4B3TK

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4b3tK00
4LF9K 4B3RK 3OTOK 4DV7K 4JI3K 5AJ3K 4DR7K 4DV1K 4NXNK 4JI5K 1FJGK 4AQYK 1I94K 5BR8K 4LF8K 4LF5K 4B3TK 4JI0K 5IWAK 4LF4K 4DV3K 4DV4K 4JYAK 1IBKK 4DR2K 2UUCK 3J80O 1HNXK 1J5EK 4DR6K 3J7AP 4X65K 4CVNE 4DR4K 4GKKK 1IBLK 1HR0K 4LF7K 4X62K 4DR1K 4CW7B 2UXBK 4YHHK 2UUAK 4DV5K 4DUYK 4DV2K 2UUBK 4DR3K 5LMUK 2UXCK 3J7YP 1HNZK 4GKJK 4K0KK 4DV0K 4LF6K 1HNWK 5IT9O 4LFAK 2VQFK 4NXMK 4JI1K 4LFCK 1XNRK 1XNQK 5FLXO 2F4VK 1N33K 1N32K 1N36K 4YY3K 1XMQK 2ZM6K 2UXDK 4JV5K 5A2QO 4JI4K 2VQEK 2E5LK 4JI6K 4X66K 3JAMO 4DR5K 2HHHK 4LFBK 4JI7K 1IBMK 5LL6Z 3T1HK 4DV6K 3J81O 5LMNK 3T1YK 4V19S 4JI2K 4OX9K 1XMOK 4JI8K 4KHPK 4B3SK 4X64K 2UU9K 4DUZK 1N34K 4B3MK
chains in the Genus database with same CATH superfamily
5J2MA 3VERA 4L3QA 1K6YA 3HT3A 2P9LA 4CBUA 4BDYA 3MCPA 3V9SA 3CFRA 3VGMA 3RSEB 4I9QA 5JS2A 4FWLA 1HNVA 4IZ9A 5CYMA 4IFYA 3L3VA 3K59A 3IDHA 1NGAA 4DV4K 3F2KA 2NRWA 3TTFA 2QWNA 2ZD1A 1QHAA 3HOSA 3O6WA 4H0VB 2IGIA 3AAQA 3QINA 4DR6K 4AHRA 2WTUA 2NRRA 2V52B 2QK9A 3DOLA 4CVNE 5JLFA 2G8IA 3DLGA 2P5OA 3ATVA 3SQ2A 3THWB 2IVOA 4CD1A 4DSFA 3EYZA 1C1AA 1VQ6N 3UKUA 3BY5A 3I8DA 3LWLA 4CEOA 4O5FA 1RTHA 3AVIA 4FYDA 4YORA 1ATNA 5J1EA 3O9RA 5AQFA 4DR3K 3QEVA 4CIEA 1NJYA 4CESA 3CYMA 3DLRA 3SQ1A 3OYCA 2QM1A 2W42A 4CK2A 3THXA 4K8XA 4ILJA 1VSHA 2D5RA 3GE1A 4UY8O 2KFZA 1GOCA 4IJNA 3M8QA 4CJQA 4CGGA 4B9SA 1ZBUA 4DTMA 4H8KA 1TKDA 1J9AA 2P9IA 4ID1A 4NLCA 1GLFO 1NGIA 2QWPA 4E7JA 2D0PA 1C0TA 3SCXA 3GL1A 2RKIA 5CR4A 5ADXA 2GWJA 1S1WA 5K14A 3TAQA 4JI8K 5FPMA 4NLBA 2VG5A 4LY7A 1L3SA 3MCAB 3HP6A 4KHNA 2GELA 1X3NA 1XC3A 1U4BA 2X6NA 5AZJB 3ZCMA 3NF8A 3VETA 1MWKA 4DF8A 4N41A 1NK0A 4EP4A 4Y1CA 3EZ5A 1FJGK 4B9UA 4LF8K 2GV9A 4BRAA 1NGHA 1RTJA 3OY9A 4G1QA 2VG6A 5IWAK 2D0AA 1U2VB 1EWRA 5HRPA 3SI6A 2E20A 3CCEN 4BRIA 1TKXA 1HNXK 3DXKA 3SAGA 3VEZA 3OS2A 3PV8A 3GDQA 3S3OA 2E2PA 1YI2N 1NU0A 1Y97A 3FFIA 1YJ9N 4H03B 4RW6A 1S6QA 2G8UA 5HL7L 3LM2A 4BRCA 4OKJA 3P83D 3LDOA 4FWOA 3I56N 4LH5A 1DTTA 1H1VA 5EVZA 3M1FA 4CF9A 4IOCL 2E2QA 3UB5A 2WBNA 4F4KA 5SWMA 3LZIA 3MN9A 3R1XA 2HF4A 3J7YP 3VGKA 1FKPA 1NGFA 2NRZA 4A61A 4EHTA 1S22A 1QQNA 1BHLA 3NH1A 4GV3A 3S3NA 2EX3A 3LM9A 4JN4A 3H3OB 2Q36A 3GOIA 3U9ZA 4BR4A 1GOBA 1S9GA 2PZSA 3UKRB 3R9PA 4GV6A 5F2RA 2HHHK 4JKGA 3VF2A 1TUUA 3SBGA 3AVFA 3BZKA 3T1HK 4ISGA 4M7XA 4J8FA 4BC2A 1LWEA 1WSJA 1D9DA 4DWIA 4M3ZA 3CIPA 3EY1A 3CPEA 1HYVA 1IO2A 4JD2B 3SAFA 3VF6A 1X9SA 3MECA 4O4GA 2E2OA 5AQKA 3PX0A 1BG3A 4FZXC 2F9TA 4JKCA 3QEIA 3AVKA 4DR7K 2KQ2A 4NXNK 3OW2M 3CCLN 4BY9C 1HJOA 3C6AA 5AQHA 4CHQA 4CF0A 2E2NA 3NH0A 3HXMA 5M1KA 1R0AA 4DMNA 1OVYA 3HVRA 3LANA 1HKGA 1S9EA 3D2EA 1E3MA 3SJJA 4CZFA 2O8CB 4FM1A 2CGKA 1TYQB 3QEWA 4CEZA 3ENOA 5C2FA 3K5MA 1SV5A 5E41A 4F2RA 3L2UA 1S1TA 4JS5A 3THYB 1WSHA 3RMAA 1RT2A 5FRMA 1TAQA 4X62K 2HHTA 3W0LA 4M3UA 4CZKA 1WOQA 3LALA 4KHWA 3HBTA 1YHQN 4W5NA 1JXBA 3JS6A 3KJVA 2HNYA 1K9MO 2FF3B 4YDUC 4DU3A 1WSGA 1C0FA 3VESA 4AF1A 1NJZA 3AVNA 3L0QA 5IT9O 3RR7A 4B9NA 4JKDA 4Z4GA 1QSLA 1YXQA 5M1PA 2HF3A 4B1WB 1QS4A 3CXCM 1NJIO 5C0YA 4BVPA 2Y1IA 1VSLA 3CCJN 1NK5A 4FJHA 2DFFA 3CI5A 4FWRA 2E4LA 2E8AA 1VRUA 3NFAA 3VF4A 4OLAA 1QSSA 4LFBK 1NMNA 4H0OA 2QXLA 3KWGA 5HRSA 4CBXA 3G71N 3SNNA 2ZJPL 3O9TA 3HPHA 3WEEB 1VRTA 2NNWA 1O13A 1JXEA 2ASOA 3CHWA 2E88A 1U04A 4E3SA 1U49A 2P9KB 2XO7A 2V7ZA 1NGEA 2VGMA 1RDAA 1W9HA 3U9DA 3C95A 4JKFA 4BR7A 3CETA 1NBWA 1ILYA 2IVPA 3MN6A 1IKVA 3SUOA 5B8HA 3OS0A 4LF5K 4B3TK 3PUFA 4GY2B 4CFDA 4LD0A 1JJ2M 4LF4K 4E7HA 1BI4B 1S1UA 3T19A 3ID6A 1W7AA 2RHKA 3LP1A 2UUCK 2D0BA 2HVHA 4CI6A 1LAVA 5EU7A 4DQPA 1UA0A 1D5AA 2Z1GA 3RRGA 1QHTA 5CHIA 1SAZA 3QB0A 4JHDB 1LAWA 2QTDA 2OZMA 4PKHA 4GVEA 2G8HA 4OKEA 3KLGA 4H5NA 4PHTX 2P9NB 5F1XA 5AQOA 2QKKA 4FOEA 3QNOA 4PUOA 3ZETA 2UXCK 3SAHA 1SL2A 3SUQA 4PQUA 3MXJA 5C24A 3CJAA 1FXXA 1KLMA 1ESVA 3ZSRA 4MDAA 4CFBA 1KVBA 1VSDA 3H3NO 3WQTA 5C15A 3TSUA 1XNQK 1T8EA 3MK6A 3VQ4A 3O08A 2O8FB 3TAFA 4DF4A 1XMQK 3DJCA 3ZX2A 3LP2A 2VQEK 3F9KA 3U6FA 3KD5E 4DLEA 4FLVA 3JAMO 4IFEA 3DMJA 3AO5A 4BROA 4IXCA 3PLAA 3NE6A 1RBSA 3O4NA 4BQLA 4B9VA 4JK8A 4DFMA 3RSEA 2NRHA 1WB9A 4CJSA 3FZHA 1T3VA 3C65A 3CJ1A 3VEVA 3ZT1A 4YOWA 5E84A 4RW4A 3AV9A 1TL1A 3LWMA 1IJJA 2YV0X 2O4IA 4A2BA 3HM8A 1DTQA 3D2FB 3AO4A 5BPMA 2QWMA 4JLHA 4EHUA 2V51B 3RRHA 2YNHA 3THWA 1VSEA 4N76A 3V9ZA 1YF5L 3V4IA 1UWBA 1VQ8N 4PWDA 2O8DB 5AQGA 3UIQA 2QKBA 4B9LA 1E4FT 2JGUA 5KQ8A 2PBDA 1DGKN 2QWQA 3NGYA 3DLEA 3RR8A 4FCYA 5BREA 4B3OA 1YJWN 1QTMA 4DTUA 5AQLA 4BG8A 4BQZA 3O8MA 3NBPA 4BR2A 3K2PA 4BRGA 4CK1A 1A5XA 2PY5A 3HPOA 4OPKA 4B08A 2QW9A 4JKAA 3AO3A 3T7ZA 3ZT3A 4YOVA 2JWLA 5AQPA 4GV9A 3ENBA 2GEMA 3JYTA 1TK8A 2E1YA 1R59O 4M63C 3OYEA 4HTUA 2O8BB 3TAMA 4DHYA 4KBOA 3D7EO 4DV0K 1KTQA 1HNWK 3KK2A 3QO9A 4BRQA 4BE2A 1JCEA 3KTQA 3MEGA 1Y64A 4CJFA 1N8RO 2YJFA 1BA1A 1IKXA 3V1OA 1NG9A 4XH4A 5JVHL 4FM2A 3AGRA 1NGGA 4FJ5A 3RMDA 4IOXA 1XNRK 4O44A 2WONA 1BUPA 1JL1A 3O3HA 1T44A 3OYFA 3AVMA 4KI4A 3VQ8A 2AA4A 4CJPA 2P9UB 3EL2A 4AHSA 4FWNA 5GIPA 1Q8IA 2VWJA 4BRFA 3SV3A 2YNGA 2G8VA 3CCMN 1NGJA 4LH4A 5AZJA 2HSTA 2P5GA 3WNHA 4C23A 3P31A 1KQSM 1RDWX 1TAUA 3B6OA 4WQ5A 2NRTA 2DTUA 1VSIA 4BWMA 3M8RA 3QICA 3NF9A 5KPZA 1U2VA 3VQPA 1WSEA 2IIRA 2PFUA 4DSLA 4CJ5A 5TKWA 4KRFA 1D4XA 4FJJA 4A57A 2Q97A 1Q7YO 4HWIA 5AZIB 4QS8A 1HUXA 1X3MA 1I94K 3C94A 3FE1A 2D1KA 3E9PA 1HPZA 1T6CA 4JI0K 1CZAN 2IC3A 4OKKA 1VQMN 4KV8A 4E1NA 3NCIA 4AHTA 4IDHA 1RT3A 3G0ZA 4CJ3A 2HMPA 1VSFA 3CC7N 3ID8A 4QAGA 3ZYYX 2EWSA 1BGXT 3BZCA 1MWMA 3O9UA 1NGCA 3GG4A 3O9SA 1RBVA 1FW6A 1KVCA 1JL2A 2CH6A 3WXIA 2IDOA 4CW7B 2W6KA 1NM1A 1SL1A 1K8KB 1MU2A 3GBTA 1RDUA 3A2FA 4DV5K 4OPAA 3EZWA 4A5AA 3IS9A 2DFHA 1RT4A 1N5YA 2A5XA 3TSPA 1QVFM 2YKNA 4BWJA 3N4PA 1NK8A 2HB5A 5KRTA 4ZHRA 3VEXA 3HRGA 4CD3A 2VQFK 3UKRA 3MEDA 3WXLA 2FF6A 1A5VA 3MEEA 4BRDA 3V81A 2BH1A 1P90A 1NKEA 2CGJA 4ZTFA 1YIJN 1S6PA 3TI0A 1N33K 4BRNA 1S72N 5BRHA 4M3RA 4OPJA 4BRMA 3AVAA 3KLEA 3CC4N 3ATUA 5HLFA 3QEPA 4ID5A 3VQBA 4JD2A 3DLHA 5KPTA 3QIPA 1IBMK 1RDBA 3EO3A 5BPNA 2DFEA 3T1YK 4FO0A 4FPAA 3V6DA 3QLHA 1HKBA 1NK9A 4FJIA 5GAGP 4C8MA 2KLAA 1YT3A 3P5JA 3BF3A 4ICLA 3QBWA 3VQEA 3LPTA 3BUZB 3M6GA 4CHNA 4LSNA 4IO8A 4DV7K 2DY4A 1OH7A 3ZEUB 2YHWA 1XHZA 2O8CA 1RNHA 1TYQA 1D9FA 4FSVA 2QWLA 3HP9A 4CJRA 2DPNA 4HUFA 4LC9B 3THYA 1ITGA 2ASMA 2J4RA 1HPMA 4Y0WA 3O3GA 1FKOA 3HYFA 3KLIA 2HHSA 2W40A 3ZX0A 2RF2A 4IG3A 4BE1A 3L8BA 2HVIA 2ZJRL 2GTDA 4E1JA 3TAPA 4C8OA 4FK4A 4DR4K 4KTWA 3ALYA 3OYGA 1RILA 4YOYA 1ZBIA 3A5OC 4Z4FA 5EXWA 3CCRN 3ULEB 1NOZA 4Z4CA 2PYLA 3DAWA 1DT9A 3O3FA 2D4WA 5J2QA 4FW1A 3WT0A 3SLCA 3KK7A 3HSCA 4IEEA 1ATRA 4I2QA 3DXMB 5FPNA 4FM0A 4C8LA 3LP0A 2RPIA 1ZBFA 4K42A 3NGIA 3IRXA 3CMEN 4O8KA 1RDDA 1CZ9A 2KZZA 3EE8A 1D8YA 4RW9A 1GOAA 1XI1A 2YI1A 3WEEA 4B1UB 3CERA 5A2QO 1MA9B 3TAGA 4ELUA 3J8AA 2P9KA 1RBUA 4O5BA 3FZFA 4DCHA 2AJQA 2VG7A 1WN7A 3P39A 3TU5A 1LOTB 3SMPA 4DLGA 2HBJA 2VWBA 1VQ4N 1LW0A 1C0UA 1JKHA 1NK4A 4FJ9A 3CJCA 1RT5A 3HPGA 3IAYA 4DKWA 3AVJA 4BC4A 1NKBA 1BI4A 1EWQA 3PSFA 3LDQA 5AJ3K 4CJLA 4M3WA 3SK3A 2W6LA 3FFKB 4ILGB 1VQKN 1KAZA 5FDLA 4NYNA 1Z26A 1ATSA 1JLBA 2G8WA 2FBYA 3CQ8A 2WUSA 3VEYA 3MXMA 3OA9A 1IG8A 4DQ8A 5KTQA 4JHDA 4ISFA 3WUHA 1VK0A 1NK7A 3DYAA 2P9NA 4EZ9A 4AH9A 4H0TB 3LPUA 3FZLA 3BGRA 4IOAL 2FXUA 5AQWA 3DM2A 3V1RA 5AFUH 3E66A 3CCQN 1Q82O 1CXUA 4QS9A 5AQTA 4W5OA 1K73O 4DUYK 4O55A 2HW3A 1DLOA 4DV2K 5C42A 4FVUA 4TSXA 1FK9A 4CGHA 4O8UA 4OLBA 3BDPA 3SBTA 1IKYA 1Z6RA 4HVJA 2O8FA 1ZXOA 4FWPA 4KB1A 5HRRA 4WE1A 4UQGA 4BGAA 1YAGA 1TKZA 3N4QA 1HQEA 2I7NA 3EN9A 3P4IA 1BL3A 2FSKA 1G99A 4I6MB 1WUAA 2OPRA 4ZTJA 3QMLA 5C10A 1N36K 4B1ZA 3IFRA 4E7LA 3A5LC 4JV5K 5D3GA 2P9PB 2YHAA 4J2EA 4KAZA 3IMXA 3WXMB 2KZMA 4B9TA 4FWSA 3SQ0A 2X74A 2E1ZA 4H0XB 1WSIA 3D2FA 2XHBA 1VQ9N 3AO2A 3LDLA 2GUIA 3O4WA 4CECA 3SUPA 4M45A 2O8DA 5HROA 3CMAN 3WNGA 3OTOK 3P1GA 1RGIA 4JI3K 4FLXA 4DTJA 1NNEA 4Q0BA 4K25A 1I39A 1BQMA 4QS7A 2OPPA 1BOTO 1KLNA 5JICA 3SJHA 3U8XA 1JLGA 3VQ9A 2HHUA 3OJUA 1IBKK 1SS6A 4XIUA 2BE2A 3CPWM 3MWTA 2HNZA 5ADXH 1JLCA 4IFVA 3PX4A 2W41A 1KD1O 4CGDA 1NGBA 4B1VA 3S3MA 2O8BA 1XHXA 1J6ZA 1RBRA 4MLHA 3QERA 5LY3A 5BRDA 1Q81O 3DI6A 3FR0A 2H3GX 1QVGM 3CJ9A 3J7ZO 3FGUA 2JLEA 4AM6A 2UUBK 3DRSA 1YTUA 4I2PA 3HVTA 4PKIA 3KK1A 3KD1E 1J53A 4KKOA 4K0KK 4LFAK 3OYNA 4LSLA 3AVGA 2P9UA 2GUPA 1KFDA 4FZYA 3AAPA 4CEQA 3OYLA 4CHZA 4QCLA 5JS1A 2QXFA 2ASPA 5E26A 4ELVA 3ITHA 3HI0A 4KFBA 3THVA 3K9JA 1LCUA 1RTDA 4C8KA 4Y1DA 1KC8O 5AQXA 3L6QA 4YOTA 2QWOA 2HBKA 2P1JA 3T69A 2O8EB 2FSJA 2BANA 4FWQA 1Z25A 4CK3A 4R79A 1LW2A 4H4OA 3G25A 1A5WA 3CCUN 2F9WA 4DFKA 4F3TA 4OX9K 4KO0A 5AZIA 3FLCO 3FZMA 4FJ8A 3WXKA 1KAXA 3O5BA 3O4QA 5FPDA 1JLAA 1TVRA 4JAXA 4LF9K 4NCBA 4BACA 2KFNA 3VEOA 1BO5O 1TUYA 1OH6A 4DTXA 4Z0UA 5C12A 4CJVA 1GLEG 2IOCA 3WQUA 3ZT0A 2ETJA 1VQ5N 4DQQA 3ULDA 1UAXA 1VSJA 3VQ5A 3HSTB 3KIOA 1VQ7N 4CFCA 2FC0A 4CGJA 3KZBA 4OJRA 3O80A 1CZBA 2WC9A 5AQIA 4JNEA 1YVUA 4JRPA 3WXJA 3J80O 1TL3A 1K8KA 2Q2RA 3LP3A 4H5TA 4CF2A 4W5QA 3G4SN 1IKWA 3AGKA 4M3TA 3A5NC 2OYQA 4CE9A 2FBXA 1OKJA 3ISNC 3OYAA 4XH5A 4DR1K 4WFAL 1S3XA 3NH2A 1G15A 2XY7A 4WCEL 2ZJQL 2UUAK 3CCSN 1BA0A 3U4LA 3VQ6A 5KRSA 4K8ZA 2HHWA 1YJNN 1P8ZA 4YNQA 5EX5A 5J2NA 4CJUA 1EX4A 1U47A 5KI6A 3NVMA 3VEWA 4YOXA 3H45C 4MO4A 3K5LA 2ZGYA 4N47A 4JI1K 5CZ1A 2A40A 4C1NK 3K58A 3VQ7A 4BGBA 5FLXO 3V1QA 2YHBA 3AVBA 3AA5X 4IDKA 1W0HA 2YJEA 4DS4A 3M5RA 4CEFA 1WSFA 5DK5A 4KH4A 4KH5A 1UOCA 1W2BM 4JI6K 1SL0A 1VSMA 4BR9A 1O1WA 4FK0A 1RBTA 4NCGA 3VQDA 1WAJA 1BISA 3ZEUA 3KLHA 1BIZA 3L2QA 2UYTA 4IBNA 3LAKA 1XMOK 1JCFA 1RT6A 3I33A 2ITMA 4B9QA 3HL8A 4CZGA 1T7PA 2VCPA 4J2BA 3NMUA 4PKGA 3TWHA 1X9MA 1NOYA 4FJXA 5JLHA 3SPZA 4O0JA 4XH1A 4CZJA 2FLOA 3RVCA 4AHCA 3CF5L 4F3OA 4WQ4A 1J54A 3DLLL 5FPEA 4AQYK 1KAYA 5JVGL 3DWLA 1NJWA 2RE2A 5AQRA 4W5RA 4KHQA 3DLBA 2WOMA 1LWCA 5T7BA 2EHGA 4EFHA 1HJRA 4FLYA 4FZZA 3ULEA 3PY8A 2ZE2A 2A1RA 1IV0A 5AQZA 5CYQA 5M1FA 3QETA 2BTFA 3MDQA 3JXUA 2B5JA 1RT1A 4GMJB 1DKGD 4BE0A 4H4MA 2F8TA 4M41A 4FWKA 4HTLA 2F7TA 3DXMA 4CGIA 3QIOA 3ZSOA 4CJEA 1HYSA 3QDKA 4FJMA 4WQ5C 3TABA 3O1WA 1M1KO 3L2RA 3ENHA 3TAEA 4K41A 4MO5A 2I7PA 1B9FA 4I7FA 5LJVA 1L3VA 4NCAA 4CCHA 3HJFA 2AP1A 5J2PA 5CZ2A 1HRHA 2HBMA 3VGLA 2LSNA 1XQSC 5KGXA 5HOOA 4CBWA 5C2DA 1T05A 3SMSA 5GAEP 4KTQA 1VQPN 3L4IA 3AA4A 1OH8A 3QBXA 4CEAA 3M8SA 1VQLN 1UA1A 4AHUA 2Q1NA 3EKSA 2F4VK 5CY4A 3CCVN 4PY5A 2HNDA 2Q31A 4JI4K 2KTQA 1OVQA 3PO5A 1Q9YA 4E0DA 4NO7A 2BDPA 3QEXA 4DTNA 4L8RB 3LZJA 1E4GT 1ZC6A 3KWIA 3H1VX 1U48A 2A6AA 3OS1A 5LMNK 3ZSZA 1QQMA 3PSIA 4CGFA 4IO9L 3MAQA 3F5TA 1K8AO 1REVA 1TKTA 4FJNA 4BREA 2OA8A 3C6UA 4B1YB 1IG9A 5KPRA 2KW4A 4B3MK 1QZ6A 2ITGA 3PO4A 4N56A 4RW8A 4PL7A 2VGNA 3PIPL 4DV1K 5BR8K 4JEPA 1C0MA 1M90O 4DG1A 1RT7A 4DV3K 2OZSA 2ZF5O 2NUBA 3ZT4A 1BCMA 4DR2K 3TSQA 2CH5A 1BWFO 3VQAA 3V9UA 4Z94A 3J7AP 3CM6A 3FZKA 4H5RA 4RWTA 1X9WA 4GKKK 1HR0K 3DLKA 5DMRA 5M1OA 2YHXA 4QOZB 4CIFA 5SZTA 2Q0RA 2UXBK 1N6QA 3R8EA 3R6MA 3MWPA 2X78A 4CJWA 4KHSA 4K43A 4M42A 4E7KA 4KTZA 5EY4A 3B8AX 1BQNA 4CERA 5CE3A 4WFNL 4FK2A 5BN8A 4FOIA 2FBTA 1Q9XA 4HUGA 5AQVA 4I6MA 4FJKA 1BIUA 1KSPA 3HTVA 1F21A 3Q7CA 4LF6K 1EO1A 1HKCA 4GW6A 4DSKA 2P9PA 2IAJA 1VSKA 4KH6A 4E89A 3VTIA 1Q86O 2OCEA 4C8NA 4HCBA 4KPYA 2ZQBA 3RMCA 4FPBA 4YY3K 3TPQA 3HZ6A 1QSYA 3ZSVA 3OJSA 1WNSA 4CJ4A 3T3FA 2OTJN 2E5LK 1GLCG 4A5BA 4X66K 1NLVA 3ZSYA 4ELTA 4JI7K 3QNNA 4DV6K 3VA0A 4CZHA 4OGEA 3K5NA 5KQDA 3L2VA 2VYPA 3E1YA 3TARA 4KB0A 5EOYA 2QWRA 4KHPK 1Q18A 2A3ZA 3H6EA 3E9OA 4BR0A 4DUZK 3K0SA 4JRQA 4NB4A 5GADP 4NYFA 5I9EB 3D6RA 1IH7A 3I0RA 4E7IA 3VMFB 3KLFA 2O4GA 2JWKA 5M1QA 4H0YB 4J2AA 2A1SA 3TANA 5BN9A 4W5TA 1KXPA 1WBDA 1VAZA 2XY5A 3F9MA 3AA3A 3C7NA 3H08A 3U3YA 3R3LA 2P9SB 3W3DA 3NF6A 4BRHA 4KI6A 4FJ7A 3CQYA 1ZBSA 2P9LB 1J5EK 1WAFA 4EIAA 3D0PA 3D45A 3OBWA 4YOUA 1KVAA 4HCCA 3CM5A 3EE9A 3CJBA 4KREA 1HYZA 1ZYQA 1XWLA 3PX6A 2YNIA 4LF7K 1XUPO 5BPLA 2VWKA 5LJWA 5AQJA 4H5WA 4CEDA 4YFUA 3G6EN 4EAHD 1NMDA 3G10A 1DEJA 3VQCA 1WLJA 1QQCA 3DOKA 3UE5A 2FSNA 2A42A 5AR0A 1T6DA 3I8BA 3NHGA 4FLUA 4B1XB 3U3GA 2XY8A 5AQMA 1B92A 3UKUB 3A8YA 4CFAA 4F8RA 3S41A 3O9QA 4NXMK 1EKEA 3DRPA 4MDBA 4R5PA 4E19A 2HBLA 3K57A 2O8EA 5FRNA 3IG1A 1BDGA 4EZ6A 4BRLA 4GNIA 2HHQA 1HLUA 4IG0A 2BGGA 3MX5A 3THXB 4PA1A 3NVKA 1J5OA 3TTDA 1HMVA 5LL6Z 1YITN 4OVLA 3EKUA 1S5JA 4DB3A 4DQRA 2P9IB 5AQUA 4CJTA 3S9HA 3ZSXA 3VOVA 3LAMA 1ZBHA 3OYJA 3RWUA 4IWVA 1GLBG 1ASWA 4N5SA 3OYMA 3C0BA 1SKRA 4Z4IA 1HNIA 4YDUA 3CG7A 4KHYA 3CFOA 2QI2A 4M3YA 1W97L 5HBMA 4CZEA 4IJAA 2IS3A 1QZ5A 2B6AA 1JLQA 4RTFD 4DU1A 2G8KA 4DU4A 1C1BA 1VQON 1BU6O 3TTCA 4JK9A 1NJXA 2D0OA 4JYAK 3AO1A 3AARA 4MLEA 1B9DA 3EEQA 4M7YA 1QQOA 1CXQA 4DTSA 2GWKA 4H5VA 4BG9A 2ATQA 2XY6A 1SKSA 3LL3A 5JMVA 1IBLK 4KHUA 2Z1JA 4CEBA 1LV5A 1X1PA 3KK3A 3DXKB 2GBZA 4YHHK 3PIOL 3C6TA 3A0IX 2XRIA 3TR8A 5I3UA 4FJGA 5DM7L 3NDKA 4DTRA 1MDUB 1JLEA 4AM7A 5LMUK 1V4TA 4DTOA 3LDNA 1OH5A 4B9MA 1TK0A 1TV6A 4FL9A 4O0IA 4XEIA 1L3TA 2BUPA 3C7NB 4Q5VA 1C6VA 2Z1HA 2RN2A 4CHPA 5BRFA 1N32K 3KVGA 1SUQA 4ISEA 2Q3SA 3AVHA 2F8SA 2ZM6K 2KKZA 4CF8A 4CJ7A 2F96A 4FLWA 4FJLA 3MX2A 1NGDA 2Z1IA 3ZT2A 1EETA 3HO1A 3AVLA 1C1CA 5GAHP 4RG8A 2ZGZA 3AA2A 5I42A 4BR5A 1ZBLA 4G9ZA 1NWKA 2E6LA 4EP5A 4RW7A 3ZX3A 4CHOA 3ASMA 3SYZA 2OPQA 2NZTA 1YTAA 4DSIA 4A59A 4F2SA 3MN7A 2OPSA 3WNEA 1VHXA 1EXQA 4GVMA 4DSEA 4X64K 4BRPA 4F9OA 2UU9K 4CZIA 2YCHA 1S1XA 3BP8A 1KCFA 4ILHA 4JKGB 3MXIA 3CD6N 3OYHA 1YVNA 1L5UA 4OPHA 4DTPA 3LDPA 3OYIA 2YNFA 3MMVA 3CJ7A 1HQUA 3T1AA 2PYJA 3CFPA 3H1QA 4FVMA 4BC5A 2GX9A 4FWMA 3B6PA 4BC3A 4DFPA 5AQYA 2WFBA 2B4JA 3CC2N 2P51A 1TK5A 4CEEA 5GIOA 1T03A 4X65K 1U6ZA 2NRVA 3HOTA 1L3UA 4HHTA 3HK2A 5M1NA 1EQYA 3BEXA 3NF7A 3NAEA 1Z05A 1YUWA 3D2EB 1S1VA 4OO1J 2HOEA 3OYDA 2CGLA 4B8AB 4FXDA 1HX1A 1RFQA 4A2AA 3KHYA 3E01A 3OVNA 1BCOA 1EP4A 1JCGA 4CIGA 5HRNA 2E6MA 4B8CA 1HNZK 3ZSQA 4GKJK 1GLLO 4Z4EA 4BRKA 2PAVA 5KGWA 3JSMA 4MQ3A 4CHYA 3SZ2A 2Y1JA 3KKRA 3OYKA 2QA4N 4CZMA 4WYBA 2V7YA 3BF1A 1RDCA 1X9JA 3A5MC 3VQQA 3OYBA 3OBYA 4I9LA 4CF1A 3LDSA 1GLDG 4DR5K 3MN5A 1VQNN 3WNFA 3KKSA 4IEIA 3M8PA 2I5JA 3J81O 4V19S 1SKWA 4JI2K 3O1BA 2HHXA 3Q7BA 2D0CA 4BVOA 4B3SK 3QFPA 4BDZA 1QE1A 2QEXN 2X6SA 5C25A 1V4SA 1U45A 1N34K 1I3AA 4U7BA 4JKBA 4B3RK 2ZWHA 3E9LA 3ZSWA 3K5OA 3H46O 3VA3A 5H1SQ 2YHYA 4JI5K 5FROA 1RTIA 1JLFA 4RCHA 2FBVA 3K9KA 3M3ZA 4Z4HA 5MLCQ 4JKEA 3HM9A 2HHVA 3C6HA 4H0PA 4J2DA 5GINA 1KRPA 1SQKA 4DQIA 3L2WA 4C1NI 1KFSA 5AQSA 2OANA 1LWFA 1ASUA 3VN5A 4DS5A 2IVNA 4DFJA 4DQSA 2YX6A 3V9XA 3SUNA 1NK6A 1SZ2A 3QESA 4HUEA 1GLJO 4AILC 3AY9A 3IKMA 4JS4A 3SV4A 4A62A 5TKYA 1TGOA 2G8FA 2R7YA 2OTLN 2A41A 1RCHA 3SPYA 4WQ4C 4JKHA 4OGCA 2Q0UA 4LFCK 4FW2A 3RMBA 4AHVA 5BR9A 3I55N 2YKMA 1XC9A 5HP1A 3ZETB 5ELZA 1NKCA 2KHOA 3P38A 4CJKA 2NLXA 4U67L 2UXDK 3OHRA 3AVCA 4IKFA 4FLZA 3RTVA 3F73A 4M3XA 3L4QA 5F0XA 5AQNA 3SQ4A 5DM6L 4E1MA 4MFBA 4JK7A 1GLAG 1C0GA 4BDPA 4DSJA 1CLQA 3I0SA 3DRRA 3QFUA 3L3UA 2NRXA 3V9WA 4PL8A 3NGZA 4FLTA 1WBBA 4CZLA 3IUCA 4WF9L 3ZLJA 3VPZA 3VENA 2HMIA 5AFUA 4WFBL 1ASVA 5AQQA 3VTHA 2P9SA 3CQXA
chains in the Genus database with same CATH topology
4LF9K 4B3RK 3OTOK 4DV7K 4JI3K 5AJ3K 4DR7K 4DV1K 4NXNK 4JI5K 1FJGK 4AQYK 1I94K 5BR8K 4LF8K 4LF5K 4B3TK 4JI0K 5IWAK 4LF4K 4DV3K 4DV4K 4JYAK 1IBKK 4DR2K 2UUCK 3J80O 1HNXK 1J5EK 4DR6K 3J7AP 4X65K 4CVNE 4DR4K 4GKKK 1IBLK 1HR0K 4LF7K 4X62K 4DR1K 4CW7B 2UXBK 4YHHK 2UUAK 4DV5K 4DUYK 4DV2K 2UUBK 4DR3K 5LMUK 2UXCK 3J7YP 1HNZK 4GKJK 4K0KK 4DV0K 4LF6K 1HNWK 5IT9O 4LFAK 2VQFK 4NXMK 4JI1K 4LFCK 1XNRK 1XNQK 5FLXO 2F4VK 1N33K 1N32K 1N36K 4YY3K 1XMQK 2ZM6K 2UXDK 4JV5K 5A2QO 4JI4K 2VQEK 2E5LK 4JI6K 4X66K 3JAMO 4DR5K 2HHHK 4LFBK 4JI7K 1IBMK 5LL6Z 3T1HK 4DV6K 3J81O 5LMNK 3T1YK 4V19S 4JI2K 4OX9K 1XMOK 4JI8K 4KHPK 4B3SK 4X64K 2UU9K 4DUZK 1N34K 4B3MK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 K;  4B3R K;  3OTO K;  4DV7 K;  4JI3 K;  5AJ3 K;  4DR7 K;  4DV1 K;  4NXN K;  4JI5 K;  1FJG K;  4AQY K;  1I94 K;  5BR8 K;  4LF8 K;  4LF5 K;  4B3T K;  4JI0 K;  5IWA K;  4LF4 K;  4DV3 K;  4DV4 K;  4JYA K;  1IBK K;  4DR2 K;  2UUC K;  3J80 O;  1HNX K;  1J5E K;  4DR6 K;  3J7A P;  4X65 K;  4CVN E;  4DR4 K;  4GKK K;  1IBL K;  1HR0 K;  4LF7 K;  4X62 K;  4DR1 K;  4CW7 B;  2UXB K;  4YHH K;  2UUA K;  4DV5 K;  4DUY K;  4DV2 K;  2UUB K;  4DR3 K;  5LMU K;  2UXC K;  3J7Y P;  1HNZ K;  4GKJ K;  4K0K K;  4DV0 K;  4LF6 K;  1HNW K;  5IT9 O;  4LFA K;  2VQF K;  4NXM K;  4JI1 K;  4LFC K;  1XNR K;  1XNQ K;  5FLX O;  2F4V K;  1N33 K;  1N32 K;  1N36 K;  4YY3 K;  1XMQ K;  2ZM6 K;  2UXD K;  4JV5 K;  5A2Q O;  4JI4 K;  2VQE K;  2E5L K;  4JI6 K;  4X66 K;  3JAM O;  4DR5 K;  2HHH K;  4LFB K;  4JI7 K;  1IBM K;  5LL6 Z;  3T1H K;  4DV6 K;  3J81 O;  5LMN K;  3T1Y K;  4V19 S;  4JI2 K;  4OX9 K;  1XMO K;  4JI8 K;  4KHP K;  4B3S K;  4X64 K;  2UU9 K;  4DUZ K;  1N34 K;  4B3M K; 
#chains in the Genus database with same CATH topology
 5J2M A;  3VER A;  4L3Q A;  1K6Y A;  3HT3 A;  2P9L A;  4CBU A;  4BDY A;  3MCP A;  3V9S A;  3CFR A;  3VGM A;  3RSE B;  4I9Q A;  5JS2 A;  4FWL A;  1HNV A;  4IZ9 A;  5CYM A;  4IFY A;  3L3V A;  3K59 A;  3IDH A;  1NGA A;  4DV4 K;  3F2K A;  2NRW A;  3TTF A;  2QWN A;  2ZD1 A;  1QHA A;  3HOS A;  3O6W A;  4H0V B;  2IGI A;  3AAQ A;  3QIN A;  4DR6 K;  4AHR A;  2WTU A;  2NRR A;  2V52 B;  2QK9 A;  3DOL A;  4CVN E;  5JLF A;  2G8I A;  3DLG A;  2P5O A;  3ATV A;  3SQ2 A;  3THW B;  2IVO A;  4CD1 A;  4DSF A;  3EYZ A;  1C1A A;  1VQ6 N;  3UKU A;  3BY5 A;  3I8D A;  3LWL A;  4CEO A;  4O5F A;  1RTH A;  3AVI A;  4FYD A;  4YOR A;  1ATN A;  5J1E A;  3O9R A;  5AQF A;  4DR3 K;  3QEV A;  4CIE A;  1NJY A;  4CES A;  3CYM A;  3DLR A;  3SQ1 A;  3OYC A;  2QM1 A;  2W42 A;  4CK2 A;  3THX A;  4K8X A;  4ILJ A;  1VSH A;  2D5R A;  3GE1 A;  4UY8 O;  2KFZ A;  1GOC A;  4IJN A;  3M8Q A;  4CJQ A;  4CGG A;  4B9S A;  1ZBU A;  4DTM A;  4H8K A;  1TKD A;  1J9A A;  2P9I A;  4ID1 A;  4NLC A;  1GLF O;  1NGI A;  2QWP A;  4E7J A;  2D0P A;  1C0T A;  3SCX A;  3GL1 A;  2RKI A;  5CR4 A;  5ADX A;  2GWJ A;  1S1W A;  5K14 A;  3TAQ A;  4JI8 K;  5FPM A;  4NLB A;  2VG5 A;  4LY7 A;  1L3S A;  3MCA B;  3HP6 A;  4KHN A;  2GEL A;  1X3N A;  1XC3 A;  1U4B A;  2X6N A;  5AZJ B;  3ZCM A;  3NF8 A;  3VET A;  1MWK A;  4DF8 A;  4N41 A;  1NK0 A;  4EP4 A;  4Y1C A;  3EZ5 A;  1FJG K;  4B9U A;  4LF8 K;  2GV9 A;  4BRA A;  1NGH A;  1RTJ A;  3OY9 A;  4G1Q A;  2VG6 A;  5IWA K;  2D0A A;  1U2V B;  1EWR A;  5HRP A;  3SI6 A;  2E20 A;  3CCE N;  4BRI A;  1TKX A;  1HNX K;  3DXK A;  3SAG A;  3VEZ A;  3OS2 A;  3PV8 A;  3GDQ A;  3S3O A;  2E2P A;  1YI2 N;  1NU0 A;  1Y97 A;  3FFI A;  1YJ9 N;  4H03 B;  4RW6 A;  1S6Q A;  2G8U A;  5HL7 L;  3LM2 A;  4BRC A;  4OKJ A;  3P83 D;  3LDO A;  4FWO A;  3I56 N;  4LH5 A;  1DTT A;  1H1V A;  5EVZ A;  3M1F A;  4CF9 A;  4IOC L;  2E2Q A;  3UB5 A;  2WBN A;  4F4K A;  5SWM A;  3LZI A;  3MN9 A;  3R1X A;  2HF4 A;  3J7Y P;  3VGK A;  1FKP A;  1NGF A;  2NRZ A;  4A61 A;  4EHT A;  1S22 A;  1QQN A;  1BHL A;  3NH1 A;  4GV3 A;  3S3N A;  2EX3 A;  3LM9 A;  4JN4 A;  3H3O B;  2Q36 A;  3GOI A;  3U9Z A;  4BR4 A;  1GOB A;  1S9G A;  2PZS A;  3UKR B;  3R9P A;  4GV6 A;  5F2R A;  2HHH K;  4JKG A;  3VF2 A;  1TUU A;  3SBG A;  3AVF A;  3BZK A;  3T1H K;  4ISG A;  4M7X A;  4J8F A;  4BC2 A;  1LWE A;  1WSJ A;  1D9D A;  4DWI A;  4M3Z A;  3CIP A;  3EY1 A;  3CPE A;  1HYV A;  1IO2 A;  4JD2 B;  3SAF A;  3VF6 A;  1X9S A;  3MEC A;  4O4G A;  2E2O A;  5AQK A;  3PX0 A;  1BG3 A;  4FZX C;  2F9T A;  4JKC A;  3QEI A;  3AVK A;  4DR7 K;  2KQ2 A;  4NXN K;  3OW2 M;  3CCL N;  4BY9 C;  1HJO A;  3C6A A;  5AQH A;  4CHQ A;  4CF0 A;  2E2N A;  3NH0 A;  3HXM A;  5M1K A;  1R0A A;  4DMN A;  1OVY A;  3HVR A;  3LAN A;  1HKG A;  1S9E A;  3D2E A;  1E3M A;  3SJJ A;  4CZF A;  2O8C B;  4FM1 A;  2CGK A;  1TYQ B;  3QEW A;  4CEZ A;  3ENO A;  5C2F A;  3K5M A;  1SV5 A;  5E41 A;  4F2R A;  3L2U A;  1S1T A;  4JS5 A;  3THY B;  1WSH A;  3RMA A;  1RT2 A;  5FRM A;  1TAQ A;  4X62 K;  2HHT A;  3W0L A;  4M3U A;  4CZK A;  1WOQ A;  3LAL A;  4KHW A;  3HBT A;  1YHQ N;  4W5N A;  1JXB A;  3JS6 A;  3KJV A;  2HNY A;  1K9M O;  2FF3 B;  4YDU C;  4DU3 A;  1WSG A;  1C0F A;  3VES A;  4AF1 A;  1NJZ A;  3AVN A;  3L0Q A;  5IT9 O;  3RR7 A;  4B9N A;  4JKD A;  4Z4G A;  1QSL A;  1YXQ A;  5M1P A;  2HF3 A;  4B1W B;  1QS4 A;  3CXC M;  1NJI O;  5C0Y A;  4BVP A;  2Y1I A;  1VSL A;  3CCJ N;  1NK5 A;  4FJH A;  2DFF A;  3CI5 A;  4FWR A;  2E4L A;  2E8A A;  1VRU A;  3NFA A;  3VF4 A;  4OLA A;  1QSS A;  4LFB K;  1NMN A;  4H0O A;  2QXL A;  3KWG A;  5HRS A;  4CBX A;  3G71 N;  3SNN A;  2ZJP L;  3O9T A;  3HPH A;  3WEE B;  1VRT A;  2NNW A;  1O13 A;  1JXE A;  2ASO A;  3CHW A;  2E88 A;  1U04 A;  4E3S A;  1U49 A;  2P9K B;  2XO7 A;  2V7Z A;  1NGE A;  2VGM A;  1RDA A;  1W9H A;  3U9D A;  3C95 A;  4JKF A;  4BR7 A;  3CET A;  1NBW A;  1ILY A;  2IVP A;  3MN6 A;  1IKV A;  3SUO A;  5B8H A;  3OS0 A;  4LF5 K;  4B3T K;  3PUF A;  4GY2 B;  4CFD A;  4LD0 A;  1JJ2 M;  4LF4 K;  4E7H A;  1BI4 B;  1S1U A;  3T19 A;  3ID6 A;  1W7A A;  2RHK A;  3LP1 A;  2UUC K;  2D0B A;  2HVH A;  4CI6 A;  1LAV A;  5EU7 A;  4DQP A;  1UA0 A;  1D5A A;  2Z1G A;  3RRG A;  1QHT A;  5CHI A;  1SAZ A;  3QB0 A;  4JHD B;  1LAW A;  2QTD A;  2OZM A;  4PKH A;  4GVE A;  2G8H A;  4OKE A;  3KLG A;  4H5N A;  4PHT X;  2P9N B;  5F1X A;  5AQO A;  2QKK A;  4FOE A;  3QNO A;  4PUO A;  3ZET A;  2UXC K;  3SAH A;  1SL2 A;  3SUQ A;  4PQU A;  3MXJ A;  5C24 A;  3CJA A;  1FXX A;  1KLM A;  1ESV A;  3ZSR A;  4MDA A;  4CFB A;  1KVB A;  1VSD A;  3H3N O;  3WQT A;  5C15 A;  3TSU A;  1XNQ K;  1T8E A;  3MK6 A;  3VQ4 A;  3O08 A;  2O8F B;  3TAF A;  4DF4 A;  1XMQ K;  3DJC A;  3ZX2 A;  3LP2 A;  2VQE K;  3F9K A;  3U6F A;  3KD5 E;  4DLE A;  4FLV A;  3JAM O;  4IFE A;  3DMJ A;  3AO5 A;  4BRO A;  4IXC A;  3PLA A;  3NE6 A;  1RBS A;  3O4N A;  4BQL A;  4B9V A;  4JK8 A;  4DFM A;  3RSE A;  2NRH A;  1WB9 A;  4CJS A;  3FZH A;  1T3V A;  3C65 A;  3CJ1 A;  3VEV A;  3ZT1 A;  4YOW A;  5E84 A;  4RW4 A;  3AV9 A;  1TL1 A;  3LWM A;  1IJJ A;  2YV0 X;  2O4I A;  4A2B A;  3HM8 A;  1DTQ A;  3D2F B;  3AO4 A;  5BPM A;  2QWM A;  4JLH A;  4EHU A;  2V51 B;  3RRH A;  2YNH A;  3THW A;  1VSE A;  4N76 A;  3V9Z A;  1YF5 L;  3V4I A;  1UWB A;  1VQ8 N;  4PWD A;  2O8D B;  5AQG A;  3UIQ A;  2QKB A;  4B9L A;  1E4F T;  2JGU A;  5KQ8 A;  2PBD A;  1DGK N;  2QWQ A;  3NGY A;  3DLE A;  3RR8 A;  4FCY A;  5BRE A;  4B3O A;  1YJW N;  1QTM A;  4DTU A;  5AQL A;  4BG8 A;  4BQZ A;  3O8M A;  3NBP A;  4BR2 A;  3K2P A;  4BRG A;  4CK1 A;  1A5X A;  2PY5 A;  3HPO A;  4OPK A;  4B08 A;  2QW9 A;  4JKA A;  3AO3 A;  3T7Z A;  3ZT3 A;  4YOV A;  2JWL A;  5AQP A;  4GV9 A;  3ENB A;  2GEM A;  3JYT A;  1TK8 A;  2E1Y A;  1R59 O;  4M63 C;  3OYE A;  4HTU A;  2O8B B;  3TAM A;  4DHY A;  4KBO A;  3D7E O;  4DV0 K;  1KTQ A;  1HNW K;  3KK2 A;  3QO9 A;  4BRQ A;  4BE2 A;  1JCE A;  3KTQ A;  3MEG A;  1Y64 A;  4CJF A;  1N8R O;  2YJF A;  1BA1 A;  1IKX A;  3V1O A;  1NG9 A;  4XH4 A;  5JVH L;  4FM2 A;  3AGR A;  1NGG A;  4FJ5 A;  3RMD A;  4IOX A;  1XNR K;  4O44 A;  2WON A;  1BUP A;  1JL1 A;  3O3H A;  1T44 A;  3OYF A;  3AVM A;  4KI4 A;  3VQ8 A;  2AA4 A;  4CJP A;  2P9U B;  3EL2 A;  4AHS A;  4FWN A;  5GIP A;  1Q8I A;  2VWJ A;  4BRF A;  3SV3 A;  2YNG A;  2G8V A;  3CCM N;  1NGJ A;  4LH4 A;  5AZJ A;  2HST A;  2P5G A;  3WNH A;  4C23 A;  3P31 A;  1KQS M;  1RDW X;  1TAU A;  3B6O A;  4WQ5 A;  2NRT A;  2DTU A;  1VSI A;  4BWM A;  3M8R A;  3QIC A;  3NF9 A;  5KPZ A;  1U2V A;  3VQP A;  1WSE A;  2IIR A;  2PFU A;  4DSL A;  4CJ5 A;  5TKW A;  4KRF A;  1D4X A;  4FJJ A;  4A57 A;  2Q97 A;  1Q7Y O;  4HWI A;  5AZI B;  4QS8 A;  1HUX A;  1X3M A;  1I94 K;  3C94 A;  3FE1 A;  2D1K A;  3E9P A;  1HPZ A;  1T6C A;  4JI0 K;  1CZA N;  2IC3 A;  4OKK A;  1VQM N;  4KV8 A;  4E1N A;  3NCI A;  4AHT A;  4IDH A;  1RT3 A;  3G0Z A;  4CJ3 A;  2HMP A;  1VSF A;  3CC7 N;  3ID8 A;  4QAG A;  3ZYY X;  2EWS A;  1BGX T;  3BZC A;  1MWM A;  3O9U A;  1NGC A;  3GG4 A;  3O9S A;  1RBV A;  1FW6 A;  1KVC A;  1JL2 A;  2CH6 A;  3WXI A;  2IDO A;  4CW7 B;  2W6K A;  1NM1 A;  1SL1 A;  1K8K B;  1MU2 A;  3GBT A;  1RDU A;  3A2F A;  4DV5 K;  4OPA A;  3EZW A;  4A5A A;  3IS9 A;  2DFH A;  1RT4 A;  1N5Y A;  2A5X A;  3TSP A;  1QVF M;  2YKN A;  4BWJ A;  3N4P A;  1NK8 A;  2HB5 A;  5KRT A;  4ZHR A;  3VEX A;  3HRG A;  4CD3 A;  2VQF K;  3UKR A;  3MED A;  3WXL A;  2FF6 A;  1A5V A;  3MEE A;  4BRD A;  3V81 A;  2BH1 A;  1P90 A;  1NKE A;  2CGJ A;  4ZTF A;  1YIJ N;  1S6P A;  3TI0 A;  1N33 K;  4BRN A;  1S72 N;  5BRH A;  4M3R A;  4OPJ A;  4BRM A;  3AVA A;  3KLE A;  3CC4 N;  3ATU A;  5HLF A;  3QEP A;  4ID5 A;  3VQB A;  4JD2 A;  3DLH A;  5KPT A;  3QIP A;  1IBM K;  1RDB A;  3EO3 A;  5BPN A;  2DFE A;  3T1Y K;  4FO0 A;  4FPA A;  3V6D A;  3QLH A;  1HKB A;  1NK9 A;  4FJI A;  5GAG P;  4C8M A;  2KLA A;  1YT3 A;  3P5J A;  3BF3 A;  4ICL A;  3QBW A;  3VQE A;  3LPT A;  3BUZ B;  3M6G A;  4CHN A;  4LSN A;  4IO8 A;  4DV7 K;  2DY4 A;  1OH7 A;  3ZEU B;  2YHW A;  1XHZ A;  2O8C A;  1RNH A;  1TYQ A;  1D9F A;  4FSV A;  2QWL A;  3HP9 A;  4CJR A;  2DPN A;  4HUF A;  4LC9 B;  3THY A;  1ITG A;  2ASM A;  2J4R A;  1HPM A;  4Y0W A;  3O3G A;  1FKO A;  3HYF A;  3KLI A;  2HHS A;  2W40 A;  3ZX0 A;  2RF2 A;  4IG3 A;  4BE1 A;  3L8B A;  2HVI A;  2ZJR L;  2GTD A;  4E1J A;  3TAP A;  4C8O A;  4FK4 A;  4DR4 K;  4KTW A;  3ALY A;  3OYG A;  1RIL A;  4YOY A;  1ZBI A;  3A5O C;  4Z4F A;  5EXW A;  3CCR N;  3ULE B;  1NOZ A;  4Z4C A;  2PYL A;  3DAW A;  1DT9 A;  3O3F A;  2D4W A;  5J2Q A;  4FW1 A;  3WT0 A;  3SLC A;  3KK7 A;  3HSC A;  4IEE A;  1ATR A;  4I2Q A;  3DXM B;  5FPN A;  4FM0 A;  4C8L A;  3LP0 A;  2RPI A;  1ZBF A;  4K42 A;  3NGI A;  3IRX A;  3CME N;  4O8K A;  1RDD A;  1CZ9 A;  2KZZ A;  3EE8 A;  1D8Y A;  4RW9 A;  1GOA A;  1XI1 A;  2YI1 A;  3WEE A;  4B1U B;  3CER A;  5A2Q O;  1MA9 B;  3TAG A;  4ELU A;  3J8A A;  2P9K A;  1RBU A;  4O5B A;  3FZF A;  4DCH A;  2AJQ A;  2VG7 A;  1WN7 A;  3P39 A;  3TU5 A;  1LOT B;  3SMP A;  4DLG A;  2HBJ A;  2VWB A;  1VQ4 N;  1LW0 A;  1C0U A;  1JKH A;  1NK4 A;  4FJ9 A;  3CJC A;  1RT5 A;  3HPG A;  3IAY A;  4DKW A;  3AVJ A;  4BC4 A;  1NKB A;  1BI4 A;  1EWQ A;  3PSF A;  3LDQ A;  5AJ3 K;  4CJL A;  4M3W A;  3SK3 A;  2W6L A;  3FFK B;  4ILG B;  1VQK N;  1KAZ A;  5FDL A;  4NYN A;  1Z26 A;  1ATS A;  1JLB A;  2G8W A;  2FBY A;  3CQ8 A;  2WUS A;  3VEY A;  3MXM A;  3OA9 A;  1IG8 A;  4DQ8 A;  5KTQ A;  4JHD A;  4ISF A;  3WUH A;  1VK0 A;  1NK7 A;  3DYA A;  2P9N A;  4EZ9 A;  4AH9 A;  4H0T B;  3LPU A;  3FZL A;  3BGR A;  4IOA L;  2FXU A;  5AQW A;  3DM2 A;  3V1R A;  5AFU H;  3E66 A;  3CCQ N;  1Q82 O;  1CXU A;  4QS9 A;  5AQT A;  4W5O A;  1K73 O;  4DUY K;  4O55 A;  2HW3 A;  1DLO A;  4DV2 K;  5C42 A;  4FVU A;  4TSX A;  1FK9 A;  4CGH A;  4O8U A;  4OLB A;  3BDP A;  3SBT A;  1IKY A;  1Z6R A;  4HVJ A;  2O8F A;  1ZXO A;  4FWP A;  4KB1 A;  5HRR A;  4WE1 A;  4UQG A;  4BGA A;  1YAG A;  1TKZ A;  3N4Q A;  1HQE A;  2I7N A;  3EN9 A;  3P4I A;  1BL3 A;  2FSK A;  1G99 A;  4I6M B;  1WUA A;  2OPR A;  4ZTJ A;  3QML A;  5C10 A;  1N36 K;  4B1Z A;  3IFR A;  4E7L A;  3A5L C;  4JV5 K;  5D3G A;  2P9P B;  2YHA A;  4J2E A;  4KAZ A;  3IMX A;  3WXM B;  2KZM A;  4B9T A;  4FWS A;  3SQ0 A;  2X74 A;  2E1Z A;  4H0X B;  1WSI A;  3D2F A;  2XHB A;  1VQ9 N;  3AO2 A;  3LDL A;  2GUI A;  3O4W A;  4CEC A;  3SUP A;  4M45 A;  2O8D A;  5HRO A;  3CMA N;  3WNG A;  3OTO K;  3P1G A;  1RGI A;  4JI3 K;  4FLX A;  4DTJ A;  1NNE A;  4Q0B A;  4K25 A;  1I39 A;  1BQM A;  4QS7 A;  2OPP A;  1BOT O;  1KLN A;  5JIC A;  3SJH A;  3U8X A;  1JLG A;  3VQ9 A;  2HHU A;  3OJU A;  1IBK K;  1SS6 A;  4XIU A;  2BE2 A;  3CPW M;  3MWT A;  2HNZ A;  5ADX H;  1JLC A;  4IFV A;  3PX4 A;  2W41 A;  1KD1 O;  4CGD A;  1NGB A;  4B1V A;  3S3M A;  2O8B A;  1XHX A;  1J6Z A;  1RBR A;  4MLH A;  3QER A;  5LY3 A;  5BRD A;  1Q81 O;  3DI6 A;  3FR0 A;  2H3G X;  1QVG M;  3CJ9 A;  3J7Z O;  3FGU A;  2JLE A;  4AM6 A;  2UUB K;  3DRS A;  1YTU A;  4I2P A;  3HVT A;  4PKI A;  3KK1 A;  3KD1 E;  1J53 A;  4KKO A;  4K0K K;  4LFA K;  3OYN A;  4LSL A;  3AVG A;  2P9U A;  2GUP A;  1KFD A;  4FZY A;  3AAP A;  4CEQ A;  3OYL A;  4CHZ A;  4QCL A;  5JS1 A;  2QXF A;  2ASP A;  5E26 A;  4ELV A;  3ITH A;  3HI0 A;  4KFB A;  3THV A;  3K9J A;  1LCU A;  1RTD A;  4C8K A;  4Y1D A;  1KC8 O;  5AQX A;  3L6Q A;  4YOT A;  2QWO A;  2HBK A;  2P1J A;  3T69 A;  2O8E B;  2FSJ A;  2BAN A;  4FWQ A;  1Z25 A;  4CK3 A;  4R79 A;  1LW2 A;  4H4O A;  3G25 A;  1A5W A;  3CCU N;  2F9W A;  4DFK A;  4F3T A;  4OX9 K;  4KO0 A;  5AZI A;  3FLC O;  3FZM A;  4FJ8 A;  3WXK A;  1KAX A;  3O5B A;  3O4Q A;  5FPD A;  1JLA A;  1TVR A;  4JAX A;  4LF9 K;  4NCB A;  4BAC A;  2KFN A;  3VEO A;  1BO5 O;  1TUY A;  1OH6 A;  4DTX A;  4Z0U A;  5C12 A;  4CJV A;  1GLE G;  2IOC A;  3WQU A;  3ZT0 A;  2ETJ A;  1VQ5 N;  4DQQ A;  3ULD A;  1UAX A;  1VSJ A;  3VQ5 A;  3HST B;  3KIO A;  1VQ7 N;  4CFC A;  2FC0 A;  4CGJ A;  3KZB A;  4OJR A;  3O80 A;  1CZB A;  2WC9 A;  5AQI A;  4JNE A;  1YVU A;  4JRP A;  3WXJ A;  3J80 O;  1TL3 A;  1K8K A;  2Q2R A;  3LP3 A;  4H5T A;  4CF2 A;  4W5Q A;  3G4S N;  1IKW A;  3AGK A;  4M3T A;  3A5N C;  2OYQ A;  4CE9 A;  2FBX A;  1OKJ A;  3ISN C;  3OYA A;  4XH5 A;  4DR1 K;  4WFA L;  1S3X A;  3NH2 A;  1G15 A;  2XY7 A;  4WCE L;  2ZJQ L;  2UUA K;  3CCS N;  1BA0 A;  3U4L A;  3VQ6 A;  5KRS A;  4K8Z A;  2HHW A;  1YJN N;  1P8Z A;  4YNQ A;  5EX5 A;  5J2N A;  4CJU A;  1EX4 A;  1U47 A;  5KI6 A;  3NVM A;  3VEW A;  4YOX A;  3H45 C;  4MO4 A;  3K5L A;  2ZGY A;  4N47 A;  4JI1 K;  5CZ1 A;  2A40 A;  4C1N K;  3K58 A;  3VQ7 A;  4BGB A;  5FLX O;  3V1Q A;  2YHB A;  3AVB A;  3AA5 X;  4IDK A;  1W0H A;  2YJE A;  4DS4 A;  3M5R A;  4CEF A;  1WSF A;  5DK5 A;  4KH4 A;  4KH5 A;  1UOC A;  1W2B M;  4JI6 K;  1SL0 A;  1VSM A;  4BR9 A;  1O1W A;  4FK0 A;  1RBT A;  4NCG A;  3VQD A;  1WAJ A;  1BIS A;  3ZEU A;  3KLH A;  1BIZ A;  3L2Q A;  2UYT A;  4IBN A;  3LAK A;  1XMO K;  1JCF A;  1RT6 A;  3I33 A;  2ITM A;  4B9Q A;  3HL8 A;  4CZG A;  1T7P A;  2VCP A;  4J2B A;  3NMU A;  4PKG A;  3TWH A;  1X9M A;  1NOY A;  4FJX A;  5JLH A;  3SPZ A;  4O0J A;  4XH1 A;  4CZJ A;  2FLO A;  3RVC A;  4AHC A;  3CF5 L;  4F3O A;  4WQ4 A;  1J54 A;  3DLL L;  5FPE A;  4AQY K;  1KAY A;  5JVG L;  3DWL A;  1NJW A;  2RE2 A;  5AQR A;  4W5R A;  4KHQ A;  3DLB A;  2WOM A;  1LWC A;  5T7B A;  2EHG A;  4EFH A;  1HJR A;  4FLY A;  4FZZ A;  3ULE A;  3PY8 A;  2ZE2 A;  2A1R A;  1IV0 A;  5AQZ A;  5CYQ A;  5M1F A;  3QET A;  2BTF A;  3MDQ A;  3JXU A;  2B5J A;  1RT1 A;  4GMJ B;  1DKG D;  4BE0 A;  4H4M A;  2F8T A;  4M41 A;  4FWK A;  4HTL A;  2F7T A;  3DXM A;  4CGI A;  3QIO A;  3ZSO A;  4CJE A;  1HYS A;  3QDK A;  4FJM A;  4WQ5 C;  3TAB A;  3O1W A;  1M1K O;  3L2R A;  3ENH A;  3TAE A;  4K41 A;  4MO5 A;  2I7P A;  1B9F A;  4I7F A;  5LJV A;  1L3V A;  4NCA A;  4CCH A;  3HJF A;  2AP1 A;  5J2P A;  5CZ2 A;  1HRH A;  2HBM A;  3VGL A;  2LSN A;  1XQS C;  5KGX A;  5HOO A;  4CBW A;  5C2D A;  1T05 A;  3SMS A;  5GAE P;  4KTQ A;  1VQP N;  3L4I A;  3AA4 A;  1OH8 A;  3QBX A;  4CEA A;  3M8S A;  1VQL N;  1UA1 A;  4AHU A;  2Q1N A;  3EKS A;  2F4V K;  5CY4 A;  3CCV N;  4PY5 A;  2HND A;  2Q31 A;  4JI4 K;  2KTQ A;  1OVQ A;  3PO5 A;  1Q9Y A;  4E0D A;  4NO7 A;  2BDP A;  3QEX A;  4DTN A;  4L8R B;  3LZJ A;  1E4G T;  1ZC6 A;  3KWI A;  3H1V X;  1U48 A;  2A6A A;  3OS1 A;  5LMN K;  3ZSZ A;  1QQM A;  3PSI A;  4CGF A;  4IO9 L;  3MAQ A;  3F5T A;  1K8A O;  1REV A;  1TKT A;  4FJN A;  4BRE A;  2OA8 A;  3C6U A;  4B1Y B;  1IG9 A;  5KPR A;  2KW4 A;  4B3M K;  1QZ6 A;  2ITG A;  3PO4 A;  4N56 A;  4RW8 A;  4PL7 A;  2VGN A;  3PIP L;  4DV1 K;  5BR8 K;  4JEP A;  1C0M A;  1M90 O;  4DG1 A;  1RT7 A;  4DV3 K;  2OZS A;  2ZF5 O;  2NUB A;  3ZT4 A;  1BCM A;  4DR2 K;  3TSQ A;  2CH5 A;  1BWF O;  3VQA A;  3V9U A;  4Z94 A;  3J7A P;  3CM6 A;  3FZK A;  4H5R A;  4RWT A;  1X9W A;  4GKK K;  1HR0 K;  3DLK A;  5DMR A;  5M1O A;  2YHX A;  4QOZ B;  4CIF A;  5SZT A;  2Q0R A;  2UXB K;  1N6Q A;  3R8E A;  3R6M A;  3MWP A;  2X78 A;  4CJW A;  4KHS A;  4K43 A;  4M42 A;  4E7K A;  4KTZ A;  5EY4 A;  3B8A X;  1BQN A;  4CER A;  5CE3 A;  4WFN L;  4FK2 A;  5BN8 A;  4FOI A;  2FBT A;  1Q9X A;  4HUG A;  5AQV A;  4I6M A;  4FJK A;  1BIU A;  1KSP A;  3HTV A;  1F21 A;  3Q7C A;  4LF6 K;  1EO1 A;  1HKC A;  4GW6 A;  4DSK A;  2P9P A;  2IAJ A;  1VSK A;  4KH6 A;  4E89 A;  3VTI A;  1Q86 O;  2OCE A;  4C8N A;  4HCB A;  4KPY A;  2ZQB A;  3RMC A;  4FPB A;  4YY3 K;  3TPQ A;  3HZ6 A;  1QSY A;  3ZSV A;  3OJS A;  1WNS A;  4CJ4 A;  3T3F A;  2OTJ N;  2E5L K;  1GLC G;  4A5B A;  4X66 K;  1NLV A;  3ZSY A;  4ELT A;  4JI7 K;  3QNN A;  4DV6 K;  3VA0 A;  4CZH A;  4OGE A;  3K5N A;  5KQD A;  3L2V A;  2VYP A;  3E1Y A;  3TAR A;  4KB0 A;  5EOY A;  2QWR A;  4KHP K;  1Q18 A;  2A3Z A;  3H6E A;  3E9O A;  4BR0 A;  4DUZ K;  3K0S A;  4JRQ A;  4NB4 A;  5GAD P;  4NYF A;  5I9E B;  3D6R A;  1IH7 A;  3I0R A;  4E7I A;  3VMF B;  3KLF A;  2O4G A;  2JWK A;  5M1Q A;  4H0Y B;  4J2A A;  2A1S A;  3TAN A;  5BN9 A;  4W5T A;  1KXP A;  1WBD A;  1VAZ A;  2XY5 A;  3F9M A;  3AA3 A;  3C7N A;  3H08 A;  3U3Y A;  3R3L A;  2P9S B;  3W3D A;  3NF6 A;  4BRH A;  4KI6 A;  4FJ7 A;  3CQY A;  1ZBS A;  2P9L B;  1J5E K;  1WAF A;  4EIA A;  3D0P A;  3D45 A;  3OBW A;  4YOU A;  1KVA A;  4HCC A;  3CM5 A;  3EE9 A;  3CJB A;  4KRE A;  1HYZ A;  1ZYQ A;  1XWL A;  3PX6 A;  2YNI A;  4LF7 K;  1XUP O;  5BPL A;  2VWK A;  5LJW A;  5AQJ A;  4H5W A;  4CED A;  4YFU A;  3G6E N;  4EAH D;  1NMD A;  3G10 A;  1DEJ A;  3VQC A;  1WLJ A;  1QQC A;  3DOK A;  3UE5 A;  2FSN A;  2A42 A;  5AR0 A;  1T6D A;  3I8B A;  3NHG A;  4FLU A;  4B1X B;  3U3G A;  2XY8 A;  5AQM A;  1B92 A;  3UKU B;  3A8Y A;  4CFA A;  4F8R A;  3S41 A;  3O9Q A;  4NXM K;  1EKE A;  3DRP A;  4MDB A;  4R5P A;  4E19 A;  2HBL A;  3K57 A;  2O8E A;  5FRN A;  3IG1 A;  1BDG A;  4EZ6 A;  4BRL A;  4GNI A;  2HHQ A;  1HLU A;  4IG0 A;  2BGG A;  3MX5 A;  3THX B;  4PA1 A;  3NVK A;  1J5O A;  3TTD A;  1HMV A;  5LL6 Z;  1YIT N;  4OVL A;  3EKU A;  1S5J A;  4DB3 A;  4DQR A;  2P9I B;  5AQU A;  4CJT A;  3S9H A;  3ZSX A;  3VOV A;  3LAM A;  1ZBH A;  3OYJ A;  3RWU A;  4IWV A;  1GLB G;  1ASW A;  4N5S A;  3OYM A;  3C0B A;  1SKR A;  4Z4I A;  1HNI A;  4YDU A;  3CG7 A;  4KHY A;  3CFO A;  2QI2 A;  4M3Y A;  1W97 L;  5HBM A;  4CZE A;  4IJA A;  2IS3 A;  1QZ5 A;  2B6A A;  1JLQ A;  4RTF D;  4DU1 A;  2G8K A;  4DU4 A;  1C1B A;  1VQO N;  1BU6 O;  3TTC A;  4JK9 A;  1NJX A;  2D0O A;  4JYA K;  3AO1 A;  3AAR A;  4MLE A;  1B9D A;  3EEQ A;  4M7Y A;  1QQO A;  1CXQ A;  4DTS A;  2GWK A;  4H5V A;  4BG9 A;  2ATQ A;  2XY6 A;  1SKS A;  3LL3 A;  5JMV A;  1IBL K;  4KHU A;  2Z1J A;  4CEB A;  1LV5 A;  1X1P A;  3KK3 A;  3DXK B;  2GBZ A;  4YHH K;  3PIO L;  3C6T A;  3A0I X;  2XRI A;  3TR8 A;  5I3U A;  4FJG A;  5DM7 L;  3NDK A;  4DTR A;  1MDU B;  1JLE A;  4AM7 A;  5LMU K;  1V4T A;  4DTO A;  3LDN A;  1OH5 A;  4B9M A;  1TK0 A;  1TV6 A;  4FL9 A;  4O0I A;  4XEI A;  1L3T A;  2BUP A;  3C7N B;  4Q5V A;  1C6V A;  2Z1H A;  2RN2 A;  4CHP A;  5BRF A;  1N32 K;  3KVG A;  1SUQ A;  4ISE A;  2Q3S A;  3AVH A;  2F8S A;  2ZM6 K;  2KKZ A;  4CF8 A;  4CJ7 A;  2F96 A;  4FLW A;  4FJL A;  3MX2 A;  1NGD A;  2Z1I A;  3ZT2 A;  1EET A;  3HO1 A;  3AVL A;  1C1C A;  5GAH P;  4RG8 A;  2ZGZ A;  3AA2 A;  5I42 A;  4BR5 A;  1ZBL A;  4G9Z A;  1NWK A;  2E6L A;  4EP5 A;  4RW7 A;  3ZX3 A;  4CHO A;  3ASM A;  3SYZ A;  2OPQ A;  2NZT A;  1YTA A;  4DSI A;  4A59 A;  4F2S A;  3MN7 A;  2OPS A;  3WNE A;  1VHX A;  1EXQ A;  4GVM A;  4DSE A;  4X64 K;  4BRP A;  4F9O A;  2UU9 K;  4CZI A;  2YCH A;  1S1X A;  3BP8 A;  1KCF A;  4ILH A;  4JKG B;  3MXI A;  3CD6 N;  3OYH A;  1YVN A;  1L5U A;  4OPH A;  4DTP A;  3LDP A;  3OYI A;  2YNF A;  3MMV A;  3CJ7 A;  1HQU A;  3T1A A;  2PYJ A;  3CFP A;  3H1Q A;  4FVM A;  4BC5 A;  2GX9 A;  4FWM A;  3B6P A;  4BC3 A;  4DFP A;  5AQY A;  2WFB A;  2B4J A;  3CC2 N;  2P51 A;  1TK5 A;  4CEE A;  5GIO A;  1T03 A;  4X65 K;  1U6Z A;  2NRV A;  3HOT A;  1L3U A;  4HHT A;  3HK2 A;  5M1N A;  1EQY A;  3BEX A;  3NF7 A;  3NAE A;  1Z05 A;  1YUW A;  3D2E B;  1S1V A;  4OO1 J;  2HOE A;  3OYD A;  2CGL A;  4B8A B;  4FXD A;  1HX1 A;  1RFQ A;  4A2A A;  3KHY A;  3E01 A;  3OVN A;  1BCO A;  1EP4 A;  1JCG A;  4CIG A;  5HRN A;  2E6M A;  4B8C A;  1HNZ K;  3ZSQ A;  4GKJ K;  1GLL O;  4Z4E A;  4BRK A;  2PAV A;  5KGW A;  3JSM A;  4MQ3 A;  4CHY A;  3SZ2 A;  2Y1J A;  3KKR A;  3OYK A;  2QA4 N;  4CZM A;  4WYB A;  2V7Y A;  3BF1 A;  1RDC A;  1X9J A;  3A5M C;  3VQQ A;  3OYB A;  3OBY A;  4I9L A;  4CF1 A;  3LDS A;  1GLD G;  4DR5 K;  3MN5 A;  1VQN N;  3WNF A;  3KKS A;  4IEI A;  3M8P A;  2I5J A;  3J81 O;  4V19 S;  1SKW A;  4JI2 K;  3O1B A;  2HHX A;  3Q7B A;  2D0C A;  4BVO A;  4B3S K;  3QFP A;  4BDZ A;  1QE1 A;  2QEX N;  2X6S A;  5C25 A;  1V4S A;  1U45 A;  1N34 K;  1I3A A;  4U7B A;  4JKB A;  4B3R K;  2ZWH A;  3E9L A;  3ZSW A;  3K5O A;  3H46 O;  3VA3 A;  5H1S Q;  2YHY A;  4JI5 K;  5FRO A;  1RTI A;  1JLF A;  4RCH A;  2FBV A;  3K9K A;  3M3Z A;  4Z4H A;  5MLC Q;  4JKE A;  3HM9 A;  2HHV A;  3C6H A;  4H0P A;  4J2D A;  5GIN A;  1KRP A;  1SQK A;  4DQI A;  3L2W A;  4C1N I;  1KFS A;  5AQS A;  2OAN A;  1LWF A;  1ASU A;  3VN5 A;  4DS5 A;  2IVN A;  4DFJ A;  4DQS A;  2YX6 A;  3V9X A;  3SUN A;  1NK6 A;  1SZ2 A;  3QES A;  4HUE A;  1GLJ O;  4AIL C;  3AY9 A;  3IKM A;  4JS4 A;  3SV4 A;  4A62 A;  5TKY A;  1TGO A;  2G8F A;  2R7Y A;  2OTL N;  2A41 A;  1RCH A;  3SPY A;  4WQ4 C;  4JKH A;  4OGC A;  2Q0U A;  4LFC K;  4FW2 A;  3RMB A;  4AHV A;  5BR9 A;  3I55 N;  2YKM A;  1XC9 A;  5HP1 A;  3ZET B;  5ELZ A;  1NKC A;  2KHO A;  3P38 A;  4CJK A;  2NLX A;  4U67 L;  2UXD K;  3OHR A;  3AVC A;  4IKF A;  4FLZ A;  3RTV A;  3F73 A;  4M3X A;  3L4Q A;  5F0X A;  5AQN A;  3SQ4 A;  5DM6 L;  4E1M A;  4MFB A;  4JK7 A;  1GLA G;  1C0G A;  4BDP A;  4DSJ A;  1CLQ A;  3I0S A;  3DRR A;  3QFU A;  3L3U A;  2NRX A;  3V9W A;  4PL8 A;  3NGZ A;  4FLT A;  1WBB A;  4CZL A;  3IUC A;  4WF9 L;  3ZLJ A;  3VPZ A;  3VEN A;  2HMI A;  5AFU A;  4WFB L;  1ASV A;  5AQQ A;  3VTH A;  2P9S A;  3CQX A; 
#chains in the Genus database with same CATH homology
 4LF9 K;  4B3R K;  3OTO K;  4DV7 K;  4JI3 K;  5AJ3 K;  4DR7 K;  4DV1 K;  4NXN K;  4JI5 K;  1FJG K;  4AQY K;  1I94 K;  5BR8 K;  4LF8 K;  4LF5 K;  4B3T K;  4JI0 K;  5IWA K;  4LF4 K;  4DV3 K;  4DV4 K;  4JYA K;  1IBK K;  4DR2 K;  2UUC K;  3J80 O;  1HNX K;  1J5E K;  4DR6 K;  3J7A P;  4X65 K;  4CVN E;  4DR4 K;  4GKK K;  1IBL K;  1HR0 K;  4LF7 K;  4X62 K;  4DR1 K;  4CW7 B;  2UXB K;  4YHH K;  2UUA K;  4DV5 K;  4DUY K;  4DV2 K;  2UUB K;  4DR3 K;  5LMU K;  2UXC K;  3J7Y P;  1HNZ K;  4GKJ K;  4K0K K;  4DV0 K;  4LF6 K;  1HNW K;  5IT9 O;  4LFA K;  2VQF K;  4NXM K;  4JI1 K;  4LFC K;  1XNR K;  1XNQ K;  5FLX O;  2F4V K;  1N33 K;  1N32 K;  1N36 K;  4YY3 K;  1XMQ K;  2ZM6 K;  2UXD K;  4JV5 K;  5A2Q O;  4JI4 K;  2VQE K;  2E5L K;  4JI6 K;  4X66 K;  3JAM O;  4DR5 K;  2HHH K;  4LFB K;  4JI7 K;  1IBM K;  5LL6 Z;  3T1H K;  4DV6 K;  3J81 O;  5LMN K;  3T1Y K;  4V19 S;  4JI2 K;  4OX9 K;  1XMO K;  4JI8 K;  4KHP K;  4B3S K;  4X64 K;  2UU9 K;  4DUZ K;  1N34 K;  4B3M K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...