F36 A;  1WJ9 A;  4TXS A;  2ILZ A;  4MKY A;  3NS6 A;  4DCP B;  1JLE B;  4X4V A;  2N3O A;  2HWT A;  5T41 A;  3VZH A;  1SV5 B;  1FTR A;  1JLQ B;  5HBM A;  2R3V A;  3V2U C;  3EGZ A;  4HTJ A;  1TU0 B;  2W2N P;  2JJ4 D;  4FVC A;  2RHS B;  3MXH P;  5FD1 A;  2DEJ A;  1R8P A;  2KXF A;  2MTL A;  5FJ4 A;  3W66 A;  4IG0 B;  4CH1 A;  4J9V A;  4R5P A;  2FDN A;  2DR9 A;  3RW7 A;  3M4X A;  1RB0 A;  1DZ5 A;  4ILL A;  2CZ4 A;  5HK4 A;  5J2M B;  5I3U A;  1JKH A;  2AWZ A;  2W4P A;  4WCE Q;  3KJV B;  2VOO A;  2MQ8 A;  3BH6 B;  1RWW B;  2J7W A;  2AGO A;  3CC2 S;  4RWX A;  2OPP A;  3HM9 A;  3JTN A;  1KTV A;  5T7L A;  4U7U D;  3TX8 A;  3I32 A;  1P9Y A;  5J1E B;  3C16 A;  2CZV C;  4DV6 F;  1R7I A;  2M0G B;  4XPC A;  4NLW A;  4WU3 A;  2WBR A;  5HMZ A;  4QW9 A;  3TZW A;  3N4W A;  3M2U A;  3MPU B;  4CLP A;  2AZ3 A;  5F0U A;  3JTO A;  1N36 F;  3DRY A;  5F9L A;  3KG1 A;  4ZVR B;  4P7V A;  5HQM A;  1NJY A;  4IUF A;  3T6J A;  2HVZ A;  1FES A;  2VG5 A;  2Z57 B;  3U1N A;  1HNI B;  3UDE A;  3EDR B;  4USH A;  3AQO A;  3IA0 A;  4CTA A;  4FNH A;  3KMQ A;  4OYW A;  4PXB A;  1SH0 A;  2GML A;  3R6G B;  3E01 A;  3X3U A;  4F0M A;  2ZH4 A;  3WIU A;  1XNQ J;  1KQG B;  3ELH A;  2FZC B;  4K50 A;  3BH7 B;  3IS9 B;  2XS7 A;  3LP0 A;  3ETM A;  3DM2 A;  4RNO A;  2CQB A;  2W9A A;  2BQU A;  1GTE A;  1H2U X;  2J0W A;  5D0E A;  4O23 A;  3NS7 B;  3DDK A;  1B0P A;  2PO4 A;  2HMI A;  1IR1 A;  1EKR A;  3PY8 A;  1ZPW X;  2XI3 A;  5IM0 A;  1ZPV A;  5K9F A;  3OFE A;  4NEY A;  1MN9 A;  3TEH B;  1H2T Z;  1S57 A;  4DR6 J;  3CCM S;  4ID8 A;  1SB6 A;  5D77 A;  1V9O A;  2J8A A;  2NUU G;  3Q8V A;  2QMX A;  3M2V A;  2YY3 A;  2GS8 A;  4ED6 A;  4NLR A;  3H90 A;  2Z8Q A;  3CNQ P;  3V81 B;  1RIS A;  3AY0 A;  1S9E B;  3DNC A;  1UPM B;  4LSN B;  3EWG A;  4C8K A;  2HHU A;  4PUO A;  5HSP A;  2IY5 B;  1HQE A;  4FBU A;  2BM0 A;  1U2R A;  4BHQ A;  5CHC B;  1FDD A;  3DRS B;  3CD5 A;  5KG2 A;  2AU0 A;  4YDX A;  1UFL A;  2AJ4 A;  4J37 A;  3I55 S;  1RDR A;  4ZIW A;  4BDP A;  4CDI A;  3PW2 A;  5K8P A;  1F6T A;  3BYR A;  4WFY A;  3TNV A;  4PWW A;  1N52 B;  4AT1 B;  1Y5N B;  1NCL A;  1RUS A;  3NNH A;  2NCK L;  1S1V B;  4A8O A;  4R8U A;  1IM4 A;  3OFF A;  4GVL A;  4GMK A;  1JJC B;  1CC8 A;  2QLJ B;  1HAR A;  2E5J A;  4ZHR B;  2K7J A;  3IGN A;  3QRP A;  2EFQ A;  3GYN A;  3DRP B;  1X5P A;  2EFV A;  3ZO7 A;  3FFI B;  4FYY B;  3P96 A;  1ZAW A;  4LQ9 A;  2OLW A;  4O4G A;  3QT6 A;  1GX6 A;  4ECU A;  1MWZ A;  2NQP A;  2IPO B;  2JL9 A;  4YR2 A;  2ALZ A;  1IKY B;  1Q7L B;  2MKI A;  4FYD A;  3C3L A;  4NLT A;  2U2F A;  2N3L A;  3T9N A;  3A4T A;  1FO1 A;  5KFS A;  1LWE A;  2GVD B;  2ZNZ A;  3OR1 B;  3W5Y A;  1G7C B;  3PEJ A;  3E2E A;  3HDS A;  1SL0 A;  4K2J A;  2DBB A;  1Y3K A;  3KK3 A;  1Y00 A;  3HZG A;  3W1Y C;  2QRR A;  2RF2 A;  2VU5 A;  4N47 A;  4ECR A;  4F67 A;  3VZI A;  4EI2 A;  2VF3 A;  2O67 A;  3S8S A;  3A1Y G;  2W9C B;  2W2M P;  2J6S A;  3BEG B;  4PEO A;  1MML A;  2A6M A;  4ZVO B;  2OJ3 A;  2BRL A;  1LEO A;  3PFO A;  2VBX A;  1EET B;  3M30 A;  4CP5 A;  2BUN A;  5HLF A;  3R3T A;  3CDW A;  1PG5 B;  5G0R A;  2XMK A;  2MQQ A;  1UCN A;  3M6W A;  1RU2 A;  3UNG C;  2Z30 B;  4H4M A;  1IM6 A;  1FI4 A;  4DUZ F;  2DXD A;  3LPE A;  4DL2 A;  4K4U A;  2ZH1 A;  4ECV A;  4LSL B;  3FC9 A;  2C2Z B;  4WP3 A;  1QAI A;  2B6A B;  4EWT A;  4FN5 A;  1RLC L;  4N8O A;  4KPC A;  5JMN A;  4PG5 A;  4DR4 J;  1S6U A;  3BR8 A;  1N33 F;  4DCJ B;  1LK5 A;  4TLR A;  3GIK A;  3KHL A;  2Y0B B;  2IM1 A;  2ZHA A;  1QTM A;  3GIJ A;  3DCA A;  3OTO J;  4S0M A;  1HW8 A;  3KG0 A;  1NRK A;  1FE0 A;  1TKZ B;  5DG7 A;  1FJE B;  3N0V A;  4B9T A;  3MEE B;  4RZR A;  1L3T A;  5KT4 A;  3M32 A;  2KFZ A;  4WTY A;  2W8K A;  3TX0 A;  2J7U A;  4RUA A;  5B0D A;  3OL7 A;  4I56 A;  2K7K A;  3RBZ A;  5LMN F;  4LF4 J;  4QU6 A;  4IKA A;  1DHM A;  3MAA A;  4F50 A;  4NXN F;  2D3O 1;  2B5J B;  2RML A;  3AA8 A;  2D9O A;  3W9J A;  1RBL A;  2N82 B;  1Q16 B;  2ZHO A;  2ZH2 A;  4DSE A;  2DRB A;  4OYI A;  2BW7 A;  3QGP A;  2FVS A;  3AOA A;  5F8L A;  3DXB A;  4RBT A;  3DKD A;  1TK0 A;  2OPR B;  2Q66 A;  1F3V A;  5EDW A;  3TZZ A;  1FKP A;  1U09 A;  3GON A;  2OGU A;  4Z2X A;  2RRB A;  3G6E S;  4MKA A;  4B17 A;  4UQG A;  2H4W B;  3WC2 A;  5IWA F;  1HNW F;  1U6B A;  2CXE A;  3D0I E;  1L3S A;  1RTJ B;  3D0H E;  3THV A;  2DRD A;  1B4S A;  5K20 B;  4C3L A;  4Q8E A;  4RU9 A;  3ITH A;  1S4E A;  1DTT A;  2FZG B;  2ZUG A;  2OTL S;  5KFL A;  4DSI A;  4KPY A;  2CJQ A;  4JI4 J;  1WC1 A;  4L73 A;  3R5G A;  1NXI A;  3PRB A;  1FD2 A;  2MLX A;  3GFY A;  2QC3 A;  3N28 A;  4RO0 A;  2UUA F;  3CED A;  1QUV A;  4CT8 A;  5F3Z A;  2R42 A;  3V6K A;  4U95 A;  9ATC B;  4K0K J;  1QE1 A;  4KHR A;  5JUM A;  4O3P A;  4PQU B;  2G2Z A;  3MEC A;  2OMO A;  3MM7 B;  3TI0 A;  5ETN A;  2B4P A;  2KZM A;  3MPD A;  4C4W A;  1S1X A;  3ZZT A;  4J9N A;  2HBY B;  5ETM A;  2CPD A;  2MKY A;  4OYM A;  5E3C A;  3HP6 A;  3SFG A;  2BAB A;  3U02 A;  2F1F A;  4ZLN A;  2CQI A;  3IG1 B;  1X4B A;  1RBA A;  2OPQ B;  3LOU A;  5E3P A;  4N41 A;  2YH0 A;  1RWM B;  3N9U C;  4PCQ A;  2V8D A;  4DV4 J;  4EMD A;  3OL6 A;  1FRK A;  1VR6 A;  4OZ5 A;  4LF7 F;  1WSV A;  2V69 A;  4DV1 F;  2NYI A;  3BO3 A;  2E5L J;  4IFY B;  4GKJ J;  4OZL A;  3IR5 B;  4DR5 F;  2OTJ S;  3I5A A;  2DH8 A;  2KT5 A;  5E3R A;  1D8Z A;  2HHQ A;  1FWL A;  1HW9 A;  5CZX A;  1RTD A;  3OJS A;  3PIP Q;  4WTO B;  4KV8 A;  4ZP6 A;  2YPZ A;  1C0T B;  4OX9 J;  4OZ2 A;  4F0H A;  1KOH A;  1HKA A;  2VG6 A;  3MR7 A;  1LXN A;  3E51 A;  2UXB F;  3CCV S;  4JI2 F;  3TA1 A;  2DKO B;  1VK3 A;  4EFA C;  1JLB B;  2OP5 A;  1AFJ A;  1GXU A;  1NDP A;  1S1W B;  2CJB A;  3NGT A;  1NH7 A;  1VLO A;  3I31 A;  4PXD A;  1NJZ A;  3LO3 A;  4OJ1 A;  1KBR A;  3A8E A;  5F8G A;  2UU9 J;  3TJ8 A;  4DHV A;  3L3C A;  4LRA A;  2NXU A;  2VOP A;  3DHW C;  3GIR A;  1VIS A;  4JP8 A;  2XM3 A;  5CYQ B;  4MK7 A;  1ZM9 A;  2HNZ B;  1HBN B;  1SI9 A;  3MMC B;  2ZHB A;  3CIM A;  5A8R A;  4LF8 F;  5HQ8 A;  1JJ4 A;  3MPW A;  4ECS A;  3DFE A;  4U7U K;  1F60 B;  5RUB A;  1YRU A;  3QLH B;  1CJK B;  5CAB A;  3MAQ A;  1C1C A;  5DG9 A;  4I2Q A;  3M9M B;  1HPZ B;  4M5G A;  1RZM A;  1FRH A;  3BSC A;  5KG4 A;  4ZJO A;  4P71 A;  2CWK A;  1UFK A;  2UUT A;  3QMQ A;  3DI6 B;  1PYO B;  1R89 A;  4Q2L A;  1VQM S;  4TNO A;  4NLP A;  3UO0 A;  5J2P A;  2J76 E;  5KFF A;  5A6W A;  3PDN A;  5L46 A;  2DD8 S;  3QAE A;  1UWB B;  1E6V A;  4OJH A;  1RTH A;  2EWH A;  3FCH A;  1HWK A;  2EC0 A;  2PGC A;  2HHH F;  4NXM F;  1XR7 A;  4N8N A;  4F02 A;  1NK5 A;  1AZS A;  1VBK A;  1S7H A;  5KFQ A;  2AZ1 A;  3MM8 B;  2YKM B;  3PJX A;  4Q0B A;  2CQH A;  3J7A 1;  2V8G A;  5E33 A;  4LMZ A;  1ZTW A;  2YKQ A;  1IKX A;  2PMH A;  3FMW A;  3EXC X;  1Q5V A;  3MMB B;  4KRW A;  2HHV A;  2ZJR Q;  3Q8R B;  3FQK A;  5IT4 A;  1BD6 A;  5F8N A;  3JYT B;  2KRB A;  2W8L A;  3R1L A;  3H25 A;  4DXL A;  2KM8 B;  3CPW R;  1AB8 A;  3KK1 A;  5AXN A;  2CAJ A;  2FPH X;  4E98 A;  3NOG A;  2AJQ A;  3EVW A;  2E9R X;  3LP1 B;  3BGR B;  2J8S A;  1YJV A;  4ZCL A;  1VIO A;  1JXE A;  1IKV A;  3MOZ A;  4NI2 A;  1F9E B;  4KAI A;  1PJ6 A;  1Y5L B;  5DM7 Q;  4AL7 A;  5DQI A;  3VAI A;  3VGS A;  3DXS X;  1MNE A;  3OVS A;  2FLL A;  4KSE B;  2WAQ D;  3LWL A;  1BHN A;  2J6T A;  2D74 B;  3SFU A;  1N0U A;  1SH3 A;  4IFV B;  1G6B A;  2CYY A;  5CYM B;  5CD4 A;  4HYK A;  3BKU A;  2DHH A;  4BWJ A;  4ES3 A;  3D0G E;  3HCX A;  3PW7 A;  3UVJ A;  3J7Z T;  2AT1 B;  1U0H B;  3KFW X;  2PII A;  2IC3 B;  2HZA A;  3ZZU A;  4BCA A;  1RJJ A;  1FX4 A;  3MMA A;  2PEH A;  1WTB A;  4KHP J;  2WON A;  3BPD A;  4W4M A;  3RR7 A;  2P9E A;  1NJX A;  2YNF B;  4K4W A;  3T5L A;  1YBA A;  2V9K A;  1A7G E;  1HWI A;  1MRO A;  1KWM A;  2L9N A;  3AT1 B;  1YJ9 S;  2I5J B;  3PRD A;  4U8V A;  3NL0 A;  3W5X A;  2JFK A;  1GX5 A;  3HFK A;  3UI3 A;  5DQH A;  3M8Q A;  1LW2 A;  1H3D A;  2DVI A;  1FRL A;  4ZPT R;  5EHH A;  2GJ2 A;  3KTQ A;  1UA1 A;  2H9Z A;  2XG8 A;  2JLE A;  1TKT B;  2CPJ A;  3C6T A;  2DNK A;  2FVP A;  1YLX A;  2Y1R I;  1IR0 A;  1ZTT A;  3F56 A;  1RAI B;  1VS3 A;  3D3C J;  1XJW B;  2AP6 A;  1FF2 A;  2MQM A;  2MJU A;  2J9D A;  4RW4 B;  5K8N A;  1U25 A;  5E0O A;  2P8I A;  4CLT A;  3L09 A;  3IAS 9;  1OYE A;  4FP9 A;  2KYZ A;  3IFE A;  3WC0 A;  3CD0 A;  2B51 A;  3WDO A;  4DV5 F;  1B64 A;  3OLB A;  3EZ5 A;  1ZH5 A;  2EC2 A;  1OMS A;  3J7Z 5;  3JSM A;  5IV3 A;  1JIH A;  4HH1 A;  4KB7 A;  1SKR A;  3TAM B;  3DLJ A;  2H48 B;  4RNF A;  2GIF A;  4DU7 A;  2RJZ A;  1N88 A;  3PG9 A;  2ZH3 A;  4DPX A;  2K1R A;  4MK9 A;  3B6B A;  1W2B R;  3LF0 A;  3OR2 A; 
#chains in the Genus database with same CATH homology
 4GKK J;  4DV2 J;  1XNQ J;  2UUA J;  3IMQ J;  2MEW A;  2UU9 J;  5LMN J;  2KVQ E;  4JI6 J;  1XNR J;  3T1Y J;  2E5L J;  4GKJ J;  2MQ8 A;  1IBK J;  4LF4 J;  4NXN J;  1N33 J;  3D3C J;  4LF8 J;  4KY3 A;  4DV5 J;  2F4V J;  2UXC J;  4JI4 J;  1HNZ J;  2UUB J;  1J5E J;  4JI3 J;  4NEZ A;  4JI1 J;  5LMU J;  3J7A N;  5LM7 E;  4KHP J;  4DV6 J;  4PWW A;  5IT9 U;  4JV5 J;  1HR0 J;  3W1Y C;  2ZM6 J;  1I94 J;  2KL8 A;  4YHH J;  1HNX J;  5FLX U;  4DV7 J;  4DR4 J;  3J80 U;  4AQY J;  1XMO J;  3JAM U;  4DUY J;  3J81 U;  1N36 J;  4K0K J;  4LFC J;  4B3R J;  1N34 J;  2VQF J;  4NEY A;  4B3S J;  5BR8 J;  4LFA J;  4DR6 J;  4OX9 J;  2HHH J;  4LFB J;  4DR1 J;  4HHU A;  4JI5 J;  2UXB J;  4YY3 J;  4JI2 J;  4RJV A;  4JI0 J;  5IWA J;  1IBL J;  1N32 J;  4X62 J;  3D3B J;  4X64 J;  4V1A k;  4LF6 J;  3R2D J;  4JI8 J;  4JI7 J;  4DV0 J;  4DR7 J;  5AJ3 J;  4DR2 J;  4X65 J;  3OTO J;  2VQE J;  4B3M J;  4LF7 J;  2UXD J;  4KYZ A;  4DV1 J;  5A2Q U;  1FJG J;  1IBM J;  4DUZ J;  4B3T J;  2MTL A;  4NXM J;  4X66 J;  4DR3 J;  1HNW J;  4JYA J;  4DR5 J;  4LF5 J;  2UUC J;  3T1H J;  1XMQ J;  3R2C J;  4DV4 J;  4DV3 J;  4LF9 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...