4B3TK

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4b3tK00
4NXMK 1IBLK 4JI1K 1N32K 1HNXK 3JAMO 4B3SK 4YHHK 4JI5K 4JI3K 4LF4K 1FJGK 2UXBK 4LFAK 1HNWK 4DR7K 5FLXO 4DV1K 4JI2K 4JYAK 4B3MK 5IT9O 4B3TK 5A2QO 1I94K 1XMQK 4JI8K 3J80O 2HHHK 4LF6K 2F4VK 4CVNE 1IBMK 4CW7B 4JI7K 1N34K 4AQYK 1IBKK 4X64K 2VQFK 4DR2K 5IWAK 4JI0K 4DV4K 4JI4K 1HR0K 4DV3K 4LF9K 4YY3K 4OX9K 4NXNK 4K0KK 1HNZK 2UXCK 4DUZK 4DV2K 4GKJK 5LL6Z 4LFBK 2UUCK 4LF8K 3J7AP 4DUYK 4GKKK 4B3RK 1XNQK 1N33K 4JV5K 4X62K 5BR8K 4DR3K 3J81O 2ZM6K 4X65K 5AJ3K 5LMNK 4DR1K 4DR5K 3OTOK 2UUBK 4JI6K 4KHPK 3T1HK 2VQEK 2UUAK 4DR4K 4V19S 2UU9K 1XNRK 1N36K 4X66K 3T1YK 4DV0K 4DR6K 4DV5K 1XMOK 4DV6K 5LMUK 4LF7K 4LF5K 4DV7K 2UXDK 2E5LK 3J7YP 4LFCK 1J5EK
chains in the Genus database with same CATH superfamily
3PIPL 3R3LA 3EEQA 2HMPA 4F4KA 1QE1A 4B9TA 2F9WA 2FSJA 5JS1A 4AILC 3ZX0A 3V9WA 1KRPA 4A2AA 4CHOA 3JYTA 4LF4K 3VGKA 1IO2A 1X9JA 4FZZA 4BGBA 4M3WA 1VSJA 1P90A 1C0FA 2E20A 4FJNA 4C23A 4DTOA 5A2QO 2YHWA 4JKAA 1VSDA 3ZLJA 2ITGA 1W7AA 2CGLA 2DFFA 4YOUA 1VSHA 4F3TA 4CJ5A 1LWCA 4U7BA 2X6SA 2G8UA 3EKSA 2ZWHA 1HJRA 2QEXN 4FJ7A 3R1XA 1QHTA 5AQKA 3SJJA 3VQQA 1UAXA 1DEJA 4ILJA 4CE9A 4PL8A 2OPQA 1L3TA 4JI0K 1T6CA 2FBXA 5M1KA 1NK4A 1Z05A 3W3DA 3WEEB 2W42A 3V1OA 2EX3A 4CJKA 1UOCA 3O3HA 3RRGA 5AQIA 3K58A 3P39A 1TL3A 4FWNA 1GLCG 1MDUB 5AQLA 3S3NA 2CH6A 4WQ5A 3V1QA 5M1NA 2A41A 4FOEA 2VGMA 3RSEB 4K42A 4E89A 1RDWX 2ITMA 1NKCA 2VQEK 3V9XA 3V81A 2Y1IA 3FZFA 3AVLA 3MWPA 1SAZA 2LSNA 1W0HA 5J1EA 3RTVA 2ZF5O 4JLHA 3T1YK 3D2FB 3B6PA 3S3OA 1LWFA 2HHSA 5AQGA 1BI4A 1X9MA 4WFBL 3THYA 3VEVA 2KTQA 2RKIA 3CC7N 4LF7K 2G8WA 4IOCL 3WUHA 1HKCA 2P9NB 3M6GA 4DV7K 1SKRA 1D9FA 1QQMA 4XH1A 4QS7A 3FZLA 1GLLO 2YV0X 1K6YA 3MXJA 3T19A 4B3SK 2P9LA 3H45C 1XWLA 4FSVA 3BY5A 3HVTA 1JXEA 4PQUA 3PX6A 1Z26A 4YDUA 3NAEA 3QIOA 4M41A 2P5OA 5CYQA 4H0YB 1C0TA 4B3MK 5IT9O 3RWUA 4FLTA 4CGGA 3IKMA 1RTIA 1TKDA 3HSTB 3C65A 2G8IA 3HRGA 3GOIA 2HB5A 4OPKA 5BRDA 1C0GA 4DTNA 3E1YA 4JI7K 4O8KA 3VEYA 1YAGA 2E2QA 3LWMA 1S5JA 1NG9A 3LPTA 3SQ2A 2KQ2A 2O8DA 1YXQA 4JI4K 1ASWA 3V9UA 4LF9K 4YY3K 3HVRA 1KSPA 3W0LA 1BQNA 3TTFA 4DTUA 1X1PA 3VETA 3AGRA 4BE2A 4HUFA 3G10A 3J7AP 2IIRA 2E8AA 1LOTB 1NMNA 1EWQA 5AQOA 2QTDA 3DYAA 3OYHA 3S9HA 3F9KA 4DU3A 3NGYA 1ZBHA 2HBJA 4DQRA 1FW6A 3AVKA 4MLHA 1JLFA 3CCLN 4B3OA 3ATUA 3O9TA 3KKSA 3TAGA 4LD0A 1RBVA 2D0PA 3WNFA 4E7JA 1WB9A 3ID6A 1KVCA 2HNDA 3I33A 4Z0UA 3WXMB 4BVOA 5JICA 1ZBFA 3CCQN 1HLUA 2A42A 2QWNA 1TK0A 1TK5A 2JWKA 1E4GT 4CEBA 3MEDA 4PKGA 4JS4A 4FCYA 4CJ3A 4DTXA 3AVCA 3H3NO 3A0IX 4JI5K 2WBNA 1WSJA 4N5SA 1EO1A 2NRHA 1HPZA 5ADXA 2R7YA 4PHTX 4CCHA 4KRFA 1XC9A 3O9SA 1NGIA 4JAXA 1TKXA 2E88A 4MDBA 5CR4A 4EFHA 3T3FA 3CQXA 4Y1DA 1TKZA 2ZJRL 3N4QA 1O1WA 3A8YA 5HP1A 4C1NI 2XO7A 3HP6A 2QWOA 4Y0WA 4Q5VA 4GW6A 4WYBA 4B9SA 5JLFA 2YKNA 1SS6A 3VTIA 2Z1HA 3IFRA 4K41A 2UXCK 2O8CB 1S9EA 3K2PA 3CMAN 5C0YA 3NH0A 4KB0A 2NRXA 4MO4A 3QERA 1BCMA 3QNOA 4CJFA 2QI2A 4B1WB 4PY5A 4ZTFA 4OKJA 1KCFA 2ASPA 3NF6A 3HM8A 3C6AA 1WNSA 1KAXA 2YHYA 5AJ3K 5HRSA 3L2VA 2G8HA 3AA5X 4HHTA 1M1KO 4O8UA 4DG1A 1M90O 3AY9A 4KHUA 2ZD1A 3OY9A 1B9DA 1RDCA 1WSIA 4CZHA 1VQ6N 4H5WA 3TSQA 2RF2A 2FBYA 3NF8A 3P1GA 5FRMA 4BDPA 1XQSC 5F1XA 4NO7A 4AHTA 1IH7A 4I2QA 1BA1A 3LM2A 2KHOA 3O3FA 1NBWA 4OGCA 4OVLA 1VK0A 4JKHA 1VQNN 3KZBA 3VQAA 1OH5A 3BZKA 4JI1K 4ILGB 1N32K 5GIOA 4CESA 1TL1A 4ISFA 4AM7A 3QESA 3PO5A 4CF8A 3B6OA 3DRSA 3QETA 3FZKA 1NJIO 3OYKA 3U9DA 4CEDA 3AVIA 1TGOA 3MECA 5BPMA 4AHCA 2FBVA 3WQUA 3ZETA 4FLXA 5KRTA 4FPBA 1ITGA 2H3GX 3WNEA 4M3XA 2F9TA 4IZ9A 3K57A 1T8EA 4JN4A 3LZIA 3HP9A 3P38A 5AR0A 3ISNC 5E26A 2PY5A 3CC2N 1U2VB 4WQ5C 4FWSA 1EXQA 1IBMK 4K25A 3LDOA 3O4QA 4F9OA 3V9SA 1Q7YO 5C10A 3CPEA 3VQBA 4N47A 3KLHA 4WE1A 4DV4K 3ZT3A 1D8YA 3LWLA 4JS5A 1Q9YA 2JGUA 1S1UA 5CHIA 3QIPA 3VEXA 2CH5A 5J2QA 4CZIA 3PX4A 4KHNA 4ILHA 5I42A 4B1YB 1HUXA 4IXCA 4JV5K 1J9AA 2BH1A 1VQ9N 1BUPA 4H5NA 4DR1K 2EWSA 3HT3A 4IBNA 3G6EN 4FWQA 3NE6A 5AZJB 1YJWN 3AVHA 4TSXA 4NCGA 3HM9A 4BRLA 3SAHA 4CGHA 4OLBA 3CI5A 1NOYA 2D0OA 5J2MA 4FM2A 1R59O 3ZSOA 2ASMA 3LANA 1ZXOA 1G15A 1BHLA 1ZBLA 4WCEL 1LAWA 3J7YP 3D0PA 2DFHA 2D0CA 4A59A 3P31A 4M3YA 3CHWA 3NF9A 3U3YA 3OJSA 3BF1A 4CEOA 2JLEA 4YHHK 3OYBA 2UXBK 5JVGL 1WSFA 3SUOA 2ZQBA 5BRHA 5E41A 1TAQA 4HTLA 4K43A 5AQVA 1ATRA 1NGFA 1S1XA 1JL1A 2Q0RA 4RW6A 3ZSRA 2A6AA 3H1QA 3DLGA 1LCUA 4F2RA 3NVKA 3O4WA 4CGJA 2Q97A 3J80O 5EY4A 1IKYA 3MWTA 4CVNE 3EE9A 2GWJA 4CW7B 4FJLA 2OPRA 1S1WA 2D4WA 4CEEA 1JL2A 1CXQA 2Z1JA 3KTQA 2OZMA 3RMBA 2B6AA 2VG7A 3DMJA 2CGJA 3AVFA 3ENOA 1ZYQA 3NH1A 1WBBA 1NJXA 1HYSA 3CMEN 5LL6Z 2YNGA 3LP3A 5AQZA 4FO0A 3VERA 1YTUA 4O4GA 1HRHA 4DUYK 3U4LA 3CJBA 2P9PA 4BR9A 4CEFA 4DS5A 1QVGM 4O55A 5DMRA 1A5XA 2KKZA 2IC3A 5AQUA 4FJHA 2Q3SA 3ULEA 3KIOA 4BRPA 1GLAG 4G1QA 4H0VB 3NF7A 4BRKA 5BPNA 4BR4A 5CE3A 4DR4K 1HKBA 2AA4A 2YJEA 1L5UA 3TU5A 3ZT0A 2WUSA 1KD1O 2BANA 4CHNA 4WFNL 1ZBIA 3ZT4A 3F73A 2BDPA 2FBTA 3DLBA 1U49A 5AQPA 3BZCA 2FC0A 3VEOA 3MEGA 1X3NA 2VG6A 3L4QA 3VESA 4M3RA 3BDPA 4B8AB 5M1PA 4BC3A 3AA4A 4CK1A 3QLHA 3NGZA 5KRSA 4B9VA 4NCAA 3NVMA 2E5LK 4CJWA 1YJNN 1VSKA 2O8DB 3AA3A 1NNEA 3QBXA 4XEIA 1HNXK 4BR2A 1NOZA 3DXKB 4B1VA 3GL1A 3LP2A 4KPYA 5CY4A 3TI0A 3AAQA 3OYEA 3HPGA 3ID8A 3THXB 4LC9B 1KC8O 4HCBA 1BCOA 1K8KA 4YOYA 2F8TA 3CCJN 1N8RO 2Q31A 2QWRA 1Q8IA 4BRMA 1U2VA 3WXKA 4IG0A 2P9UB 3PX0A 1VQ4N 1JCGA 1YTAA 3AO4A 4NYNA 5FDLA 1B9FA 5GINA 5I3UA 3PSFA 4KHWA 2E6MA 3D6RA 2D0AA 3A5LC 4DQ8A 4OPAA 4FJMA 4BRHA 3LDLA 3I56N 1V4SA 3AARA 4DWIA 3OYGA 4FK4A 1RDAA 3MN9A 5GIPA 3VQ8A 3DAWA 4CF1A 4CFBA 3SAFA 5AZIA 5KPZA 3K5LA 3L0QA 4DUZK 4FYDA 4DV2K 1GOAA 5ADXH 4GKJK 5D3GA 4IEIA 4DF8A 1J6ZA 1C1BA 1U4BA 4LF8K 4JNEA 4CF0A 5HOOA 4JD2A 3M8RA 4DTJA 3ASMA 3ZX2A 2WTUA 3ULDA 4B9UA 3KLIA 1CZ9A 4X65K 4BACA 2P9IA 3AGKA 5AZJA 3SUPA 4E7LA 1HPMA 4FWOA 3OYMA 3DXMA 1TUYA 3CFPA 3T1HK 2NRZA 3LAMA 3TAQA 3MCAB 3M8SA 2OTLN 3P4IA 4O0JA 4BQLA 3CIPA 1ILYA 2O4IA 1S1TA 2D0BA 5FRNA 4X66K 2GUPA 3UE5A 1RDUA 1NK7A 3THVA 4Y1CA 4FWRA 5KPTA 1GLDG 3C0BA 2KLAA 1QQCA 2QWQA 3A5OC 4GV6A 4O44A 5ELZA 2HNYA 4Z4EA 1QHAA 4E1NA 1U04A 3SQ1A 1K8KB 1OH8A 1FKPA 5B8HA 4H5TA 2ASOA 3MMVA 1Y97A 4FZXC 4RW7A 3OJUA 3CERA 4JHDB 4K8ZA 3VF4A 4DV1K 1XUPO 2EHGA 4JYAK 4YOTA 2QKBA 4ISEA 4CGDA 4RW9A 1VSLA 2I7NA 2P9KB 1JXBA 4CIFA 1A5WA 4W5NA 4JKBA 4YORA 1S9GA 3LDQA 1BI4B 1J54A 5AZIB 2P9UA 4AHUA 2FSKA 2KZMA 3I0RA 1KLNA 3MX2A 1C1AA 4B1ZA 1RBUA 5SZTA 4HWIA 2O8EA 2OTJN 5AQHA 4Z4IA 4JKFA 3VGMA 3K5MA 1KAZA 3AVNA 2CGKA 3AVGA 3JXUA 4EZ9A 5HRRA 1GLEG 1NK0A 1IG8A 4CJ7A 4O5BA 3VMFB 1FKOA 4LFBK 1KFSA 2UUCK 4KKOA 1IKXA 4F2SA 4YOXA 2W6KA 2B5JA 2RPIA 3O1WA 5K14A 1C6VA 4BRQA 3WEEA 3J81O 1BA0A 4OGEA 3RR8A 3VQ5A 3AO1A 5FPDA 4DFPA 4WQ4A 1YITN 2QK9A 4DR5K 4BC4A 1DTQA 3D2EB 4RWTA 4R5PA 4XH5A 2IDOA 1NJWA 5JMVA 1VSIA 3NFAA 5AQNA 3SV4A 5EXWA 1YF5L 4M7XA 4KTQA 4E7KA 1VRUA 4WFAL 2J4RA 4M7YA 4DHYA 1YT3A 2ZGZA 2KZZA 4XH4A 3OBYA 2YKMA 1RT2A 2VWBA 3QDKA 2ATQA 3TTDA 3CCUN 2YJFA 1TK8A 1UA1A 3HOSA 2ETJA 1NK9A 4NLCA 3QEPA 1RBRA 4H8KA 4AM6A 5JLHA 3O1BA 4H0XB 4ID1A 1QZ6A 2QKKA 4FZYA 2W40A 3JS6A 4JI3K 2Q0UA 1FJGK 1MA9B 3E01A 3HXMA 3TANA 3VN5A 4A5AA 2WC9A 3CCSN 1NGEA 1SKSA 3EO3A 2OPSA 3SNNA 4BE0A 5HROA 4DSJA 3SMPA 3CM5A 1KVBA 4OPJA 3UKUA 4LH4A 3TARA 3FFIA 3VTHA 1RFQA 1VQ5N 3WXJA 5AFUA 2IVPA 4FW2A 4KFBA 1EETA 3VGLA 3VQ6A 2FSNA 4QCLA 5T7BA 4RW8A 5C2DA 3HYFA 2Q1NA 3OYLA 1LW2A 4DCHA 4MDAA 3ZSVA 1S6PA 1V4TA 3KK2A 3M8PA 3H46O 4NXNK 2A5XA 4CJPA 3VA0A 4FLVA 1NGCA 2BTFA 3PO4A 4CFCA 3MEEA 3NBPA 4M63C 1JLQA 1VSMA 5M1OA 4FK2A 1RT1A 2WOMA 3OBWA 1HQEA 5J2PA 1TYQB 3V6DA 1KTQA 1EWRA 3KLEA 1SV5A 3RRHA 3O08A 1YHQN 4OKEA 5SWMA 4I9QA 2QW9A 1ATNA 4UQGA 2HSTA 4KHPK 3LDPA 5FROA 3SQ4A 3PY8A 1ASVA 3KLGA 1GOBA 1ASUA 2D1KA 1S72N 1N36K 1TVRA 3ATVA 1JLAA 2O8FA 4DV6K 4Z4CA 5LMUK 5LJWA 3ZSXA 2V7YA 2FLOA 1ZBUA 3RMAA 4N56A 4BR0A 1S22A 2O4GA 2OA8A 4CGFA 3CFRA 2IVNA 3GE1A 5AQWA 4B9LA 3JAMO 4FWPA 4BDYA 1J5OA 5MLCQ 4AH9A 3UIQA 1NWKA 2HVHA 4RTFD 4KH4A 4M3ZA 1N5YA 3CCMN 3T1AA 1NJYA 2QWPA 3ZX3A 3U9ZA 1QS4A 4CHPA 1SL1A 4KHYA 2O8BA 3K0SA 1VQ8N 1HNVA 4IFEA 1SL0A 3L2WA 3DLHA 3R6MA 2P9SA 1CLQA 1YI2N 1D5AA 4CZKA 4DSKA 4KAZA 4ICLA 2F7TA 5CZ1A 4IJNA 3MXIA 4FWMA 1E4FT 2F4VK 4FJXA 4I2PA 1W97L 1X3MA 3AO5A 3C6TA 4H0OA 3SJHA 2HHWA 3BEXA 3FGUA 3IG1A 4L3QA 2A40A 4FJ9A 3VQ7A 3ZSYA 3NGIA 5IWAK 4FK0A 4KHSA 3D2EA 4QS9A 3PIOL 4M3UA 3M1FA 4IOAL 2PZSA 4MLEA 3FFKB 4IO8A 4CECA 4U67L 3V9ZA 3TR8A 5KI6A 3L2UA 3VQCA 1TUUA 3CXCM 4BR7A 4DU1A 2QXLA 3THYB 4K8XA 1W9HA 2HBLA 3BUZB 4IDKA 2P9LB 4FM0A 3GDQA 4B3RK 2VCPA 1ATSA 3AVJA 3Q7CA 3UB5A 1HQUA 1UA0A 3QEWA 5AQFA 2G8FA 2RN2A 2YI1A 4GNIA 1T03A 1NMDA 2OCEA 2F8SA 1RT5A 2PFUA 5HRNA 3CFOA 3OVNA 3K9JA 2HHQA 2OYQA 4V19S 2UU9K 1GOCA 4MFBA 3A5MC 1L3VA 4L8RB 1JKHA 3WXIA 4CEZA 5GAEP 3GBTA 3S3MA 1RT4A 3AO2A 2QWLA 4CJQA 2IS3A 1VQPN 3C7NA 4BR5A 4DQPA 1RDBA 3LP0A 1SL2A 1XHZA 1WUAA 3THXA 3IDHA 2XY7A 1HX1A 3CF5L 4W5RA 2BE2A 1NGDA 5KGXA 4OO1J 4MO5A 2E2OA 4JEPA 3Q7BA 4LFAK 4DU4A 2P5GA 3TABA 2KW4A 4DR7K 5EU7A 5M1FA 1QTMA 4CBXA 1Q81O 4B3TK 4M42A 3AA2A 4CD1A 4PKHA 1OVQA 4JI8K 4W5OA 3F2KA 1T44A 3OS1A 4BRIA 3THWA 3QO9A 3K5NA 3ZT1A 1S6QA 3DRRA 2P51A 4FJJA 3UKRA 4AHRA 4F3OA 2QWMA 3L4IA 1N34K 4CJLA 4AQYK 4BVPA 1VAZA 4H03B 2F96A 3HOTA 3ZEUA 4AHSA 2XY5A 3DWLA 1HR0K 2VG5A 3NH2A 4DLGA 2YNIA 1NK8A 3C7NB 3N4PA 2YNFA 4FWLA 2VWKA 3SV3A 4I6MA 3BGRA 5KGWA 1U48A 1Z6RA 4H4MA 3C6HA 1HMVA 4HVJA 3WNHA 3EKUA 1FK9A 3LPUA 5GADP 3NCIA 3E66A 4CJEA 1BISA 4A62A 1TKTA 1XNQK 1C1CA 1Q86O 4HUGA 4C8NA 1C0MA 2D5RA 2ZM6K 3OYJA 1SUQA 1KLMA 3E9LA 4NYFA 4QOZB 1R0AA 3T7ZA 5KPRA 4DQQA 3IUCA 2QXFA 4GY2B 4CF9A 4BE1A 4J2BA 1J53A 2FF3B 3ITHA 3KWIA 5E84A 1MWKA 4H5VA 2DPNA 3LALA 2P9SB 3DOKA 3CPWM 4IG3A 3H1VX 2P1JA 4W5TA 4CEQA 4C8KA 4DFJA 2W6LA 1MU2A 4CBWA 4CJRA 4I9LA 1REVA 3HI0A 2B4JA 4NXMK 1D4XA 3EY1A 3HO1A 3HJFA 4E7HA 2VYPA 1CZBA 3A5NC 4GVMA 3AVMA 3IAYA 4IKFA 2YHAA 1GLJO 1YVNA 3V4IA 1T05A 5JVHL 4YDUC 2KFZA 4E7IA 4J2DA 4B1XB 1I39A 5JS2A 4GV9A 4O0IA 1VQ7N 3UKUB 2GTDA 2P9IB 3CJAA 3MXMA 1BGXT 1L3SA 4ZTJA 4CF2A 3SUQA 1NKEA 1U47A 3VPZA 3SLCA 4CD3A 3TSPA 1XC3A 5FPNA 5C2FA 4HTUA 3I0SA 5C42A 3VEWA 4JRQA 2X6NA 3QB0A 2GUIA 1UWBA 2QM1A 1YJ9N 4BROA 1RTDA 4CHQA 4KV8A 3HL8A 2E6LA 1OVYA 4QAGA 4KHQA 4DQSA 4XIUA 2XHBA 4DTPA 4CJUA 1B92A 1WAFA 3ALYA 1LW0A 5C24A 2E4LA 4YNQA 3EZWA 3DRPA 5AQQA 2ZE2A 1IJJA 1O13A 1T6DA 5EX5A 3I8DA 2HHUA 4JKGB 4J2EA 4YFUA 2XY8A 5HRPA 1JLCA 1IG9A 3QINA 4CBUA 1JLBA 4JKDA 3RMCA 4FLWA 3D7EO 4DF4A 3CJ1A 2IVOA 3U3GA 5H1SQ 2GEMA 4DR6K 3DLKA 3ZETB 3P5JA 1YIJN 1VHXA 3KKRA 4ELVA 2KFNA 2V7ZA 4LF5K 4C8OA 3CM6A 3MK6A 4EP5A 4LFCK 2HOEA 3KD5E 1IBLK 2G8KA 4UY8O 4GV3A 3U6FA 5BRFA 3CQYA 5LY3A 1MWMA 1VRTA 2A1SA 3TAPA 4OLAA 4NB4A 2P9KA 3ZSWA 4CZMA 4EP4A 3LL3A 3KHYA 1NGHA 5TKWA 4KREA 3L3UA 2GWKA 1HNIA 1WLJA 3ZSZA 4CJ4A 3HBTA 4KI4A 3O8MA 4FL9A 1RBTA 4KTZA 4FVMA 4CI6A 3R9PA 1RBSA 4CJSA 5F0XA 1RTHA 4DSLA 2HHHK 3E9OA 4LF6K 4HCCA 1HYZA 3L8BA 2XY6A 4N76A 4JHDA 3MCPA 4EHUA 5LJVA 1S3XA 4FLYA 1BO5O 3HPHA 4FLUA 3SAGA 4X64K 1RGIA 3M5RA 3CG7A 4H5RA 4IOXA 5CYMA 4ID5A 3CJ9A 2I5JA 3DJCA 1ZC6A 4DV3K 5AFUH 3NMUA 5AQJA 3U8XA 1U6ZA 3O6WA 1HKGA 3I55N 3EN9A 4BRDA 2BUPA 2HNZA 5C12A 1NGAA 4KI6A 3O5BA 4F8RA 4W5QA 4DSEA 3DOLA 4HUEA 3K9KA 4FPAA 3O9QA 3TPQA 4BRNA 1TAUA 2E1YA 2FF6A 3H08A 3VEZA 1JCFA 3PUFA 3CCRN 4OPHA 3LDNA 4X62K 3HZ6A 4DR3K 2AP1A 3TAEA 3ZCMA 3ENBA 3DXMB 3C95A 1L3UA 4YOVA 4DMNA 4CJTA 4Z4HA 1K8AO 2UUBK 2Q2RA 3MAQA 3EL2A 3VQ4A 4BWMA 1EP4A 1IV0A 4DTRA 4BGAA 3QEIA 1C0UA 5C25A 3VF2A 2HHVA 3AAPA 5AQMA 3RMDA 2PYLA 2DY4A 3RSEA 5EVZA 3C6UA 2GBZA 4E1JA 1G99A 4CZFA 3AVBA 3VF6A 4EIAA 5C15A 3G4SN 4PL7A 4FJGA 4CHYA 4DTSA 1QSYA 1BIUA 4CIEA 1CXUA 3RVCA 3SK3A 3PLAA 3OYDA 1RT7A 4JD2B 2GELA 3ZSQA 4BRCA 3THWB 3LZJA 4CZJA 1VSEA 3QNNA 4GMJB 4DSIA 3OA9A 3SMSA 5BN9A 4WQ4C 1KAYA 1SKWA 1ZBSA 3H3OB 1NK5A 2IOCA 2QA4N 3CD6N 1BOTO 2ZJQL 3PV8A 1U45A 3CJ7A 4BDZA 4BC2A 2ZJPL 5GAGP 4Z94A 3EE8A 4RCHA 5BN8A 4C1NK 3BF3A 3SCXA 1OH6A 1T7PA 5AQYA 3DLLL 3KLFA 2Y1JA 2HBMA 1SQKA 4ELTA 2HHXA 3D45A 4C8LA 2O8CA 1NK6A 4KBOA 2P9NA 3ENHA 5BREA 4JKCA 2YX6A 3E9PA 2NRWA 3O80A 2DTUA 1QSLA 2G8VA 1WSEA 3LDSA 3AVAA 1OH7A 5CZ2A 4DSFA 1BDGA 4DTMA 4LY7A 4EZ6A 4CHZA 2Z1IA 1VQMN 4GKKK 1VQON 4BG8A 2YHBA 1QQOA 1T3VA 3ZEUB 1LV5A 3EYZA 3QFPA 2GV9A 3OS0A 4NCBA 2OPPA 3OTOK 3KWGA 4DKWA 2AJQA 4CFAA 4BWJA 3VA3A 4C8MA 2FXUA 4EAHD 2P9PB 2NUBA 1GLFO 1W2BM 2UUAK 1XNRK 4CZLA 1DT9A 1YVUA 2X78A 4BRFA 1IKWA 3QBWA 3I8BA 1EQYA 5F2RA 1GLBG 1KQSM 5I9EB 1NKBA 4JK8A 1RT3A 1K9MO 3AV9A 1LAVA 1JLGA 2YHXA 1X9WA 1VQLN 3SI6A 3C94A 5AQXA 1KFDA 3DM2A 3AO3A 1WSGA 3SQ0A 3OHRA 4A57A 4BREA 1NGBA 5DM7L 1VQKN 3KK1A 4DS4A 5HL7L 3J7ZO 3NDKA 3QEVA 4EHTA 2Z1GA 3HTVA 1EKEA 1Z25A 3SYZA 3DI6A 4CZEA 2GX9A 4N41A 1HNWK 3G25A 4IWVA 1DGKN 5FLXO 1SZ2A 3RR7A 4QS8A 5GAHP 3OYCA 1DTTA 4R79A 1HYVA 4CZGA 1RDDA 4CERA 1XMQK 1I94K 3IRXA 5TKYA 4ISGA 2V52B 4E3SA 1Q18A 2IAJA 3CQ8A 3VOVA 2VWJA 3QFUA 4M3TA 1BL3A 3D2FA 4LH5A 2O8BB 5M1QA 4PKIA 3G0ZA 3SPYA 4H4OA 2HHTA 2VQFK 3KVGA 3HK2A 3A2FA 1FXXA 4J8FA 3ZT2A 1XHXA 2NLXA 3CCEN 3MN5A 4FJ8A 4OX9K 3SUNA 1BU6O 3CETA 4FWKA 3S41A 2HVIA 4M45A 1NJZA 3PSIA 1QSSA 3VQDA 1LWEA 4I7FA 3H6EA 4IJAA 1TV6A 2DFEA 1XI1A 1N33K 4RW4A 4BG9A 3M8QA 4BRGA 3OYFA 5BR8K 4Z4FA 4CK2A 3BP8A 2NRRA 1WBDA 3KK3A 3QMLA 3L3VA 4DFMA 4A2BA 3TTCA 2HBKA 4OKKA 2RE2A 4JI6K 3KJVA 3FLCO 2O8FB 1JCEA 4PUOA 4DFKA 3FZMA 1Q82O 4DV0K 1EX4A 5KTQA 4JK9A 2I7PA 4IFYA 3LAKA 4JRPA 3ZYYX 3MN6A 3L2QA 5BPLA 1VSFA 2YNHA 3VQ9A 1WN7A 2UYTA 2WONA 3R8EA 4BQZA 2E1ZA 4A5BA 2HW3A 1BWFO 2A1RA 4BY9C 3JSMA 5BR9A 1IKVA 4LSNA 3WQTA 1X9SA 1KVAA 4FM1A 2HMIA 4CEAA 3O9UA 3VENA 4RG8A 4YOWA 1YUWA 1RTJA 4B1UB 2HF4A 3HSCA 4B9NA 1WAJA 3F5TA 3O4NA 4Z4GA 5DM6L 4E0DA 2VGNA 3L2RA 2O8EB 1WOQA 1RNHA 3UKRB 2PYJA 3OW2M 4O5FA 1DLOA 4B08A 5FPMA 3O3GA 1NGGA 3TWHA 4KTWA 4ELUA 4AHVA 4DR2K 4JKEA 3IS9A 5HLFA 1CZAN 4PA1A 3K5OA 4I6MB 4CJVA 5KQ8A 3GG4A 4IO9L 4B9MA 2NZTA 3ULEB 1QVFM 3LP1A 1HNZK 3DLRA 2W41A 1RCHA 3KK7A 4NLBA 3J8AA 2X74A 4KO0A 1RILA 3WXLA 5LMNK 3CJCA 4JKGA 4G9ZA 1S1VA 2PBDA 3P83D 3DLEA 4FJIA 4FW1A 4DLEA 2PAVA 2E2PA 1E3MA 2RHKA 3FE1A 4H0TB 1HJOA 1OKJA 1N6QA 1Y64A 1NGJA 3EZ5A 4DV5K 1WSHA 1XMOK 3SBTA 3WNGA 1D9DA 1JJ2M 2UXDK 3F9MA 3M3ZA 3CYMA 3K59A 3SPZA 3FR0A 2OANA 4A61A 3OS2A 4DB3A 3KD1E 1K73O 4Q0BA 5AQRA 5AQSA 3LM9A 3SBGA 2NNWA 3VQPA 4J2AA 2JWLA 3O9RA 4MQ3A 4JI2K 3MN7A 4CGIA 4PWDA 4E1MA 4KH5A 3CC4N 1BG3A 4E19A 4KB1A 2NRVA 4FJ5A 4GVEA 1NU0A 5FPEA 4AF1A 3HPOA 1ESVA 3TAMA 3IMXA 1BIZA 3OYIA 1IBKK 3OYAA 4OJRA 3CCVN 2IGIA 1F21A 4JK7A 3OYNA 3TSUA 2Q36A 2HF3A 5J2NA 4FVUA 3B8AX 3QEXA 5EOYA 4FXDA 2V51B 4K0KK 1TYQA 1RT6A 2NRTA 4WF9L 5AQTA 4CK3A 3DXKA 3WT0A 4FOIA 1DKGD 4B9QA 3NHGA 3SZ2A 3G71N 4FLZA 3V1RA 4IEEA 4FJKA 3T69A 1QQNA 2E2NA 4CFDA 3MDQA 1I3AA 1JLEA 4IFVA 4CIGA 4ZHRA 2WFBA 1BQMA 1NLVA 3L6QA 2XRIA 1H1VA 3VQEA 4BRAA 1NM1A 5KQDA 1A5VA 3MX5A 1P8ZA 3QICA 4KH6A 4B8CA 4IDHA 5DK5A 2ZGYA 2A3ZA 2BGGA 1QZ5A 5HBMA 4H0PA 2YCHA 4LSLA 1Q9XA 1KXPA 4DQIA 4BC5A 3TAFA 3FZHA 2OZSA 1J5EK
chains in the Genus database with same CATH topology
4NXMK 1IBLK 4JI1K 1N32K 1HNXK 3JAMO 4B3SK 4YHHK 4JI5K 4JI3K 4LF4K 1FJGK 2UXBK 4LFAK 1HNWK 4DR7K 5FLXO 4DV1K 4JI2K 4JYAK 4B3MK 5IT9O 4B3TK 5A2QO 1I94K 1XMQK 4JI8K 3J80O 2HHHK 4LF6K 2F4VK 4CVNE 1IBMK 4CW7B 4JI7K 1N34K 4AQYK 1IBKK 4X64K 2VQFK 4DR2K 5IWAK 4JI0K 4DV4K 4JI4K 1HR0K 4DV3K 4LF9K 4YY3K 4OX9K 4NXNK 4K0KK 1HNZK 2UXCK 4DUZK 4DV2K 4GKJK 5LL6Z 4LFBK 2UUCK 4LF8K 3J7AP 4DUYK 4GKKK 4B3RK 1XNQK 1N33K 4JV5K 4X62K 5BR8K 4DR3K 3J81O 2ZM6K 4X65K 5AJ3K 5LMNK 4DR1K 4DR5K 3OTOK 2UUBK 4JI6K 4KHPK 3T1HK 2VQEK 2UUAK 4DR4K 4V19S 2UU9K 1XNRK 1N36K 4X66K 3T1YK 4DV0K 4DR6K 4DV5K 1XMOK 4DV6K 5LMUK 4LF7K 4LF5K 4DV7K 2UXDK 2E5LK 3J7YP 4LFCK 1J5EK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXM K;  1IBL K;  4JI1 K;  1N32 K;  1HNX K;  3JAM O;  4B3S K;  4YHH K;  4JI5 K;  4JI3 K;  4LF4 K;  1FJG K;  2UXB K;  4LFA K;  1HNW K;  4DR7 K;  5FLX O;  4DV1 K;  4JI2 K;  4JYA K;  4B3M K;  5IT9 O;  4B3T K;  5A2Q O;  1I94 K;  1XMQ K;  4JI8 K;  3J80 O;  2HHH K;  4LF6 K;  2F4V K;  4CVN E;  1IBM K;  4CW7 B;  4JI7 K;  1N34 K;  4AQY K;  1IBK K;  4X64 K;  2VQF K;  4DR2 K;  5IWA K;  4JI0 K;  4DV4 K;  4JI4 K;  1HR0 K;  4DV3 K;  4LF9 K;  4YY3 K;  4OX9 K;  4NXN K;  4K0K K;  1HNZ K;  2UXC K;  4DUZ K;  4DV2 K;  4GKJ K;  5LL6 Z;  4LFB K;  2UUC K;  4LF8 K;  3J7A P;  4DUY K;  4GKK K;  4B3R K;  1XNQ K;  1N33 K;  4JV5 K;  4X62 K;  5BR8 K;  4DR3 K;  3J81 O;  2ZM6 K;  4X65 K;  5AJ3 K;  5LMN K;  4DR1 K;  4DR5 K;  3OTO K;  2UUB K;  4JI6 K;  4KHP K;  3T1H K;  2VQE K;  2UUA K;  4DR4 K;  4V19 S;  2UU9 K;  1XNR K;  1N36 K;  4X66 K;  3T1Y K;  4DV0 K;  4DR6 K;  4DV5 K;  1XMO K;  4DV6 K;  5LMU K;  4LF7 K;  4LF5 K;  4DV7 K;  2UXD K;  2E5L K;  3J7Y P;  4LFC K;  1J5E K; 
#chains in the Genus database with same CATH topology
 3PIP L;  3R3L A;  3EEQ A;  2HMP A;  4F4K A;  1QE1 A;  4B9T A;  2F9W A;  2FSJ A;  5JS1 A;  4AIL C;  3ZX0 A;  3V9W A;  1KRP A;  4A2A A;  4CHO A;  3JYT A;  4LF4 K;  3VGK A;  1IO2 A;  1X9J A;  4FZZ A;  4BGB A;  4M3W A;  1VSJ A;  1P90 A;  1C0F A;  2E20 A;  4FJN A;  4C23 A;  4DTO A;  5A2Q O;  2YHW A;  4JKA A;  1VSD A;  3ZLJ A;  2ITG A;  1W7A A;  2CGL A;  2DFF A;  4YOU A;  1VSH A;  4F3T A;  4CJ5 A;  1LWC A;  4U7B A;  2X6S A;  2G8U A;  3EKS A;  2ZWH A;  1HJR A;  2QEX N;  4FJ7 A;  3R1X A;  1QHT A;  5AQK A;  3SJJ A;  3VQQ A;  1UAX A;  1DEJ A;  4ILJ A;  4CE9 A;  4PL8 A;  2OPQ A;  1L3T A;  4JI0 K;  1T6C A;  2FBX A;  5M1K A;  1NK4 A;  1Z05 A;  3W3D A;  3WEE B;  2W42 A;  3V1O A;  2EX3 A;  4CJK A;  1UOC A;  3O3H A;  3RRG A;  5AQI A;  3K58 A;  3P39 A;  1TL3 A;  4FWN A;  1GLC G;  1MDU B;  5AQL A;  3S3N A;  2CH6 A;  4WQ5 A;  3V1Q A;  5M1N A;  2A41 A;  4FOE A;  2VGM A;  3RSE B;  4K42 A;  4E89 A;  1RDW X;  2ITM A;  1NKC A;  2VQE K;  3V9X A;  3V81 A;  2Y1I A;  3FZF A;  3AVL A;  3MWP A;  1SAZ A;  2LSN A;  1W0H A;  5J1E A;  3RTV A;  2ZF5 O;  4JLH A;  3T1Y K;  3D2F B;  3B6P A;  3S3O A;  1LWF A;  2HHS A;  5AQG A;  1BI4 A;  1X9M A;  4WFB L;  3THY A;  3VEV A;  2KTQ A;  2RKI A;  3CC7 N;  4LF7 K;  2G8W A;  4IOC L;  3WUH A;  1HKC A;  2P9N B;  3M6G A;  4DV7 K;  1SKR A;  1D9F A;  1QQM A;  4XH1 A;  4QS7 A;  3FZL A;  1GLL O;  2YV0 X;  1K6Y A;  3MXJ A;  3T19 A;  4B3S K;  2P9L A;  3H45 C;  1XWL A;  4FSV A;  3BY5 A;  3HVT A;  1JXE A;  4PQU A;  3PX6 A;  1Z26 A;  4YDU A;  3NAE A;  3QIO A;  4M41 A;  2P5O A;  5CYQ A;  4H0Y B;  1C0T A;  4B3M K;  5IT9 O;  3RWU A;  4FLT A;  4CGG A;  3IKM A;  1RTI A;  1TKD A;  3HST B;  3C65 A;  2G8I A;  3HRG A;  3GOI A;  2HB5 A;  4OPK A;  5BRD A;  1C0G A;  4DTN A;  3E1Y A;  4JI7 K;  4O8K A;  3VEY A;  1YAG A;  2E2Q A;  3LWM A;  1S5J A;  1NG9 A;  3LPT A;  3SQ2 A;  2KQ2 A;  2O8D A;  1YXQ A;  4JI4 K;  1ASW A;  3V9U A;  4LF9 K;  4YY3 K;  3HVR A;  1KSP A;  3W0L A;  1BQN A;  3TTF A;  4DTU A;  1X1P A;  3VET A;  3AGR A;  4BE2 A;  4HUF A;  3G10 A;  3J7A P;  2IIR A;  2E8A A;  1LOT B;  1NMN A;  1EWQ A;  5AQO A;  2QTD A;  3DYA A;  3OYH A;  3S9H A;  3F9K A;  4DU3 A;  3NGY A;  1ZBH A;  2HBJ A;  4DQR A;  1FW6 A;  3AVK A;  4MLH A;  1JLF A;  3CCL N;  4B3O A;  3ATU A;  3O9T A;  3KKS A;  3TAG A;  4LD0 A;  1RBV A;  2D0P A;  3WNF A;  4E7J A;  1WB9 A;  3ID6 A;  1KVC A;  2HND A;  3I33 A;  4Z0U A;  3WXM B;  4BVO A;  5JIC A;  1ZBF A;  3CCQ N;  1HLU A;  2A42 A;  2QWN A;  1TK0 A;  1TK5 A;  2JWK A;  1E4G T;  4CEB A;  3MED A;  4PKG A;  4JS4 A;  4FCY A;  4CJ3 A;  4DTX A;  3AVC A;  3H3N O;  3A0I X;  4JI5 K;  2WBN A;  1WSJ A;  4N5S A;  1EO1 A;  2NRH A;  1HPZ A;  5ADX A;  2R7Y A;  4PHT X;  4CCH A;  4KRF A;  1XC9 A;  3O9S A;  1NGI A;  4JAX A;  1TKX A;  2E88 A;  4MDB A;  5CR4 A;  4EFH A;  3T3F A;  3CQX A;  4Y1D A;  1TKZ A;  2ZJR L;  3N4Q A;  1O1W A;  3A8Y A;  5HP1 A;  4C1N I;  2XO7 A;  3HP6 A;  2QWO A;  4Y0W A;  4Q5V A;  4GW6 A;  4WYB A;  4B9S A;  5JLF A;  2YKN A;  1SS6 A;  3VTI A;  2Z1H A;  3IFR A;  4K41 A;  2UXC K;  2O8C B;  1S9E A;  3K2P A;  3CMA N;  5C0Y A;  3NH0 A;  4KB0 A;  2NRX A;  4MO4 A;  3QER A;  1BCM A;  3QNO A;  4CJF A;  2QI2 A;  4B1W B;  4PY5 A;  4ZTF A;  4OKJ A;  1KCF A;  2ASP A;  3NF6 A;  3HM8 A;  3C6A A;  1WNS A;  1KAX A;  2YHY A;  5AJ3 K;  5HRS A;  3L2V A;  2G8H A;  3AA5 X;  4HHT A;  1M1K O;  4O8U A;  4DG1 A;  1M90 O;  3AY9 A;  4KHU A;  2ZD1 A;  3OY9 A;  1B9D A;  1RDC A;  1WSI A;  4CZH A;  1VQ6 N;  4H5W A;  3TSQ A;  2RF2 A;  2FBY A;  3NF8 A;  3P1G A;  5FRM A;  4BDP A;  1XQS C;  5F1X A;  4NO7 A;  4AHT A;  1IH7 A;  4I2Q A;  1BA1 A;  3LM2 A;  2KHO A;  3O3F A;  1NBW A;  4OGC A;  4OVL A;  1VK0 A;  4JKH A;  1VQN N;  3KZB A;  3VQA A;  1OH5 A;  3BZK A;  4JI1 K;  4ILG B;  1N32 K;  5GIO A;  4CES A;  1TL1 A;  4ISF A;  4AM7 A;  3QES A;  3PO5 A;  4CF8 A;  3B6O A;  3DRS A;  3QET A;  3FZK A;  1NJI O;  3OYK A;  3U9D A;  4CED A;  3AVI A;  1TGO A;  3MEC A;  5BPM A;  4AHC A;  2FBV A;  3WQU A;  3ZET A;  4FLX A;  5KRT A;  4FPB A;  1ITG A;  2H3G X;  3WNE A;  4M3X A;  2F9T A;  4IZ9 A;  3K57 A;  1T8E A;  4JN4 A;  3LZI A;  3HP9 A;  3P38 A;  5AR0 A;  3ISN C;  5E26 A;  2PY5 A;  3CC2 N;  1U2V B;  4WQ5 C;  4FWS A;  1EXQ A;  1IBM K;  4K25 A;  3LDO A;  3O4Q A;  4F9O A;  3V9S A;  1Q7Y O;  5C10 A;  3CPE A;  3VQB A;  4N47 A;  3KLH A;  4WE1 A;  4DV4 K;  3ZT3 A;  1D8Y A;  3LWL A;  4JS5 A;  1Q9Y A;  2JGU A;  1S1U A;  5CHI A;  3QIP A;  3VEX A;  2CH5 A;  5J2Q A;  4CZI A;  3PX4 A;  4KHN A;  4ILH A;  5I42 A;  4B1Y B;  1HUX A;  4IXC A;  4JV5 K;  1J9A A;  2BH1 A;  1VQ9 N;  1BUP A;  4H5N A;  4DR1 K;  2EWS A;  3HT3 A;  4IBN A;  3G6E N;  4FWQ A;  3NE6 A;  5AZJ B;  1YJW N;  3AVH A;  4TSX A;  4NCG A;  3HM9 A;  4BRL A;  3SAH A;  4CGH A;  4OLB A;  3CI5 A;  1NOY A;  2D0O A;  5J2M A;  4FM2 A;  1R59 O;  3ZSO A;  2ASM A;  3LAN A;  1ZXO A;  1G15 A;  1BHL A;  1ZBL A;  4WCE L;  1LAW A;  3J7Y P;  3D0P A;  2DFH A;  2D0C A;  4A59 A;  3P31 A;  4M3Y A;  3CHW A;  3NF9 A;  3U3Y A;  3OJS A;  3BF1 A;  4CEO A;  2JLE A;  4YHH K;  3OYB A;  2UXB K;  5JVG L;  1WSF A;  3SUO A;  2ZQB A;  5BRH A;  5E41 A;  1TAQ A;  4HTL A;  4K43 A;  5AQV A;  1ATR A;  1NGF A;  1S1X A;  1JL1 A;  2Q0R A;  4RW6 A;  3ZSR A;  2A6A A;  3H1Q A;  3DLG A;  1LCU A;  4F2R A;  3NVK A;  3O4W A;  4CGJ A;  2Q97 A;  3J80 O;  5EY4 A;  1IKY A;  3MWT A;  4CVN E;  3EE9 A;  2GWJ A;  4CW7 B;  4FJL A;  2OPR A;  1S1W A;  2D4W A;  4CEE A;  1JL2 A;  1CXQ A;  2Z1J A;  3KTQ A;  2OZM A;  3RMB A;  2B6A A;  2VG7 A;  3DMJ A;  2CGJ A;  3AVF A;  3ENO A;  1ZYQ A;  3NH1 A;  1WBB A;  1NJX A;  1HYS A;  3CME N;  5LL6 Z;  2YNG A;  3LP3 A;  5AQZ A;  4FO0 A;  3VER A;  1YTU A;  4O4G A;  1HRH A;  4DUY K;  3U4L A;  3CJB A;  2P9P A;  4BR9 A;  4CEF A;  4DS5 A;  1QVG M;  4O55 A;  5DMR A;  1A5X A;  2KKZ A;  2IC3 A;  5AQU A;  4FJH A;  2Q3S A;  3ULE A;  3KIO A;  4BRP A;  1GLA G;  4G1Q A;  4H0V B;  3NF7 A;  4BRK A;  5BPN A;  4BR4 A;  5CE3 A;  4DR4 K;  1HKB A;  2AA4 A;  2YJE A;  1L5U A;  3TU5 A;  3ZT0 A;  2WUS A;  1KD1 O;  2BAN A;  4CHN A;  4WFN L;  1ZBI A;  3ZT4 A;  3F73 A;  2BDP A;  2FBT A;  3DLB A;  1U49 A;  5AQP A;  3BZC A;  2FC0 A;  3VEO A;  3MEG A;  1X3N A;  2VG6 A;  3L4Q A;  3VES A;  4M3R A;  3BDP A;  4B8A B;  5M1P A;  4BC3 A;  3AA4 A;  4CK1 A;  3QLH A;  3NGZ A;  5KRS A;  4B9V A;  4NCA A;  3NVM A;  2E5L K;  4CJW A;  1YJN N;  1VSK A;  2O8D B;  3AA3 A;  1NNE A;  3QBX A;  4XEI A;  1HNX K;  4BR2 A;  1NOZ A;  3DXK B;  4B1V A;  3GL1 A;  3LP2 A;  4KPY A;  5CY4 A;  3TI0 A;  3AAQ A;  3OYE A;  3HPG A;  3ID8 A;  3THX B;  4LC9 B;  1KC8 O;  4HCB A;  1BCO A;  1K8K A;  4YOY A;  2F8T A;  3CCJ N;  1N8R O;  2Q31 A;  2QWR A;  1Q8I A;  4BRM A;  1U2V A;  3WXK A;  4IG0 A;  2P9U B;  3PX0 A;  1VQ4 N;  1JCG A;  1YTA A;  3AO4 A;  4NYN A;  5FDL A;  1B9F A;  5GIN A;  5I3U A;  3PSF A;  4KHW A;  2E6M A;  3D6R A;  2D0A A;  3A5L C;  4DQ8 A;  4OPA A;  4FJM A;  4BRH A;  3LDL A;  3I56 N;  1V4S A;  3AAR A;  4DWI A;  3OYG A;  4FK4 A;  1RDA A;  3MN9 A;  5GIP A;  3VQ8 A;  3DAW A;  4CF1 A;  4CFB A;  3SAF A;  5AZI A;  5KPZ A;  3K5L A;  3L0Q A;  4DUZ K;  4FYD A;  4DV2 K;  1GOA A;  5ADX H;  4GKJ K;  5D3G A;  4IEI A;  4DF8 A;  1J6Z A;  1C1B A;  1U4B A;  4LF8 K;  4JNE A;  4CF0 A;  5HOO A;  4JD2 A;  3M8R A;  4DTJ A;  3ASM A;  3ZX2 A;  2WTU A;  3ULD A;  4B9U A;  3KLI A;  1CZ9 A;  4X65 K;  4BAC A;  2P9I A;  3AGK A;  5AZJ A;  3SUP A;  4E7L A;  1HPM A;  4FWO A;  3OYM A;  3DXM A;  1TUY A;  3CFP A;  3T1H K;  2NRZ A;  3LAM A;  3TAQ A;  3MCA B;  3M8S A;  2OTL N;  3P4I A;  4O0J A;  4BQL A;  3CIP A;  1ILY A;  2O4I A;  1S1T A;  2D0B A;  5FRN A;  4X66 K;  2GUP A;  3UE5 A;  1RDU A;  1NK7 A;  3THV A;  4Y1C A;  4FWR A;  5KPT A;  1GLD G;  3C0B A;  2KLA A;  1QQC A;  2QWQ A;  3A5O C;  4GV6 A;  4O44 A;  5ELZ A;  2HNY A;  4Z4E A;  1QHA A;  4E1N A;  1U04 A;  3SQ1 A;  1K8K B;  1OH8 A;  1FKP A;  5B8H A;  4H5T A;  2ASO A;  3MMV A;  1Y97 A;  4FZX C;  4RW7 A;  3OJU A;  3CER A;  4JHD B;  4K8Z A;  3VF4 A;  4DV1 K;  1XUP O;  2EHG A;  4JYA K;  4YOT A;  2QKB A;  4ISE A;  4CGD A;  4RW9 A;  1VSL A;  2I7N A;  2P9K B;  1JXB A;  4CIF A;  1A5W A;  4W5N A;  4JKB A;  4YOR A;  1S9G A;  3LDQ A;  1BI4 B;  1J54 A;  5AZI B;  2P9U A;  4AHU A;  2FSK A;  2KZM A;  3I0R A;  1KLN A;  3MX2 A;  1C1A A;  4B1Z A;  1RBU A;  5SZT A;  4HWI A;  2O8E A;  2OTJ N;  5AQH A;  4Z4I A;  4JKF A;  3VGM A;  3K5M A;  1KAZ A;  3AVN A;  2CGK A;  3AVG A;  3JXU A;  4EZ9 A;  5HRR A;  1GLE G;  1NK0 A;  1IG8 A;  4CJ7 A;  4O5B A;  3VMF B;  1FKO A;  4LFB K;  1KFS A;  2UUC K;  4KKO A;  1IKX A;  4F2S A;  4YOX A;  2W6K A;  2B5J A;  2RPI A;  3O1W A;  5K14 A;  1C6V A;  4BRQ A;  3WEE A;  3J81 O;  1BA0 A;  4OGE A;  3RR8 A;  3VQ5 A;  3AO1 A;  5FPD A;  4DFP A;  4WQ4 A;  1YIT N;  2QK9 A;  4DR5 K;  4BC4 A;  1DTQ A;  3D2E B;  4RWT A;  4R5P A;  4XH5 A;  2IDO A;  1NJW A;  5JMV A;  1VSI A;  3NFA A;  5AQN A;  3SV4 A;  5EXW A;  1YF5 L;  4M7X A;  4KTQ A;  4E7K A;  1VRU A;  4WFA L;  2J4R A;  4M7Y A;  4DHY A;  1YT3 A;  2ZGZ A;  2KZZ A;  4XH4 A;  3OBY A;  2YKM A;  1RT2 A;  2VWB A;  3QDK A;  2ATQ A;  3TTD A;  3CCU N;  2YJF A;  1TK8 A;  1UA1 A;  3HOS A;  2ETJ A;  1NK9 A;  4NLC A;  3QEP A;  1RBR A;  4H8K A;  4AM6 A;  5JLH A;  3O1B A;  4H0X B;  4ID1 A;  1QZ6 A;  2QKK A;  4FZY A;  2W40 A;  3JS6 A;  4JI3 K;  2Q0U A;  1FJG K;  1MA9 B;  3E01 A;  3HXM A;  3TAN A;  3VN5 A;  4A5A A;  2WC9 A;  3CCS N;  1NGE A;  1SKS A;  3EO3 A;  2OPS A;  3SNN A;  4BE0 A;  5HRO A;  4DSJ A;  3SMP A;  3CM5 A;  1KVB A;  4OPJ A;  3UKU A;  4LH4 A;  3TAR A;  3FFI A;  3VTH A;  1RFQ A;  1VQ5 N;  3WXJ A;  5AFU A;  2IVP A;  4FW2 A;  4KFB A;  1EET A;  3VGL A;  3VQ6 A;  2FSN A;  4QCL A;  5T7B A;  4RW8 A;  5C2D A;  3HYF A;  2Q1N A;  3OYL A;  1LW2 A;  4DCH A;  4MDA A;  3ZSV A;  1S6P A;  1V4T A;  3KK2 A;  3M8P A;  3H46 O;  4NXN K;  2A5X A;  4CJP A;  3VA0 A;  4FLV A;  1NGC A;  2BTF A;  3PO4 A;  4CFC A;  3MEE A;  3NBP A;  4M63 C;  1JLQ A;  1VSM A;  5M1O A;  4FK2 A;  1RT1 A;  2WOM A;  3OBW A;  1HQE A;  5J2P A;  1TYQ B;  3V6D A;  1KTQ A;  1EWR A;  3KLE A;  1SV5 A;  3RRH A;  3O08 A;  1YHQ N;  4OKE A;  5SWM A;  4I9Q A;  2QW9 A;  1ATN A;  4UQG A;  2HST A;  4KHP K;  3LDP A;  5FRO A;  3SQ4 A;  3PY8 A;  1ASV A;  3KLG A;  1GOB A;  1ASU A;  2D1K A;  1S72 N;  1N36 K;  1TVR A;  3ATV A;  1JLA A;  2O8F A;  4DV6 K;  4Z4C A;  5LMU K;  5LJW A;  3ZSX A;  2V7Y A;  2FLO A;  1ZBU A;  3RMA A;  4N56 A;  4BR0 A;  1S22 A;  2O4G A;  2OA8 A;  4CGF A;  3CFR A;  2IVN A;  3GE1 A;  5AQW A;  4B9L A;  3JAM O;  4FWP A;  4BDY A;  1J5O A;  5MLC Q;  4AH9 A;  3UIQ A;  1NWK A;  2HVH A;  4RTF D;  4KH4 A;  4M3Z A;  1N5Y A;  3CCM N;  3T1A A;  1NJY A;  2QWP A;  3ZX3 A;  3U9Z A;  1QS4 A;  4CHP A;  1SL1 A;  4KHY A;  2O8B A;  3K0S A;  1VQ8 N;  1HNV A;  4IFE A;  1SL0 A;  3L2W A;  3DLH A;  3R6M A;  2P9S A;  1CLQ A;  1YI2 N;  1D5A A;  4CZK A;  4DSK A;  4KAZ A;  4ICL A;  2F7T A;  5CZ1 A;  4IJN A;  3MXI A;  4FWM A;  1E4F T;  2F4V K;  4FJX A;  4I2P A;  1W97 L;  1X3M A;  3AO5 A;  3C6T A;  4H0O A;  3SJH A;  2HHW A;  3BEX A;  3FGU A;  3IG1 A;  4L3Q A;  2A40 A;  4FJ9 A;  3VQ7 A;  3ZSY A;  3NGI A;  5IWA K;  4FK0 A;  4KHS A;  3D2E A;  4QS9 A;  3PIO L;  4M3U A;  3M1F A;  4IOA L;  2PZS A;  4MLE A;  3FFK B;  4IO8 A;  4CEC A;  4U67 L;  3V9Z A;  3TR8 A;  5KI6 A;  3L2U A;  3VQC A;  1TUU A;  3CXC M;  4BR7 A;  4DU1 A;  2QXL A;  3THY B;  4K8X A;  1W9H A;  2HBL A;  3BUZ B;  4IDK A;  2P9L B;  4FM0 A;  3GDQ A;  4B3R K;  2VCP A;  1ATS A;  3AVJ A;  3Q7C A;  3UB5 A;  1HQU A;  1UA0 A;  3QEW A;  5AQF A;  2G8F A;  2RN2 A;  2YI1 A;  4GNI A;  1T03 A;  1NMD A;  2OCE A;  2F8S A;  1RT5 A;  2PFU A;  5HRN A;  3CFO A;  3OVN A;  3K9J A;  2HHQ A;  2OYQ A;  4V19 S;  2UU9 K;  1GOC A;  4MFB A;  3A5M C;  1L3V A;  4L8R B;  1JKH A;  3WXI A;  4CEZ A;  5GAE P;  3GBT A;  3S3M A;  1RT4 A;  3AO2 A;  2QWL A;  4CJQ A;  2IS3 A;  1VQP N;  3C7N A;  4BR5 A;  4DQP A;  1RDB A;  3LP0 A;  1SL2 A;  1XHZ A;  1WUA A;  3THX A;  3IDH A;  2XY7 A;  1HX1 A;  3CF5 L;  4W5R A;  2BE2 A;  1NGD A;  5KGX A;  4OO1 J;  4MO5 A;  2E2O A;  4JEP A;  3Q7B A;  4LFA K;  4DU4 A;  2P5G A;  3TAB A;  2KW4 A;  4DR7 K;  5EU7 A;  5M1F A;  1QTM A;  4CBX A;  1Q81 O;  4B3T K;  4M42 A;  3AA2 A;  4CD1 A;  4PKH A;  1OVQ A;  4JI8 K;  4W5O A;  3F2K A;  1T44 A;  3OS1 A;  4BRI A;  3THW A;  3QO9 A;  3K5N A;  3ZT1 A;  1S6Q A;  3DRR A;  2P51 A;  4FJJ A;  3UKR A;  4AHR A;  4F3O A;  2QWM A;  3L4I A;  1N34 K;  4CJL A;  4AQY K;  4BVP A;  1VAZ A;  4H03 B;  2F96 A;  3HOT A;  3ZEU A;  4AHS A;  2XY5 A;  3DWL A;  1HR0 K;  2VG5 A;  3NH2 A;  4DLG A;  2YNI A;  1NK8 A;  3C7N B;  3N4P A;  2YNF A;  4FWL A;  2VWK A;  3SV3 A;  4I6M A;  3BGR A;  5KGW A;  1U48 A;  1Z6R A;  4H4M A;  3C6H A;  1HMV A;  4HVJ A;  3WNH A;  3EKU A;  1FK9 A;  3LPU A;  5GAD P;  3NCI A;  3E66 A;  4CJE A;  1BIS A;  4A62 A;  1TKT A;  1XNQ K;  1C1C A;  1Q86 O;  4HUG A;  4C8N A;  1C0M A;  2D5R A;  2ZM6 K;  3OYJ A;  1SUQ A;  1KLM A;  3E9L A;  4NYF A;  4QOZ B;  1R0A A;  3T7Z A;  5KPR A;  4DQQ A;  3IUC A;  2QXF A;  4GY2 B;  4CF9 A;  4BE1 A;  4J2B A;  1J53 A;  2FF3 B;  3ITH A;  3KWI A;  5E84 A;  1MWK A;  4H5V A;  2DPN A;  3LAL A;  2P9S B;  3DOK A;  3CPW M;  4IG3 A;  3H1V X;  2P1J A;  4W5T A;  4CEQ A;  4C8K A;  4DFJ A;  2W6L A;  1MU2 A;  4CBW A;  4CJR A;  4I9L A;  1REV A;  3HI0 A;  2B4J A;  4NXM K;  1D4X A;  3EY1 A;  3HO1 A;  3HJF A;  4E7H A;  2VYP A;  1CZB A;  3A5N C;  4GVM A;  3AVM A;  3IAY A;  4IKF A;  2YHA A;  1GLJ O;  1YVN A;  3V4I A;  1T05 A;  5JVH L;  4YDU C;  2KFZ A;  4E7I A;  4J2D A;  4B1X B;  1I39 A;  5JS2 A;  4GV9 A;  4O0I A;  1VQ7 N;  3UKU B;  2GTD A;  2P9I B;  3CJA A;  3MXM A;  1BGX T;  1L3S A;  4ZTJ A;  4CF2 A;  3SUQ A;  1NKE A;  1U47 A;  3VPZ A;  3SLC A;  4CD3 A;  3TSP A;  1XC3 A;  5FPN A;  5C2F A;  4HTU A;  3I0S A;  5C42 A;  3VEW A;  4JRQ A;  2X6N A;  3QB0 A;  2GUI A;  1UWB A;  2QM1 A;  1YJ9 N;  4BRO A;  1RTD A;  4CHQ A;  4KV8 A;  3HL8 A;  2E6L A;  1OVY A;  4QAG A;  4KHQ A;  4DQS A;  4XIU A;  2XHB A;  4DTP A;  4CJU A;  1B92 A;  1WAF A;  3ALY A;  1LW0 A;  5C24 A;  2E4L A;  4YNQ A;  3EZW A;  3DRP A;  5AQQ A;  2ZE2 A;  1IJJ A;  1O13 A;  1T6D A;  5EX5 A;  3I8D A;  2HHU A;  4JKG B;  4J2E A;  4YFU A;  2XY8 A;  5HRP A;  1JLC A;  1IG9 A;  3QIN A;  4CBU A;  1JLB A;  4JKD A;  3RMC A;  4FLW A;  3D7E O;  4DF4 A;  3CJ1 A;  2IVO A;  3U3G A;  5H1S Q;  2GEM A;  4DR6 K;  3DLK A;  3ZET B;  3P5J A;  1YIJ N;  1VHX A;  3KKR A;  4ELV A;  2KFN A;  2V7Z A;  4LF5 K;  4C8O A;  3CM6 A;  3MK6 A;  4EP5 A;  4LFC K;  2HOE A;  3KD5 E;  1IBL K;  2G8K A;  4UY8 O;  4GV3 A;  3U6F A;  5BRF A;  3CQY A;  5LY3 A;  1MWM A;  1VRT A;  2A1S A;  3TAP A;  4OLA A;  4NB4 A;  2P9K A;  3ZSW A;  4CZM A;  4EP4 A;  3LL3 A;  3KHY A;  1NGH A;  5TKW A;  4KRE A;  3L3U A;  2GWK A;  1HNI A;  1WLJ A;  3ZSZ A;  4CJ4 A;  3HBT A;  4KI4 A;  3O8M A;  4FL9 A;  1RBT A;  4KTZ A;  4FVM A;  4CI6 A;  3R9P A;  1RBS A;  4CJS A;  5F0X A;  1RTH A;  4DSL A;  2HHH K;  3E9O A;  4LF6 K;  4HCC A;  1HYZ A;  3L8B A;  2XY6 A;  4N76 A;  4JHD A;  3MCP A;  4EHU A;  5LJV A;  1S3X A;  4FLY A;  1BO5 O;  3HPH A;  4FLU A;  3SAG A;  4X64 K;  1RGI A;  3M5R A;  3CG7 A;  4H5R A;  4IOX A;  5CYM A;  4ID5 A;  3CJ9 A;  2I5J A;  3DJC A;  1ZC6 A;  4DV3 K;  5AFU H;  3NMU A;  5AQJ A;  3U8X A;  1U6Z A;  3O6W A;  1HKG A;  3I55 N;  3EN9 A;  4BRD A;  2BUP A;  2HNZ A;  5C12 A;  1NGA A;  4KI6 A;  3O5B A;  4F8R A;  4W5Q A;  4DSE A;  3DOL A;  4HUE A;  3K9K A;  4FPA A;  3O9Q A;  3TPQ A;  4BRN A;  1TAU A;  2E1Y A;  2FF6 A;  3H08 A;  3VEZ A;  1JCF A;  3PUF A;  3CCR N;  4OPH A;  3LDN A;  4X62 K;  3HZ6 A;  4DR3 K;  2AP1 A;  3TAE A;  3ZCM A;  3ENB A;  3DXM B;  3C95 A;  1L3U A;  4YOV A;  4DMN A;  4CJT A;  4Z4H A;  1K8A O;  2UUB K;  2Q2R A;  3MAQ A;  3EL2 A;  3VQ4 A;  4BWM A;  1EP4 A;  1IV0 A;  4DTR A;  4BGA A;  3QEI A;  1C0U A;  5C25 A;  3VF2 A;  2HHV A;  3AAP A;  5AQM A;  3RMD A;  2PYL A;  2DY4 A;  3RSE A;  5EVZ A;  3C6U A;  2GBZ A;  4E1J A;  1G99 A;  4CZF A;  3AVB A;  3VF6 A;  4EIA A;  5C15 A;  3G4S N;  4PL7 A;  4FJG A;  4CHY A;  4DTS A;  1QSY A;  1BIU A;  4CIE A;  1CXU A;  3RVC A;  3SK3 A;  3PLA A;  3OYD A;  1RT7 A;  4JD2 B;  2GEL A;  3ZSQ A;  4BRC A;  3THW B;  3LZJ A;  4CZJ A;  1VSE A;  3QNN A;  4GMJ B;  4DSI A;  3OA9 A;  3SMS A;  5BN9 A;  4WQ4 C;  1KAY A;  1SKW A;  1ZBS A;  3H3O B;  1NK5 A;  2IOC A;  2QA4 N;  3CD6 N;  1BOT O;  2ZJQ L;  3PV8 A;  1U45 A;  3CJ7 A;  4BDZ A;  4BC2 A;  2ZJP L;  5GAG P;  4Z94 A;  3EE8 A;  4RCH A;  5BN8 A;  4C1N K;  3BF3 A;  3SCX A;  1OH6 A;  1T7P A;  5AQY A;  3DLL L;  3KLF A;  2Y1J A;  2HBM A;  1SQK A;  4ELT A;  2HHX A;  3D45 A;  4C8L A;  2O8C A;  1NK6 A;  4KBO A;  2P9N A;  3ENH A;  5BRE A;  4JKC A;  2YX6 A;  3E9P A;  2NRW A;  3O80 A;  2DTU A;  1QSL A;  2G8V A;  1WSE A;  3LDS A;  3AVA A;  1OH7 A;  5CZ2 A;  4DSF A;  1BDG A;  4DTM A;  4LY7 A;  4EZ6 A;  4CHZ A;  2Z1I A;  1VQM N;  4GKK K;  1VQO N;  4BG8 A;  2YHB A;  1QQO A;  1T3V A;  3ZEU B;  1LV5 A;  3EYZ A;  3QFP A;  2GV9 A;  3OS0 A;  4NCB A;  2OPP A;  3OTO K;  3KWG A;  4DKW A;  2AJQ A;  4CFA A;  4BWJ A;  3VA3 A;  4C8M A;  2FXU A;  4EAH D;  2P9P B;  2NUB A;  1GLF O;  1W2B M;  2UUA K;  1XNR K;  4CZL A;  1DT9 A;  1YVU A;  2X78 A;  4BRF A;  1IKW A;  3QBW A;  3I8B A;  1EQY A;  5F2R A;  1GLB G;  1KQS M;  5I9E B;  1NKB A;  4JK8 A;  1RT3 A;  1K9M O;  3AV9 A;  1LAV A;  1JLG A;  2YHX A;  1X9W A;  1VQL N;  3SI6 A;  3C94 A;  5AQX A;  1KFD A;  3DM2 A;  3AO3 A;  1WSG A;  3SQ0 A;  3OHR A;  4A57 A;  4BRE A;  1NGB A;  5DM7 L;  1VQK N;  3KK1 A;  4DS4 A;  5HL7 L;  3J7Z O;  3NDK A;  3QEV A;  4EHT A;  2Z1G A;  3HTV A;  1EKE A;  1Z25 A;  3SYZ A;  3DI6 A;  4CZE A;  2GX9 A;  4N41 A;  1HNW K;  3G25 A;  4IWV A;  1DGK N;  5FLX O;  1SZ2 A;  3RR7 A;  4QS8 A;  5GAH P;  3OYC A;  1DTT A;  4R79 A;  1HYV A;  4CZG A;  1RDD A;  4CER A;  1XMQ K;  1I94 K;  3IRX A;  5TKY A;  4ISG A;  2V52 B;  4E3S A;  1Q18 A;  2IAJ A;  3CQ8 A;  3VOV A;  2VWJ A;  3QFU A;  4M3T A;  1BL3 A;  3D2F A;  4LH5 A;  2O8B B;  5M1Q A;  4PKI A;  3G0Z A;  3SPY A;  4H4O A;  2HHT A;  2VQF K;  3KVG A;  3HK2 A;  3A2F A;  1FXX A;  4J8F A;  3ZT2 A;  1XHX A;  2NLX A;  3CCE N;  3MN5 A;  4FJ8 A;  4OX9 K;  3SUN A;  1BU6 O;  3CET A;  4FWK A;  3S41 A;  2HVI A;  4M45 A;  1NJZ A;  3PSI A;  1QSS A;  3VQD A;  1LWE A;  4I7F A;  3H6E A;  4IJA A;  1TV6 A;  2DFE A;  1XI1 A;  1N33 K;  4RW4 A;  4BG9 A;  3M8Q A;  4BRG A;  3OYF A;  5BR8 K;  4Z4F A;  4CK2 A;  3BP8 A;  2NRR A;  1WBD A;  3KK3 A;  3QML A;  3L3V A;  4DFM A;  4A2B A;  3TTC A;  2HBK A;  4OKK A;  2RE2 A;  4JI6 K;  3KJV A;  3FLC O;  2O8F B;  1JCE A;  4PUO A;  4DFK A;  3FZM A;  1Q82 O;  4DV0 K;  1EX4 A;  5KTQ A;  4JK9 A;  2I7P A;  4IFY A;  3LAK A;  4JRP A;  3ZYY X;  3MN6 A;  3L2Q A;  5BPL A;  1VSF A;  2YNH A;  3VQ9 A;  1WN7 A;  2UYT A;  2WON A;  3R8E A;  4BQZ A;  2E1Z A;  4A5B A;  2HW3 A;  1BWF O;  2A1R A;  4BY9 C;  3JSM A;  5BR9 A;  1IKV A;  4LSN A;  3WQT A;  1X9S A;  1KVA A;  4FM1 A;  2HMI A;  4CEA A;  3O9U A;  3VEN A;  4RG8 A;  4YOW A;  1YUW A;  1RTJ A;  4B1U B;  2HF4 A;  3HSC A;  4B9N A;  1WAJ A;  3F5T A;  3O4N A;  4Z4G A;  5DM6 L;  4E0D A;  2VGN A;  3L2R A;  2O8E B;  1WOQ A;  1RNH A;  3UKR B;  2PYJ A;  3OW2 M;  4O5F A;  1DLO A;  4B08 A;  5FPM A;  3O3G A;  1NGG A;  3TWH A;  4KTW A;  4ELU A;  4AHV A;  4DR2 K;  4JKE A;  3IS9 A;  5HLF A;  1CZA N;  4PA1 A;  3K5O A;  4I6M B;  4CJV A;  5KQ8 A;  3GG4 A;  4IO9 L;  4B9M A;  2NZT A;  3ULE B;  1QVF M;  3LP1 A;  1HNZ K;  3DLR A;  2W41 A;  1RCH A;  3KK7 A;  4NLB A;  3J8A A;  2X74 A;  4KO0 A;  1RIL A;  3WXL A;  5LMN K;  3CJC A;  4JKG A;  4G9Z A;  1S1V A;  2PBD A;  3P83 D;  3DLE A;  4FJI A;  4FW1 A;  4DLE A;  2PAV A;  2E2P A;  1E3M A;  2RHK A;  3FE1 A;  4H0T B;  1HJO A;  1OKJ A;  1N6Q A;  1Y64 A;  1NGJ A;  3EZ5 A;  4DV5 K;  1WSH A;  1XMO K;  3SBT A;  3WNG A;  1D9D A;  1JJ2 M;  2UXD K;  3F9M A;  3M3Z A;  3CYM A;  3K59 A;  3SPZ A;  3FR0 A;  2OAN A;  4A61 A;  3OS2 A;  4DB3 A;  3KD1 E;  1K73 O;  4Q0B A;  5AQR A;  5AQS A;  3LM9 A;  3SBG A;  2NNW A;  3VQP A;  4J2A A;  2JWL A;  3O9R A;  4MQ3 A;  4JI2 K;  3MN7 A;  4CGI A;  4PWD A;  4E1M A;  4KH5 A;  3CC4 N;  1BG3 A;  4E19 A;  4KB1 A;  2NRV A;  4FJ5 A;  4GVE A;  1NU0 A;  5FPE A;  4AF1 A;  3HPO A;  1ESV A;  3TAM A;  3IMX A;  1BIZ A;  3OYI A;  1IBK K;  3OYA A;  4OJR A;  3CCV N;  2IGI A;  1F21 A;  4JK7 A;  3OYN A;  3TSU A;  2Q36 A;  2HF3 A;  5J2N A;  4FVU A;  3B8A X;  3QEX A;  5EOY A;  4FXD A;  2V51 B;  4K0K K;  1TYQ A;  1RT6 A;  2NRT A;  4WF9 L;  5AQT A;  4CK3 A;  3DXK A;  3WT0 A;  4FOI A;  1DKG D;  4B9Q A;  3NHG A;  3SZ2 A;  3G71 N;  4FLZ A;  3V1R A;  4IEE A;  4FJK A;  3T69 A;  1QQN A;  2E2N A;  4CFD A;  3MDQ A;  1I3A A;  1JLE A;  4IFV A;  4CIG A;  4ZHR A;  2WFB A;  1BQM A;  1NLV A;  3L6Q A;  2XRI A;  1H1V A;  3VQE A;  4BRA A;  1NM1 A;  5KQD A;  1A5V A;  3MX5 A;  1P8Z A;  3QIC A;  4KH6 A;  4B8C A;  4IDH A;  5DK5 A;  2ZGY A;  2A3Z A;  2BGG A;  1QZ5 A;  5HBM A;  4H0P A;  2YCH A;  4LSL A;  1Q9X A;  1KXP A;  4DQI A;  4BC5 A;  3TAF A;  3FZH A;  2OZS A;  1J5E K; 
#chains in the Genus database with same CATH homology
 4NXM K;  1IBL K;  4JI1 K;  1N32 K;  1HNX K;  3JAM O;  4B3S K;  4YHH K;  4JI5 K;  4JI3 K;  4LF4 K;  1FJG K;  2UXB K;  4LFA K;  1HNW K;  4DR7 K;  5FLX O;  4DV1 K;  4JI2 K;  4JYA K;  4B3M K;  5IT9 O;  4B3T K;  5A2Q O;  1I94 K;  1XMQ K;  4JI8 K;  3J80 O;  2HHH K;  4LF6 K;  2F4V K;  4CVN E;  1IBM K;  4CW7 B;  4JI7 K;  1N34 K;  4AQY K;  1IBK K;  4X64 K;  2VQF K;  4DR2 K;  5IWA K;  4JI0 K;  4DV4 K;  4JI4 K;  1HR0 K;  4DV3 K;  4LF9 K;  4YY3 K;  4OX9 K;  4NXN K;  4K0K K;  1HNZ K;  2UXC K;  4DUZ K;  4DV2 K;  4GKJ K;  5LL6 Z;  4LFB K;  2UUC K;  4LF8 K;  3J7A P;  4DUY K;  4GKK K;  4B3R K;  1XNQ K;  1N33 K;  4JV5 K;  4X62 K;  5BR8 K;  4DR3 K;  3J81 O;  2ZM6 K;  4X65 K;  5AJ3 K;  5LMN K;  4DR1 K;  4DR5 K;  3OTO K;  2UUB K;  4JI6 K;  4KHP K;  3T1H K;  2VQE K;  2UUA K;  4DR4 K;  4V19 S;  2UU9 K;  1XNR K;  1N36 K;  4X66 K;  3T1Y K;  4DV0 K;  4DR6 K;  4DV5 K;  1XMO K;  4DV6 K;  5LMU K;  4LF7 K;  4LF5 K;  4DV7 K;  2UXD K;  2E5L K;  3J7Y P;  4LFC K;  1J5E K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...