4B3TL

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3tL00
4A3IG 4NXNL 1YHQA 2K52A 3U58A 4PG3A 1YI2A 4A75A 3A0JA 2N78A 4DV4L 1OXVA 4IPCA 3K7AH 1X3GA 4A3JH 2K4KA 4YWMA 2ID0A 4DV6L 4BXXG 2UXCQ 2BA1A 4L5QA 3ER0A 3HFZB 4GLAC 1AH9A 2OTJA 1N36Q 3L7ZC 2CQOA 3PO3H 4A3EH 5LMNW 2E5LQ 1IBKL 4XIGS 4GNXC 4JYAQ 3K8AA 2UXCL 2NN6G 2ZJPA 4LUOA 4IJHA 3HOWG 1QVCA 1Q8KA 4DR4Q 1PA6A 4IPHA 3GD7A 4P75A 3S24A 1G291 1D7QA 3ULLA 4JOIA 1FGUA 1XTDA 1Q1BA 2ALYB 3PCOB 3DM3A 3CCVA 3M3YH 3CXCA 2ES2A 4A4IA 4NXNQ 3PIOA 1NTGA 3RZDH 3A74A 2HHHQ 1HR0Q 3GTGH 3H0GH 2WAQE 4PMWA 4GOPC 2MFIA 1Q81C 1YJWA 1QZGA 2NVTH 4HIMA 2HHHL 2UUBL 4LF9Q 1N36L 2EIFA 3UDXA 3CP0A 4X64Q 1E1TA 2B29A 4BY7G 1TWGH 1WCMH 4IPGA 1L0WA 1VQKA 5M3FG 4DR3Q 1KC8C 4LUVA 4LF8L 3CPFA 1VQBA 2A1AA 3L2PA 2JA8G 2JEAI 1X54A 4P72A 1HNXQ 4OWWB 4PZ7A 1HNWL 5C4JH 4B3ML 3NENA 3AYHB 3CF5A 1X56A 4JOIC 5IE8A 4A93G 5BR8L 1HJPA 1VQOA 4R4QA 3TREA 1XPOA 4BBSH 2KCTA 3STBD 2UU9L 4JI1Q 1Z47A 2JA9A 4QIWE 3HOWH 1I6HH 3H15A 1EFWA 1YHAA 2ZTCA 4TVAB 4BY1H 4QGUA 4NXML 3S2HH 4FDBA 4DUZQ 3FKIH 1JMCA 4OXPA 1JE5A 3CC4A 4HJAA 1SLJA 4DR3L 3S1MH 4RMFA 3S1QH 3CCLA 2XTIA 4A3GH 2PI2E 4A3KH 1Q82C 4DR4L 3FHWA 3HKZE 3F2DA 3TS0A 2R92G 4OWTB 4KHPQ 3HOVH 4DUZL 4HJ7A 3S15H 1VQEA 3S17H 1Y1WG 4X62L 4BBSG 4JI6Q 2GN5A 4GNXA 1JJGA 2ZTDA 4IFDG 1HNZL 1IL2A 2CWAA 2OWOA 5H1SE 3I4MH 3EBEA 3WWVA 4DR6Q 1N33L 4KLKA 1WCMG 1Y1VH 2KHJA 3RLOA 1XMQL 1Q46A 5AJ3Q 5M3FH 2HT1A 1I94Q 3I2ZA 4L5RC 1VQNA 1L2FA 2NN6I 3H0GG 2ASBA 5C3EG 4HJ8A 2NVXH 4ALPA 1VCIA 4DK6C 1YIJA 1XNRQ 3OTOL 3PUVA 2UUBQ 3KLWA 4ME3A 4LF9L 4GKJL 1B7YB 3W5OA 1IBML 3A5UA 3F1ZA 3AEVA 1VS0A 4AQYL 1N34L 4JI3L 3HKZG 1S40A 5LMNL 5IP7H 1EQRA 4DV5L 2UXBQ 1R9TH 4DR7Q 1AE3A 1PH6A 4NB3A 4P73A 1MJEA 3PUZA 3GTPH 1VQJA 1I3QH 3CC7A 2K5HA 2WP8J 4JI6L 4MNOA 4JI7Q 2KBNA 2A19A 1PH7A 2UXBL 3U4ZA 4C3IH 1K73C 3STBC 3KFUA 1MIUA 4YY3L 3IRBA 3CCJA 3CCQA 1G51A 4YCWA 3ULJA 4YWLA 2JA5G 4LFBQ 3RLNA 1V43A 2WB1E 3L0OA 4DV2L 3J7ZC 1PH9A 1MJCA 3HKSA 1XNRL 3OTOQ 2Q2IA 4DV0Q 2E2JH 4IPDA 1VQ4A 3TS2A 2R7ZH 1X3EA 3H3VI 4OX9Q 4JC0A 5DLQE 2YV5A 1GKHA 2D0PA 4JBJA 5ELNA 3M4OH 1XNQL 4B3RQ 1BVSA 3D31A 4A3GG 2B63G 4JI8L 5LMUL 2R92H 4JG2A 4C3HH 1PH3A 4LF4Q 1TWCH 1UWVA 1EOVA 4JI1L 5E7NA 1A63A 2CWPA 4JCVE 1P16A 4DR5L 1XNQQ 2ZM6L 4J15A 4A3IH 4B3RL 1N32Q 3EIVA 4DV3Q 5IYDG 1EIFA 1U5KA 2YTYA 2QA4A 4A3MH 1OTCA 4LF4L 1L1OB 2YTVA 2IHFA 3FP9A 3G4SA 4OO1G 3U50C 4NXMQ 4LFCL 3S1NH 2Q2UA 4R4IA 4EQ5A 1UE5A 3J81c 3CMAA 2KCMA 1YVCA 4DR1L 4LF7Q 2JE6I 2KHIA 3CCSA 1W3SA 4AIMA 4GLVB 1Q1EA 5IYBG 3MEFA 2UUAL 2R6GA 4AQYQ 1N34Q 4JV5L 1VQPA 2JA6H 4P71A 4BBRH 5C44H 1IYJB 5C0XI 3S1RH 4A3EG 1RIPA 3KF8B 1YBYA 4DK3C 3CCRA 1GO3E 3G71A 2QGQA 4UP8A 1JB7A 4B3SQ 3HOUG 3AFPA 1G6PA 1BBWA 4QQBX 3UDGA 1GM5A 2PQAA 1E22A 1XMOQ 4DNIA 2OQ0A 2MO0A 3I4NG 2EQSA 3RZOH 2UXDL 3Q8DA 2ZM6Q 1PH4A 4L5TA 1DGSA 4XTCS 4LNQA 4DUYQ 4JI0L 2IHEA 4O0AA 3JC66 2UXDQ 4NPSA 3E9IA 4R1JA 4LFCQ 1LYLA 5FJ8G 2UUCQ 1E1OA 1SRUA 1EUJA 2IX0A 1B70B 3PF5A 5LMNQ 1CSQA 2OTLA 2JA6G 3KF6A 3BZKA 5FLXc 3HOZH 2UUAQ 2Z6KC 4POFA 2Q2TA 2VQFQ 1XPUA 1KIXA 1JJCB 5J3BA 3PO2G 4HJ9A 4BY7H 4A3CG 4QL5A 4OX9L 2RCNA 1PHJA 1VQ7A 1CKNB 4JI8Q 4DV1Q 3W1GA 1E7ZA 1C9OA 3B6YA 4YY3Q 4OONA 1Q86C 4JBKA 4RG1A 2LSSA 4Y52H 3KYHC 3K7UC 5BR8Q 4P74A 4IOAA 3CD6A 4C3JH 1LM0A 1KAWA 1BBUA 2F4VQ 1TWAH 5K36G 4A93H 4A3MG 3PF4A 2AKWB 2E2IH 4C2MH 4KHZA 3GTLH 1XPRA 1KD1C 1PH5A 2DGYA 4LUZA 1YEZA 4AYBE 3DLLA 3FKIG 3KDFB 3M9BA 5GAGC 4JI4Q 5GAHC 4DPGA 1TWFH 1U0LA 3F2CA 3KJPA 2ZJQA 3LGJA 3SGIA 3I55A 4UY8C 1C7YA 4YHHL 2VUMH 2Z0SA 4KHPL 3HOVG 2WFWA 4DV3L 4APVA 1QVGA 2K75A 1VQ6A 3S14H 3PUWA 4LF5Q 1TWHH 4A3DH 1V9PA 1HNZQ 1CSPA 5GQOA 1VQFA 4OWXB 3ERSX 3ULPA 1Y14B 1JJ2A 2E5LL 4B3TQ 1FVIA 1PYBA 4HIKA 3CPWA 4DR1Q 2E2HH 1Q12A 2MQHA 2VNUD 4GN4B 2E8GA 2MO1A 4YWKA 4H02A 4YCUA 1FL0A 4JV5Q 2K5NA 3RNUA 1SROA 1HZBA 2ZJRA 4GKKQ 3PSIA 2HIVA 4LF8Q 4BA2I 2NZOA 3M4PA 1KHIA 4DV7L 3J81j 2QEXA 4JI5L 3UDIA 4POGA 3CAMA 4X62Q 1VQMA 1PV4A 1VQ8A 1H95A 2Z6KA 1S3OA 4YHHQ 1BKBA 2F52A 1PYSB 1PH2A 2NVYH 3UDFA 1X55A 4GOPB 4JI5Q 2R7FA 3BJUA 4DUYL 4K0KL 4X6AH 5IYCG 3J81i 1K83H 4A3BH 4TQUS 5GROA 4R4CA 1VQ5A 4A3FH 1C0AA 5IP9H 5M5WH 4WJ4A 4DKAC 3E9HA 4K0KQ 2IT1A 4AH6A 2B3GA 4GKJQ 2PNHA 4GS3A 1VQGA 4LFBL 4OO1I 1P8LA 2N49A 1I5FA 2BH8A 1MKHA 5FLMG 2VZAA 4DV5Q 1Q7YC 4LF6Q 1X3FA 3OYYA 2I0QA 2AWNA 1X6OA 4QJFA 1EYGA 2K5VA 3ZJYC 3M4QA 3PUYA 4JBWA 2VQEQ 3H3VH 1VQHA 4X66Q 2VL6A 1LUZA 4A3BG 2EXDA 3F2BA 1HNXL 3TRZA 1CKMA 2VQEL 1N33Q 1YZ6A 4GN3B 1WFQA 1HR0L 1OXXK 5GADC 1VQLA 2IY5B 4LW1A 3PV0A 2K14A 4DV4Q 4A3DG 4DR5Q 5JJLA 2F3IA 1VQDA 1CUKA 4A3KG 3GTOH 2DUDA 3GTMH 3W1BA 3CMEA 1NMFA 3KOJA 5EAYA 4JI3Q 4JI4L 3M7NA 4O2DA 4GKKL 3GDEA 1NY4A 5GAEC 3E0EA 3KDFA 2N3SA 4R4TA 1Y1VG 3GTQH 1PVOA 4DAYB 3CW2C 4B3MQ 3JAMi 4A3JG 4GN5A 4BBRG 2PI2A 5C3EH 3HOXH 3BU2A 5FJ8H 1Y1WH 4X65Q 1AE2A 5C0XJ 2ZTEA 2HQLA 3CCEA 4DV6Q 2Q2HA 4B3TL 2UU9Q 1OXSC 1XMOL 1O7IA 3RLFA 2KENA 1IBMQ 3TEHB 3GTJH 3I4MG 3HOZG 2I5LX 5IYCH 1IBKQ 3CC2A 4DV2Q 1I50H 1LTLA 5JJKA 1QUQB 4A3FG 5M5XH 1GVPA 3UE1A 1HH2P 2D62A 1WJJA 1HZ9A 5JEAG 1I94L 1IXRA 1J5EQ 2OCEA 4DR2L 4Y7NH 1A0IA 3VDYA 5IY0A 3K0XA 4LF6L 1NMGA 3D0FA 2RF4A 5IT9c 5FLMH 5HGQA 3HOXG 3BZCA 1HR0W 2NVQH 3PO3G 1L1OA 3J7A5 3G6EA 4L5SA 1VQIA 4X66L 1KQSA 3HOYG 4IFDJ 4DAMA 2NZHA 3PO2H 4YCVA 1YJNA 2V1CC 1WOCA 1XJVA 1UE1A 3JAMc 2JA5H 1XMQQ 2N8NA 4JI7L 2BA0A 5M5YH 4DV0L 2UUCL 3NBHB 4PZ8A 1KL9A 1K3RA 4BA1I 1UE6A 1IBLQ 3UE0A 2YYZA 2F4VL 1NJIC 1UE7A 1SFOH 4A3LH 4HJ5A 1PH8A 1A8VA 2AMCB 3CCUA 4DR2Q 4JI2L 1ASYA 2B63H 2JK8A 3HOYH 1PH1A 1EQQA 1UEBA 4B3SL 1T9HA 1YHBA 4AYBG 2MNAA 3M85A 4LFAL 1YITA 1FJGL 3ICEA 2HIXA 1SN8A 1WI5A 3I4OA 1Z9FA 3OW2A 2WB1G 3F8TA 2YTXA 4X65L 1S72A 2JA7G 4DR6L 3KJOA 1IZ6A 5M3MG 5IYBH 5ELOA 1FJGQ 4IFDI 4BY1G 3NEMA 3NELA 4LWCA 4PZ6A 1N9WA 2K50A 4A3LG 3KF6B 2GVBA 1K0RA 5IWAQ 4IJLA 2CFMA 2WAQG 3S16H 1JT8A 3HOUH 2CCZA 2R93G 5JJIA 4R4OA 3RN5A 4JI2Q 3I4NH 4JYAL 3PGZA 2PMZE 5IWAL 4GLXA 3T1YQ 4LF7L 4WJ3M 2Y0SG 1YJ9A 5C4XH 1QVFA 2RHQB 1SE8A 1SR3A 1K8AC 3AFQA 1WYDA 1SMXA 3MXNB 3K81C 5C44G 4LFAQ 3GTKH 3EN2A 2GVAA 3TQYA 4JI0Q 2C35B 2LXKA 5AJ3L 3T1YL 1VQCA 2BH2A 2JA7H 4BXXH 4HIOA 1CKNA 2VS1A 4UP9A 4GNXB 1N32L 2JJQA 4JBMA 1VQ9A 1ASZA 4MTNA 1OXUA 1J5EL 3I56A 1KRSA 5IP9G 4GOPA 1KXLA 2YU9H 3A5ZB 1YNXA 2OQKA 4UP7A 3J80c 3PIPA 3GO5A 1QUQA 4DR7L 4KI0A 1KRTA 4IO9A 5C4XG 2AHOB 2Y0SE 1HZCA 4DV1L 2VW9A 1V1QA 1M90C 3K80C 4EX5A 4IOCA 2ATWA 2VY3A 1N8RC 5M3MH 4MZ9A 2A8VA 1D8LA 2JEBI 3T1HL 5LMUQ 2VQFL 2I5HA 3S2DH 1HNWQ 1HZAA 2PQAB 2RHSB 1J6QA 3AQQA 5IP7G 5C0XG 1K9MC 3U4VA 4UPAA 3RR5A 4A76A 2FXQA 2H5XA 2I5MX 3CCMA 1X9NA 1GD7A 3T1HQ 1M1KC 2R93H 1IBLL 1EIYB 5HY6A 2IX1A 1X65A 1TXYA 4X64L 2L15A 2R7ZG 3CQZH 1E24A 5JEAJ 2JA8H 2LXJA 2XGTA 1NBWA 1RL2A 1EWIA 3G48A 4QY7A 1E3PA 1L1OC 2CKZB 4A3CH 3PUXA 1B8AA 1A62A 1PFSA 4DV7Q 2D0OA 3RN2A 1CKOA 2AWOA 3J80i 1NE3A 1VQAA 1W2BA 1QZHA 2VUMG 1OXTA 2JQOA 4LF5L 5IYDH 4HIDA 2R7DA 1K8GA 3I7FA
chains in the Genus database with same CATH superfamily
1YHQA 3H6MA 2K52A 2SEBD 3L3OC 1ENCA 3S2HB 3U58A 3A8KE 4PG3A 1YI2A 3S16B 4A75A 4JK1C 5EPLA 1HFNA 3K7AH 4A3JH 2ID0A 2TMPA 2Q8TA 3VR6A 2UXCQ 4L5QA 3ER0A 4A3EH 2F0JA 2E2JB 2UXCL 4G7OC 2B2VA 4LUOA 3HOWG 2O5JC 2SOBA 1Q8KA 3K5LA 2A68C 3GD7A 1Q1BA 3M3YH 2ES2A 4EQOA 5CC4A 5M5XB 1H9KA 3A74A 4A3IB 3GTGH 4LK1C 5E3FA 2NB0A 3EFXD 5CV5A 1Q81C 4HIMA 2UUBL 5DM63 4A3CH 3CP0A 2QCPX 1WCMH 4IUUA 4LUVA 1CZWA 3CPFA 4KK7A 2A1AA 1BO0A 1I4HA 3L2PA 1K8MA 3AB9A 1AP0A 4B3ML 1AEXA 3NENA 2F0EA 3QIAA 2DJFC 4A93G 1HJPA 1BUVT 4KKSA 2JP1A 2KCTA 2UU9L 5K36H 4QIWE 2B63B 1ENFA 1WTRA 1YHAA 4L8JA 1QCBD 1SNOA 3IFDA 2KJXA 4C3HB 5NUCA 3FKIH 1JMCA 2XN9C 2PI2E 2R92G 3TS0A 2F3VA 3EA6A 1VQEA 1EEID 3X3NA 2ZTDA 1Y8NB 4IFDG 3Q22A 2CWAA 4UHVA 5H1SE 3NTKA 3WWVA 1WCMG 1KLGD 1PTOF 4IN3A 1LTGD 2Z4IA 1I94Q 3HOYB 2ASBA 1GUOA 4DK6C 2LFNA 1ONLA 4GKJL 1A2UA 1B7YB 5FK9C 5FLXE 1S5ED 3HKZG 3CRKC 1EQRA 1VF7A 3TMEA 3OW7A 1PH6A 3H94A 2QDBA 1STEA 3PUZA 4ILWA 1B2TA 4MNOA 2KBNA 1PDQA 4FXDA 1GUNA 4K2KA 5EKLA 3IRBA 1SDFA 3CCJA 2PW5A 4YCWA 2JA5G 1PH9A 3L0OA 1IW7D 1MJCA 3HKSA 5KNCA 5LL6X 5C0XH 5IGFA 2Q2IA 1R4QB 3GQBA 4DV0Q 2E2JH 1TT2A 4HCEA 3QG1A 2F0SA 3QOJA 3W2DA 1GKHA 5BN5A 3M4OH 4A3GG 4JI8L 3D8GA 2F4IA 4JG2A 2IX3A 1TWCH 3J81L 5DEHA 5EBDA 2B2YC 1GJXA 4JCVE 1P16A 4B3RL 2CHBD 4A3IH 4FF3A 3ND9A 5IYDG 2RDGA 1U5KA 4A3MH 3N52A 2YTVA 1EY6A 2F1MA 3G4SA 3U50C 4EQ5A 3DWAA 3J81c 4PNYA 4DR1L 3PQIA 1W3SA 1HCZA 1QE6A 3MEFA 1BCPB 2R6GA 2K01A 4P71A 2J0TD 4BBRH 1IYJB 5C0XI 5C4JB 2PZWA 1D2BA 4B3SQ 1GO3E 3G71A 3IKJA 1LTTD 1SNDA 2AUKA 1D1KA 2PQAA 1E22A 5CMDA 1GM5A 3I4NG 2UXDL 2ZM6Q 4XTCS 3BDLA 1LLRD 2PQEA 1G6ZA 1F2LA 1HA6A 4DUYQ 2UXDQ 4LFCQ 2UUCQ 2IX0A 2AQ2B 2EOTA 3HKZB 1CSQA 1TY0A 1ZKOA 2OTLA 2CQAA 3OMGA 4A3FB 1JJCB 2AQ3B 4HJ9A 4QL5A 1VQ7A 2MUYA 1CKNB 1DJRD 1BXTA 4JI8Q 1SMYC 1LABA 1TY2A 4OONA 2LSSA 1RF2D 5EQ0A 3KYHC 1TQOA 5BR8Q 1FD7D 1TKWB 4C3JH 2QW7A 1TWAB 1BBUA 2F4VQ 4U673 1EEFD 3RZOB 1PH5A 2DGYA 1YEZA 3EJIA 4AYBE 2Q8RE 4JI4Q 3M4OB 4DPGA 3VR2A 2NVQB 2G9HD 3I8ZA 2L5TA 1LTRD 5FOBB 3VR3A 4YIJA 1CSPA 3ULPA 2E5LL 1B3AA 3HP3A 4XT3B 2NYZD 4MHEA 4HIKA 2E2HH 2MQHA 2MO1A 4ZKBB 5ELBA 3HRZC 4YWKA 4YCUA 1FL0A 2KCNA 5KEEA 2F0TA 3NXWA 2D2CC 5EBCA 2HIVA 4LF8Q 1D1IA 3J7YW 2QEXA 3T4AC 3UDIA 4POGA 3U9OA 5KNDA 3J7AF 3A54A 1CT1D 3WOFA 3OSOA 3CKIB 2JA8B 4X3UA 3TP5A 1V1PB 1AZPA 4OHJA 1S5FD 4A3BH 1BCPF 2OXPA 3HS0C 3QWNA 1C0AA 2ICIA 2L9HA 2IT1A 4AH6A 2FJ2A 2PNHA 2JYOA 2A5HA 4LFBL 1I5FA 2PMZB 5FLMG 1NCVA 4LF6Q 1X3FA 2I0QA 1HQRD 4IUQA 4A3JB 1JOOA 3ZJYC 1Q3LA 4X66Q 4ME5A 2VL6A 1SSOA 4ZKCB 3S9WA 1HFGA 4H44C 5KIXA 2B2WA 3PV0A 2H1EA 4A3DG 3NSWA 3R8BA 2B39A 2VUMB 3GTMH 5KGUA 5TSSA 3NTHA 1R4PB 5COYA 3A8IE 4K6LA 1YNNC 4QF4A 4A3MB 1WD0A 1DXMA 3GTQH 1D5MC 2PI2A 3Q0AA 1SFOB 1DOKA 1O7IA 3RLFA 3GTJH 2I5LX 3I72A 4DV2Q 2F0VA 2K33A 2WACA 1GVPA 4CKCA 3OPOA 1J5EQ 1PZJD 2K1BA 2OCEA 3K0XA 2K03A 4O1NA 3D0FA 3U9SA 5FLMH 5HGQA 3BZCA 3PO3G 1ML0D 4K6DA 4L5SA 2R3ZA 1BNZA 1SYFA 3T53B 4NP5A 1WTQA 2L12A 1II3A 4PMBA 3BZDB 4CKBA 3BVGA 1KL9A 1B3QA 1PH8A 1A8VA 2AMCB 5IOCA 2B63H 1LTID 3HOYH 1UEBA 2EDGA 1LT6D 1YHBA 1CK1A 3D4RA 3M85A 1FJGL 2NBFA 2HIXA 3S14B 1SN8A 1WI5A 1XXGA 3I4OA 4O42A 2WB1G 2DNCA 1S72A 2JA7G 1IZ6A 5M3MG 1LO5D 2MHVA 1C48A 3S15B 2X6LA 1STYA 4PZ6A 3TP7A 4A3LG 3I70A 3KF6B 2GVBA 2VB3X 1F9QA 5IWAQ 1RHPA 2CFMA 1BCPC 1JT8A 2CCZA 4QUCA 5JVH3 4JYAL 2PMZE 5IWAL 4GLXA 3T1YQ 4LF7L 4ZK9B 1QVFA 2LS01 1SR3A 2HDMA 1WYDA 3R93A 1SMXA 1PFBA 2K7VA 4LFAQ 1XTCD 2GVAA 2B2UA 1EY9A 4BXXH 4BBSB 1CKNA 2VS1A 2L0CA 3GV6A 3TSSA 3VYUA 4EQPA 4JBMA 1VQ9A 1AFPA 1L0YB 1OXUA 2RBMA 1KXLA 1WCMB 4UP7A 2K32A 2EY5A 3GO5A 1QUQA 4S3SA 4KI0A 4RHSA 4DR7L 4IO9A 2K04A 1A2TA 3HG9A 5JAVA 1M90C 3K80C 1DCZA 3OIPA 1T5EA 1PRTC 1F9PA 1GUSA 2JEBI 1Z7TA 2I5HA 3S2DH 5BN3A 2PQAB 5IP7G 1DZ1A 1GUGA 2FFKB 1PTOD 1S5DD 2KCCA 3RR5A 5DNFA 2FXQA 3U4VA 3CCMA 4A76A 1X9NA 1M1KC 1KABA 1IHZA 3VA7A 2EE1A 4G7ZC 2RQXA 3GTKB 4DK1A 1IKMA 2XGTA 4K2LA 3DEOA 2R61A 1E3PA 4QY7A 1B8AA 4DV7Q 3RN2A 2VUMG 3LNNA 2JQOA 5I9OA 4LF5L 4HIDA 3W3AA 1UEAB 4BY1B 1I3QB 4NXNL 4QCLA 1BCPD 4K5XA 2EVBA 4CDDC 2IWHA 5LL6S 1X3GA 2Q8IB 4YWMA 2Z4HA 3HFZB 4FP5D 2OTJA 1N36Q 3L7ZC 3QB3A 4ZCKA 2NN6G 2ZJPA 1PA6A 2IJ0A 4P75A 3IFTA 4JOIA 1XTDA 1B9MA 2QF7A 3PCOB 1HXYD 3CCVA 4A4IA 1ET6A 1NTGA 3RZDH 2HHHQ 4XQNA 1HR0Q 3K59A 2ZT9C 2NVTH 5KYIA 2HHHL 4ID6A 3AU7A 1TU2B 2EIFA 3UDXA 4BY7G 3P20A 1DD2A 2B29A 2YU9B 2ZXOA 1X3QA 2M2LA 4P72A 1HNXQ 2B2TC 4OWWB 4PZ7A 1FNWA 1ZXTA 1LTAD 4JOIC 1JWMD 5IE8A 1KNEA 1V1OA 1WTOA 1VQOA 1XPOA 4BBSH 1NUCA 4JI1Q 1SXTA 4JVZA 1HRJA 3H15A 5CBEE 1FGBD 3S1MB 2OT2A 4RMFA 4HTHA 2HQEA 2XTIA 1Q82C 1HA5A 3FHWA 1D6EC 1QILA 3K5OA 4OWTB 2CW0C 4HJ7A 4FF4A 3S15H 2FHTA 2O4XA 3L9AX 3ONAB 1HUNA 5IT9E 1CQFA 4NKLA 3EBEA 4DR6Q 4OO1H 3RLOA 2KHJA 4KY6A 4RAUC 1Q46A 2HT1A 3TBIB 1D5XC 1CHPD 1VCIA 2F0MA 2EYFA 3HGBA 3OTOL 1XNRQ 4LF9L 3A5UA 3F1ZA 2EYHA 4AQYL 1N34L 4JI3L 3VYRA 3D6WA 4MTKA 4A3KB 5LMNL 3EQLC 1GHKA 2UXBQ 1R9TH 5AFWA 4P73A 3GTPH 1F2ZA 1DOLA 2K5HA 1PH7A 3U4ZA 4C3IH 3URYA 4M1UB 1TVXA 1MIUA 1SBBB 2BDNA 5JVG3 3CCQA 1YNND 2VXWA 4LFBQ 4C56C 3OTOQ 3BVMA 3TS2A 4MN3A 1VQ4A 4ZQ3A 1RCVD 1SYGA 2YV5A 4HAEA 4HSVA 1XNQL 1FNUA 2B63G 2R92H 1PH3A 1SAPA 4J15A 1PTOB 2YTYA 1OTCA 4ZLTF 2B2YA 3S1NH 2Q2UA 4R4IA 2LKVA 2B8GA 4H7BA 3CMAA 2KCMA 1YVCA 4LF7Q 4KTAA 4AIMA 5IYBG 4GLVB 1Q1EA 1ZYRC 4A3DB 1ICFB 4AQYQ 1N34Q 2UUAL 4A3EG 1RIPA 1JWUD 1EQTA 1PRTB 2MO0A 5FO9B 3FPUB 3Q8DA 3I3CA 1PH4A 1PFNA 4JI0L 2IHEA 4O0AA 3JC66 5ELFA 4NPSA 3TP6A 1LYLA 5FJ8G 2Z8LA 4B9XA 1SRUA 1B70B 2XWJB 2EJGC 2JA6G 2UUAQ 4POFA 2Q2TA 5M5WB 1F2MA 5J3BA 4BY7B 4A3CG 4KY7A 3W1GA 1SMYD 3B6YA 2LY7A 4UDUC 3E6ZX 3JAME 4L63B 1T5XD 1Y8OB 4P74A 3CD6A 1O7ZA 5C5LA 2F0NA 1TWAH 5M9OA 2DNEA 1F9SA 2F0DA 4A3MG 4XT1B 4DGZA 2E2IH 3BS1A 3C3LA 1PTOC 1XPRA 2F0KA 4CJ2C 1A3UA 4XQJA 1EIGA 2D9UA 3DLLA 3GTQB 5GAHC 1IL8A 1TWFH 1U0LA 1SNPA 1EYAA 3LGJA 3SGIA 1KDBA 4YHHL 2Z0SA 3I4LA 4MIUA 3HOVG 3R2TA 4DV3L 4APVA 1H9SA 2K75A 1QVGA 3S14H 1Y1VB 5IGGA 3IAYA 1HNZQ 1VQFA 3ERSX 3CPWA 2TSSA 4IZ8A 1E2ZA 3RNUA 5G3LF 1SROA 1HUMA 3M4PA 2D5DA 4RKLA 1VQMA 1VQ8A 1RJTA 1S3OA 4YHHQ 1BKBA 1PYSB 1PH2A 2A73B 3UDFA 5LHY1 3BJUA 5IYCG 4DN4M 2LMCB 4TQUS 5IP9H 1JB3A 4DKAC 1CM9A 2B3GA 3K0YA 1ZEQX 2N49A 4C3IB 4IUPA 4DV5Q 3OYYA 4WJWA 2MP1A 2AWNA 1U4LA 1X6OA 4TKOB 2L55A 4V0BA 1EYGA 4KD4A 3M4QA 5JPNC 3PUYA 4OL7A 5M3MB 3FVQA 1QB5D 4HMJA 1U9RA 3TRZA 3J7AV 4NW2A 1N33Q 1YZ6A 2IY5B 1OXXK 2NUCA 5GADC 4LW1A 3LWUA 2K14A 4DR5Q 5JJLA 2F3IA 4A3KG 1RDPD 1STAA 1NR2A 3M3YB 1ILPA 2DUDA 2BE5D 2BDOA 3CMEA 3DEPA 4NDXA 4R9WA 1K83B 3E0JA 4GKKL 2F0WA 3KDFA 1EWCA 4NMZA 3HOVB 1GHJA 3CW2C 3HEJA 4DAYB 1E2WA 3JAMi 4GN5A 4K5WA 3HOXH 2Z9HA 4X65Q 1AE2A 1I4GA 2Q2HA 2UU9Q 2PNRC 1XMOL 1WVLA 3LWEA 4RH6A 2KENA 4C3JB 3TEHB 2QEJC 4CBVA 3UE1A 1HH2P 1HZ9A 3BYYB 2QILA 2J7ZA 4ZUJA 1CA6A 5IY0A 3RMHA 3NHHA 4DNTB 3A7AB 2NVQH 5JOBA 1K0SA 5ELCA 3G6EA 4DAMA 3PO2H 1WD1A 1STHA 3NBIA 5T1IA 2NVYB 2V1CC 1WOCA 3VR4A 1UE1A 4IURA 1VMCA 4RGOS 4JI7L 5M5YH 5KRUA 4DV0L 5CYUA 3NBHB 1HTPA 4PZ8A 4BA1I 1NSNS 2YYZA 4C1NK 1UE7A 1SFOH 1MD2D 1GOZA 4RGNA 5C44B 3MHBA 1GUWA 1T9HA 1BR9A 5ELDA 1YITA 1FYCA 1LV9A 4C1NI 4X3TA 5I2YA 2F0UA 2Y0SB 4X65L 3F8TA 2G9DA 5IYBH 4IFDI 4KV6A 2EJFC 1FJGQ 3E3XA 3NELA 2EY2A 2ZXPA 4LWCA 3S17B 3N6RA 1S4ZA 4OIJA 4E6IA 3S16H 1EZ8A 5C4HA 4R4OA 2MPMA 3RN5A 4OELB 5IGDA 1TS4A 2Y0SG 1YJ9A 5C4XH 3I91A 3AFQA 1JICA 1M4VA 3SK6A 5C4ZA 3MZ5A 3K81C 2E74C 3CQZB 3TQYA 4JI0Q 2JA7H 3T1YL 2LXKA 2V4DA 3C2PA 1VQCA 1ENAA 4HIOA 1LACA 2QDLA 4IUNA 1Q8IA 5I6YA 2WKCA 1EY4A 4IUTA 2DY7A 1SNCA 1PRTD 4ZUIA 4K14A 2YU9H 3A5ZB 3RD4A 3PIPA 2HCCA 2AHOB 4X3SA 2Y0SE 1JOKA 2FMMA 2VW9A 1V1QA 1R9TB 1N8RC 2A8VA 3M4YA 2VQFL 1HZAA 1WTVA 1LTSD 3VA5A 4UPAA 1X32A 2H5XA 3A8JE 2L1BA 1IBLL 1EIYB 2IPKD 2IX1A 1X65A 1TXYA 4X64L 2L15A 3KLRA 3PIO3 1E24A 2JA8H 1EWIA 3G48A 1ZYRD 2CKZB 3DM1A 3PUXA 4CHTB 1PTOH 2N88A 3J80i 1NE3A 1VQAA 4KHVA 4N9PA 1W2BA 1K8OA 1OXTA 5IYDH 2R7DA 2F0QA 3I7FA 1EQQA 4A3IG 2VB2X 3NUCA 3P75A 1EU3A 2N78A 4DV4L 3H0GB 2WV6D 1HTLD 1OXVA 4IPCA 4BXXG 2JXMB 5T1GA 4RHRA 1SE3A 2AQ1B 4KN4C 1IW7C 2CQOA 3PO3H 2A74C 5LMNW 1IBKL 4XIGS 4GNXC 3K8AA 3QOLA 3SEBA 4IPHA 3S24A 1G291 1D7QA 1FGUA 1JOQA 2A6ED 3DM3A 1B9NA 2EXZA 4NXNQ 3PIOA 1JQYD 5CV7A 2KECA 3H0GH 3MXNA 2E2DC 2MFIA 3BVZA 4I7ZC 1YJWA 3MC0B 2XNAC 4LF9Q 3J81E 3MEHA 1N36L 4X64Q 1L0WA 3LX0A 5M3FG 3RUZA 4DR3Q 1KC8C 2JEAI 2HDLA 1HNWL 5C4JH 2E75C 3AYHB 4C3JG 3Q23A 3MVVA 3KK7A 4J8QA 5BR8L 3ND8A 3TREA 3VYTA 4X3KA 5DM73 2RCFA 2JA9A 1I6HH 2R93B 3GP7A 2OEOA 2ZTCA 2CW0D 3VYSA 4BY1H 1Z6HA 3S2HH 3K6OA 4FDBA 4DUZQ 3D3RA 4OXPA 3S1QH 5HGTA 1SLJA 4DR3L 1O7YA 4A3KH 3WOEA 3HKZE 4N8FA 1S5CD 3F2DA 3HOVH 4DUZL 3S17H 2BE5C 3KBXA 1STNA 3T51B 4JI6Q 4FXGC 5C3XA 1HNZL 1V8QA 5A35A 2OWOA 3I4MH 1PMRA 2SDFA 1Y1VH 2NZ1D 2EYOA 1XMQL 5AJ3Q 5M3FH 2PCFB 3JAML 1AN8A 2NN6I 3H0GG 4HJ8A 2NVXH 4ALPA 1YIJA 2XVSA 1O78A 1A15A 3W5OA 1TWCB 5JPMC 1S40A 1MBYA 5IP7H 4DV5L 1MI2A 2DY8A 4DK0A 2F0HA 1VQJA 1I3QH 2WP8J 4JI7Q 1G2TA 2UXBL 2A19A 3MTSA 4JW0A 1K73C 4QB4A 3KFUA 3EROA 4RCOA 1MSGA 4BBRB 3ULJA 2KEEA 4G57A 1A63A 1V43A 4DV2L 3K57A 1XNRL 2WB1B 2F0OA 1B44D 3I4MB 4F8MA 1YNJD 2R7ZH 1K3BC 1X3EA 5I6WA 2D0PA 1DYQA 2BCOA 3QR8A 5LMUL 4EGVA 2J4XA 4LF4Q 1UWVA 5E7NA 1XNQQ 3GTGB 3FKIB 5A2QL 3SK8A 1SJED 1N32Q 3EIVA 1EIFA 1I6HB 4LF4L 1L1OB 2KQ3A 4OO1G 1JORA 5D65A 4NXMQ 2WINB 3GV3A 1CQVA 1AZQA 4WFN3 1PXUA 2JE6I 2KHIA 3CCSA 2SNMA 1VQPA 2RSOA 1CTMA 4HR7B 5C44H 4N8X1 1ILQA 3KF8B 4OX9Q 4DK3C 1JB7A 4UP8A 3HOUG 3H3VC 3AFPA 1BBWA 4CDFC 3UDGA 1XMOQ 3X3MA 4XYOA 2K5QA 5JEAH 3NBHA 4L5TA 2P5ZX 4LNQA 1L0XB 4C3IG 1RD9D 2EYPA 2RDHA 2XSCA 1WTWA 1J8IA 3WDNA 5CORA 1ET9A 2GA4B 3V96A 3KF6A 1EYDA 2EYJA 2F0GA 5FLXc 3HOZH 2Z6KC 1EFID 1KIXA 1WTPA 4BY7H 3DMUA 4OX9L 2RCNA 1SE2A 1I4QA 5ELEA 3FDTA 4ZRZA 3PO3B 1YNJC 1C9OA 2X6GA 4YY3Q 1DOMA 4RG1A 1PLFA 1MHWC 3K7UC 5CR3A 4JPBW 3GTJB 5C4XB 3KLSX 5K36G 1SNMA 4A93H 4FYDA 2K5WA 5IT9L 3SHLA 4KHZA 1XX8A 3T56B 1KD1C 3PIP3 4DAYA 2NWGA 1QNKA 3MAQA 3M9BA 5GAGC 2ZJQA 3KJPA 3A7LA 3I55A 4UY8C 1D5ZC 3GTMB 2VUMH 4KHPL 3HZXA 1VQ6A 1H9JA 3PUWA 1EY7A 1TWHH 4KKTA 1BOSA 1UAPA 2A69C 1Y8PB 4OWXB 1JJ2A 1EOTA 3K5MA 1Q12A 1U4MA 3OMCA 1CZGA 2K5NA 4JV5Q 1HZBA 2ZJRA 4GKKQ 2PW7A 3PSIA 5FKAC 4BA2I 2NZOA 1KHIA 3J81j 4JI5L 1PZKD 1G2SA 4X62Q 4Q5VA 2B8FA 2F0LA 3DHQA 4JI5Q 2NVYH 4K0KL 1M8AA 4DUYL 2KA7A 3OWFA 5GROA 4R4CA 4A3FH 4I65A 5CGKA 3E9HA 2RSNA 3S1NB 3F2UA 5EPKA 4OO1I 1P8LA 4EVOA 2BH8A 1MKHA 1Q7YC 1ICWA 2B2TA 4A3GB 2VQEQ 3H3VH 4DU9A 3MA2B 4A3BG 2MJ8A 2EXDA 2VQEL 4GN3B 1HR0L 1WFQA 5E4WC 2ZXRA 5C3WA 3BDOA 5IODA 1STBA 3GTOH 5FO7B 3W1BA 1NMFA 2EYMA 3KOJA 4JI3Q 1VMPA 5J1ZA 3M7NA 4A3BB 5D3IB 4K8JA 4CDCC 5IGEA 4R4TA 1Y1VG 1PVOA 5CV6A 4B3MQ 5HURA 1V1PA 4PQXA 4A3JG 4BBRG 1ESRA 3NQIA 3C1FA 1W6KA 5C0XJ 3CCEA 4B3TL 1TS2A 2M9VA 3ZYYX 3NWSA 3CRLC 3I4MG 2Z1CA 1EWHA 4FXKC 1XYIA 5IYCH 1IBKQ 3CC2A 5JJKA 1I50H 1LTLA 3CHBD 3MXPA 1SE4A 1SYDA 2DJGC 2XIWA 2IW3A 1I94L 2EJMA 4Y7NH 4DR2L 1A0IA 1PZID 4K5VA 1KLUD 4Z9CB 1NMGA 2RF4A 5IT9c 3HOXG 1HR0W 3J7A5 3C46A 1KQSA 3HOYG 1PYWD 4IFDJ 4BS9A 4YCVA 1XJVA 1EU4A 2JA5H 1IYUA 2O2LD 1NR4A 2WIIB 2N8NA 1SEBD 2UUCL 1UE6A 3HOXB 1IBLQ 2F3WA 2KHSA 4CJ1B 2F0IA 2F4VL 1NJIC 5FLXL 3CCUA 4DR2Q 4JI2L 4FF2A 1RODA 4DAPA 1PH1A 1HPCA 5L37A 4B3SL 2EY1A 4AYBG 1B4OA 2M00A 1Z9FA 4DR6L 3KJOA 3SK5A 1TWFB 4C3HG 4RGTA 3SDZA 2WKDA 1EIHA 1I4PA 1K0RA 2XRQD 3BDCA 5IIFA 5ISRA 3HOUH 2R93G 5JJIA 1SYBA 4JI2Q 4IFDH 3QO2A 3SK4A 1DONA 1UUPA 2RHQB 3A55A 1QOHA 2K05A 3MXNB 3DWPA 3EVQA 3K58A 3EN2A 4F7XA 4DF7A 5CBAE 4GNXB 2JJQA 5M3FB 1ASZA 4MTNA 1J5EL 4KJNA 1KRSA 4KY5A 2BOSA 1E2VA 4GOPA 1YNXA 1RTNA 1HQMC 2EPBA 4QUFA 1EL0A 3MFYA 4EX5A 1FR3A 5EJWA 5LMUQ 5C0XG 5E1FA 2JA5B 2OF1A 2PZUA 3R2IA 2R93H 5HY6A 1I4RA 3CQZH 4J6HA 2LXJA 1RL2A 3NK9A 2HUGA 1PFSA 4FNFA 4LJZC 1CKOA 3D6CA 1QZHA 5D14A 5JJZA 4P2CB 4RFBA 5I9PA 4PMCA 2ENBA 1K8GA 4WJ4A 4HCSA 2C9OA 4Y52H 1Y1WB 1IYVA 5KYLA 2QKIC 1K28A 3A0JA 3T13A 2K4KA 1CHQD 4DV6L 5M5YB 1I4XA 1VF5C 2BA1A 1XWEA 4IALA 4GLAC 1AH9A 1H9SB 2EY6A 2E5LQ 4CKEA 4JYAQ 4IJHA 1QVCA 4DR4Q 1EQVA 5DAUA 3VR5A 3ULLA 3NWTA 1NNXA 4ODGA 1Y69U 4KJOA 4KKUA 2ALYB 3CXCA 1TIID 3GTLB 3P1HA 4J1MA 3DXJC 4WRDA 4QMGA 2WAQE 4PMWA 4GOPC 1LT5D 4HN7A 3SXHA 3K7AB 1QZGA 4IQZA 2B2WC 1E0BA 2NN6H 3PO2B 1E1TA 1TWGH 3OWEB 4IPGA 1VQKA 5E4XA 3QJYA 4LF8L 1VQBA 2JA8G 2JA6B 1X54A 2RDFA 2A6HD 1LT3D 3CF5A 1X56A 1W6JA 1Q90A 2JA7B 4ABNA 4FO2A 2FMCA 3DWQA 4R4QA 3STBD 1Z47A 3HOWH 2A68D 4FF1A 4K8IA 1EFWA 1SJHD 4TVAB 5I2XA 1DM0B 4QGUA 4NXML 3S1MH 3CC4A 1JE5A 4HJAA 1F77A 3KF8A 3FMCA 3CCLA 4HMIA 4A3GH 4DR4L 5IGCA 3S1RB 1KDCA 4KHPQ 3BYTB 5CV4A 1Y1WG 5EKKA 4X62L 2E2HB 4BBSG 4DFAA 2GN5A 4GNXA 2PPBC 1JJGA 4L6TB 5K5PA 1IL2A 1N33L 4KLKA 4GZYC 5KNBA 3I90A 5IGBA 3I2ZA 4L5RC 1VQNA 1L2FA 5C3EG 2CH4A 3MXGA 3PUVA 2UUBQ 3KLWA 4ME3A 4R8NA 1IBML 3MXUA 3AEVA 5EGTA 1VS0A 1IKLA 2B2UC 3FEWX 4HSPA 4DR7Q 1AE3A 3GTPB 2CVRA 4NB3A 2HCIA 1MJEA 2NVTB 4B9WA 2X69A 3CC7A 4G4KA 4JI6L 4TRDA 2Z6BA 2KOLA 4WORA 4LAAA 1SNQA 3STBC 2MGSA 3V05A 4YY3L 1QG7A 3C1EA 1G51A 4KN7C 4YWLA 1CFMA 2WB1E 3RLNA 3J7ZC 1PFMA 3MFGA 1OO9B 3FRPB 4Y7NB 4IPDA 4XYQA 3TN2A 3H3VI 2F0PA 3I4NB 1LT4D 4JC0A 5DLQE 4JBJA 5ELNA 4B3RQ 1BVSA 1I50B 3D31A 3NE5B 4N9TA 3G6JB 4C3HH 1JCKB 1EOVA 4JI1L 2CWPA 4DR5L 2ZM6L 1JR0D 1KTKA 4DV3Q 1G6PA 2QA4A 3HOWB 2A6EC 1MGSA 3FP9A 2IHFA 5A2QE 4LFCL 2O5IC 3ERQA 1UE5A 4F87A 4V190 1PRTF 3NP8A 3J80E 4JV5L 3NQTA 2JA6H 2HD3A 3S1RH 1GUTA 3CCRA 1YBYA 2QGQA 1BF4A 4QQBX 4AYBB 4DNIA 2OQ0A 2EQSA 3RZOH 4BWGB 1DGSA 1U4PA 5C5MA 3E9IA 4R1JA 1E1OA 5EKIA 3PF5A 1EUJA 5LMNQ 3BZKA 1O80A 3ITPA 2E76C 4RGMA 2VQFQ 1XPUA 3KLSA 3PO2G 1PHJA 3H91A 1G8ZD 4Q0FA 4DV1Q 2K28A 4A3EB 1B53A 1E7ZA 1TWGB 1Q86C 4JBKA 4PV1C 3J80L 4IOAA 5EPJA 1LM0A 1KAWA 2PZTA 3M7GA 5F2DA 4ZYSA 2R92B 3PF4A 2AKWB 2E2IB 3RZDB 4C2MH 1X3PA 3GTLH 4DXGA 1MSHA 4LUZA 2AUJD 3FKIG 3KDFB 3F2CA 2JN4A 3NTIA 1C7YA 1FNVA 1EY5A 1TS3A 1EY8A 4U68A 2XRSD 2WFWA 3TDQA 4A3DH 4LF5Q 1TWHB 3OIQA 4CJ0B 4QIWB 1V9PA 5GQOA 1Y14B 4B3TQ 3KBGA 1FVIA 1PYBA 4DR1Q 2VNUD 1RKNA 4GN4B 2E8GA 4H02A 4C2MB 3HOUB 2F0FA 2JSOA 4H13C 1EY0A 3A56A 4DV7L 2IL8A 3CAMA 1PV4A 3Q6SA 1QJOA 1H95A 2Z6KA 2F52A 1X55A 4GOPB 2R7FA 4RCNA 3MWYW 4X6AH 3BG3A 1K83H 3J81i 4TSSA 1VQ5A 3O13A 4IUVA 1EYCA 5M5WH 2F03A 4K0KQ 3OHXC 1ESFA 2L4NA 4GKJQ 4M8AA 4GS3A 1VQGA 5D3DA 3S2DB 2VZAA 1I6VC 4QJFA 4KD3A 2K5VA 1JE4A 3AMUA 4JBWA 1VQHA 4CDEC 3SR1A 3TP8A 3OOCA 1LUZA 2I46A 5J22A 1HNXL 3F2BA 4DXFA 4DAVA 5CV8A 1CKMA 2R7ZB 2KEDA 1VQLA 2B2VC 3TZUA 1TR5A 3K5NA 4DV4Q 3H09A 3KUPA 1B1ZA 1VQDA 1CUKA 3IL8A 1F9RA 3I73A 1U4RA 2KVMA 4RA8A 4RKBA 5EAYA 4JI4L 1KDAA 3HOZB 4O2DA 4LMQD 3GDEA 1NY4A 5GAEC 2WAQB 3E0EA 2C5CA 2N3SA 1H9MA 1TS5A 1AW7A 4HEDA 4RWSC 5C3EH 3BU2A 1G91A 5FJ8H 1S5BD 3SE0A 1Y1WH 2ZTEA 2HQLA 4DV6Q 3UI2A 1OXSC 2K5DA 1IBMQ 3HOZG 4A93B 1QUQB 4OEMB 5M5XH 4A3FG 1BQQT 1NAPA 1WJJA 2D62A 2RVLA 5JEAG 1IXRA 3T16A 5BN4A 1HHVA 3VDYA 3D4WA 4LF6L 5I4DA 4UAIA 3NPPA 2A6HC 1L1OA 3GTOB 1H9RA 4OGQC 1VQIA 4X66L 1WTXA 2DN8A 2NZHA 4F88A 1YJNA 1RTOA 3JAMc 3S1QB 3DUZA 1GXDC 1XMQQ 5CV9A 2BA0A 4B08A 3TZDA 5FO8B 1O7LA 2XWBB 4G7HC 1K3RA 3UE0A 1QNUA 5C3EB 1C8CA 4A3LH 4EQNA 4HJ5A 3SVMA 2A69D 1CI3M 4OIKA 4ULLA 1ASYA 1KNAA 1B50A 3E5SA 4FVMA 2JK8A 1JC7A 2KUMA 4H0LC 1STGA 1SYCA 2MNAA 4LFAL 3ICEA 1LTBD 2N55A 3PMFA 1A6XA 3OW2A 1F2YA 2YTXA 1VDZA 5ELOA 1BDOA 4BY1G 4KMUC 2K6AA 3NEMA 2NTSA 3Q24A 2CH4W 3FPPA 2FINB 1N9WA 2K50A 1EZ6A 4I7AA 4ZAIA 4IJLA 1C4QA 2WAQG 3I4NH 3PGZA 1A3TA 2SNSA 4WJ3M 1K8AC 1SE8A 1BBXC 5C44G 4XQQA 3GTKH 1CA5A 4CGYB 1A3VA 2C35B 5AJ3L 2BH2A 2H4OA 4UP9A 1N32L 4DNRB 2RKSA 3I56A 2NTTA 5IP9G 1WTHA 1SYEA 2OQKA 2L11A 3J80c 4DA2A 4R8IA 1QWYA 1KRTA 5C4XG 5C6AA 1HZCA 4DV1L 2EZVA 3D4DA 4IOCA 2ATWA 2VY3A 3CU7A 5M3MH 4MZ9A 5J39A 1D8LA 1JWSD 3T1HL 1HNWQ 2RHSB 1J6QA 3AQQA 1K9MC 2I5MX 4XXEA 1GD7A 3T1HQ 3R3OA 5G3LD 2G5DA 2I07B 2NVXB 2PYKA 2R7ZG 1J9OA 5JEAJ 3G7LA 1NBWA 3V2TA 1L1OC 1UNSA 2EYLA 1A62A 2RA4A 2D0OA 2PO4A 4XDXA 2AWOA 3P7JA 2ICEC 1KAAA
chains in the Genus database with same CATH topology
4A3IG 4NXNL 1YHQA 2K52A 3U58A 4PG3A 1YI2A 4A75A 3A0JA 2N78A 4DV4L 1OXVA 4IPCA 3K7AH 1X3GA 4A3JH 2K4KA 4YWMA 2ID0A 4DV6L 4BXXG 2UXCQ 2BA1A 4L5QA 3ER0A 3HFZB 4GLAC 1AH9A 2OTJA 1N36Q 3L7ZC 2CQOA 3PO3H 4A3EH 5LMNW 2E5LQ 1IBKL 4XIGS 4GNXC 4JYAQ 3K8AA 2UXCL 2NN6G 2ZJPA 4LUOA 4IJHA 3HOWG 1QVCA 1Q8KA 4DR4Q 1PA6A 4IPHA 3GD7A 4P75A 3S24A 1G291 1D7QA 3ULLA 4JOIA 1FGUA 1XTDA 1Q1BA 2ALYB 3PCOB 3DM3A 3CCVA 3M3YH 3CXCA 2ES2A 4A4IA 4NXNQ 3PIOA 1NTGA 3RZDH 3A74A 2HHHQ 1HR0Q 3GTGH 3H0GH 2WAQE 4PMWA 4GOPC 2MFIA 1Q81C 1YJWA 1QZGA 2NVTH 4HIMA 2HHHL 2UUBL 4LF9Q 1N36L 2EIFA 3UDXA 3CP0A 4X64Q 1E1TA 2B29A 4BY7G 1TWGH 1WCMH 4IPGA 1L0WA 1VQKA 5M3FG 4DR3Q 1KC8C 4LUVA 4LF8L 3CPFA 1VQBA 2A1AA 3L2PA 2JA8G 2JEAI 1X54A 4P72A 1HNXQ 4OWWB 4PZ7A 1HNWL 5C4JH 4B3ML 3NENA 3AYHB 3CF5A 1X56A 4JOIC 5IE8A 4A93G 5BR8L 1HJPA 1VQOA 4R4QA 3TREA 1XPOA 4BBSH 2KCTA 3STBD 2UU9L 4JI1Q 1Z47A 2JA9A 4QIWE 3HOWH 1I6HH 3H15A 1EFWA 1YHAA 2ZTCA 4TVAB 4BY1H 4QGUA 4NXML 3S2HH 4FDBA 4DUZQ 3FKIH 1JMCA 4OXPA 1JE5A 3CC4A 4HJAA 1SLJA 4DR3L 3S1MH 4RMFA 3S1QH 3CCLA 2XTIA 4A3GH 2PI2E 4A3KH 1Q82C 4DR4L 3FHWA 3HKZE 3F2DA 3TS0A 2R92G 4OWTB 4KHPQ 3HOVH 4DUZL 4HJ7A 3S15H 1VQEA 3S17H 1Y1WG 4X62L 4BBSG 4JI6Q 2GN5A 4GNXA 1JJGA 2ZTDA 4IFDG 1HNZL 1IL2A 2CWAA 2OWOA 5H1SE 3I4MH 3EBEA 3WWVA 4DR6Q 1N33L 4KLKA 1WCMG 1Y1VH 2KHJA 3RLOA 1XMQL 1Q46A 5AJ3Q 5M3FH 2HT1A 1I94Q 3I2ZA 4L5RC 1VQNA 1L2FA 2NN6I 3H0GG 2ASBA 5C3EG 4HJ8A 2NVXH 4ALPA 1VCIA 4DK6C 1YIJA 1XNRQ 3OTOL 3PUVA 2UUBQ 3KLWA 4ME3A 4LF9L 4GKJL 1B7YB 3W5OA 1IBML 3A5UA 3F1ZA 3AEVA 1VS0A 4AQYL 1N34L 4JI3L 3HKZG 1S40A 5LMNL 5IP7H 1EQRA 4DV5L 2UXBQ 1R9TH 4DR7Q 1AE3A 1PH6A 4NB3A 4P73A 1MJEA 3PUZA 3GTPH 1VQJA 1I3QH 3CC7A 2K5HA 2WP8J 4JI6L 4MNOA 4JI7Q 2KBNA 2A19A 1PH7A 2UXBL 3U4ZA 4C3IH 1K73C 3STBC 3KFUA 1MIUA 4YY3L 3IRBA 3CCJA 3CCQA 1G51A 4YCWA 3ULJA 4YWLA 2JA5G 4LFBQ 3RLNA 1V43A 2WB1E 3L0OA 4DV2L 3J7ZC 1PH9A 1MJCA 3HKSA 1XNRL 3OTOQ 2Q2IA 4DV0Q 2E2JH 4IPDA 1VQ4A 3TS2A 2R7ZH 1X3EA 3H3VI 4OX9Q 4JC0A 5DLQE 2YV5A 1GKHA 2D0PA 4JBJA 5ELNA 3M4OH 1XNQL 4B3RQ 1BVSA 3D31A 4A3GG 2B63G 4JI8L 5LMUL 2R92H 4JG2A 4C3HH 1PH3A 4LF4Q 1TWCH 1UWVA 1EOVA 4JI1L 5E7NA 1A63A 2CWPA 4JCVE 1P16A 4DR5L 1XNQQ 2ZM6L 4J15A 4A3IH 4B3RL 1N32Q 3EIVA 4DV3Q 5IYDG 1EIFA 1U5KA 2YTYA 2QA4A 4A3MH 1OTCA 4LF4L 1L1OB 2YTVA 2IHFA 3FP9A 3G4SA 4OO1G 3U50C 4NXMQ 4LFCL 3S1NH 2Q2UA 4R4IA 4EQ5A 1UE5A 3J81c 3CMAA 2KCMA 1YVCA 4DR1L 4LF7Q 2JE6I 2KHIA 3CCSA 1W3SA 4AIMA 4GLVB 1Q1EA 5IYBG 3MEFA 2UUAL 2R6GA 4AQYQ 1N34Q 4JV5L 1VQPA 2JA6H 4P71A 4BBRH 5C44H 1IYJB 5C0XI 3S1RH 4A3EG 1RIPA 3KF8B 1YBYA 4DK3C 3CCRA 1GO3E 3G71A 2QGQA 4UP8A 1JB7A 4B3SQ 3HOUG 3AFPA 1G6PA 1BBWA 4QQBX 3UDGA 1GM5A 2PQAA 1E22A 1XMOQ 4DNIA 2OQ0A 2MO0A 3I4NG 2EQSA 3RZOH 2UXDL 3Q8DA 2ZM6Q 1PH4A 4L5TA 1DGSA 4XTCS 4LNQA 4DUYQ 4JI0L 2IHEA 4O0AA 3JC66 2UXDQ 4NPSA 3E9IA 4R1JA 4LFCQ 1LYLA 5FJ8G 2UUCQ 1E1OA 1SRUA 1EUJA 2IX0A 1B70B 3PF5A 5LMNQ 1CSQA 2OTLA 2JA6G 3KF6A 3BZKA 5FLXc 3HOZH 2UUAQ 2Z6KC 4POFA 2Q2TA 2VQFQ 1XPUA 1KIXA 1JJCB 5J3BA 3PO2G 4HJ9A 4BY7H 4A3CG 4QL5A 4OX9L 2RCNA 1PHJA 1VQ7A 1CKNB 4JI8Q 4DV1Q 3W1GA 1E7ZA 1C9OA 3B6YA 4YY3Q 4OONA 1Q86C 4JBKA 4RG1A 2LSSA 4Y52H 3KYHC 3K7UC 5BR8Q 4P74A 4IOAA 3CD6A 4C3JH 1LM0A 1KAWA 1BBUA 2F4VQ 1TWAH 5K36G 4A93H 4A3MG 3PF4A 2AKWB 2E2IH 4C2MH 4KHZA 3GTLH 1XPRA 1KD1C 1PH5A 2DGYA 4LUZA 1YEZA 4AYBE 3DLLA 3FKIG 3KDFB 3M9BA 5GAGC 4JI4Q 5GAHC 4DPGA 1TWFH 1U0LA 3F2CA 3KJPA 2ZJQA 3LGJA 3SGIA 3I55A 4UY8C 1C7YA 4YHHL 2VUMH 2Z0SA 4KHPL 3HOVG 2WFWA 4DV3L 4APVA 1QVGA 2K75A 1VQ6A 3S14H 3PUWA 4LF5Q 1TWHH 4A3DH 1V9PA 1HNZQ 1CSPA 5GQOA 1VQFA 4OWXB 3ERSX 3ULPA 1Y14B 1JJ2A 2E5LL 4B3TQ 1FVIA 1PYBA 4HIKA 3CPWA 4DR1Q 2E2HH 1Q12A 2MQHA 2VNUD 4GN4B 2E8GA 2MO1A 4YWKA 4H02A 4YCUA 1FL0A 4JV5Q 2K5NA 3RNUA 1SROA 1HZBA 2ZJRA 4GKKQ 3PSIA 2HIVA 4LF8Q 4BA2I 2NZOA 3M4PA 1KHIA 4DV7L 3J81j 2QEXA 4JI5L 3UDIA 4POGA 3CAMA 4X62Q 1VQMA 1PV4A 1VQ8A 1H95A 2Z6KA 1S3OA 4YHHQ 1BKBA 2F52A 1PYSB 1PH2A 2NVYH 3UDFA 1X55A 4GOPB 4JI5Q 2R7FA 3BJUA 4DUYL 4K0KL 4X6AH 5IYCG 3J81i 1K83H 4A3BH 4TQUS 5GROA 4R4CA 1VQ5A 4A3FH 1C0AA 5IP9H 5M5WH 4WJ4A 4DKAC 3E9HA 4K0KQ 2IT1A 4AH6A 2B3GA 4GKJQ 2PNHA 4GS3A 1VQGA 4LFBL 4OO1I 1P8LA 2N49A 1I5FA 2BH8A 1MKHA 5FLMG 2VZAA 4DV5Q 1Q7YC 4LF6Q 1X3FA 3OYYA 2I0QA 2AWNA 1X6OA 4QJFA 1EYGA 2K5VA 3ZJYC 3M4QA 3PUYA 4JBWA 2VQEQ 3H3VH 1VQHA 4X66Q 2VL6A 1LUZA 4A3BG 2EXDA 3F2BA 1HNXL 3TRZA 1CKMA 2VQEL 1N33Q 1YZ6A 4GN3B 1WFQA 1HR0L 1OXXK 5GADC 1VQLA 2IY5B 4LW1A 3PV0A 2K14A 4DV4Q 4A3DG 4DR5Q 5JJLA 2F3IA 1VQDA 1CUKA 4A3KG 3GTOH 2DUDA 3GTMH 3W1BA 3CMEA 1NMFA 3KOJA 5EAYA 4JI3Q 4JI4L 3M7NA 4O2DA 4GKKL 3GDEA 1NY4A 5GAEC 3E0EA 3KDFA 2N3SA 4R4TA 1Y1VG 3GTQH 1PVOA 4DAYB 3CW2C 4B3MQ 3JAMi 4A3JG 4GN5A 4BBRG 2PI2A 5C3EH 3HOXH 3BU2A 5FJ8H 1Y1WH 4X65Q 1AE2A 5C0XJ 2ZTEA 2HQLA 3CCEA 4DV6Q 2Q2HA 4B3TL 2UU9Q 1OXSC 1XMOL 1O7IA 3RLFA 2KENA 1IBMQ 3TEHB 3GTJH 3I4MG 3HOZG 2I5LX 5IYCH 1IBKQ 3CC2A 4DV2Q 1I50H 1LTLA 5JJKA 1QUQB 4A3FG 5M5XH 1GVPA 3UE1A 1HH2P 2D62A 1WJJA 1HZ9A 5JEAG 1I94L 1IXRA 1J5EQ 2OCEA 4DR2L 4Y7NH 1A0IA 3VDYA 5IY0A 3K0XA 4LF6L 1NMGA 3D0FA 2RF4A 5IT9c 5FLMH 5HGQA 3HOXG 3BZCA 1HR0W 2NVQH 3PO3G 1L1OA 3J7A5 3G6EA 4L5SA 1VQIA 4X66L 1KQSA 3HOYG 4IFDJ 4DAMA 2NZHA 3PO2H 4YCVA 1YJNA 2V1CC 1WOCA 1XJVA 1UE1A 3JAMc 2JA5H 1XMQQ 2N8NA 4JI7L 2BA0A 5M5YH 4DV0L 2UUCL 3NBHB 4PZ8A 1KL9A 1K3RA 4BA1I 1UE6A 1IBLQ 3UE0A 2YYZA 2F4VL 1NJIC 1UE7A 1SFOH 4A3LH 4HJ5A 1PH8A 1A8VA 2AMCB 3CCUA 4DR2Q 4JI2L 1ASYA 2B63H 2JK8A 3HOYH 1PH1A 1EQQA 1UEBA 4B3SL 1T9HA 1YHBA 4AYBG 2MNAA 3M85A 4LFAL 1YITA 1FJGL 3ICEA 2HIXA 1SN8A 1WI5A 3I4OA 1Z9FA 3OW2A 2WB1G 3F8TA 2YTXA 4X65L 1S72A 2JA7G 4DR6L 3KJOA 1IZ6A 5M3MG 5IYBH 5ELOA 1FJGQ 4IFDI 4BY1G 3NEMA 3NELA 4LWCA 4PZ6A 1N9WA 2K50A 4A3LG 3KF6B 2GVBA 1K0RA 5IWAQ 4IJLA 2CFMA 2WAQG 3S16H 1JT8A 3HOUH 2CCZA 2R93G 5JJIA 4R4OA 3RN5A 4JI2Q 3I4NH 4JYAL 3PGZA 2PMZE 5IWAL 4GLXA 3T1YQ 4LF7L 4WJ3M 2Y0SG 1YJ9A 5C4XH 1QVFA 2RHQB 1SE8A 1SR3A 1K8AC 3AFQA 1WYDA 1SMXA 3MXNB 3K81C 5C44G 4LFAQ 3GTKH 3EN2A 2GVAA 3TQYA 4JI0Q 2C35B 2LXKA 5AJ3L 3T1YL 1VQCA 2BH2A 2JA7H 4BXXH 4HIOA 1CKNA 2VS1A 4UP9A 4GNXB 1N32L 2JJQA 4JBMA 1VQ9A 1ASZA 4MTNA 1OXUA 1J5EL 3I56A 1KRSA 5IP9G 4GOPA 1KXLA 2YU9H 3A5ZB 1YNXA 2OQKA 4UP7A 3J80c 3PIPA 3GO5A 1QUQA 4DR7L 4KI0A 1KRTA 4IO9A 5C4XG 2AHOB 2Y0SE 1HZCA 4DV1L 2VW9A 1V1QA 1M90C 3K80C 4EX5A 4IOCA 2ATWA 2VY3A 1N8RC 5M3MH 4MZ9A 2A8VA 1D8LA 2JEBI 3T1HL 5LMUQ 2VQFL 2I5HA 3S2DH 1HNWQ 1HZAA 2PQAB 2RHSB 1J6QA 3AQQA 5IP7G 5C0XG 1K9MC 3U4VA 4UPAA 3RR5A 4A76A 2FXQA 2H5XA 2I5MX 3CCMA 1X9NA 1GD7A 3T1HQ 1M1KC 2R93H 1IBLL 1EIYB 5HY6A 2IX1A 1X65A 1TXYA 4X64L 2L15A 2R7ZG 3CQZH 1E24A 5JEAJ 2JA8H 2LXJA 2XGTA 1NBWA 1RL2A 1EWIA 3G48A 4QY7A 1E3PA 1L1OC 2CKZB 4A3CH 3PUXA 1B8AA 1A62A 1PFSA 4DV7Q 2D0OA 3RN2A 1CKOA 2AWOA 3J80i 1NE3A 1VQAA 1W2BA 1QZHA 2VUMG 1OXTA 2JQOA 4LF5L 5IYDH 4HIDA 2R7DA 1K8GA 3I7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3I G;  4NXN L;  1YHQ A;  2K52 A;  3U58 A;  4PG3 A;  1YI2 A;  4A75 A;  3A0J A;  2N78 A;  4DV4 L;  1OXV A;  4IPC A;  3K7A H;  1X3G A;  4A3J H;  2K4K A;  4YWM A;  2ID0 A;  4DV6 L;  4BXX G;  2UXC Q;  2BA1 A;  4L5Q A;  3ER0 A;  3HFZ B;  4GLA C;  1AH9 A;  2OTJ A;  1N36 Q;  3L7Z C;  2CQO A;  3PO3 H;  4A3E H;  5LMN W;  2E5L Q;  1IBK L;  4XIG S;  4GNX C;  4JYA Q;  3K8A A;  2UXC L;  2NN6 G;  2ZJP A;  4LUO A;  4IJH A;  3HOW G;  1QVC A;  1Q8K A;  4DR4 Q;  1PA6 A;  4IPH A;  3GD7 A;  4P75 A;  3S24 A;  1G29 1;  1D7Q A;  3ULL A;  4JOI A;  1FGU A;  1XTD A;  1Q1B A;  2ALY B;  3PCO B;  3DM3 A;  3CCV A;  3M3Y H;  3CXC A;  2ES2 A;  4A4I A;  4NXN Q;  3PIO A;  1NTG A;  3RZD H;  3A74 A;  2HHH Q;  1HR0 Q;  3GTG H;  3H0G H;  2WAQ E;  4PMW A;  4GOP C;  2MFI A;  1Q81 C;  1YJW A;  1QZG A;  2NVT H;  4HIM A;  2HHH L;  2UUB L;  4LF9 Q;  1N36 L;  2EIF A;  3UDX A;  3CP0 A;  4X64 Q;  1E1T A;  2B29 A;  4BY7 G;  1TWG H;  1WCM H;  4IPG A;  1L0W A;  1VQK A;  5M3F G;  4DR3 Q;  1KC8 C;  4LUV A;  4LF8 L;  3CPF A;  1VQB A;  2A1A A;  3L2P A;  2JA8 G;  2JEA I;  1X54 A;  4P72 A;  1HNX Q;  4OWW B;  4PZ7 A;  1HNW L;  5C4J H;  4B3M L;  3NEN A;  3AYH B;  3CF5 A;  1X56 A;  4JOI C;  5IE8 A;  4A93 G;  5BR8 L;  1HJP A;  1VQO A;  4R4Q A;  3TRE A;  1XPO A;  4BBS H;  2KCT A;  3STB D;  2UU9 L;  4JI1 Q;  1Z47 A;  2JA9 A;  4QIW E;  3HOW H;  1I6H H;  3H15 A;  1EFW A;  1YHA A;  2ZTC A;  4TVA B;  4BY1 H;  4QGU A;  4NXM L;  3S2H H;  4FDB A;  4DUZ Q;  3FKI H;  1JMC A;  4OXP A;  1JE5 A;  3CC4 A;  4HJA A;  1SLJ A;  4DR3 L;  3S1M H;  4RMF A;  3S1Q H;  3CCL A;  2XTI A;  4A3G H;  2PI2 E;  4A3K H;  1Q82 C;  4DR4 L;  3FHW A;  3HKZ E;  3F2D A;  3TS0 A;  2R92 G;  4OWT B;  4KHP Q;  3HOV H;  4DUZ L;  4HJ7 A;  3S15 H;  1VQE A;  3S17 H;  1Y1W G;  4X62 L;  4BBS G;  4JI6 Q;  2GN5 A;  4GNX A;  1JJG A;  2ZTD A;  4IFD G;  1HNZ L;  1IL2 A;  2CWA A;  2OWO A;  5H1S E;  3I4M H;  3EBE A;  3WWV A;  4DR6 Q;  1N33 L;  4KLK A;  1WCM G;  1Y1V H;  2KHJ A;  3RLO A;  1XMQ L;  1Q46 A;  5AJ3 Q;  5M3F H;  2HT1 A;  1I94 Q;  3I2Z A;  4L5R C;  1VQN A;  1L2F A;  2NN6 I;  3H0G G;  2ASB A;  5C3E G;  4HJ8 A;  2NVX H;  4ALP A;  1VCI A;  4DK6 C;  1YIJ A;  1XNR Q;  3OTO L;  3PUV A;  2UUB Q;  3KLW A;  4ME3 A;  4LF9 L;  4GKJ L;  1B7Y B;  3W5O A;  1IBM L;  3A5U A;  3F1Z A;  3AEV A;  1VS0 A;  4AQY L;  1N34 L;  4JI3 L;  3HKZ G;  1S40 A;  5LMN L;  5IP7 H;  1EQR A;  4DV5 L;  2UXB Q;  1R9T H;  4DR7 Q;  1AE3 A;  1PH6 A;  4NB3 A;  4P73 A;  1MJE A;  3PUZ A;  3GTP H;  1VQJ A;  1I3Q H;  3CC7 A;  2K5H A;  2WP8 J;  4JI6 L;  4MNO A;  4JI7 Q;  2KBN A;  2A19 A;  1PH7 A;  2UXB L;  3U4Z A;  4C3I H;  1K73 C;  3STB C;  3KFU A;  1MIU A;  4YY3 L;  3IRB A;  3CCJ A;  3CCQ A;  1G51 A;  4YCW A;  3ULJ A;  4YWL A;  2JA5 G;  4LFB Q;  3RLN A;  1V43 A;  2WB1 E;  3L0O A;  4DV2 L;  3J7Z C;  1PH9 A;  1MJC A;  3HKS A;  1XNR L;  3OTO Q;  2Q2I A;  4DV0 Q;  2E2J H;  4IPD A;  1VQ4 A;  3TS2 A;  2R7Z H;  1X3E A;  3H3V I;  4OX9 Q;  4JC0 A;  5DLQ E;  2YV5 A;  1GKH A;  2D0P A;  4JBJ A;  5ELN A;  3M4O H;  1XNQ L;  4B3R Q;  1BVS A;  3D31 A;  4A3G G;  2B63 G;  4JI8 L;  5LMU L;  2R92 H;  4JG2 A;  4C3H H;  1PH3 A;  4LF4 Q;  1TWC H;  1UWV A;  1EOV A;  4JI1 L;  5E7N A;  1A63 A;  2CWP A;  4JCV E;  1P16 A;  4DR5 L;  1XNQ Q;  2ZM6 L;  4J15 A;  4A3I H;  4B3R L;  1N32 Q;  3EIV A;  4DV3 Q;  5IYD G;  1EIF A;  1U5K A;  2YTY A;  2QA4 A;  4A3M H;  1OTC A;  4LF4 L;  1L1O B;  2YTV A;  2IHF A;  3FP9 A;  3G4S A;  4OO1 G;  3U50 C;  4NXM Q;  4LFC L;  3S1N H;  2Q2U A;  4R4I A;  4EQ5 A;  1UE5 A;  3J81 c;  3CMA A;  2KCM A;  1YVC A;  4DR1 L;  4LF7 Q;  2JE6 I;  2KHI A;  3CCS A;  1W3S A;  4AIM A;  4GLV B;  1Q1E A;  5IYB G;  3MEF A;  2UUA L;  2R6G A;  4AQY Q;  1N34 Q;  4JV5 L;  1VQP A;  2JA6 H;  4P71 A;  4BBR H;  5C44 H;  1IYJ B;  5C0X I;  3S1R H;  4A3E G;  1RIP A;  3KF8 B;  1YBY A;  4DK3 C;  3CCR A;  1GO3 E;  3G71 A;  2QGQ A;  4UP8 A;  1JB7 A;  4B3S Q;  3HOU G;  3AFP A;  1G6P A;  1BBW A;  4QQB X;  3UDG A;  1GM5 A;  2PQA A;  1E22 A;  1XMO Q;  4DNI A;  2OQ0 A;  2MO0 A;  3I4N G;  2EQS A;  3RZO H;  2UXD L;  3Q8D A;  2ZM6 Q;  1PH4 A;  4L5T A;  1DGS A;  4XTC S;  4LNQ A;  4DUY Q;  4JI0 L;  2IHE A;  4O0A A;  3JC6 6;  2UXD Q;  4NPS A;  3E9I A;  4R1J A;  4LFC Q;  1LYL A;  5FJ8 G;  2UUC Q;  1E1O A;  1SRU A;  1EUJ A;  2IX0 A;  1B70 B;  3PF5 A;  5LMN Q;  1CSQ A;  2OTL A;  2JA6 G;  3KF6 A;  3BZK A;  5FLX c;  3HOZ H;  2UUA Q;  2Z6K C;  4POF A;  2Q2T A;  2VQF Q;  1XPU A;  1KIX A;  1JJC B;  5J3B A;  3PO2 G;  4HJ9 A;  4BY7 H;  4A3C G;  4QL5 A;  4OX9 L;  2RCN A;  1PHJ A;  1VQ7 A;  1CKN B;  4JI8 Q;  4DV1 Q;  3W1G A;  1E7Z A;  1C9O A;  3B6Y A;  4YY3 Q;  4OON A;  1Q86 C;  4JBK A;  4RG1 A;  2LSS A;  4Y52 H;  3KYH C;  3K7U C;  5BR8 Q;  4P74 A;  4IOA A;  3CD6 A;  4C3J H;  1LM0 A;  1KAW A;  1BBU A;  2F4V Q;  1TWA H;  5K36 G;  4A93 H;  4A3M G;  3PF4 A;  2AKW B;  2E2I H;  4C2M H;  4KHZ A;  3GTL H;  1XPR A;  1KD1 C;  1PH5 A;  2DGY A;  4LUZ A;  1YEZ A;  4AYB E;  3DLL A;  3FKI G;  3KDF B;  3M9B A;  5GAG C;  4JI4 Q;  5GAH C;  4DPG A;  1TWF H;  1U0L A;  3F2C A;  3KJP A;  2ZJQ A;  3LGJ A;  3SGI A;  3I55 A;  4UY8 C;  1C7Y A;  4YHH L;  2VUM H;  2Z0S A;  4KHP L;  3HOV G;  2WFW A;  4DV3 L;  4APV A;  1QVG A;  2K75 A;  1VQ6 A;  3S14 H;  3PUW A;  4LF5 Q;  1TWH H;  4A3D H;  1V9P A;  1HNZ Q;  1CSP A;  5GQO A;  1VQF A;  4OWX B;  3ERS X;  3ULP A;  1Y14 B;  1JJ2 A;  2E5L L;  4B3T Q;  1FVI A;  1PYB A;  4HIK A;  3CPW A;  4DR1 Q;  2E2H H;  1Q12 A;  2MQH A;  2VNU D;  4GN4 B;  2E8G A;  2MO1 A;  4YWK A;  4H02 A;  4YCU A;  1FL0 A;  4JV5 Q;  2K5N A;  3RNU A;  1SRO A;  1HZB A;  2ZJR A;  4GKK Q;  3PSI A;  2HIV A;  4LF8 Q;  4BA2 I;  2NZO A;  3M4P A;  1KHI A;  4DV7 L;  3J81 j;  2QEX A;  4JI5 L;  3UDI A;  4POG A;  3CAM A;  4X62 Q;  1VQM A;  1PV4 A;  1VQ8 A;  1H95 A;  2Z6K A;  1S3O A;  4YHH Q;  1BKB A;  2F52 A;  1PYS B;  1PH2 A;  2NVY H;  3UDF A;  1X55 A;  4GOP B;  4JI5 Q;  2R7F A;  3BJU A;  4DUY L;  4K0K L;  4X6A H;  5IYC G;  3J81 i;  1K83 H;  4A3B H;  4TQU S;  5GRO A;  4R4C A;  1VQ5 A;  4A3F H;  1C0A A;  5IP9 H;  5M5W H;  4WJ4 A;  4DKA C;  3E9H A;  4K0K Q;  2IT1 A;  4AH6 A;  2B3G A;  4GKJ Q;  2PNH A;  4GS3 A;  1VQG A;  4LFB L;  4OO1 I;  1P8L A;  2N49 A;  1I5F A;  2BH8 A;  1MKH A;  5FLM G;  2VZA A;  4DV5 Q;  1Q7Y C;  4LF6 Q;  1X3F A;  3OYY A;  2I0Q A;  2AWN A;  1X6O A;  4QJF A;  1EYG A;  2K5V A;  3ZJY C;  3M4Q A;  3PUY A;  4JBW A;  2VQE Q;  3H3V H;  1VQH A;  4X66 Q;  2VL6 A;  1LUZ A;  4A3B G;  2EXD A;  3F2B A;  1HNX L;  3TRZ A;  1CKM A;  2VQE L;  1N33 Q;  1YZ6 A;  4GN3 B;  1WFQ A;  1HR0 L;  1OXX K;  5GAD C;  1VQL A;  2IY5 B;  4LW1 A;  3PV0 A;  2K14 A;  4DV4 Q;  4A3D G;  4DR5 Q;  5JJL A;  2F3I A;  1VQD A;  1CUK A;  4A3K G;  3GTO H;  2DUD A;  3GTM H;  3W1B A;  3CME A;  1NMF A;  3KOJ A;  5EAY A;  4JI3 Q;  4JI4 L;  3M7N A;  4O2D A;  4GKK L;  3GDE A;  1NY4 A;  5GAE C;  3E0E A;  3KDF A;  2N3S A;  4R4T A;  1Y1V G;  3GTQ H;  1PVO A;  4DAY B;  3CW2 C;  4B3M Q;  3JAM i;  4A3J G;  4GN5 A;  4BBR G;  2PI2 A;  5C3E H;  3HOX H;  3BU2 A;  5FJ8 H;  1Y1W H;  4X65 Q;  1AE2 A;  5C0X J;  2ZTE A;  2HQL A;  3CCE A;  4DV6 Q;  2Q2H A;  4B3T L;  2UU9 Q;  1OXS C;  1XMO L;  1O7I A;  3RLF A;  2KEN A;  1IBM Q;  3TEH B;  3GTJ H;  3I4M G;  3HOZ G;  2I5L X;  5IYC H;  1IBK Q;  3CC2 A;  4DV2 Q;  1I50 H;  1LTL A;  5JJK A;  1QUQ B;  4A3F G;  5M5X H;  1GVP A;  3UE1 A;  1HH2 P;  2D62 A;  1WJJ A;  1HZ9 A;  5JEA G;  1I94 L;  1IXR A;  1J5E Q;  2OCE A;  4DR2 L;  4Y7N H;  1A0I A;  3VDY A;  5IY0 A;  3K0X A;  4LF6 L;  1NMG A;  3D0F A;  2RF4 A;  5IT9 c;  5FLM H;  5HGQ A;  3HOX G;  3BZC A;  1HR0 W;  2NVQ H;  3PO3 G;  1L1O A;  3J7A 5;  3G6E A;  4L5S A;  1VQI A;  4X66 L;  1KQS A;  3HOY G;  4IFD J;  4DAM A;  2NZH A;  3PO2 H;  4YCV A;  1YJN A;  2V1C C;  1WOC A;  1XJV A;  1UE1 A;  3JAM c;  2JA5 H;  1XMQ Q;  2N8N A;  4JI7 L;  2BA0 A;  5M5Y H;  4DV0 L;  2UUC L;  3NBH B;  4PZ8 A;  1KL9 A;  1K3R A;  4BA1 I;  1UE6 A;  1IBL Q;  3UE0 A;  2YYZ A;  2F4V L;  1NJI C;  1UE7 A;  1SFO H;  4A3L H;  4HJ5 A;  1PH8 A;  1A8V A;  2AMC B;  3CCU A;  4DR2 Q;  4JI2 L;  1ASY A;  2B63 H;  2JK8 A;  3HOY H;  1PH1 A;  1EQQ A;  1UEB A;  4B3S L;  1T9H A;  1YHB A;  4AYB G;  2MNA A;  3M85 A;  4LFA L;  1YIT A;  1FJG L;  3ICE A;  2HIX A;  1SN8 A;  1WI5 A;  3I4O A;  1Z9F A;  3OW2 A;  2WB1 G;  3F8T A;  2YTX A;  4X65 L;  1S72 A;  2JA7 G;  4DR6 L;  3KJO A;  1IZ6 A;  5M3M G;  5IYB H;  5ELO A;  1FJG Q;  4IFD I;  4BY1 G;  3NEM A;  3NEL A;  4LWC A;  4PZ6 A;  1N9W A;  2K50 A;  4A3L G;  3KF6 B;  2GVB A;  1K0R A;  5IWA Q;  4IJL A;  2CFM A;  2WAQ G;  3S16 H;  1JT8 A;  3HOU H;  2CCZ A;  2R93 G;  5JJI A;  4R4O A;  3RN5 A;  4JI2 Q;  3I4N H;  4JYA L;  3PGZ A;  2PMZ E;  5IWA L;  4GLX A;  3T1Y Q;  4LF7 L;  4WJ3 M;  2Y0S G;  1YJ9 A;  5C4X H;  1QVF A;  2RHQ B;  1SE8 A;  1SR3 A;  1K8A C;  3AFQ A;  1WYD A;  1SMX A;  3MXN B;  3K81 C;  5C44 G;  4LFA Q;  3GTK H;  3EN2 A;  2GVA A;  3TQY A;  4JI0 Q;  2C35 B;  2LXK A;  5AJ3 L;  3T1Y L;  1VQC A;  2BH2 A;  2JA7 H;  4BXX H;  4HIO A;  1CKN A;  2VS1 A;  4UP9 A;  4GNX B;  1N32 L;  2JJQ A;  4JBM A;  1VQ9 A;  1ASZ A;  4MTN A;  1OXU A;  1J5E L;  3I56 A;  1KRS A;  5IP9 G;  4GOP A;  1KXL A;  2YU9 H;  3A5Z B;  1YNX A;  2OQK A;  4UP7 A;  3J80 c;  3PIP A;  3GO5 A;  1QUQ A;  4DR7 L;  4KI0 A;  1KRT A;  4IO9 A;  5C4X G;  2AHO B;  2Y0S E;  1HZC A;  4DV1 L;  2VW9 A;  1V1Q A;  1M90 C;  3K80 C;  4EX5 A;  4IOC A;  2ATW A;  2VY3 A;  1N8R C;  5M3M H;  4MZ9 A;  2A8V A;  1D8L A;  2JEB I;  3T1H L;  5LMU Q;  2VQF L;  2I5H A;  3S2D H;  1HNW Q;  1HZA A;  2PQA B;  2RHS B;  1J6Q A;  3AQQ A;  5IP7 G;  5C0X G;  1K9M C;  3U4V A;  4UPA A;  3RR5 A;  4A76 A;  2FXQ A;  2H5X A;  2I5M X;  3CCM A;  1X9N A;  1GD7 A;  3T1H Q;  1M1K C;  2R93 H;  1IBL L;  1EIY B;  5HY6 A;  2IX1 A;  1X65 A;  1TXY A;  4X64 L;  2L15 A;  2R7Z G;  3CQZ H;  1E24 A;  5JEA J;  2JA8 H;  2LXJ A;  2XGT A;  1NBW A;  1RL2 A;  1EWI A;  3G48 A;  4QY7 A;  1E3P A;  1L1O C;  2CKZ B;  4A3C H;  3PUX A;  1B8A A;  1A62 A;  1PFS A;  4DV7 Q;  2D0O A;  3RN2 A;  1CKO A;  2AWO A;  3J80 i;  1NE3 A;  1VQA A;  1W2B A;  1QZH A;  2VUM G;  1OXT A;  2JQO A;  4LF5 L;  5IYD H;  4HID A;  2R7D A;  1K8G A;  3I7F A; 
#chains in the Genus database with same CATH topology
 1YHQ A;  3H6M A;  2K52 A;  2SEB D;  3L3O C;  1ENC A;  3S2H B;  3U58 A;  3A8K E;  4PG3 A;  1YI2 A;  3S16 B;  4A75 A;  4JK1 C;  5EPL A;  1HFN A;  3K7A H;  4A3J H;  2ID0 A;  2TMP A;  2Q8T A;  3VR6 A;  2UXC Q;  4L5Q A;  3ER0 A;  4A3E H;  2F0J A;  2E2J B;  2UXC L;  4G7O C;  2B2V A;  4LUO A;  3HOW G;  2O5J C;  2SOB A;  1Q8K A;  3K5L A;  2A68 C;  3GD7 A;  1Q1B A;  3M3Y H;  2ES2 A;  4EQO A;  5CC4 A;  5M5X B;  1H9K A;  3A74 A;  4A3I B;  3GTG H;  4LK1 C;  5E3F A;  2NB0 A;  3EFX D;  5CV5 A;  1Q81 C;  4HIM A;  2UUB L;  5DM6 3;  4A3C H;  3CP0 A;  2QCP X;  1WCM H;  4IUU A;  4LUV A;  1CZW A;  3CPF A;  4KK7 A;  2A1A A;  1BO0 A;  1I4H A;  3L2P A;  1K8M A;  3AB9 A;  1AP0 A;  4B3M L;  1AEX A;  3NEN A;  2F0E A;  3QIA A;  2DJF C;  4A93 G;  1HJP A;  1BUV T;  4KKS A;  2JP1 A;  2KCT A;  2UU9 L;  5K36 H;  4QIW E;  2B63 B;  1ENF A;  1WTR A;  1YHA A;  4L8J A;  1QCB D;  1SNO A;  3IFD A;  2KJX A;  4C3H B;  5NUC A;  3FKI H;  1JMC A;  2XN9 C;  2PI2 E;  2R92 G;  3TS0 A;  2F3V A;  3EA6 A;  1VQE A;  1EEI D;  3X3N A;  2ZTD A;  1Y8N B;  4IFD G;  3Q22 A;  2CWA A;  4UHV A;  5H1S E;  3NTK A;  3WWV A;  1WCM G;  1KLG D;  1PTO F;  4IN3 A;  1LTG D;  2Z4I A;  1I94 Q;  3HOY B;  2ASB A;  1GUO A;  4DK6 C;  2LFN A;  1ONL A;  4GKJ L;  1A2U A;  1B7Y B;  5FK9 C;  5FLX E;  1S5E D;  3HKZ G;  3CRK C;  1EQR A;  1VF7 A;  3TME A;  3OW7 A;  1PH6 A;  3H94 A;  2QDB A;  1STE A;  3PUZ A;  4ILW A;  1B2T A;  4MNO A;  2KBN A;  1PDQ A;  4FXD A;  1GUN A;  4K2K A;  5EKL A;  3IRB A;  1SDF A;  3CCJ A;  2PW5 A;  4YCW A;  2JA5 G;  1PH9 A;  3L0O A;  1IW7 D;  1MJC A;  3HKS A;  5KNC A;  5LL6 X;  5C0X H;  5IGF A;  2Q2I A;  1R4Q B;  3GQB A;  4DV0 Q;  2E2J H;  1TT2 A;  4HCE A;  3QG1 A;  2F0S A;  3QOJ A;  3W2D A;  1GKH A;  5BN5 A;  3M4O H;  4A3G G;  4JI8 L;  3D8G A;  2F4I A;  4JG2 A;  2IX3 A;  1TWC H;  3J81 L;  5DEH A;  5EBD A;  2B2Y C;  1GJX A;  4JCV E;  1P16 A;  4B3R L;  2CHB D;  4A3I H;  4FF3 A;  3ND9 A;  5IYD G;  2RDG A;  1U5K A;  4A3M H;  3N52 A;  2YTV A;  1EY6 A;  2F1M A;  3G4S A;  3U50 C;  4EQ5 A;  3DWA A;  3J81 c;  4PNY A;  4DR1 L;  3PQI A;  1W3S A;  1HCZ A;  1QE6 A;  3MEF A;  1BCP B;  2R6G A;  2K01 A;  4P71 A;  2J0T D;  4BBR H;  1IYJ B;  5C0X I;  5C4J B;  2PZW A;  1D2B A;  4B3S Q;  1GO3 E;  3G71 A;  3IKJ A;  1LTT D;  1SND A;  2AUK A;  1D1K A;  2PQA A;  1E22 A;  5CMD A;  1GM5 A;  3I4N G;  2UXD L;  2ZM6 Q;  4XTC S;  3BDL A;  1LLR D;  2PQE A;  1G6Z A;  1F2L A;  1HA6 A;  4DUY Q;  2UXD Q;  4LFC Q;  2UUC Q;  2IX0 A;  2AQ2 B;  2EOT A;  3HKZ B;  1CSQ A;  1TY0 A;  1ZKO A;  2OTL A;  2CQA A;  3OMG A;  4A3F B;  1JJC B;  2AQ3 B;  4HJ9 A;  4QL5 A;  1VQ7 A;  2MUY A;  1CKN B;  1DJR D;  1BXT A;  4JI8 Q;  1SMY C;  1LAB A;  1TY2 A;  4OON A;  2LSS A;  1RF2 D;  5EQ0 A;  3KYH C;  1TQO A;  5BR8 Q;  1FD7 D;  1TKW B;  4C3J H;  2QW7 A;  1TWA B;  1BBU A;  2F4V Q;  4U67 3;  1EEF D;  3RZO B;  1PH5 A;  2DGY A;  1YEZ A;  3EJI A;  4AYB E;  2Q8R E;  4JI4 Q;  3M4O B;  4DPG A;  3VR2 A;  2NVQ B;  2G9H D;  3I8Z A;  2L5T A;  1LTR D;  5FOB B;  3VR3 A;  4YIJ A;  1CSP A;  3ULP A;  2E5L L;  1B3A A;  3HP3 A;  4XT3 B;  2NYZ D;  4MHE A;  4HIK A;  2E2H H;  2MQH A;  2MO1 A;  4ZKB B;  5ELB A;  3HRZ C;  4YWK A;  4YCU A;  1FL0 A;  2KCN A;  5KEE A;  2F0T A;  3NXW A;  2D2C C;  5EBC A;  2HIV A;  4LF8 Q;  1D1I A;  3J7Y W;  2QEX A;  3T4A C;  3UDI A;  4POG A;  3U9O A;  5KND A;  3J7A F;  3A54 A;  1CT1 D;  3WOF A;  3OSO A;  3CKI B;  2JA8 B;  4X3U A;  3TP5 A;  1V1P B;  1AZP A;  4OHJ A;  1S5F D;  4A3B H;  1BCP F;  2OXP A;  3HS0 C;  3QWN A;  1C0A A;  2ICI A;  2L9H A;  2IT1 A;  4AH6 A;  2FJ2 A;  2PNH A;  2JYO A;  2A5H A;  4LFB L;  1I5F A;  2PMZ B;  5FLM G;  1NCV A;  4LF6 Q;  1X3F A;  2I0Q A;  1HQR D;  4IUQ A;  4A3J B;  1JOO A;  3ZJY C;  1Q3L A;  4X66 Q;  4ME5 A;  2VL6 A;  1SSO A;  4ZKC B;  3S9W A;  1HFG A;  4H44 C;  5KIX A;  2B2W A;  3PV0 A;  2H1E A;  4A3D G;  3NSW A;  3R8B A;  2B39 A;  2VUM B;  3GTM H;  5KGU A;  5TSS A;  3NTH A;  1R4P B;  5COY A;  3A8I E;  4K6L A;  1YNN C;  4QF4 A;  4A3M B;  1WD0 A;  1DXM A;  3GTQ H;  1D5M C;  2PI2 A;  3Q0A A;  1SFO B;  1DOK A;  1O7I A;  3RLF A;  3GTJ H;  2I5L X;  3I72 A;  4DV2 Q;  2F0V A;  2K33 A;  2WAC A;  1GVP A;  4CKC A;  3OPO A;  1J5E Q;  1PZJ D;  2K1B A;  2OCE A;  3K0X A;  2K03 A;  4O1N A;  3D0F A;  3U9S A;  5FLM H;  5HGQ A;  3BZC A;  3PO3 G;  1ML0 D;  4K6D A;  4L5S A;  2R3Z A;  1BNZ A;  1SYF A;  3T53 B;  4NP5 A;  1WTQ A;  2L12 A;  1II3 A;  4PMB A;  3BZD B;  4CKB A;  3BVG A;  1KL9 A;  1B3Q A;  1PH8 A;  1A8V A;  2AMC B;  5IOC A;  2B63 H;  1LTI D;  3HOY H;  1UEB A;  2EDG A;  1LT6 D;  1YHB A;  1CK1 A;  3D4R A;  3M85 A;  1FJG L;  2NBF A;  2HIX A;  3S14 B;  1SN8 A;  1WI5 A;  1XXG A;  3I4O A;  4O42 A;  2WB1 G;  2DNC A;  1S72 A;  2JA7 G;  1IZ6 A;  5M3M G;  1LO5 D;  2MHV A;  1C48 A;  3S15 B;  2X6L A;  1STY A;  4PZ6 A;  3TP7 A;  4A3L G;  3I70 A;  3KF6 B;  2GVB A;  2VB3 X;  1F9Q A;  5IWA Q;  1RHP A;  2CFM A;  1BCP C;  1JT8 A;  2CCZ A;  4QUC A;  5JVH 3;  4JYA L;  2PMZ E;  5IWA L;  4GLX A;  3T1Y Q;  4LF7 L;  4ZK9 B;  1QVF A;  2LS0 1;  1SR3 A;  2HDM A;  1WYD A;  3R93 A;  1SMX A;  1PFB A;  2K7V A;  4LFA Q;  1XTC D;  2GVA A;  2B2U A;  1EY9 A;  4BXX H;  4BBS B;  1CKN A;  2VS1 A;  2L0C A;  3GV6 A;  3TSS A;  3VYU A;  4EQP A;  4JBM A;  1VQ9 A;  1AFP A;  1L0Y B;  1OXU A;  2RBM A;  1KXL A;  1WCM B;  4UP7 A;  2K32 A;  2EY5 A;  3GO5 A;  1QUQ A;  4S3S A;  4KI0 A;  4RHS A;  4DR7 L;  4IO9 A;  2K04 A;  1A2T A;  3HG9 A;  5JAV A;  1M90 C;  3K80 C;  1DCZ A;  3OIP A;  1T5E A;  1PRT C;  1F9P A;  1GUS A;  2JEB I;  1Z7T A;  2I5H A;  3S2D H;  5BN3 A;  2PQA B;  5IP7 G;  1DZ1 A;  1GUG A;  2FFK B;  1PTO D;  1S5D D;  2KCC A;  3RR5 A;  5DNF A;  2FXQ A;  3U4V A;  3CCM A;  4A76 A;  1X9N A;  1M1K C;  1KAB A;  1IHZ A;  3VA7 A;  2EE1 A;  4G7Z C;  2RQX A;  3GTK B;  4DK1 A;  1IKM A;  2XGT A;  4K2L A;  3DEO A;  2R61 A;  1E3P A;  4QY7 A;  1B8A A;  4DV7 Q;  3RN2 A;  2VUM G;  3LNN A;  2JQO A;  5I9O A;  4LF5 L;  4HID A;  3W3A A;  1UEA B;  4BY1 B;  1I3Q B;  4NXN L;  4QCL A;  1BCP D;  4K5X A;  2EVB A;  4CDD C;  2IWH A;  5LL6 S;  1X3G A;  2Q8I B;  4YWM A;  2Z4H A;  3HFZ B;  4FP5 D;  2OTJ A;  1N36 Q;  3L7Z C;  3QB3 A;  4ZCK A;  2NN6 G;  2ZJP A;  1PA6 A;  2IJ0 A;  4P75 A;  3IFT A;  4JOI A;  1XTD A;  1B9M A;  2QF7 A;  3PCO B;  1HXY D;  3CCV A;  4A4I A;  1ET6 A;  1NTG A;  3RZD H;  2HHH Q;  4XQN A;  1HR0 Q;  3K59 A;  2ZT9 C;  2NVT H;  5KYI A;  2HHH L;  4ID6 A;  3AU7 A;  1TU2 B;  2EIF A;  3UDX A;  4BY7 G;  3P20 A;  1DD2 A;  2B29 A;  2YU9 B;  2ZXO A;  1X3Q A;  2M2L A;  4P72 A;  1HNX Q;  2B2T C;  4OWW B;  4PZ7 A;  1FNW A;  1ZXT A;  1LTA D;  4JOI C;  1JWM D;  5IE8 A;  1KNE A;  1V1O A;  1WTO A;  1VQO A;  1XPO A;  4BBS H;  1NUC A;  4JI1 Q;  1SXT A;  4JVZ A;  1HRJ A;  3H15 A;  5CBE E;  1FGB D;  3S1M B;  2OT2 A;  4RMF A;  4HTH A;  2HQE A;  2XTI A;  1Q82 C;  1HA5 A;  3FHW A;  1D6E C;  1QIL A;  3K5O A;  4OWT B;  2CW0 C;  4HJ7 A;  4FF4 A;  3S15 H;  2FHT A;  2O4X A;  3L9A X;  3ONA B;  1HUN A;  5IT9 E;  1CQF A;  4NKL A;  3EBE A;  4DR6 Q;  4OO1 H;  3RLO A;  2KHJ A;  4KY6 A;  4RAU C;  1Q46 A;  2HT1 A;  3TBI B;  1D5X C;  1CHP D;  1VCI A;  2F0M A;  2EYF A;  3HGB A;  3OTO L;  1XNR Q;  4LF9 L;  3A5U A;  3F1Z A;  2EYH A;  4AQY L;  1N34 L;  4JI3 L;  3VYR A;  3D6W A;  4MTK A;  4A3K B;  5LMN L;  3EQL C;  1GHK A;  2UXB Q;  1R9T H;  5AFW A;  4P73 A;  3GTP H;  1F2Z A;  1DOL A;  2K5H A;  1PH7 A;  3U4Z A;  4C3I H;  3URY A;  4M1U B;  1TVX A;  1MIU A;  1SBB B;  2BDN A;  5JVG 3;  3CCQ A;  1YNN D;  2VXW A;  4LFB Q;  4C56 C;  3OTO Q;  3BVM A;  3TS2 A;  4MN3 A;  1VQ4 A;  4ZQ3 A;  1RCV D;  1SYG A;  2YV5 A;  4HAE A;  4HSV A;  1XNQ L;  1FNU A;  2B63 G;  2R92 H;  1PH3 A;  1SAP A;  4J15 A;  1PTO B;  2YTY A;  1OTC A;  4ZLT F;  2B2Y A;  3S1N H;  2Q2U A;  4R4I A;  2LKV A;  2B8G A;  4H7B A;  3CMA A;  2KCM A;  1YVC A;  4LF7 Q;  4KTA A;  4AIM A;  5IYB G;  4GLV B;  1Q1E A;  1ZYR C;  4A3D B;  1ICF B;  4AQY Q;  1N34 Q;  2UUA L;  4A3E G;  1RIP A;  1JWU D;  1EQT A;  1PRT B;  2MO0 A;  5FO9 B;  3FPU B;  3Q8D A;  3I3C A;  1PH4 A;  1PFN A;  4JI0 L;  2IHE A;  4O0A A;  3JC6 6;  5ELF A;  4NPS A;  3TP6 A;  1LYL A;  5FJ8 G;  2Z8L A;  4B9X A;  1SRU A;  1B70 B;  2XWJ B;  2EJG C;  2JA6 G;  2UUA Q;  4POF A;  2Q2T A;  5M5W B;  1F2M A;  5J3B A;  4BY7 B;  4A3C G;  4KY7 A;  3W1G A;  1SMY D;  3B6Y A;  2LY7 A;  4UDU C;  3E6Z X;  3JAM E;  4L63 B;  1T5X D;  1Y8O B;  4P74 A;  3CD6 A;  1O7Z A;  5C5L A;  2F0N A;  1TWA H;  5M9O A;  2DNE A;  1F9S A;  2F0D A;  4A3M G;  4XT1 B;  4DGZ A;  2E2I H;  3BS1 A;  3C3L A;  1PTO C;  1XPR A;  2F0K A;  4CJ2 C;  1A3U A;  4XQJ A;  1EIG A;  2D9U A;  3DLL A;  3GTQ B;  5GAH C;  1IL8 A;  1TWF H;  1U0L A;  1SNP A;  1EYA A;  3LGJ A;  3SGI A;  1KDB A;  4YHH L;  2Z0S A;  3I4L A;  4MIU A;  3HOV G;  3R2T A;  4DV3 L;  4APV A;  1H9S A;  2K75 A;  1QVG A;  3S14 H;  1Y1V B;  5IGG A;  3IAY A;  1HNZ Q;  1VQF A;  3ERS X;  3CPW A;  2TSS A;  4IZ8 A;  1E2Z A;  3RNU A;  5G3L F;  1SRO A;  1HUM A;  3M4P A;  2D5D A;  4RKL A;  1VQM A;  1VQ8 A;  1RJT A;  1S3O A;  4YHH Q;  1BKB A;  1PYS B;  1PH2 A;  2A73 B;  3UDF A;  5LHY 1;  3BJU A;  5IYC G;  4DN4 M;  2LMC B;  4TQU S;  5IP9 H;  1JB3 A;  4DKA C;  1CM9 A;  2B3G A;  3K0Y A;  1ZEQ X;  2N49 A;  4C3I B;  4IUP A;  4DV5 Q;  3OYY A;  4WJW A;  2MP1 A;  2AWN A;  1U4L A;  1X6O A;  4TKO B;  2L55 A;  4V0B A;  1EYG A;  4KD4 A;  3M4Q A;  5JPN C;  3PUY A;  4OL7 A;  5M3M B;  3FVQ A;  1QB5 D;  4HMJ A;  1U9R A;  3TRZ A;  3J7A V;  4NW2 A;  1N33 Q;  1YZ6 A;  2IY5 B;  1OXX K;  2NUC A;  5GAD C;  4LW1 A;  3LWU A;  2K14 A;  4DR5 Q;  5JJL A;  2F3I A;  4A3K G;  1RDP D;  1STA A;  1NR2 A;  3M3Y B;  1ILP A;  2DUD A;  2BE5 D;  2BDO A;  3CME A;  3DEP A;  4NDX A;  4R9W A;  1K83 B;  3E0J A;  4GKK L;  2F0W A;  3KDF A;  1EWC A;  4NMZ A;  3HOV B;  1GHJ A;  3CW2 C;  3HEJ A;  4DAY B;  1E2W A;  3JAM i;  4GN5 A;  4K5W A;  3HOX H;  2Z9H A;  4X65 Q;  1AE2 A;  1I4G A;  2Q2H A;  2UU9 Q;  2PNR C;  1XMO L;  1WVL A;  3LWE A;  4RH6 A;  2KEN A;  4C3J B;  3TEH B;  2QEJ C;  4CBV A;  3UE1 A;  1HH2 P;  1HZ9 A;  3BYY B;  2QIL A;  2J7Z A;  4ZUJ A;  1CA6 A;  5IY0 A;  3RMH A;  3NHH A;  4DNT B;  3A7A B;  2NVQ H;  5JOB A;  1K0S A;  5ELC A;  3G6E A;  4DAM A;  3PO2 H;  1WD1 A;  1STH A;  3NBI A;  5T1I A;  2NVY B;  2V1C C;  1WOC A;  3VR4 A;  1UE1 A;  4IUR A;  1VMC A;  4RGO S;  4JI7 L;  5M5Y H;  5KRU A;  4DV0 L;  5CYU A;  3NBH B;  1HTP A;  4PZ8 A;  4BA1 I;  1NSN S;  2YYZ A;  4C1N K;  1UE7 A;  1SFO H;  1MD2 D;  1GOZ A;  4RGN A;  5C44 B;  3MHB A;  1GUW A;  1T9H A;  1BR9 A;  5ELD A;  1YIT A;  1FYC A;  1LV9 A;  4C1N I;  4X3T A;  5I2Y A;  2F0U A;  2Y0S B;  4X65 L;  3F8T A;  2G9D A;  5IYB H;  4IFD I;  4KV6 A;  2EJF C;  1FJG Q;  3E3X A;  3NEL A;  2EY2 A;  2ZXP A;  4LWC A;  3S17 B;  3N6R A;  1S4Z A;  4OIJ A;  4E6I A;  3S16 H;  1EZ8 A;  5C4H A;  4R4O A;  2MPM A;  3RN5 A;  4OEL B;  5IGD A;  1TS4 A;  2Y0S G;  1YJ9 A;  5C4X H;  3I91 A;  3AFQ A;  1JIC A;  1M4V A;  3SK6 A;  5C4Z A;  3MZ5 A;  3K81 C;  2E74 C;  3CQZ B;  3TQY A;  4JI0 Q;  2JA7 H;  3T1Y L;  2LXK A;  2V4D A;  3C2P A;  1VQC A;  1ENA A;  4HIO A;  1LAC A;  2QDL A;  4IUN A;  1Q8I A;  5I6Y A;  2WKC A;  1EY4 A;  4IUT A;  2DY7 A;  1SNC A;  1PRT D;  4ZUI A;  4K14 A;  2YU9 H;  3A5Z B;  3RD4 A;  3PIP A;  2HCC A;  2AHO B;  4X3S A;  2Y0S E;  1JOK A;  2FMM A;  2VW9 A;  1V1Q A;  1R9T B;  1N8R C;  2A8V A;  3M4Y A;  2VQF L;  1HZA A;  1WTV A;  1LTS D;  3VA5 A;  4UPA A;  1X32 A;  2H5X A;  3A8J E;  2L1B A;  1IBL L;  1EIY B;  2IPK D;  2IX1 A;  1X65 A;  1TXY A;  4X64 L;  2L15 A;  3KLR A;  3PIO 3;  1E24 A;  2JA8 H;  1EWI A;  3G48 A;  1ZYR D;  2CKZ B;  3DM1 A;  3PUX A;  4CHT B;  1PTO H;  2N88 A;  3J80 i;  1NE3 A;  1VQA A;  4KHV A;  4N9P A;  1W2B A;  1K8O A;  1OXT A;  5IYD H;  2R7D A;  2F0Q A;  3I7F A;  1EQQ A;  4A3I G;  2VB2 X;  3NUC A;  3P75 A;  1EU3 A;  2N78 A;  4DV4 L;  3H0G B;  2WV6 D;  1HTL D;  1OXV A;  4IPC A;  4BXX G;  2JXM B;  5T1G A;  4RHR A;  1SE3 A;  2AQ1 B;  4KN4 C;  1IW7 C;  2CQO A;  3PO3 H;  2A74 C;  5LMN W;  1IBK L;  4XIG S;  4GNX C;  3K8A A;  3QOL A;  3SEB A;  4IPH A;  3S24 A;  1G29 1;  1D7Q A;  1FGU A;  1JOQ A;  2A6E D;  3DM3 A;  1B9N A;  2EXZ A;  4NXN Q;  3PIO A;  1JQY D;  5CV7 A;  2KEC A;  3H0G H;  3MXN A;  2E2D C;  2MFI A;  3BVZ A;  4I7Z C;  1YJW A;  3MC0 B;  2XNA C;  4LF9 Q;  3J81 E;  3MEH A;  1N36 L;  4X64 Q;  1L0W A;  3LX0 A;  5M3F G;  3RUZ A;  4DR3 Q;  1KC8 C;  2JEA I;  2HDL A;  1HNW L;  5C4J H;  2E75 C;  3AYH B;  4C3J G;  3Q23 A;  3MVV A;  3KK7 A;  4J8Q A;  5BR8 L;  3ND8 A;  3TRE A;  3VYT A;  4X3K A;  5DM7 3;  2RCF A;  2JA9 A;  1I6H H;  2R93 B;  3GP7 A;  2OEO A;  2ZTC A;  2CW0 D;  3VYS A;  4BY1 H;  1Z6H A;  3S2H H;  3K6O A;  4FDB A;  4DUZ Q;  3D3R A;  4OXP A;  3S1Q H;  5HGT A;  1SLJ A;  4DR3 L;  1O7Y A;  4A3K H;  3WOE A;  3HKZ E;  4N8F A;  1S5C D;  3F2D A;  3HOV H;  4DUZ L;  3S17 H;  2BE5 C;  3KBX A;  1STN A;  3T51 B;  4JI6 Q;  4FXG C;  5C3X A;  1HNZ L;  1V8Q A;  5A35 A;  2OWO A;  3I4M H;  1PMR A;  2SDF A;  1Y1V H;  2NZ1 D;  2EYO A;  1XMQ L;  5AJ3 Q;  5M3F H;  2PCF B;  3JAM L;  1AN8 A;  2NN6 I;  3H0G G;  4HJ8 A;  2NVX H;  4ALP A;  1YIJ A;  2XVS A;  1O78 A;  1A15 A;  3W5O A;  1TWC B;  5JPM C;  1S40 A;  1MBY A;  5IP7 H;  4DV5 L;  1MI2 A;  2DY8 A;  4DK0 A;  2F0H A;  1VQJ A;  1I3Q H;  2WP8 J;  4JI7 Q;  1G2T A;  2UXB L;  2A19 A;  3MTS A;  4JW0 A;  1K73 C;  4QB4 A;  3KFU A;  3ERO A;  4RCO A;  1MSG A;  4BBR B;  3ULJ A;  2KEE A;  4G57 A;  1A63 A;  1V43 A;  4DV2 L;  3K57 A;  1XNR L;  2WB1 B;  2F0O A;  1B44 D;  3I4M B;  4F8M A;  1YNJ D;  2R7Z H;  1K3B C;  1X3E A;  5I6W A;  2D0P A;  1DYQ A;  2BCO A;  3QR8 A;  5LMU L;  4EGV A;  2J4X A;  4LF4 Q;  1UWV A;  5E7N A;  1XNQ Q;  3GTG B;  3FKI B;  5A2Q L;  3SK8 A;  1SJE D;  1N32 Q;  3EIV A;  1EIF A;  1I6H B;  4LF4 L;  1L1O B;  2KQ3 A;  4OO1 G;  1JOR A;  5D65 A;  4NXM Q;  2WIN B;  3GV3 A;  1CQV A;  1AZQ A;  4WFN 3;  1PXU A;  2JE6 I;  2KHI A;  3CCS A;  2SNM A;  1VQP A;  2RSO A;  1CTM A;  4HR7 B;  5C44 H;  4N8X 1;  1ILQ A;  3KF8 B;  4OX9 Q;  4DK3 C;  1JB7 A;  4UP8 A;  3HOU G;  3H3V C;  3AFP A;  1BBW A;  4CDF C;  3UDG A;  1XMO Q;  3X3M A;  4XYO A;  2K5Q A;  5JEA H;  3NBH A;  4L5T A;  2P5Z X;  4LNQ A;  1L0X B;  4C3I G;  1RD9 D;  2EYP A;  2RDH A;  2XSC A;  1WTW A;  1J8I A;  3WDN A;  5COR A;  1ET9 A;  2GA4 B;  3V96 A;  3KF6 A;  1EYD A;  2EYJ A;  2F0G A;  5FLX c;  3HOZ H;  2Z6K C;  1EFI D;  1KIX A;  1WTP A;  4BY7 H;  3DMU A;  4OX9 L;  2RCN A;  1SE2 A;  1I4Q A;  5ELE A;  3FDT A;  4ZRZ A;  3PO3 B;  1YNJ C;  1C9O A;  2X6G A;  4YY3 Q;  1DOM A;  4RG1 A;  1PLF A;  1MHW C;  3K7U C;  5CR3 A;  4JPB W;  3GTJ B;  5C4X B;  3KLS X;  5K36 G;  1SNM A;  4A93 H;  4FYD A;  2K5W A;  5IT9 L;  3SHL A;  4KHZ A;  1XX8 A;  3T56 B;  1KD1 C;  3PIP 3;  4DAY A;  2NWG A;  1QNK A;  3MAQ A;  3M9B A;  5GAG C;  2ZJQ A;  3KJP A;  3A7L A;  3I55 A;  4UY8 C;  1D5Z C;  3GTM B;  2VUM H;  4KHP L;  3HZX A;  1VQ6 A;  1H9J A;  3PUW A;  1EY7 A;  1TWH H;  4KKT A;  1BOS A;  1UAP A;  2A69 C;  1Y8P B;  4OWX B;  1JJ2 A;  1EOT A;  3K5M A;  1Q12 A;  1U4M A;  3OMC A;  1CZG A;  2K5N A;  4JV5 Q;  1HZB A;  2ZJR A;  4GKK Q;  2PW7 A;  3PSI A;  5FKA C;  4BA2 I;  2NZO A;  1KHI A;  3J81 j;  4JI5 L;  1PZK D;  1G2S A;  4X62 Q;  4Q5V A;  2B8F A;  2F0L A;  3DHQ A;  4JI5 Q;  2NVY H;  4K0K L;  1M8A A;  4DUY L;  2KA7 A;  3OWF A;  5GRO A;  4R4C A;  4A3F H;  4I65 A;  5CGK A;  3E9H A;  2RSN A;  3S1N B;  3F2U A;  5EPK A;  4OO1 I;  1P8L A;  4EVO A;  2BH8 A;  1MKH A;  1Q7Y C;  1ICW A;  2B2T A;  4A3G B;  2VQE Q;  3H3V H;  4DU9 A;  3MA2 B;  4A3B G;  2MJ8 A;  2EXD A;  2VQE L;  4GN3 B;  1HR0 L;  1WFQ A;  5E4W C;  2ZXR A;  5C3W A;  3BDO A;  5IOD A;  1STB A;  3GTO H;  5FO7 B;  3W1B A;  1NMF A;  2EYM A;  3KOJ A;  4JI3 Q;  1VMP A;  5J1Z A;  3M7N A;  4A3B B;  5D3I B;  4K8J A;  4CDC C;  5IGE A;  4R4T A;  1Y1V G;  1PVO A;  5CV6 A;  4B3M Q;  5HUR A;  1V1P A;  4PQX A;  4A3J G;  4BBR G;  1ESR A;  3NQI A;  3C1F A;  1W6K A;  5C0X J;  3CCE A;  4B3T L;  1TS2 A;  2M9V A;  3ZYY X;  3NWS A;  3CRL C;  3I4M G;  2Z1C A;  1EWH A;  4FXK C;  1XYI A;  5IYC H;  1IBK Q;  3CC2 A;  5JJK A;  1I50 H;  1LTL A;  3CHB D;  3MXP A;  1SE4 A;  1SYD A;  2DJG C;  2XIW A;  2IW3 A;  1I94 L;  2EJM A;  4Y7N H;  4DR2 L;  1A0I A;  1PZI D;  4K5V A;  1KLU D;  4Z9C B;  1NMG A;  2RF4 A;  5IT9 c;  3HOX G;  1HR0 W;  3J7A 5;  3C46 A;  1KQS A;  3HOY G;  1PYW D;  4IFD J;  4BS9 A;  4YCV A;  1XJV A;  1EU4 A;  2JA5 H;  1IYU A;  2O2L D;  1NR4 A;  2WII B;  2N8N A;  1SEB D;  2UUC L;  1UE6 A;  3HOX B;  1IBL Q;  2F3W A;  2KHS A;  4CJ1 B;  2F0I A;  2F4V L;  1NJI C;  5FLX L;  3CCU A;  4DR2 Q;  4JI2 L;  4FF2 A;  1ROD A;  4DAP A;  1PH1 A;  1HPC A;  5L37 A;  4B3S L;  2EY1 A;  4AYB G;  1B4O A;  2M00 A;  1Z9F A;  4DR6 L;  3KJO A;  3SK5 A;  1TWF B;  4C3H G;  4RGT A;  3SDZ A;  2WKD A;  1EIH A;  1I4P A;  1K0R A;  2XRQ D;  3BDC A;  5IIF A;  5ISR A;  3HOU H;  2R93 G;  5JJI A;  1SYB A;  4JI2 Q;  4IFD H;  3QO2 A;  3SK4 A;  1DON A;  1UUP A;  2RHQ B;  3A55 A;  1QOH A;  2K05 A;  3MXN B;  3DWP A;  3EVQ A;  3K58 A;  3EN2 A;  4F7X A;  4DF7 A;  5CBA E;  4GNX B;  2JJQ A;  5M3F B;  1ASZ A;  4MTN A;  1J5E L;  4KJN A;  1KRS A;  4KY5 A;  2BOS A;  1E2V A;  4GOP A;  1YNX A;  1RTN A;  1HQM C;  2EPB A;  4QUF A;  1EL0 A;  3MFY A;  4EX5 A;  1FR3 A;  5EJW A;  5LMU Q;  5C0X G;  5E1F A;  2JA5 B;  2OF1 A;  2PZU A;  3R2I A;  2R93 H;  5HY6 A;  1I4R A;  3CQZ H;  4J6H A;  2LXJ A;  1RL2 A;  3NK9 A;  2HUG A;  1PFS A;  4FNF A;  4LJZ C;  1CKO A;  3D6C A;  1QZH A;  5D14 A;  5JJZ A;  4P2C B;  4RFB A;  5I9P A;  4PMC A;  2ENB A;  1K8G A;  4WJ4 A;  4HCS A;  2C9O A;  4Y52 H;  1Y1W B;  1IYV A;  5KYL A;  2QKI C;  1K28 A;  3A0J A;  3T13 A;  2K4K A;  1CHQ D;  4DV6 L;  5M5Y B;  1I4X A;  1VF5 C;  2BA1 A;  1XWE A;  4IAL A;  4GLA C;  1AH9 A;  1H9S B;  2EY6 A;  2E5L Q;  4CKE A;  4JYA Q;  4IJH A;  1QVC A;  4DR4 Q;  1EQV A;  5DAU A;  3VR5 A;  3ULL A;  3NWT A;  1NNX A;  4ODG A;  1Y69 U;  4KJO A;  4KKU A;  2ALY B;  3CXC A;  1TII D;  3GTL B;  3P1H A;  4J1M A;  3DXJ C;  4WRD A;  4QMG A;  2WAQ E;  4PMW A;  4GOP C;  1LT5 D;  4HN7 A;  3SXH A;  3K7A B;  1QZG A;  4IQZ A;  2B2W C;  1E0B A;  2NN6 H;  3PO2 B;  1E1T A;  1TWG H;  3OWE B;  4IPG A;  1VQK A;  5E4X A;  3QJY A;  4LF8 L;  1VQB A;  2JA8 G;  2JA6 B;  1X54 A;  2RDF A;  2A6H D;  1LT3 D;  3CF5 A;  1X56 A;  1W6J A;  1Q90 A;  2JA7 B;  4ABN A;  4FO2 A;  2FMC A;  3DWQ A;  4R4Q A;  3STB D;  1Z47 A;  3HOW H;  2A68 D;  4FF1 A;  4K8I A;  1EFW A;  1SJH D;  4TVA B;  5I2X A;  1DM0 B;  4QGU A;  4NXM L;  3S1M H;  3CC4 A;  1JE5 A;  4HJA A;  1F77 A;  3KF8 A;  3FMC A;  3CCL A;  4HMI A;  4A3G H;  4DR4 L;  5IGC A;  3S1R B;  1KDC A;  4KHP Q;  3BYT B;  5CV4 A;  1Y1W G;  5EKK A;  4X62 L;  2E2H B;  4BBS G;  4DFA A;  2GN5 A;  4GNX A;  2PPB C;  1JJG A;  4L6T B;  5K5P A;  1IL2 A;  1N33 L;  4KLK A;  4GZY C;  5KNB A;  3I90 A;  5IGB A;  3I2Z A;  4L5R C;  1VQN A;  1L2F A;  5C3E G;  2CH4 A;  3MXG A;  3PUV A;  2UUB Q;  3KLW A;  4ME3 A;  4R8N A;  1IBM L;  3MXU A;  3AEV A;  5EGT A;  1VS0 A;  1IKL A;  2B2U C;  3FEW X;  4HSP A;  4DR7 Q;  1AE3 A;  3GTP B;  2CVR A;  4NB3 A;  2HCI A;  1MJE A;  2NVT B;  4B9W A;  2X69 A;  3CC7 A;  4G4K A;  4JI6 L;  4TRD A;  2Z6B A;  2KOL A;  4WOR A;  4LAA A;  1SNQ A;  3STB C;  2MGS A;  3V05 A;  4YY3 L;  1QG7 A;  3C1E A;  1G51 A;  4KN7 C;  4YWL A;  1CFM A;  2WB1 E;  3RLN A;  3J7Z C;  1PFM A;  3MFG A;  1OO9 B;  3FRP B;  4Y7N B;  4IPD A;  4XYQ A;  3TN2 A;  3H3V I;  2F0P A;  3I4N B;  1LT4 D;  4JC0 A;  5DLQ E;  4JBJ A;  5ELN A;  4B3R Q;  1BVS A;  1I50 B;  3D31 A;  3NE5 B;  4N9T A;  3G6J B;  4C3H H;  1JCK B;  1EOV A;  4JI1 L;  2CWP A;  4DR5 L;  2ZM6 L;  1JR0 D;  1KTK A;  4DV3 Q;  1G6P A;  2QA4 A;  3HOW B;  2A6E C;  1MGS A;  3FP9 A;  2IHF A;  5A2Q E;  4LFC L;  2O5I C;  3ERQ A;  1UE5 A;  4F87 A;  4V19 0;  1PRT F;  3NP8 A;  3J80 E;  4JV5 L;  3NQT A;  2JA6 H;  2HD3 A;  3S1R H;  1GUT A;  3CCR A;  1YBY A;  2QGQ A;  1BF4 A;  4QQB X;  4AYB B;  4DNI A;  2OQ0 A;  2EQS A;  3RZO H;  4BWG B;  1DGS A;  1U4P A;  5C5M A;  3E9I A;  4R1J A;  1E1O A;  5EKI A;  3PF5 A;  1EUJ A;  5LMN Q;  3BZK A;  1O80 A;  3ITP A;  2E76 C;  4RGM A;  2VQF Q;  1XPU A;  3KLS A;  3PO2 G;  1PHJ A;  3H91 A;  1G8Z D;  4Q0F A;  4DV1 Q;  2K28 A;  4A3E B;  1B53 A;  1E7Z A;  1TWG B;  1Q86 C;  4JBK A;  4PV1 C;  3J80 L;  4IOA A;  5EPJ A;  1LM0 A;  1KAW A;  2PZT A;  3M7G A;  5F2D A;  4ZYS A;  2R92 B;  3PF4 A;  2AKW B;  2E2I B;  3RZD B;  4C2M H;  1X3P A;  3GTL H;  4DXG A;  1MSH A;  4LUZ A;  2AUJ D;  3FKI G;  3KDF B;  3F2C A;  2JN4 A;  3NTI A;  1C7Y A;  1FNV A;  1EY5 A;  1TS3 A;  1EY8 A;  4U68 A;  2XRS D;  2WFW A;  3TDQ A;  4A3D H;  4LF5 Q;  1TWH B;  3OIQ A;  4CJ0 B;  4QIW B;  1V9P A;  5GQO A;  1Y14 B;  4B3T Q;  3KBG A;  1FVI A;  1PYB A;  4DR1 Q;  2VNU D;  1RKN A;  4GN4 B;  2E8G A;  4H02 A;  4C2M B;  3HOU B;  2F0F A;  2JSO A;  4H13 C;  1EY0 A;  3A56 A;  4DV7 L;  2IL8 A;  3CAM A;  1PV4 A;  3Q6S A;  1QJO A;  1H95 A;  2Z6K A;  2F52 A;  1X55 A;  4GOP B;  2R7F A;  4RCN A;  3MWY W;  4X6A H;  3BG3 A;  1K83 H;  3J81 i;  4TSS A;  1VQ5 A;  3O13 A;  4IUV A;  1EYC A;  5M5W H;  2F03 A;  4K0K Q;  3OHX C;  1ESF A;  2L4N A;  4GKJ Q;  4M8A A;  4GS3 A;  1VQG A;  5D3D A;  3S2D B;  2VZA A;  1I6V C;  4QJF A;  4KD3 A;  2K5V A;  1JE4 A;  3AMU A;  4JBW A;  1VQH A;  4CDE C;  3SR1 A;  3TP8 A;  3OOC A;  1LUZ A;  2I46 A;  5J22 A;  1HNX L;  3F2B A;  4DXF A;  4DAV A;  5CV8 A;  1CKM A;  2R7Z B;  2KED A;  1VQL A;  2B2V C;  3TZU A;  1TR5 A;  3K5N A;  4DV4 Q;  3H09 A;  3KUP A;  1B1Z A;  1VQD A;  1CUK A;  3IL8 A;  1F9R A;  3I73 A;  1U4R A;  2KVM A;  4RA8 A;  4RKB A;  5EAY A;  4JI4 L;  1KDA A;  3HOZ B;  4O2D A;  4LMQ D;  3GDE A;  1NY4 A;  5GAE C;  2WAQ B;  3E0E A;  2C5C A;  2N3S A;  1H9M A;  1TS5 A;  1AW7 A;  4HED A;  4RWS C;  5C3E H;  3BU2 A;  1G91 A;  5FJ8 H;  1S5B D;  3SE0 A;  1Y1W H;  2ZTE A;  2HQL A;  4DV6 Q;  3UI2 A;  1OXS C;  2K5D A;  1IBM Q;  3HOZ G;  4A93 B;  1QUQ B;  4OEM B;  5M5X H;  4A3F G;  1BQQ T;  1NAP A;  1WJJ A;  2D62 A;  2RVL A;  5JEA G;  1IXR A;  3T16 A;  5BN4 A;  1HHV A;  3VDY A;  3D4W A;  4LF6 L;  5I4D A;  4UAI A;  3NPP A;  2A6H C;  1L1O A;  3GTO B;  1H9R A;  4OGQ C;  1VQI A;  4X66 L;  1WTX A;  2DN8 A;  2NZH A;  4F88 A;  1YJN A;  1RTO A;  3JAM c;  3S1Q B;  3DUZ A;  1GXD C;  1XMQ Q;  5CV9 A;  2BA0 A;  4B08 A;  3TZD A;  5FO8 B;  1O7L A;  2XWB B;  4G7H C;  1K3R A;  3UE0 A;  1QNU A;  5C3E B;  1C8C A;  4A3L H;  4EQN A;  4HJ5 A;  3SVM A;  2A69 D;  1CI3 M;  4OIK A;  4ULL A;  1ASY A;  1KNA A;  1B50 A;  3E5S A;  4FVM A;  2JK8 A;  1JC7 A;  2KUM A;  4H0L C;  1STG A;  1SYC A;  2MNA A;  4LFA L;  3ICE A;  1LTB D;  2N55 A;  3PMF A;  1A6X A;  3OW2 A;  1F2Y A;  2YTX A;  1VDZ A;  5ELO A;  1BDO A;  4BY1 G;  4KMU C;  2K6A A;  3NEM A;  2NTS A;  3Q24 A;  2CH4 W;  3FPP A;  2FIN B;  1N9W A;  2K50 A;  1EZ6 A;  4I7A A;  4ZAI A;  4IJL A;  1C4Q A;  2WAQ G;  3I4N H;  3PGZ A;  1A3T A;  2SNS A;  4WJ3 M;  1K8A C;  1SE8 A;  1BBX C;  5C44 G;  4XQQ A;  3GTK H;  1CA5 A;  4CGY B;  1A3V A;  2C35 B;  5AJ3 L;  2BH2 A;  2H4O A;  4UP9 A;  1N32 L;  4DNR B;  2RKS A;  3I56 A;  2NTT A;  5IP9 G;  1WTH A;  1SYE A;  2OQK A;  2L11 A;  3J80 c;  4DA2 A;  4R8I A;  1QWY A;  1KRT A;  5C4X G;  5C6A A;  1HZC A;  4DV1 L;  2EZV A;  3D4D A;  4IOC A;  2ATW A;  2VY3 A;  3CU7 A;  5M3M H;  4MZ9 A;  5J39 A;  1D8L A;  1JWS D;  3T1H L;  1HNW Q;  2RHS B;  1J6Q A;  3AQQ A;  1K9M C;  2I5M X;  4XXE A;  1GD7 A;  3T1H Q;  3R3O A;  5G3L D;  2G5D A;  2I07 B;  2NVX B;  2PYK A;  2R7Z G;  1J9O A;  5JEA J;  3G7L A;  1NBW A;  3V2T A;  1L1O C;  1UNS A;  2EYL A;  1A62 A;  2RA4 A;  2D0O A;  2PO4 A;  4XDX A;  2AWO A;  3P7J A;  2ICE C;  1KAA A; 
#chains in the Genus database with same CATH homology
 4A3I G;  4NXN L;  1YHQ A;  2K52 A;  3U58 A;  4PG3 A;  1YI2 A;  4A75 A;  3A0J A;  2N78 A;  4DV4 L;  1OXV A;  4IPC A;  3K7A H;  1X3G A;  4A3J H;  2K4K A;  4YWM A;  2ID0 A;  4DV6 L;  4BXX G;  2UXC Q;  2BA1 A;  4L5Q A;  3ER0 A;  3HFZ B;  4GLA C;  1AH9 A;  2OTJ A;  1N36 Q;  3L7Z C;  2CQO A;  3PO3 H;  4A3E H;  5LMN W;  2E5L Q;  1IBK L;  4XIG S;  4GNX C;  4JYA Q;  3K8A A;  2UXC L;  2NN6 G;  2ZJP A;  4LUO A;  4IJH A;  3HOW G;  1QVC A;  1Q8K A;  4DR4 Q;  1PA6 A;  4IPH A;  3GD7 A;  4P75 A;  3S24 A;  1G29 1;  1D7Q A;  3ULL A;  4JOI A;  1FGU A;  1XTD A;  1Q1B A;  2ALY B;  3PCO B;  3DM3 A;  3CCV A;  3M3Y H;  3CXC A;  2ES2 A;  4A4I A;  4NXN Q;  3PIO A;  1NTG A;  3RZD H;  3A74 A;  2HHH Q;  1HR0 Q;  3GTG H;  3H0G H;  2WAQ E;  4PMW A;  4GOP C;  2MFI A;  1Q81 C;  1YJW A;  1QZG A;  2NVT H;  4HIM A;  2HHH L;  2UUB L;  4LF9 Q;  1N36 L;  2EIF A;  3UDX A;  3CP0 A;  4X64 Q;  1E1T A;  2B29 A;  4BY7 G;  1TWG H;  1WCM H;  4IPG A;  1L0W A;  1VQK A;  5M3F G;  4DR3 Q;  1KC8 C;  4LUV A;  4LF8 L;  3CPF A;  1VQB A;  2A1A A;  3L2P A;  2JA8 G;  2JEA I;  1X54 A;  4P72 A;  1HNX Q;  4OWW B;  4PZ7 A;  1HNW L;  5C4J H;  4B3M L;  3NEN A;  3AYH B;  3CF5 A;  1X56 A;  4JOI C;  5IE8 A;  4A93 G;  5BR8 L;  1HJP A;  1VQO A;  4R4Q A;  3TRE A;  1XPO A;  4BBS H;  2KCT A;  3STB D;  2UU9 L;  4JI1 Q;  1Z47 A;  2JA9 A;  4QIW E;  3HOW H;  1I6H H;  3H15 A;  1EFW A;  1YHA A;  2ZTC A;  4TVA B;  4BY1 H;  4QGU A;  4NXM L;  3S2H H;  4FDB A;  4DUZ Q;  3FKI H;  1JMC A;  4OXP A;  1JE5 A;  3CC4 A;  4HJA A;  1SLJ A;  4DR3 L;  3S1M H;  4RMF A;  3S1Q H;  3CCL A;  2XTI A;  4A3G H;  2PI2 E;  4A3K H;  1Q82 C;  4DR4 L;  3FHW A;  3HKZ E;  3F2D A;  3TS0 A;  2R92 G;  4OWT B;  4KHP Q;  3HOV H;  4DUZ L;  4HJ7 A;  3S15 H;  1VQE A;  3S17 H;  1Y1W G;  4X62 L;  4BBS G;  4JI6 Q;  2GN5 A;  4GNX A;  1JJG A;  2ZTD A;  4IFD G;  1HNZ L;  1IL2 A;  2CWA A;  2OWO A;  5H1S E;  3I4M H;  3EBE A;  3WWV A;  4DR6 Q;  1N33 L;  4KLK A;  1WCM G;  1Y1V H;  2KHJ A;  3RLO A;  1XMQ L;  1Q46 A;  5AJ3 Q;  5M3F H;  2HT1 A;  1I94 Q;  3I2Z A;  4L5R C;  1VQN A;  1L2F A;  2NN6 I;  3H0G G;  2ASB A;  5C3E G;  4HJ8 A;  2NVX H;  4ALP A;  1VCI A;  4DK6 C;  1YIJ A;  1XNR Q;  3OTO L;  3PUV A;  2UUB Q;  3KLW A;  4ME3 A;  4LF9 L;  4GKJ L;  1B7Y B;  3W5O A;  1IBM L;  3A5U A;  3F1Z A;  3AEV A;  1VS0 A;  4AQY L;  1N34 L;  4JI3 L;  3HKZ G;  1S40 A;  5LMN L;  5IP7 H;  1EQR A;  4DV5 L;  2UXB Q;  1R9T H;  4DR7 Q;  1AE3 A;  1PH6 A;  4NB3 A;  4P73 A;  1MJE A;  3PUZ A;  3GTP H;  1VQJ A;  1I3Q H;  3CC7 A;  2K5H A;  2WP8 J;  4JI6 L;  4MNO A;  4JI7 Q;  2KBN A;  2A19 A;  1PH7 A;  2UXB L;  3U4Z A;  4C3I H;  1K73 C;  3STB C;  3KFU A;  1MIU A;  4YY3 L;  3IRB A;  3CCJ A;  3CCQ A;  1G51 A;  4YCW A;  3ULJ A;  4YWL A;  2JA5 G;  4LFB Q;  3RLN A;  1V43 A;  2WB1 E;  3L0O A;  4DV2 L;  3J7Z C;  1PH9 A;  1MJC A;  3HKS A;  1XNR L;  3OTO Q;  2Q2I A;  4DV0 Q;  2E2J H;  4IPD A;  1VQ4 A;  3TS2 A;  2R7Z H;  1X3E A;  3H3V I;  4OX9 Q;  4JC0 A;  5DLQ E;  2YV5 A;  1GKH A;  2D0P A;  4JBJ A;  5ELN A;  3M4O H;  1XNQ L;  4B3R Q;  1BVS A;  3D31 A;  4A3G G;  2B63 G;  4JI8 L;  5LMU L;  2R92 H;  4JG2 A;  4C3H H;  1PH3 A;  4LF4 Q;  1TWC H;  1UWV A;  1EOV A;  4JI1 L;  5E7N A;  1A63 A;  2CWP A;  4JCV E;  1P16 A;  4DR5 L;  1XNQ Q;  2ZM6 L;  4J15 A;  4A3I H;  4B3R L;  1N32 Q;  3EIV A;  4DV3 Q;  5IYD G;  1EIF A;  1U5K A;  2YTY A;  2QA4 A;  4A3M H;  1OTC A;  4LF4 L;  1L1O B;  2YTV A;  2IHF A;  3FP9 A;  3G4S A;  4OO1 G;  3U50 C;  4NXM Q;  4LFC L;  3S1N H;  2Q2U A;  4R4I A;  4EQ5 A;  1UE5 A;  3J81 c;  3CMA A;  2KCM A;  1YVC A;  4DR1 L;  4LF7 Q;  2JE6 I;  2KHI A;  3CCS A;  1W3S A;  4AIM A;  4GLV B;  1Q1E A;  5IYB G;  3MEF A;  2UUA L;  2R6G A;  4AQY Q;  1N34 Q;  4JV5 L;  1VQP A;  2JA6 H;  4P71 A;  4BBR H;  5C44 H;  1IYJ B;  5C0X I;  3S1R H;  4A3E G;  1RIP A;  3KF8 B;  1YBY A;  4DK3 C;  3CCR A;  1GO3 E;  3G71 A;  2QGQ A;  4UP8 A;  1JB7 A;  4B3S Q;  3HOU G;  3AFP A;  1G6P A;  1BBW A;  4QQB X;  3UDG A;  1GM5 A;  2PQA A;  1E22 A;  1XMO Q;  4DNI A;  2OQ0 A;  2MO0 A;  3I4N G;  2EQS A;  3RZO H;  2UXD L;  3Q8D A;  2ZM6 Q;  1PH4 A;  4L5T A;  1DGS A;  4XTC S;  4LNQ A;  4DUY Q;  4JI0 L;  2IHE A;  4O0A A;  3JC6 6;  2UXD Q;  4NPS A;  3E9I A;  4R1J A;  4LFC Q;  1LYL A;  5FJ8 G;  2UUC Q;  1E1O A;  1SRU A;  1EUJ A;  2IX0 A;  1B70 B;  3PF5 A;  5LMN Q;  1CSQ A;  2OTL A;  2JA6 G;  3KF6 A;  3BZK A;  5FLX c;  3HOZ H;  2UUA Q;  2Z6K C;  4POF A;  2Q2T A;  2VQF Q;  1XPU A;  1KIX A;  1JJC B;  5J3B A;  3PO2 G;  4HJ9 A;  4BY7 H;  4A3C G;  4QL5 A;  4OX9 L;  2RCN A;  1PHJ A;  1VQ7 A;  1CKN B;  4JI8 Q;  4DV1 Q;  3W1G A;  1E7Z A;  1C9O A;  3B6Y A;  4YY3 Q;  4OON A;  1Q86 C;  4JBK A;  4RG1 A;  2LSS A;  4Y52 H;  3KYH C;  3K7U C;  5BR8 Q;  4P74 A;  4IOA A;  3CD6 A;  4C3J H;  1LM0 A;  1KAW A;  1BBU A;  2F4V Q;  1TWA H;  5K36 G;  4A93 H;  4A3M G;  3PF4 A;  2AKW B;  2E2I H;  4C2M H;  4KHZ A;  3GTL H;  1XPR A;  1KD1 C;  1PH5 A;  2DGY A;  4LUZ A;  1YEZ A;  4AYB E;  3DLL A;  3FKI G;  3KDF B;  3M9B A;  5GAG C;  4JI4 Q;  5GAH C;  4DPG A;  1TWF H;  1U0L A;  3F2C A;  3KJP A;  2ZJQ A;  3LGJ A;  3SGI A;  3I55 A;  4UY8 C;  1C7Y A;  4YHH L;  2VUM H;  2Z0S A;  4KHP L;  3HOV G;  2WFW A;  4DV3 L;  4APV A;  1QVG A;  2K75 A;  1VQ6 A;  3S14 H;  3PUW A;  4LF5 Q;  1TWH H;  4A3D H;  1V9P A;  1HNZ Q;  1CSP A;  5GQO A;  1VQF A;  4OWX B;  3ERS X;  3ULP A;  1Y14 B;  1JJ2 A;  2E5L L;  4B3T Q;  1FVI A;  1PYB A;  4HIK A;  3CPW A;  4DR1 Q;  2E2H H;  1Q12 A;  2MQH A;  2VNU D;  4GN4 B;  2E8G A;  2MO1 A;  4YWK A;  4H02 A;  4YCU A;  1FL0 A;  4JV5 Q;  2K5N A;  3RNU A;  1SRO A;  1HZB A;  2ZJR A;  4GKK Q;  3PSI A;  2HIV A;  4LF8 Q;  4BA2 I;  2NZO A;  3M4P A;  1KHI A;  4DV7 L;  3J81 j;  2QEX A;  4JI5 L;  3UDI A;  4POG A;  3CAM A;  4X62 Q;  1VQM A;  1PV4 A;  1VQ8 A;  1H95 A;  2Z6K A;  1S3O A;  4YHH Q;  1BKB A;  2F52 A;  1PYS B;  1PH2 A;  2NVY H;  3UDF A;  1X55 A;  4GOP B;  4JI5 Q;  2R7F A;  3BJU A;  4DUY L;  4K0K L;  4X6A H;  5IYC G;  3J81 i;  1K83 H;  4A3B H;  4TQU S;  5GRO A;  4R4C A;  1VQ5 A;  4A3F H;  1C0A A;  5IP9 H;  5M5W H;  4WJ4 A;  4DKA C;  3E9H A;  4K0K Q;  2IT1 A;  4AH6 A;  2B3G A;  4GKJ Q;  2PNH A;  4GS3 A;  1VQG A;  4LFB L;  4OO1 I;  1P8L A;  2N49 A;  1I5F A;  2BH8 A;  1MKH A;  5FLM G;  2VZA A;  4DV5 Q;  1Q7Y C;  4LF6 Q;  1X3F A;  3OYY A;  2I0Q A;  2AWN A;  1X6O A;  4QJF A;  1EYG A;  2K5V A;  3ZJY C;  3M4Q A;  3PUY A;  4JBW A;  2VQE Q;  3H3V H;  1VQH A;  4X66 Q;  2VL6 A;  1LUZ A;  4A3B G;  2EXD A;  3F2B A;  1HNX L;  3TRZ A;  1CKM A;  2VQE L;  1N33 Q;  1YZ6 A;  4GN3 B;  1WFQ A;  1HR0 L;  1OXX K;  5GAD C;  1VQL A;  2IY5 B;  4LW1 A;  3PV0 A;  2K14 A;  4DV4 Q;  4A3D G;  4DR5 Q;  5JJL A;  2F3I A;  1VQD A;  1CUK A;  4A3K G;  3GTO H;  2DUD A;  3GTM H;  3W1B A;  3CME A;  1NMF A;  3KOJ A;  5EAY A;  4JI3 Q;  4JI4 L;  3M7N A;  4O2D A;  4GKK L;  3GDE A;  1NY4 A;  5GAE C;  3E0E A;  3KDF A;  2N3S A;  4R4T A;  1Y1V G;  3GTQ H;  1PVO A;  4DAY B;  3CW2 C;  4B3M Q;  3JAM i;  4A3J G;  4GN5 A;  4BBR G;  2PI2 A;  5C3E H;  3HOX H;  3BU2 A;  5FJ8 H;  1Y1W H;  4X65 Q;  1AE2 A;  5C0X J;  2ZTE A;  2HQL A;  3CCE A;  4DV6 Q;  2Q2H A;  4B3T L;  2UU9 Q;  1OXS C;  1XMO L;  1O7I A;  3RLF A;  2KEN A;  1IBM Q;  3TEH B;  3GTJ H;  3I4M G;  3HOZ G;  2I5L X;  5IYC H;  1IBK Q;  3CC2 A;  4DV2 Q;  1I50 H;  1LTL A;  5JJK A;  1QUQ B;  4A3F G;  5M5X H;  1GVP A;  3UE1 A;  1HH2 P;  2D62 A;  1WJJ A;  1HZ9 A;  5JEA G;  1I94 L;  1IXR A;  1J5E Q;  2OCE A;  4DR2 L;  4Y7N H;  1A0I A;  3VDY A;  5IY0 A;  3K0X A;  4LF6 L;  1NMG A;  3D0F A;  2RF4 A;  5IT9 c;  5FLM H;  5HGQ A;  3HOX G;  3BZC A;  1HR0 W;  2NVQ H;  3PO3 G;  1L1O A;  3J7A 5;  3G6E A;  4L5S A;  1VQI A;  4X66 L;  1KQS A;  3HOY G;  4IFD J;  4DAM A;  2NZH A;  3PO2 H;  4YCV A;  1YJN A;  2V1C C;  1WOC A;  1XJV A;  1UE1 A;  3JAM c;  2JA5 H;  1XMQ Q;  2N8N A;  4JI7 L;  2BA0 A;  5M5Y H;  4DV0 L;  2UUC L;  3NBH B;  4PZ8 A;  1KL9 A;  1K3R A;  4BA1 I;  1UE6 A;  1IBL Q;  3UE0 A;  2YYZ A;  2F4V L;  1NJI C;  1UE7 A;  1SFO H;  4A3L H;  4HJ5 A;  1PH8 A;  1A8V A;  2AMC B;  3CCU A;  4DR2 Q;  4JI2 L;  1ASY A;  2B63 H;  2JK8 A;  3HOY H;  1PH1 A;  1EQQ A;  1UEB A;  4B3S L;  1T9H A;  1YHB A;  4AYB G;  2MNA A;  3M85 A;  4LFA L;  1YIT A;  1FJG L;  3ICE A;  2HIX A;  1SN8 A;  1WI5 A;  3I4O A;  1Z9F A;  3OW2 A;  2WB1 G;  3F8T A;  2YTX A;  4X65 L;  1S72 A;  2JA7 G;  4DR6 L;  3KJO A;  1IZ6 A;  5M3M G;  5IYB H;  5ELO A;  1FJG Q;  4IFD I;  4BY1 G;  3NEM A;  3NEL A;  4LWC A;  4PZ6 A;  1N9W A;  2K50 A;  4A3L G;  3KF6 B;  2GVB A;  1K0R A;  5IWA Q;  4IJL A;  2CFM A;  2WAQ G;  3S16 H;  1JT8 A;  3HOU H;  2CCZ A;  2R93 G;  5JJI A;  4R4O A;  3RN5 A;  4JI2 Q;  3I4N H;  4JYA L;  3PGZ A;  2PMZ E;  5IWA L;  4GLX A;  3T1Y Q;  4LF7 L;  4WJ3 M;  2Y0S G;  1YJ9 A;  5C4X H;  1QVF A;  2RHQ B;  1SE8 A;  1SR3 A;  1K8A C;  3AFQ A;  1WYD A;  1SMX A;  3MXN B;  3K81 C;  5C44 G;  4LFA Q;  3GTK H;  3EN2 A;  2GVA A;  3TQY A;  4JI0 Q;  2C35 B;  2LXK A;  5AJ3 L;  3T1Y L;  1VQC A;  2BH2 A;  2JA7 H;  4BXX H;  4HIO A;  1CKN A;  2VS1 A;  4UP9 A;  4GNX B;  1N32 L;  2JJQ A;  4JBM A;  1VQ9 A;  1ASZ A;  4MTN A;  1OXU A;  1J5E L;  3I56 A;  1KRS A;  5IP9 G;  4GOP A;  1KXL A;  2YU9 H;  3A5Z B;  1YNX A;  2OQK A;  4UP7 A;  3J80 c;  3PIP A;  3GO5 A;  1QUQ A;  4DR7 L;  4KI0 A;  1KRT A;  4IO9 A;  5C4X G;  2AHO B;  2Y0S E;  1HZC A;  4DV1 L;  2VW9 A;  1V1Q A;  1M90 C;  3K80 C;  4EX5 A;  4IOC A;  2ATW A;  2VY3 A;  1N8R C;  5M3M H;  4MZ9 A;  2A8V A;  1D8L A;  2JEB I;  3T1H L;  5LMU Q;  2VQF L;  2I5H A;  3S2D H;  1HNW Q;  1HZA A;  2PQA B;  2RHS B;  1J6Q A;  3AQQ A;  5IP7 G;  5C0X G;  1K9M C;  3U4V A;  4UPA A;  3RR5 A;  4A76 A;  2FXQ A;  2H5X A;  2I5M X;  3CCM A;  1X9N A;  1GD7 A;  3T1H Q;  1M1K C;  2R93 H;  1IBL L;  1EIY B;  5HY6 A;  2IX1 A;  1X65 A;  1TXY A;  4X64 L;  2L15 A;  2R7Z G;  3CQZ H;  1E24 A;  5JEA J;  2JA8 H;  2LXJ A;  2XGT A;  1NBW A;  1RL2 A;  1EWI A;  3G48 A;  4QY7 A;  1E3P A;  1L1O C;  2CKZ B;  4A3C H;  3PUX A;  1B8A A;  1A62 A;  1PFS A;  4DV7 Q;  2D0O A;  3RN2 A;  1CKO A;  2AWO A;  3J80 i;  1NE3 A;  1VQA A;  1W2B A;  1QZH A;  2VUM G;  1OXT A;  2JQO A;  4LF5 L;  5IYD H;  4HID A;  2R7D A;  1K8G A;  3I7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...