4B3TL

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3tL00
2VQEQ 3S1MH 1PV4A 1UWVA 4DV4Q 4UP9A 4B3MQ 4JI0L 2QGQA 1XMOL 4C3IH 5LMNQ 2E2JH 1X65A 4B3RQ 2I5LX 3I4MH 4HIMA 2VZAA 2LXKA 5C4XG 4POFA 4YWKA 3MEFA 4BY1G 1KC8C 4OONA 4JYAL 3ULJA 4DV7L 1EIFA 1FVIA 1Q82C 2KCMA 4DUZQ 1GKHA 4A3JG 1Q8KA 1VQ8A 1G6PA 2VUMH 4GNXA 2JEBI 1L1OC 1C7YA 2HHHQ 3S14H 1E3PA 1PVOA 1K0RA 5JJLA 1TWHH 4LFAL 3M9BA 3DM3A 3CCJA 4A3MH 4A3DH 3DLLA 1DGSA 2AKWB 4LUZA 4OWXB 3OTOL 3HOZG 4NXML 4GLAC 5FLXc 2UXDL 3HOWG 4DR6Q 3FP9A 2ZJRA 4R4OA 1VS0A 1Y14B 4RMFA 5BR8Q 5JEAG 2E5LL 1MIUA 3RZOH 1TWGH 5IP7H 5FLMG 1HR0L 4LFCL 3PF5A 4AH6A 3KLWA 5HGQA 2HIVA 1C0AA 2Z0SA 2PI2E 2UUCL 4B3TQ 2UU9L 3CPFA 4L5TA 3G71A 1QVFA 4LF4Q 3H3VI 4X6AH 4DV0Q 2OCEA 2JA8H 2BH8A 4QIWE 3PUXA 2JA9A 5IWAL 1VQ9A 1YBYA 1BKBA 1CKOA 2HIXA 2I5HA 4DV3Q 1N34L 3S17H 4IFDI 2F3IA 4OX9L 4HJ9A 3D0FA 2PNHA 1N36L 1UE7A 1U5KA 2JA6G 4BXXG 1JJCB 3TQYA 4PZ6A 5K36G 4KHZA 4A3GH 4BBRG 1UEBA 2UUAL 1E22A 2L15A 2ASBA 2ZJPA 3CCVA 3F2BA 3CW2C 3B6YA 1VQ5A 4PZ8A 1XNRL 3HOUH 5IT9c 1A62A 4YCVA 3PV0A 3AQQA 3RR5A 1FJGL 4JI7Q 1TWCH 4GN5A 1X56A 5C0XJ 2UUBQ 1W2BA 4JI1L 1A63A 1KXLA 1VQNA 4GOPC 3S24A 3HFZB 1Q86C 2K5HA 1P8LA 4R4TA 4AQYQ 3E0EA 3HOYG 1P16A 1O7IA 1OTCA 5IE8A 5M3FH 1EWIA 1XNQL 4DR7Q 1L1OA 3H15A 2QA4A 1XMQQ 4HIOA 2ZTDA 1E24A 1SN8A 4MZ9A 4YWLA 4LF7Q 4GS3A 4LUOA 4EX5A 1NMFA 4A3LG 3I55A 2NZOA 2YV5A 4IPDA 4OWTB 5IP9G 1X55A 5GROA 1FL0A 1VCIA 1HNZL 1TWAH 3BJUA 3NELA 1WCMG 2N3SA 4TQUS 1IZ6A 3K0XA 1VQLA 1JB7A 4X64Q 4H02A 4A3FG 3CMAA 3ICEA 1V1QA 3PO2G 4J15A 3U4VA 3JC66 4C3HH 3IRBA 3I4NG 4IPCA 1LM0A 2ZTEA 2MFIA 4JOIC 2WB1E 1E1OA 3W1BA 5GAGC 2ZM6Q 4LFBQ 3H3VH 1WYDA 3CCSA 4R4IA 3GTKH 4JI4L 5C3EG 1YEZA 2UXCL 4JI2L 4YHHL 1MKHA 1PYSB 4AIMA 1J5EL 3ULLA 2ATWA 2A19A 1A0IA 2WB1G 3NBHB 4DV6L 3K8AA 1IBML 4LNQA 1HNXQ 1XPOA 5J3BA 2AWNA 2EQSA 1KRTA 4YCWA 4X65L 4P71A 4A3BG 4A3CH 1I5FA 2MO1A 4DR1Q 3GTLH 4O2DA 2EXDA 5IYBG 2JA7G 3J81i 2IT1A 2N49A 3T1YL 1YHQA 4LF8Q 1HNWQ 1NE3A 3CF5A 2ID0A 4DR2L 4JI3L 4DUYL 1RIPA 1IBKQ 3FKIG 1WI5A 3L0OA 5DLQE 4LF9Q 2B63H 2LXJA 2JK8A 1XPUA 5FJ8G 3U58A 1N32Q 3ERSX 1AH9A 1OXTA 1YHBA 5M3MH 2NN6G 4PMWA 4XTCS 4KHPL 4BY1H 1EYGA 4JI8Q 2VQFL 4GOPA 1QZGA 1VQHA 2N78A 1QUQB 3J80i 5AJ3L 2JA5G 5M5XH 4DV5Q 2R93G 4A3JH 3Q8DA 2Q2IA 3KOJA 1D8LA 2F4VQ 5IYDG 4LF5Q 2BA0A 2E2IH 1VQ6A 3E9HA 5C44G 1BBUA 3UE0A 2HT1A 2Q2UA 2VQEL 1GVPA 2N8NA 3I4OA 4DV4L 3HOZH 2IY5B 3CCLA 1Z47A 4NPSA 3WWVA 3HOWH 4A93G 2RF4A 3KF6A 3F1ZA 3ULPA 4B3RL 3U50C 2K75A 4JI0Q 1XMOQ 4DV1L 5FLMH 3CCRA 1PH9A 2NVYH 4DR4Q 5IYCG 4JOIA 3S2DH 1B8AA 2GN5A 2HHHL 3GTGH 4QY7A 4XIGS 3RLNA 3UDGA 3L2PA 2FXQA 2MQHA 1HZCA 2GVAA 2OQ0A 4PZ7A 3KYHC 4NXNQ 3EBEA 1N33Q 2D62A 4YCUA 1I6HH 5GADC 4WJ3M 4IO9A 3H0GG 4A3KG 1YJNA 1VQGA 1AE2A 3S15H 3K7AH 4JI6Q 4RG1A 1QVCA 1I94L 5BR8L 2JA6H 4BXXH 3T1HL 2UXDQ 4FDBA 2WP8J 5H1SE 2Q2TA 5GAEC 3FHWA 4BBRH 4BBSG 2K4KA 4YY3Q 3GDEA 4K0KL 2NZHA 1YNXA 3K81C 3S1RH 2XGTA 2YTXA 4QJFA 2ZTCA 4EQ5A 4GNXB 3PSIA 3VDYA 1HR0Q 2ES2A 3UDXA 2OWOA 1ASYA 4B3TL 4LF4L 2OTJA 1Z9FA 2WAQG 4HIDA 3PIPA 4JCVE 4NB3A 2UU9Q 1M1KC 2XTIA 4DV3L 3F2CA 2D0OA 2NN6I 3J7A5 5C0XG 4BY7H 1YJ9A 1EUJA 3RLOA 3CD6A 2CFMA 4IPGA 4X62Q 5LMNW 3W1GA 1NBWA 2Z6KA 1IXRA 3F8TA 3A74A 4LUVA 2HQLA 1A8VA 2PMZE 1CKMA 1GD7A 4A3LH 4QGUA 5IP9H 4DR3Q 2EIFA 3GTJH 4DV2Q 1KL9A 2UUAQ 1KHIA 1WCMH 3PF4A 3HKZE 1UE6A 4DK6C 2YYZA 2CWAA 2I0QA 2NVXH 2UUBL 2R6GA 1YIJA 1YI2A 4A3FH 4ALPA 1VQAA 3RNUA 3PO2H 3CQZH 1HZBA 3JAMi 4KLKA 3I4NH 3D31A 2MO0A 3HKZG 3G4SA 1K73C 2OTLA 2R7ZH 2GVBA 1YHAA 1SLJA 5EAYA 1LYLA 2K52A 4AYBE 4DR7L 4GKJL 2V1CC 5C3EH 4P72A 4LF7L 4BA2I 1SR3A 2NVTH 1VQOA 1N8RC 1PH7A 1E1TA 1X3GA 2JE6I 3BU2A 4X66Q 4AYBG 4A3BH 1Q1BA 3SGIA 1Y1WG 4IOCA 1B70B 1CKNA 1J6QA 1K9MC 3HKSA 4APVA 4C2MH 5IYBH 2JA7H 3M4OH 5HY6A 2CQOA 4LW1A 3GTQH 4PG3A 1ASZA 1EFWA 3GO5A 4UP8A 1L2FA 3HOXG 4A3IG 2WFWA 1WFQA 4GKKL 4L5SA 3FKIH 1RL2A 1NJIC 3HOVG 2Y0SG 1IBLL 5M5WH 2YU9H 2UXBQ 1VQPA 1L1OB 4OXPA 3UDIA 3EN2A 1PYBA 1PH1A 2YTYA 1SMXA 1HZAA 4IJHA 2IX1A 1L0WA 3BZKA 3J7ZC 1LUZA 4UY8C 1OXSC 5LMUQ 3M4PA 2UXCQ 2PQAA 4MTNA 3MXNB 1S40A 4BA1I 1TWFH 1TXYA 5C4JH 1J5EQ 1HNXL 2JA5H 4HJ7A 1Q46A 3PUWA 4JV5L 2R93H 1HH2P 3UDFA 3GD7A 4DR1L 1SROA 2RHSB 1KIXA 1XPRA 2LSSA 3ER0A 4P75A 5C0XI 1EQQA 4LF8L 2QEXA 5IY0A 3RN2A 2E8GA 3W5OA 5IYDH 1B7YB 1X3FA 4LF6Q 4IJLA 4QL5A 2AMCB 1K83H 3A0JA 2R7FA 3I2ZA 5C4XH 1K3RA 5C44H 4HJAA 4DR5Q 1CKNB 1NTGA 4HJ5A 1OXUA 3S1NH 2KENA 5GAHC 1R9TH 1E7ZA 4JI5L 3GTOH 4A93H 1NY4A 1QVGA 2CCZA 1KQSA 3I56A 2Z6KC 1VQMA 1V9PA 4JI8L 1PH3A 1UE1A 4A76A 1G51A 3J81c 3CCEA 3PGZA 3G6EA 4DV5L 1JT8A 5IYCH 2VQFQ 1MJCA 1SE8A 4B3SQ 1V43A 1VQBA 3S16H 1VQJA 2IHEA 4B3ML 2R92G 4A3EG 5M5YH 4IOAA 5LMNL 4LF5L 2IX0A 2KCTA 4DK3C 4OWWB 3S2HH 4IFDJ 2ZJQA 1GO3E 3KFUA 4L5RC 2B3GA 3AFPA 4IPHA 1JMCA 3PO3G 5ELNA 2JJQA 1PFSA 1XTDA 3STBC 1JJGA 3H0GH 2F52A 4DUZL 4A3KH 3M7NA 3J80c 4TVAB 1SRUA 1XJVA 4DV7Q 4JYAQ 1MJEA 3RLFA 2IHFA 4GN3B 3NENA 1Q81C 5M3MG 3LGJA 4GOPB 3STBD 1S3OA 4DR4L 4BBSH 4R1JA 4DV1Q 4ME3A 1Y1VG 4LFAQ 2A8VA 4UP7A 1K8GA 3GTMH 4A4IA 1KRSA 1N9WA 3F2DA 4MNOA 3M3YH 4DR6L 2B29A 1AE3A 1FGUA 3OTOQ 4JBJA 4NXNL 1N33L 4NXMQ 4C3JH 1UE5A 2PI2A 4R4QA 4HJ8A 3I4MG 3AFQA 2WAQE 2RCNA 2E5LQ 2RHQB 1YJWA 3PCOB 4JI6L 1VQCA 3KF6B 3PUVA 1D7QA 2VL6A 2VY3A 4LFCQ 1VQIA 4OO1G 1OXVA 4JBWA 4DV0L 3AYHB 2VUMG 3M85A 1I94Q 4P74A 2MNAA 4YY3L 2UUCQ 3T1HQ 3PIOA 4L5QA 4DAYB 4A3MG 4JBMA 4A3DG 2BH2A 1I50H 2YTVA 1KAWA 1YVCA 5E7NA 4K0KQ 5IWAQ 1S72A 3HOYH 4A75A 1N34Q 1VQDA 5JEAJ 1VQKA 3CC2A 5ELOA 4OX9Q 2KHIA 1HZ9A 3RZDH 1PH6A 4GLVB 1CSQA 1W3SA 1IYJB 3GTPH 1YITA 1N36Q 2I5MX 3CP0A 2R7DA 3I7FA 3S1QH 2VS1A 5IP7G 1EQRA 4X62L 4QQBX 3BZCA 4LWCA 1Q7YC 4JI7L 4HIKA 1XNRQ 2KHJA 1VQ7A 1G291 3TREA 4GLXA 1JJ2A 1FJGQ 4DR3L 2JA8G 1X6OA 4DV2L 1PH8A 4JI1Q 1PH4A 4AQYL 2Q2HA 4Y7NH 3OW2A 1Y1WH 3K80C 3CCQA 3A5UA 2OQKA 2C35B 1X54A 3TS2A 1H95A 1XMQL 4DKAC 3AEVA 3G48A 1XNQQ 2NVQH 3TRZA 3HOXH 1PHJA 4A3IH 2AHOB 3HOVH 2K5NA 1VQFA 3CC4A 1QZHA 3KJOA 4A3GG 1T9HA 2DUDA 1LTLA 3CPWA 4BY7G 3PUYA 1BVSA 4JBKA 1HNZQ 2Y0SE 4X64L 4Y52H 2KBNA 3HOUG 4GKJQ 4DAMA 4X66L 1Q1EA 3KDFA 1YZ6A 1HR0W 2ZM6L 1X9NA 3JAMc 4LFBL 4JC0A 1VQEA 5FJ8H 2BA1A 3M4QA 2D0PA 3TEHB 1VQ4A 4UPAA 3PUZA 5M3FG 4GNXC 1IL2A 4WJ4A 3TS0A 4OO1I 1C9OA 5JJIA 3CMEA 4JI4Q 2UXBL 1CUKA 1EOVA 4JI2Q 4DNIA 1BBWA 4YHHQ 3U4ZA 4O0AA 2CWPA 2R7ZG 4GKKQ 4KI0A 4DV6Q 1SFOH 4GN4B 1IBLQ 4R4CA 1IBMQ 1QUQA 3EIVA 3OYYA 3ZJYC 4X65Q 5LMUL 3UE1A 1HNWL 3KF8B 1U0LA 4YWMA 1GM5A 2VW9A 1JE5A 1PH5A 3T1YQ 1IBKL 4LF9L 1WOCA 2CKZB 1CSPA 3CC7A 3NEMA 4DR2Q 1M90C 3RN5A 4JI3Q 2K5VA 3K7UC 5GQOA 4DUYQ 4P73A 2R92H 4A3EH 3CXCA 4JV5Q 1N32L 4LF6L 3KDFB 2JQOA 1I3QH 3J81j 1NMGA 5JJKA 2K50A 4DR5L 3PO3H 2A1AA 4DPGA 3KJPA 4IFDG 4POGA 4KHPQ 1X3EA 1PH2A 1WJJA 2ALYB 4A3CG 5AJ3Q 3CCUA 1PA6A 3CAMA 1K8AC 2F4VL 1HJPA 4JI5Q 2PQAB 1Q12A 1OXXK 2AWOA 2DGYA 2H5XA 3E9IA 1Y1VH 3CCMA 4B3SL 2E2HH 2JEAI 2K14A 1KD1C 2VNUD 3L7ZC 3A5ZB 1EIYB 2B63G 4JG2A
chains in the Genus database with same CATH superfamily
3S1MH 4CKBA 1GOZA 1KDCA 1QG7A 1WVLA 1K0SA 2BDOA 2LS01 2LKVA 4HIMA 2VZAA 5JOBA 3I4MH 3K5LA 5M3MB 4BY1G 1EY7A 4DV7L 1EIFA 4BY1B 1Q82C 4RGNA 3EFXD 2EYOA 2XWBB 2HHHQ 3DM3A 3CCJA 3DLLA 2ZXOA 2AKWB 3OIQA 3N6RA 3A8IE 5FLXc 1BBXC 2J7ZA 3HOWG 3QO2A 3VYTA 4FXKC 3HOWB 3VR3A 2E5LL 2XN9C 3RZOH 5FLMG 1CM9A 4XXEA 1HR0L 4AH6A 3T16A 1BCPD 1A3VA 1PXUA 2QEJC 3TZUA 1IW7C 3G71A 4LF4Q 4DV0Q 3OMGA 2O5JC 4IN3A 4DV3Q 1CKOA 4HJ9A 1M8AA 5C3XA 1KLGD 5EPKA 3D0FA 2M2LA 2PNHA 1UE7A 1F2LA 1U5KA 2JA6G 1NCVA 3KLSA 3TQYA 1GUWA 2JA6B 5C6AA 5E4XA 2ASBA 3Q24A 4TKOB 4PZ8A 3S17B 3K0YA 4YCVA 4DF7A 4JI7Q 1UAPA 5C0XJ 2UUBQ 1W2BA 4JI1L 4XQNA 1H9RA 3FVQA 5G3LF 5KYLA 4EVOA 4JVZA 5DAUA 3MXGA 3E0EA 3HOYG 1JORA 2FMMA 1NR4A 1EWIA 3H15A 2RBMA 4GS3A 2YV5A 5I9OA 1STGA 1X55A 1HNZL 1EEFD 3BJUA 3NELA 1WCMG 2N3SA 1GUOA 1WCMB 1SJHD 3ICEA 4C3HH 3BYYB 3CQZB 3D4WA 3H3VH 3ND9A 3CCSA 2F0EA 4R4IA 3GTKH 4AIMA 1J5EL 1EY5A 1JQYD 3NP8A 4DV6L 2WB1G 3NBHB 1LT5D 2NVTB 2CHBD 1HNXQ 3H6MA 2WB1B 2EQSA 2KHSA 2MP1A 2NWGA 4YCWA 4HEDA 1JE4A 2Z8LA 3QWNA 2N49A 3T1YL 4C2MB 3M4OB 1KAAA 3QOLA 1LT4D 1XTCD 1RIPA 2EZVA 5DLQE 3C46A 2JK8A 1GHJA 5M5WB 1N32Q 1AH9A 3H94A 3NTHA 5M3MH 2NN6G 4X3TA 4BY1H 2VQFL 2J4XA 4GOPA 1A3UA 1VQHA 5EQ0A 3J80i 1QUQB 4DV5Q 2R93G 2O2LD 3RD4A 2R93B 3X3NA 5IYDG 5CV5A 3E9HA 1BBUA 4FF4A 2Q2UA 2IY5B 3CCLA 1ENFA 3HOWH 3KF6A 4HTHA 2KEEA 1VF5C 1R9TB 1D6EC 2K75A 5DEHA 1C4QA 4A3JB 4DV1L 1XMOQ 1AW7A 3R2TA 5FLMH 1PH9A 3R2IA 5KEEA 2F0HA 3BVZA 4P2CB 4QY7A 4XIGS 4DNRB 3RLNA 3L2PA 2FXQA 4DXGA 4PZ7A 2L5TA 5M5YB 4NXNQ 1N33Q 3TP8A 1I6HH 4K8IA 4CDEC 1EY6A 1K28A 3FEWX 1VQGA 1AE2A 3PIP3 4JI6Q 4UAIA 1QVCA 4UHVA 1U4PA 1I94L 4DA2A 4M8AA 2JA6H 3S2DB 1KDAA 3T1HL 2X69A 2OEOA 1TKWB 2Q2TA 3CHBD 3EQLC 2B2WC 1JOKA 3H09A 3K81C 1YNXA 2YTXA 4EQ5A 4GNXB 4B3TL 3GTMB 5IGFA 1AZQA 3PIPA 4NB3A 2XTIA 1QB5D 1DYQA 3TMEA 1EUJA 3CD6A 2CFMA 4IPGA 2LMCB 4RWSC 2Z6KA 1DOKA 1A8VA 1CKMA 2F0OA 1Z6HA 3VYRA 1BXTA 2EIFA 4DV2Q 1CT1D 1WCMH 5I6WA 4DK6C 1UE6A 2TSSA 2YYZA 5C4HA 2CWAA 2I0QA 2VB2X 1YIJA 4ALPA 5ELFA 3CQZH 3JAML 3RZDB 1LTAD 5DNFA 3D31A 2IW3A 5CBAE 1SLJA 5EAYA 2IWHA 4DR7L 3DXJC 4GKJL 2B8FA 1ZXTA 2NVTH 1PH7A 1B2TA 3T51B 3BU2A 4A3FB 4KY6A 4PV1C 3OOCA 3FDTA 1TT2A 4IOCA 1CKNA 1J6QA 4C2MH 3M4OH 4Y7NB 2CQOA 1S5DD 3BVGA 1PYWD 4PG3A 1EFWA 3GO5A 3LWUA 4EGVA 4X3SA 4L5SA 5J22A 1IBLL 5M5WH 2YU9H 2KECA 1UUPA 2ICIA 3MWYW 1PH1A 1PYBA 1HZAA 2NN6H 1LUZA 3J81L 2JA7B 4BA1I 1TXYA 5C4JH 2DNCA 4N9PA 1R4PB 3I4LA 3PUWA 3WOEA 4HJ7A 4JV5L 1HH2P 2R93H 1KNEA 4L63B 1SROA 2RHSB 1VMCA 1KIXA 3ER0A 1EQQA 3URYA 3BYTB 2XRQD 1CI3M 1O78A 3RN2A 2RDHA 5IYDH 4LF6Q 4IJLA 5FKAC 1PZID 1PTOF 2F0TA 1K3RA 4N8X1 3QIAA 2KENA 5GAHC 4ZLTF 1R9TH 2QW7A 1E7ZA 1II3A 2L1BA 2SEBD 4V0BA 3GTOH 3HS0C 2J0TD 1QVGA 3I56A 1PFBA 4A76A 3J81c 3PGZA 1WTWA 1V43A 1VQBA 5C44B 2R92G 5M5YH 5LMNL 1CK1A 2R92B 4OWWB 4IFDJ 3AFPA 4IPHA 4CHTB 3PO3G 2EXZA 2JJQA 1F9RA 1PFSA 1XTDA 1JJGA 3PO3B 1S5CD 1SRUA 3GV3A 3TP6A 5D3IB 4H13C 1HRJA 3LGJA 4IZ8A 3RMHA 1CZGA 3S2HB 1R4QB 2WIIB 3QG1A 1JICA 4XYQA 3GTMH 3BDCA 1GUNA 3M3YH 2E2HB 2B29A 1AE3A 1B44D 4A3KB 4C3IG 4M1UB 4R4QA 5FK9C 3OSOA 3CRLC 3AFQA 2WAQE 4H7BA 4OL7A 1U9RA 3VYSA 1YJWA 2SNSA 1VQCA 3PUVA 1LTGD 2VL6A 4LFCQ 4U673 3QOJA 3Q23A 2PW5A 4OGQC 1CQFA 2VUMG 4KJOA 4DGZA 2WINB 1SYEA 3GV6A 3A7AB 4JBMA 4A3DG 4FP5D 2BH2A 1I50H 2F03A 1S72A 3V05A 4A75A 1N34Q 5JEAJ 5CORA 4OX9Q 2KHIA 1HZ9A 3RZDH 1EY9A 1W3SA 1IYJB 1ZYRD 2F0GA 4U68A 5TSSA 1YITA 2I5MX 3BZCA 1Q7YC 1CHPD 5IT9E 3C2PA 3TN2A 1A15A 3T13A 1X6OA 1PH8A 1RTOA 4Y7NH 3CCQA 1FR3A 2C35B 1G2TA 3TS2A 1H95A 3AEVA 2PZWA 4K8JA 4B08A 2BDNA 2B2YA 1AEXA 4ZUJA 3CPWA 5EBCA 4ZUIA 1HUMA 1BQQT 1TVXA 4X66L 1PFNA 1Q1EA 1JC7A 1X9NA 4LFBL 4JC0A 4GZYC 2PZUA 2Y0SB 4HAEA 1S5FD 3M4QA 3PUZA 5M3FG 4WJ4A 3F2UA 4OO1I 1C9OA 2R3ZA 1EOVA 4JI2Q 4YHHQ 2QCPX 3RUZA 3K6OA 1IBMQ 1QUQA 3EIVA 3H91A 2WKDA 1TWAB 1ICFB 3KF8B 3WDNA 2FJ2A 4R9WA 1IBKL 4LF9L 1WOCA 1M90C 4HR7B 4JI3Q 1SE2A 4XYOA 2R92H 4PMBA 5KGUA 3G6JB 5I2XA 5JJKA 1NMGA 1BNZA 4ZCKA 1C48A 4DR5L 1I6VC 2EY5A 3PO3H 4O1NA 4K5VA 2NUCA 4POGA 1X3EA 1PH2A 4KHPQ 4QUCA 2G5DA 4A3CG 3CCUA 3SR1A 3FPPA 3HRZC 1OXXK 5BN4A 1YNJD 3E9IA 2H5XA 4Z9CB 2F0VA 1I3QB 1PRTF 2E2HH 2BCOA 5FO7B 1KD1C 3L7ZC 1GUTA 2B63G 4JG2A 1EFID 2VQEQ 1XWEA 1PV4A 3K59A 4DV4Q 2B63B 4JI0L 3M7GA 4C3IH 5DM63 4B3RQ 2I5LX 2K01A 5C4XG 1KC8C 3MEFA 4RH6A 3O13A 1PZJD 4OONA 1Y1VB 2KCMA 4DUZQ 1Q8KA 5M5XB 2VUMH 4GNXA 1C7YA 4YIJA 2K5DA 4A3DH 1DM0B 5CV8A 2E2IB 1IL8A 3I4MB 3CRKC 5FO8B 3OTOL 4NXML 4GLAC 1K3BC 4DR6Q 2F0FA 1TS4A 1BCPC 4R4OA 1VS0A 5M9OA 1B1ZA 1KABA 1TWGH 4DAPA 1XXGA 3PF5A 3KLWA 5HGQA 4PMCA 3NWSA 2PI2E 2UUCL 2UU9L 1QVFA 3D6WA 2BH8A 2F0JA 2A6ED 2EY1A 2JA9A 5IWAL 2L55A 1HQRD 1BKBA 1YBYA 3E0JA 4DU9A 4KK7A 1SNOA 3RZOB 4BXXG 1MSGA 4QIWB 2M9VA 1HA6A 1UEBA 2NYZD 4BWGB 3B6YA 3IL8A 1HXYD 4J8QA 3PV0A 2AQ2B 1TWCH 4GN5A 1PTOB 3VR5A 1MSHA 1J8IA 1KXLA 2EE1A 4X3UA 4GOPC 3S24A 1Q86C 2F0KA 4FXGC 5AFWA 3P7JA 4R4TA 3A8JE 4ZQ3A 1O7IA 2DJFC 5M3FH 2QA4A 3IFDA 1XMQQ 5G3LD 1SN8A 2K32A 4LUOA 1NMFA 4CJ2C 3ITPA 1I4GA 3EA6A 1FL0A 5GROA 1TWAH 1IZ6A 3K0XA 1LTBD 1JB7A 4X64Q 2KVMA 3KLSX 4K5XA 3T53B 3X3MA 3SK8A 3VA7A 2PZTA 2OT2A 4CKEA 5GAGC 4Q0FA 2ZM6Q 1E1OA 1FYCA 3L3OC 2R7ZB 4HSVA 3ZYYX 4JI4L 5C3EG 1YEZA 3K5OA 4JK1C 4CJ1B 1BF4A 3ULLA 2ATWA 3V2TA 2A19A 1A0IA 3OWFA 1B9NA 1XPOA 4A3CH 5KRUA 1KRTA 4X65L 4P71A 1I5FA 4PNYA 3NE5B 4C3HB 1L0YB 5IYBG 1I4XA 1YHQA 4LF8Q 1HNWQ 3DUZA 2ID0A 3GTKB 4DR2L 1F9QA 4EQNA 3MHBA 4DUYL 5EKKA 1X3QA 3MTSA 2K6AA 2B63H 2LXJA 3OIPA 2F0SA 4N8FA 4EQPA 3SXHA 4XTCS 5CV7A 1EYGA 1QZGA 1B9MA 5AJ3L 2JA5G 5M5XH 5FO9B 1TWFB 3Q8DA 2JA5B 4LF5Q 2E2IH 5IGDA 1UNSA 3Q22A 1A2UA 2CH4A 2N8NA 3NTKA 1CZWA 2EYHA 4NPSA 4A93G 5DM73 2RF4A 1NSNS 5JJZA 1TQOA 3CCRA 4DR4Q 3ND8A 5D65A 1FNUA 3IKJA 2MJ8A 4JPBW 2HHHL 3GTGH 3P20A 1B3AA 2OQ0A 2MQHA 2GVAA 1X3PA 3QR8A 2D62A 4UDUC 4IO9A 2MHVA 1YJNA 3S15H 4BXXH 4FDBA 5H1SE 3Q6SA 4H44C 2K4KA 4YY3Q 3NPPA 3CKIB 1CA6A 1HR0Q 1FD7D 1I6HB 3PSIA 1PTOH 2OTJA 3R3OA 4LF4L 1Z9FA 2WAQG 2X6LA 4HIDA 4DV3L 1HPCA 2D0OA 3J7A5 1RODA 3MEHA 4H0LC 3W2DA 1HTPA 2HDLA 4X62Q 4XQQA 2CH4W 4B9XA 3TSSA 2HQLA 2NB0A 5CV9A 1MD2D 4DR3Q 3I70A 1KL9A 1T5XD 2KCNA 2UUBL 3HOYB 1VQAA 1ET6A 3RNUA 1QOHA 1G6ZA 4KLKA 3K5NA 1YNNC 3HKZG 1CFMA 2R7ZH 3GTPB 1YHAA 3HKZB 2EJGC 4AYBE 2Z4HA 1G91A 3SK5A 5C3EH 2F1MA 4P72A 1SR3A 1VQOA 1PRTB 1GUGA 1E1TA 1X3GA 2JE6I 3KF8A 1Y1WG 5HGTA 4APVA 2DN8A 1V1OA 5IYBH 1LTTD 1Y1WB 5CC4A 4TRDA 2D2CC 4GKKL 2NVQB 1RL2A 1CTMA 4KN7C 4WFN3 1L1OB 3EN2A 3MXUA 2YTYA 2IX1A 3I90A 4PQXA 2C9OA 4MTNA 3DM1A 1TWFH 2B2TA 2A68D 1J5EQ 1HNXL 2JA5H 1GHKA 3HG9A 3E6ZX 4OEMB 5C0XI 2YU9B 3W5OA 1X3FA 3VR6A 4QL5A 2AMCB 2DJGC 1JWMD 3A0JA 1RF2D 4HJAA 1NTGA 2IX3A 3NBIA 1ILQA 4HCSA 1HTLD 4JI5L 5C4JB 4A93H 3A55A 3OW7A 2CCZA 1T5EA 1PTOD 1ZKOA 2QKIC 3CCEA 4O42A 2WKCA 4DV5L 1JT8A 2NTTA 2VQFQ 4B3SQ 1VQJA 3BDLA 3J80E 4B3ML 1TY0A 3D8GA 1H9SB 2IX0A 1GO3E 3KFUA 3GTOB 5I4DA 2F0MA 2F3VA 4KV6A 4E6IA 4JYAQ 3EJIA 4K6LA 2IHFA 2Q8RE 3NENA 4KKSA 3DEOA 3STBD 4R1JA 2B2YC 4DV1Q 4ME3A 4LFAQ 4IUVA 1K8GA 2WV6D 4A4IA 4KHVA 5FLXE 1TY2A 2K03A 4OIKA 4NXNL 1QJOA 4LJZC 1N33L 3FRPB 4RGOS 5KNDA 2E2JB 2RCNA 1SYBA 2HCCA 2K7VA 4JI6L 2VY3A 4OO1G 1EYDA 1WTOA 3M3YB 1I94Q 4P74A 1SNQA 2MNAA 2EYPA 3T1HQ 3S14B 2LY7A 4DAYB 1TWHB 3V96A 1ZYRC 1KDBA 1D1KA 2PNRC 1V8QA 1L0XB 1AFPA 3HOYH 2D5DA 2EPBA 5IT9L 3I3CA 1BOSA 5ELOA 2N88A 2RSNA 4FNFA 1RDPD 3GTPH 1N36Q 2CQAA 3CP0A 1HUNA 1STHA 2B2UA 1EQRA 3OHXC 4LMQD 4LWCA 3NWTA 1CA5A 3AB9A 1W6KA 4FF1A 3K58A 1I50B 1H9KA 1PFMA 5JVH3 1XNRQ 1VQ7A 1G291 4GLXA 1FJGQ 1F2ZA 2EOTA 4DV2L 2K5QA 1B4OA 4AQYL 2Q2HA 3OW2A 1Y1WH 5KIXA 3DHQA 1BO0A 2VXWA 4DKAC 1XNQQ 1EZ8A 2NVQH 2AHOB 1VQFA 1SJED 3K57A 3KJOA 4A3GG 4BY7G 3PUYA 1WTVA 4JBKA 4A3GB 3HOUG 3NQIA 4DAMA 4GKJQ 2AUJD 1HR0W 3JAMc 4ZKBB 1RCVD 3BZDB 1VQ4A 4GNXC 3TS0A 4G4KA 4N9TA 2JYOA 4O0AA 2BE5D 2CWPA 4ZK9B 4GN4B 1IBLQ 4R4CA 3OYYA 4CKCA 1Y8NB 4LK1C 1ET9A 1BUVT 1EIHA 1SYCA 1JE5A 5KNBA 2I07B 1PH5A 1ILPA 5I2YA 4I7ZC 4JV5Q 5GQOA 4P73A 4LF6L 3KDFB 1JWUD 1LLRD 1DCZA 1SMYD 2K50A 1LTID 1O7YA 4QCLA 4DPGA 3KJPA 1I4PA 1YNJC 5LHY1 1HHVA 2RVLA 1PA6A 2F4VL 4CDDC 2PQAB 1Q12A 3LNNA 3MXPA 2E2DC 2OF1A 3CCMA 4IUPA 5FOBB 1D5ZC 2VNUD 1EIYB 5EBDA 4ID6A 4UP9A 2GA4B 5LMNQ 2E2JH 1X65A 2F0QA 1PRTD 2LXKA 4R8NA 4YWKA 3I8ZA 5BN5A 1F2YA 4OO1H 1SXTA 1PVOA 2JEBI 3S14H 5JJLA 1E3PA 1K0RA 1TWHH 1PLFA 2QDLA 4C3IB 4CJ0B 3J7YW 1HCZA 2RA4A 4LUZA 2F0PA 4OWXB 3D6CA 2UXDL 3FP9A 2EYMA 4FVMA 1Y14B 5BR8Q 4RMFA 4V190 2VUMB 5HURA 2F0DA 3HP3A 4LFCL 1SEBD 2A6EC 4A3DB 3MC0B 2K1BA 1C0AA 1F9PA 4L5TA 2G9HD 3ONAB 1TS2A 3UI2A 2HIXA 1N34L 1C8CA 3IFTA 4IFDI 2F3IA 4OX9L 1TWGB 2EDGA 1FGBD 5K36G 1E2WA 4PZ6A 4KHZA 4A3GH 4RCOA 2UUAL 2L15A 5ELEA 1VDZA 3CW2C 3S1RB 3HOUH 1A62A 1DD2A 3RR5A 1QWYA 5JAVA 2C5CA 1A63A 2L4NA 2E76C 2NBFA 4QB4A 3TP5A 3HFZB 1P8LA 3M4YA 1CHQD 1D1IA 3NBHA 1P16A 1D5XC 1OTCA 1L1OA 2QF7A 3NSWA 2ZTDA 1E24A 4MZ9A 1XX8A 4YWLA 4LF7Q 4EX5A 2EY6A 3OMCA 1TWCB 3Q0AA 1JWSD 2NZOA 2QDBA 4OWTB 4IPDA 2RCFA 4RGMA 4A3LG 1VCIA 4KKUA 1Q8IA 4TQUS 3GTJB 1MGSA 2DNEA 4L8JA 1V1QA 5M3FB 2ZT9C 1Y8OB 3HZXA 3JC66 2AQ1B 2F3WA 4IPCA 5CV6A 2DY7A 2MFIA 2WB1E 4LFBQ 1SAPA 1WYDA 2IPKD 4XQJA 4S3SA 3I91A 4DK0A 3TP7A 2UXCL 4JI2L 4YHHL 1PYSB 4MN3A 3CU7A 3K8AA 1IBML 5J3BA 4A3BG 5CBEE 4DR1Q 2HD3A 3GTLH 4A3BB 2EXDA 5IGEA 3J81i 2IT1A 1H9SA 4LAAA 1NE3A 1AN8A 2L9HA 3QB3A 3TBIB 3GTQB 1XYIA 4JI3L 1IBKQ 3L0OA 1U4LA 4LF9Q 3KLRA 5FJ8G 3T56B 3U58A 1YHBA 3IAYA 3J81E 4KHPL 2A6HD 4JI8Q 4HMJA 3NUCA 4TSSA 2B2VA 2Q2IA 1PMRA 1QILA 1LABA 4WORA 5EJWA 3TZDA 1HA5A 5ELDA 4G7OC 3UE0A 2HT1A 2VQEL 3WOFA 1K83B 1GVPA 2RQXA 4DV4L 1WTPA 5C4XB 1Z47A 3WWVA 5LL6X 2CVRA 4B3RL 3F1ZA 4WRDA 1TIID 4JI0Q 1STAA 1TS3A 2NZ1D 2R61A 2B39A 5IYCG 4DAYA 4JOIA 5IGCA 1B8AA 1NUCA 4CBVA 3GQBA 3UDGA 4DFAA 1WD0A 3S16B 1QNUA 1IYVA 3KYHC 3BS1A 1RTNA 4B9WA 4WJ3M 4FF2A 1ONLA 1BDOA 2OXPA 4RG1A 5E3FA 1A6XA 2DY8A 2WP8J 3GTGB 5T1IA 1ENAA 4NDXA 4RFBA 4R8IA 3GDEA 4K0KL 3VR2A 3S1RH 2XGTA 4DXFA 2OWOA 5IIFA 4RKBA 2A73B 1ASYA 3J7AF 1LV9A 3S15B 2UU9Q 1M1KC 2SOBA 2B2TC 3F2CA 2M00A 5C0XG 1YJ9A 3RLOA 2KJXA 5LMNW 1EIGA 4BS9A 3W1GA 1NBWA 1IXRA 2JXMB 1Q3LA 2X6GA 1GD7A 4A3LH 1EL0A 3T4AC 4NW2A 3GTJH 1VMPA 1I4RA 1KHIA 5KNCA 2FHTA 2R6GA 1YI2A 1PZKD 2SDFA 1MBYA 3G4SA 2H1EA 1O7LA 4RA8A 3S1QB 1F2MA 1WTRA 5CR3A 3SDZA 4A3BH 1Q1BA 2RSOA 5CGKA 1K9MC 3D4DA 3HKSA 5HY6A 4LW1A 1SNMA 3GTQH 1L2FA 5C3EB 4A3IG 1JR0D 1NJIC 2UXBQ 4XT3B 1S4ZA 2A68C 4OXPA 1F77A 1SMXA 4IJHA 1Y8PB 1EY0A 3BZKA 4UY8C 5LMUQ 3NK9A 2HQEA 2PQAA 1WTXA 3MXNB 4K2LA 5E4WC 5J39A 5A35A 4F8MA 1Q46A 3GD7A 4F87A 4HMIA 5EGTA 1I4QA 2LSSA 4LF8L 2QEXA 2EJFC 2E8GA 1B7YB 1M4VA 1K83H 4HCEA 5C4XH 3I2ZA 1PTOC 1CKNB 3J80L 4RKLA 1NY4A 1SFOB 2VB3X 1KQSA 1JB3A 2Z6KC 1VQMA 3MA2B 2EJMA 1PH3A 1G51A 1F9SA 3G6EA 1X32A 4FXDA 5IYCH 3DWAA 1A2TA 1MJCA 1SE8A 3S16H 4ME5A 4NKLA 4A3EG 4LF5L 4DK3C 2ZJQA 4A93B 4L5RC 3STBC 2F52A 3M7NA 2PO4A 3J80c 5FLXL 1XJVA 4DV7Q 1IYUA 1DJRD 3RLFA 1Z7TA 5M3MG 4DR4L 1B53A 3A8KE 2V4DA 4IALA 1E0BA 4UP7A 2E75C 2Z9HA 1KRSA 1N9WA 1Q90A 4JBJA 2KQ3A 3H3VC 2E5LQ 5C0XH 3PCOB 2KCCA 1D7QA 1PDQA 1VQIA 1OXVA 2FINB 1RHPA 4DV0L 4YY3L 4L5QA 2HDMA 2WAQB 1GJXA 4A3MG 1HFNA 1U4MA 1YVCA 5E7NA 4A3MB 1D5MC 2EYJA 1LACA 1QNKA 4J6HA 4GLVB 4IUTA 2R7DA 3I7FA 3S1QH 5IP7G 4X62L 4XT1B 4JI7L 1B50A 1SSOA 4HIKA 2KHJA 3NHHA 2PMZB 4DR3L 2JA8G 4JI1Q 2JA8B 1SE4A 3VR4A 1KLUD 3K80C 2KUMA 2L12A 1X54A 3D3RA 2K04A 3G48A 3TRZA 1H9MA 4A3IH 5EPLA 2EVBA 2HUGA 2K5NA 5A2QE 1QZHA 1T9HA 2DUDA 1BVSA 2Z6BA 3SK4A 1HNZQ 2Y0SE 4Y52H 2KBNA 4I7AA 1JCKB 2EYLA 1EYAA 3KK7A 4G57A 3E5SA 1YZ6A 2BOSA 4K5WA 1B3QA 2AUKA 2BE5C 4KD3A 2A74C 4HSPA 4KD4A 3R93A 5JJIA 3CMEA 1CUKA 3U9SA 4GKKQ 1Y69U 4KI0A 4DV6Q 4RCNA 2CW0D 3MZ5A 1SFOH 3ZJYC 3C3LA 4G7ZC 3P1HA 1U0LA 1GM5A 1IKLA 1SMYC 3KBXA 3T1YQ 2F0NA 4QUFA 1CSPA 4JW0A 3NEMA 2K5VA 1N32L 4A3EH 3CXCA 2IJ0A 1DOLA 1SNCA 4DN4M 4RHSA 1LO5D 1EU3A 5I9PA 5JPMC 4IFDG 4J1MA 1EEID 2ALYB 2EYFA 2JP1A 1K8AC 4JI5Q 2Q8IB 1STBA 2AWOA 1STNA 4B3SL 2JEAI 1PRTC 1UWVA 4B3MQ 2QGQA 3PQIA 1XMOL 1EY4A 3TDQA 1EU4A 2A69D 5JPNC 4ILWA 4POFA 3MVVA 1J9OA 3ULJA 4JYAL 1FVIA 4CDFC 1GKHA 4ZKCB 1SE3A 4A3JG 2EY2A 1VQ8A 1G6PA 2L0CA 1L1OC 1HFGA 3GP7A 4LFAL 2KA7A 3M9BA 2QILA 4A3MH 2PPBC 3NQTA 4NMZA 1DGSA 4K14A 2ZXPA 2F0UA 3HOZG 2PYKA 1BCPF 3HOZB 5I6YA 4QMGA 4ZYSA 2ZJRA 5JEAG 1RKNA 1MIUA 3NTIA 4FF3A 5IP7H 1I4HA 2NVYB 1KNAA 2HIVA 3QJYA 5C3WA 2Z0SA 1OO9B 4B3TQ 3CPFA 3H3VI 4X6AH 3OWEB 4RGTA 2OCEA 2Q8TA 2JA8H 4QIWE 3PUXA 2FFKB 1VQ9A 2JSOA 3S17H 2I5HA 3DWPA 1O80A 1IW7D 1EQVA 1N36L 1NNXA 3K7AB 1JJCB 3N52A 3LX0A 5CMDA 2XIWA 4BBRG 1E22A 2ZJPA 1EQTA 3CCVA 3F2BA 2KEDA 4BBRB 3E3XA 5IODA 1NAPA 5BN3A 1VQ5A 1XNRL 5IT9c 1A3TA 3AQQA 1FJGL 1LT3D 1WTQA 1X56A 1NR2A 3A7LA 4KMUC 4RHRA 4X3KA 1VQNA 4G7HC 2K5HA 4AQYQ 1SNPA 2B2VC 3K5MA 5IE8A 1XNQL 1EY8A 4BY7B 4DR7Q 1WTHA 2Z1CA 4HIOA 3HOUB 1D2BA 3I55A 1DONA 3MFYA 5IP9G 3MXNA 2TMPA 4DNTB 3FPUB 2ICEC 1VQLA 5IOCA 4H02A 1YNND 4A3FG 3CMAA 2NVXB 3PO2G 4J15A 3U4VA 4MIUA 3IRBA 3I4NG 1LM0A 4IUUA 3PO2B 2ZTEA 4JOIC 3W1BA 5KYIA 1S5BD 2PQEA 3I4NB 4MTKA 3D4RA 4EQOA 1CQVA 1RJTA 1MKHA 3VA5A 2MPMA 4IQZA 2RDGA 4IFDH 5ELBA 4LNQA 2AWNA 1V1PB 2MO1A 4O2DA 1U4RA 3C1EA 2JA7G 5C4ZA 4CGYB 1DZ1A 3CF5A 5J1ZA 2HCIA 2XRSD 3FKIG 1WI5A 1E2VA 2A6HC 3FKIB 4I65A 1XPUA 3ERSX 3DEPA 1OXTA 4F88A 4PMWA 3SHLA 1FNVA 1EWHA 3MFGA 2PCFB 3J7AV 3GTLB 1JOQA 2N78A 4A3JH 5L37A 3PMFA 3KOJA 2K5WA 1D8LA 2F4VQ 1EZ6A 2BA0A 4ABNA 1VQ6A 4KN4C 3AU7A 5C44G 3FMCA 2L11A 3I4OA 3HOZH 4C1NI 3S1NB 2O4XA 3EROA 3ULPA 3U50C 5JEAH 4KY5A 2NVYH 1KTKA 4ZRZA 3S2DH 1O7ZA 2GN5A 1QE6A 3P75A 1HZCA 3VYUA 4QF4A 3EBEA 5ELCA 2WACA 4YCUA 3SEBA 5GADC 1FNWA 4F7XA 3H0GG 4A3KG 3K7AH 3H0GB 2MUYA 3A56A 5F2DA 5BR8L 2UXDQ 5GAEC 3FHWA 4BBRH 4BBSG 1EOTA 3G7LA 2NZHA 4BBSB 4OHJA 4QJFA 3VDYA 2ZTCA 2ES2A 3UDXA 4CDCC 3S9WA 3C1FA 3L9AX 1SYDA 4C3JG 4JCVE 4C3JB 2NN6I 3SK6A 4BY7H 2LFNA 1SYGA 3F8TA 3A74A 1GXDC 4LUVA 2PMZE 1STYA 4QGUA 5IP9H 4C1NK 2UUAQ 2NTSA 1MHWC 2K28A 3PF4A 3HKZE 1HQMC 2NVXH 2K33A 4OIJA 4A3FH 3AMUA 4XDXA 3PO2H 1HZBA 3JAMi 3I4NH 2XNAC 2MO0A 1K73C 2OTLA 1K8MA 2GVBA 1LYLA 2K52A 2V1CC 4LF7L 4BA2I 1N8RC 4X66Q 2O5IC 3JAME 4AYBG 2K05A 5IGBA 4KJNA 3SGIA 4AYBB 4NP5A 1B70B 2ZXRA 2XSCA 2JA7H 4Q5VA 1ASZA 5EPJA 4UP8A 1LTRD 2RDFA 3HOXG 2WFWA 1WFQA 1TR5A 2B2WA 3FKIH 3HOXB 3HOVG 2Y0SG 1STEA 2RKSA 5LL6S 3HOVB 1VQPA 1ZEQX 4ODGA 4DAVA 3UDIA 1K8OA 3U9OA 1L0WA 3J7ZC 1OXSC 3NXWA 3M4PA 2UXCQ 3I73A 1S40A 4RAUC 3UDFA 2F0LA 4DR1L 1BCPB 1XPRA 4P75A 5IY0A 4K2KA 3SVMA 5C44H 2R7FA 3ERQA 3S1NH 4DR5Q 4HJ5A 1OXUA 3LWEA 1V9PA 1W6JA 4KTAA 4KKTA 4JI8L 1UE1A 4OELB 2IHEA 2Z4IA 2AQ3B 4K6DA 4IOAA 3S2HH 2IL8A 2KCTA 1BR9A 2B3GA 5EKLA 2XVSA 1JMCA 5ELNA 1IKMA 1TS5A 3H0GH 4C56C 4DUZL 4A3KH 3KBGA 2I46A 4TVAB 4MHEA 5NUCA 1MJEA 3A54A 1DXMA 4GN3B 1Q81C 1H9JA 2ENBA 4GOPB 3HEJA 1S3OA 2JN4A 5JVG3 3DWQA 4BBSH 4IUNA 1Y1VG 1SNDA 2A8VA 1IHZA 1ESRA 3F2DA 4FO2A 4MNOA 4DR6L 3DMUA 1FGUA 3PIO3 3OTOQ 4NXMQ 4C3JH 4WJWA 3S1MB 1UE5A 1VF7A 2P5ZX 2PI2A 5K36H 4HJ8A 3I4MG 5D14A 2RHQB 3KF6B 5COYA 4JBWA 3AYHB 3M85A 4IUQA 2UUCQ 3PIOA 1MI2A 1AP0A 2YTVA 1KAWA 4K0KQ 5IWAQ 1G2SA 1VQDA 1VQKA 5K5PA 3CC2A 1RD9D 2KOLA 1PH6A 1CSQA 3I72A 2G9DA 3EVQA 4ZAIA 4HN7A 2VS1A 3HGBA 4QQBX 1LT6D 2E74C 3OPOA 2F0WA 1E2ZA 3BVMA 2D9UA 1ICWA 3TREA 1JJ2A 5A2QL 1PH4A 5CYUA 3A5UA 2OQKA 1XMQL 3HOXH 1PHJA 3BDOA 3HOVH 5E1FA 3CC4A 1GUSA 1DOMA 1LTLA 5T1GA 2F0IA 2B8GA 5IGGA 1SDFA 4X64L 1V1PA 4IURA 4L6TB 3KDFA 2MGSA 2H4OA 2PW7A 5ISRA 2ZM6L 4A3IB 1VQEA 1WD1A 5FJ8H 2BA1A 3TEHB 2D0PA 2CW0C 4ULLA 4UPAA 1IL2A 4JI4Q 2UXBL 4DNIA 1BBWA 3U4ZA 3MAQA 2R7ZG 3R8BA 4FYDA 1ML0D 5EKIA 4X65Q 5LMUL 3UE1A 1HNWL 4DK1A 4YWMA 2VW9A 5CV4A 5D3DA 1EYCA 5C5LA 1LTSD 2CKZB 3CC7A 4C3HG 4DR2Q 3RN5A 3K7UC 4DUYQ 2A5HA 3W3AA 1ENCA 2JQOA 1I3QH 3J81j 3KUPA 1SYFA 2FMCA 2SNMA 1JOOA 1S5ED 1SBBB 4KY7A 1EWCA 2A1AA 3BG3A 1UEAB 2F4IA 2B2UC 1WJJA 5AJ3Q 2N55A 3CAMA 1HJPA 1G8ZD 5C5MA 4A3EB 1ESFA 2DGYA 3SE0A 1AZPA 1Y1VH 1QCBD 2A69C 2XWJB 1TU2B 2K14A 3A5ZB
chains in the Genus database with same CATH topology
2VQEQ 3S1MH 1PV4A 1UWVA 4DV4Q 4UP9A 4B3MQ 4JI0L 2QGQA 1XMOL 4C3IH 5LMNQ 2E2JH 1X65A 4B3RQ 2I5LX 3I4MH 4HIMA 2VZAA 2LXKA 5C4XG 4POFA 4YWKA 3MEFA 4BY1G 1KC8C 4OONA 4JYAL 3ULJA 4DV7L 1EIFA 1FVIA 1Q82C 2KCMA 4DUZQ 1GKHA 4A3JG 1Q8KA 1VQ8A 1G6PA 2VUMH 4GNXA 2JEBI 1L1OC 1C7YA 2HHHQ 3S14H 1E3PA 1PVOA 1K0RA 5JJLA 1TWHH 4LFAL 3M9BA 3DM3A 3CCJA 4A3MH 4A3DH 3DLLA 1DGSA 2AKWB 4LUZA 4OWXB 3OTOL 3HOZG 4NXML 4GLAC 5FLXc 2UXDL 3HOWG 4DR6Q 3FP9A 2ZJRA 4R4OA 1VS0A 1Y14B 4RMFA 5BR8Q 5JEAG 2E5LL 1MIUA 3RZOH 1TWGH 5IP7H 5FLMG 1HR0L 4LFCL 3PF5A 4AH6A 3KLWA 5HGQA 2HIVA 1C0AA 2Z0SA 2PI2E 2UUCL 4B3TQ 2UU9L 3CPFA 4L5TA 3G71A 1QVFA 4LF4Q 3H3VI 4X6AH 4DV0Q 2OCEA 2JA8H 2BH8A 4QIWE 3PUXA 2JA9A 5IWAL 1VQ9A 1YBYA 1BKBA 1CKOA 2HIXA 2I5HA 4DV3Q 1N34L 3S17H 4IFDI 2F3IA 4OX9L 4HJ9A 3D0FA 2PNHA 1N36L 1UE7A 1U5KA 2JA6G 4BXXG 1JJCB 3TQYA 4PZ6A 5K36G 4KHZA 4A3GH 4BBRG 1UEBA 2UUAL 1E22A 2L15A 2ASBA 2ZJPA 3CCVA 3F2BA 3CW2C 3B6YA 1VQ5A 4PZ8A 1XNRL 3HOUH 5IT9c 1A62A 4YCVA 3PV0A 3AQQA 3RR5A 1FJGL 4JI7Q 1TWCH 4GN5A 1X56A 5C0XJ 2UUBQ 1W2BA 4JI1L 1A63A 1KXLA 1VQNA 4GOPC 3S24A 3HFZB 1Q86C 2K5HA 1P8LA 4R4TA 4AQYQ 3E0EA 3HOYG 1P16A 1O7IA 1OTCA 5IE8A 5M3FH 1EWIA 1XNQL 4DR7Q 1L1OA 3H15A 2QA4A 1XMQQ 4HIOA 2ZTDA 1E24A 1SN8A 4MZ9A 4YWLA 4LF7Q 4GS3A 4LUOA 4EX5A 1NMFA 4A3LG 3I55A 2NZOA 2YV5A 4IPDA 4OWTB 5IP9G 1X55A 5GROA 1FL0A 1VCIA 1HNZL 1TWAH 3BJUA 3NELA 1WCMG 2N3SA 4TQUS 1IZ6A 3K0XA 1VQLA 1JB7A 4X64Q 4H02A 4A3FG 3CMAA 3ICEA 1V1QA 3PO2G 4J15A 3U4VA 3JC66 4C3HH 3IRBA 3I4NG 4IPCA 1LM0A 2ZTEA 2MFIA 4JOIC 2WB1E 1E1OA 3W1BA 5GAGC 2ZM6Q 4LFBQ 3H3VH 1WYDA 3CCSA 4R4IA 3GTKH 4JI4L 5C3EG 1YEZA 2UXCL 4JI2L 4YHHL 1MKHA 1PYSB 4AIMA 1J5EL 3ULLA 2ATWA 2A19A 1A0IA 2WB1G 3NBHB 4DV6L 3K8AA 1IBML 4LNQA 1HNXQ 1XPOA 5J3BA 2AWNA 2EQSA 1KRTA 4YCWA 4X65L 4P71A 4A3BG 4A3CH 1I5FA 2MO1A 4DR1Q 3GTLH 4O2DA 2EXDA 5IYBG 2JA7G 3J81i 2IT1A 2N49A 3T1YL 1YHQA 4LF8Q 1HNWQ 1NE3A 3CF5A 2ID0A 4DR2L 4JI3L 4DUYL 1RIPA 1IBKQ 3FKIG 1WI5A 3L0OA 5DLQE 4LF9Q 2B63H 2LXJA 2JK8A 1XPUA 5FJ8G 3U58A 1N32Q 3ERSX 1AH9A 1OXTA 1YHBA 5M3MH 2NN6G 4PMWA 4XTCS 4KHPL 4BY1H 1EYGA 4JI8Q 2VQFL 4GOPA 1QZGA 1VQHA 2N78A 1QUQB 3J80i 5AJ3L 2JA5G 5M5XH 4DV5Q 2R93G 4A3JH 3Q8DA 2Q2IA 3KOJA 1D8LA 2F4VQ 5IYDG 4LF5Q 2BA0A 2E2IH 1VQ6A 3E9HA 5C44G 1BBUA 3UE0A 2HT1A 2Q2UA 2VQEL 1GVPA 2N8NA 3I4OA 4DV4L 3HOZH 2IY5B 3CCLA 1Z47A 4NPSA 3WWVA 3HOWH 4A93G 2RF4A 3KF6A 3F1ZA 3ULPA 4B3RL 3U50C 2K75A 4JI0Q 1XMOQ 4DV1L 5FLMH 3CCRA 1PH9A 2NVYH 4DR4Q 5IYCG 4JOIA 3S2DH 1B8AA 2GN5A 2HHHL 3GTGH 4QY7A 4XIGS 3RLNA 3UDGA 3L2PA 2FXQA 2MQHA 1HZCA 2GVAA 2OQ0A 4PZ7A 3KYHC 4NXNQ 3EBEA 1N33Q 2D62A 4YCUA 1I6HH 5GADC 4WJ3M 4IO9A 3H0GG 4A3KG 1YJNA 1VQGA 1AE2A 3S15H 3K7AH 4JI6Q 4RG1A 1QVCA 1I94L 5BR8L 2JA6H 4BXXH 3T1HL 2UXDQ 4FDBA 2WP8J 5H1SE 2Q2TA 5GAEC 3FHWA 4BBRH 4BBSG 2K4KA 4YY3Q 3GDEA 4K0KL 2NZHA 1YNXA 3K81C 3S1RH 2XGTA 2YTXA 4QJFA 2ZTCA 4EQ5A 4GNXB 3PSIA 3VDYA 1HR0Q 2ES2A 3UDXA 2OWOA 1ASYA 4B3TL 4LF4L 2OTJA 1Z9FA 2WAQG 4HIDA 3PIPA 4JCVE 4NB3A 2UU9Q 1M1KC 2XTIA 4DV3L 3F2CA 2D0OA 2NN6I 3J7A5 5C0XG 4BY7H 1YJ9A 1EUJA 3RLOA 3CD6A 2CFMA 4IPGA 4X62Q 5LMNW 3W1GA 1NBWA 2Z6KA 1IXRA 3F8TA 3A74A 4LUVA 2HQLA 1A8VA 2PMZE 1CKMA 1GD7A 4A3LH 4QGUA 5IP9H 4DR3Q 2EIFA 3GTJH 4DV2Q 1KL9A 2UUAQ 1KHIA 1WCMH 3PF4A 3HKZE 1UE6A 4DK6C 2YYZA 2CWAA 2I0QA 2NVXH 2UUBL 2R6GA 1YIJA 1YI2A 4A3FH 4ALPA 1VQAA 3RNUA 3PO2H 3CQZH 1HZBA 3JAMi 4KLKA 3I4NH 3D31A 2MO0A 3HKZG 3G4SA 1K73C 2OTLA 2R7ZH 2GVBA 1YHAA 1SLJA 5EAYA 1LYLA 2K52A 4AYBE 4DR7L 4GKJL 2V1CC 5C3EH 4P72A 4LF7L 4BA2I 1SR3A 2NVTH 1VQOA 1N8RC 1PH7A 1E1TA 1X3GA 2JE6I 3BU2A 4X66Q 4AYBG 4A3BH 1Q1BA 3SGIA 1Y1WG 4IOCA 1B70B 1CKNA 1J6QA 1K9MC 3HKSA 4APVA 4C2MH 5IYBH 2JA7H 3M4OH 5HY6A 2CQOA 4LW1A 3GTQH 4PG3A 1ASZA 1EFWA 3GO5A 4UP8A 1L2FA 3HOXG 4A3IG 2WFWA 1WFQA 4GKKL 4L5SA 3FKIH 1RL2A 1NJIC 3HOVG 2Y0SG 1IBLL 5M5WH 2YU9H 2UXBQ 1VQPA 1L1OB 4OXPA 3UDIA 3EN2A 1PYBA 1PH1A 2YTYA 1SMXA 1HZAA 4IJHA 2IX1A 1L0WA 3BZKA 3J7ZC 1LUZA 4UY8C 1OXSC 5LMUQ 3M4PA 2UXCQ 2PQAA 4MTNA 3MXNB 1S40A 4BA1I 1TWFH 1TXYA 5C4JH 1J5EQ 1HNXL 2JA5H 4HJ7A 1Q46A 3PUWA 4JV5L 2R93H 1HH2P 3UDFA 3GD7A 4DR1L 1SROA 2RHSB 1KIXA 1XPRA 2LSSA 3ER0A 4P75A 5C0XI 1EQQA 4LF8L 2QEXA 5IY0A 3RN2A 2E8GA 3W5OA 5IYDH 1B7YB 1X3FA 4LF6Q 4IJLA 4QL5A 2AMCB 1K83H 3A0JA 2R7FA 3I2ZA 5C4XH 1K3RA 5C44H 4HJAA 4DR5Q 1CKNB 1NTGA 4HJ5A 1OXUA 3S1NH 2KENA 5GAHC 1R9TH 1E7ZA 4JI5L 3GTOH 4A93H 1NY4A 1QVGA 2CCZA 1KQSA 3I56A 2Z6KC 1VQMA 1V9PA 4JI8L 1PH3A 1UE1A 4A76A 1G51A 3J81c 3CCEA 3PGZA 3G6EA 4DV5L 1JT8A 5IYCH 2VQFQ 1MJCA 1SE8A 4B3SQ 1V43A 1VQBA 3S16H 1VQJA 2IHEA 4B3ML 2R92G 4A3EG 5M5YH 4IOAA 5LMNL 4LF5L 2IX0A 2KCTA 4DK3C 4OWWB 3S2HH 4IFDJ 2ZJQA 1GO3E 3KFUA 4L5RC 2B3GA 3AFPA 4IPHA 1JMCA 3PO3G 5ELNA 2JJQA 1PFSA 1XTDA 3STBC 1JJGA 3H0GH 2F52A 4DUZL 4A3KH 3M7NA 3J80c 4TVAB 1SRUA 1XJVA 4DV7Q 4JYAQ 1MJEA 3RLFA 2IHFA 4GN3B 3NENA 1Q81C 5M3MG 3LGJA 4GOPB 3STBD 1S3OA 4DR4L 4BBSH 4R1JA 4DV1Q 4ME3A 1Y1VG 4LFAQ 2A8VA 4UP7A 1K8GA 3GTMH 4A4IA 1KRSA 1N9WA 3F2DA 4MNOA 3M3YH 4DR6L 2B29A 1AE3A 1FGUA 3OTOQ 4JBJA 4NXNL 1N33L 4NXMQ 4C3JH 1UE5A 2PI2A 4R4QA 4HJ8A 3I4MG 3AFQA 2WAQE 2RCNA 2E5LQ 2RHQB 1YJWA 3PCOB 4JI6L 1VQCA 3KF6B 3PUVA 1D7QA 2VL6A 2VY3A 4LFCQ 1VQIA 4OO1G 1OXVA 4JBWA 4DV0L 3AYHB 2VUMG 3M85A 1I94Q 4P74A 2MNAA 4YY3L 2UUCQ 3T1HQ 3PIOA 4L5QA 4DAYB 4A3MG 4JBMA 4A3DG 2BH2A 1I50H 2YTVA 1KAWA 1YVCA 5E7NA 4K0KQ 5IWAQ 1S72A 3HOYH 4A75A 1N34Q 1VQDA 5JEAJ 1VQKA 3CC2A 5ELOA 4OX9Q 2KHIA 1HZ9A 3RZDH 1PH6A 4GLVB 1CSQA 1W3SA 1IYJB 3GTPH 1YITA 1N36Q 2I5MX 3CP0A 2R7DA 3I7FA 3S1QH 2VS1A 5IP7G 1EQRA 4X62L 4QQBX 3BZCA 4LWCA 1Q7YC 4JI7L 4HIKA 1XNRQ 2KHJA 1VQ7A 1G291 3TREA 4GLXA 1JJ2A 1FJGQ 4DR3L 2JA8G 1X6OA 4DV2L 1PH8A 4JI1Q 1PH4A 4AQYL 2Q2HA 4Y7NH 3OW2A 1Y1WH 3K80C 3CCQA 3A5UA 2OQKA 2C35B 1X54A 3TS2A 1H95A 1XMQL 4DKAC 3AEVA 3G48A 1XNQQ 2NVQH 3TRZA 3HOXH 1PHJA 4A3IH 2AHOB 3HOVH 2K5NA 1VQFA 3CC4A 1QZHA 3KJOA 4A3GG 1T9HA 2DUDA 1LTLA 3CPWA 4BY7G 3PUYA 1BVSA 4JBKA 1HNZQ 2Y0SE 4X64L 4Y52H 2KBNA 3HOUG 4GKJQ 4DAMA 4X66L 1Q1EA 3KDFA 1YZ6A 1HR0W 2ZM6L 1X9NA 3JAMc 4LFBL 4JC0A 1VQEA 5FJ8H 2BA1A 3M4QA 2D0PA 3TEHB 1VQ4A 4UPAA 3PUZA 5M3FG 4GNXC 1IL2A 4WJ4A 3TS0A 4OO1I 1C9OA 5JJIA 3CMEA 4JI4Q 2UXBL 1CUKA 1EOVA 4JI2Q 4DNIA 1BBWA 4YHHQ 3U4ZA 4O0AA 2CWPA 2R7ZG 4GKKQ 4KI0A 4DV6Q 1SFOH 4GN4B 1IBLQ 4R4CA 1IBMQ 1QUQA 3EIVA 3OYYA 3ZJYC 4X65Q 5LMUL 3UE1A 1HNWL 3KF8B 1U0LA 4YWMA 1GM5A 2VW9A 1JE5A 1PH5A 3T1YQ 1IBKL 4LF9L 1WOCA 2CKZB 1CSPA 3CC7A 3NEMA 4DR2Q 1M90C 3RN5A 4JI3Q 2K5VA 3K7UC 5GQOA 4DUYQ 4P73A 2R92H 4A3EH 3CXCA 4JV5Q 1N32L 4LF6L 3KDFB 2JQOA 1I3QH 3J81j 1NMGA 5JJKA 2K50A 4DR5L 3PO3H 2A1AA 4DPGA 3KJPA 4IFDG 4POGA 4KHPQ 1X3EA 1PH2A 1WJJA 2ALYB 4A3CG 5AJ3Q 3CCUA 1PA6A 3CAMA 1K8AC 2F4VL 1HJPA 4JI5Q 2PQAB 1Q12A 1OXXK 2AWOA 2DGYA 2H5XA 3E9IA 1Y1VH 3CCMA 4B3SL 2E2HH 2JEAI 2K14A 1KD1C 2VNUD 3L7ZC 3A5ZB 1EIYB 2B63G 4JG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE Q;  3S1M H;  1PV4 A;  1UWV A;  4DV4 Q;  4UP9 A;  4B3M Q;  4JI0 L;  2QGQ A;  1XMO L;  4C3I H;  5LMN Q;  2E2J H;  1X65 A;  4B3R Q;  2I5L X;  3I4M H;  4HIM A;  2VZA A;  2LXK A;  5C4X G;  4POF A;  4YWK A;  3MEF A;  4BY1 G;  1KC8 C;  4OON A;  4JYA L;  3ULJ A;  4DV7 L;  1EIF A;  1FVI A;  1Q82 C;  2KCM A;  4DUZ Q;  1GKH A;  4A3J G;  1Q8K A;  1VQ8 A;  1G6P A;  2VUM H;  4GNX A;  2JEB I;  1L1O C;  1C7Y A;  2HHH Q;  3S14 H;  1E3P A;  1PVO A;  1K0R A;  5JJL A;  1TWH H;  4LFA L;  3M9B A;  3DM3 A;  3CCJ A;  4A3M H;  4A3D H;  3DLL A;  1DGS A;  2AKW B;  4LUZ A;  4OWX B;  3OTO L;  3HOZ G;  4NXM L;  4GLA C;  5FLX c;  2UXD L;  3HOW G;  4DR6 Q;  3FP9 A;  2ZJR A;  4R4O A;  1VS0 A;  1Y14 B;  4RMF A;  5BR8 Q;  5JEA G;  2E5L L;  1MIU A;  3RZO H;  1TWG H;  5IP7 H;  5FLM G;  1HR0 L;  4LFC L;  3PF5 A;  4AH6 A;  3KLW A;  5HGQ A;  2HIV A;  1C0A A;  2Z0S A;  2PI2 E;  2UUC L;  4B3T Q;  2UU9 L;  3CPF A;  4L5T A;  3G71 A;  1QVF A;  4LF4 Q;  3H3V I;  4X6A H;  4DV0 Q;  2OCE A;  2JA8 H;  2BH8 A;  4QIW E;  3PUX A;  2JA9 A;  5IWA L;  1VQ9 A;  1YBY A;  1BKB A;  1CKO A;  2HIX A;  2I5H A;  4DV3 Q;  1N34 L;  3S17 H;  4IFD I;  2F3I A;  4OX9 L;  4HJ9 A;  3D0F A;  2PNH A;  1N36 L;  1UE7 A;  1U5K A;  2JA6 G;  4BXX G;  1JJC B;  3TQY A;  4PZ6 A;  5K36 G;  4KHZ A;  4A3G H;  4BBR G;  1UEB A;  2UUA L;  1E22 A;  2L15 A;  2ASB A;  2ZJP A;  3CCV A;  3F2B A;  3CW2 C;  3B6Y A;  1VQ5 A;  4PZ8 A;  1XNR L;  3HOU H;  5IT9 c;  1A62 A;  4YCV A;  3PV0 A;  3AQQ A;  3RR5 A;  1FJG L;  4JI7 Q;  1TWC H;  4GN5 A;  1X56 A;  5C0X J;  2UUB Q;  1W2B A;  4JI1 L;  1A63 A;  1KXL A;  1VQN A;  4GOP C;  3S24 A;  3HFZ B;  1Q86 C;  2K5H A;  1P8L A;  4R4T A;  4AQY Q;  3E0E A;  3HOY G;  1P16 A;  1O7I A;  1OTC A;  5IE8 A;  5M3F H;  1EWI A;  1XNQ L;  4DR7 Q;  1L1O A;  3H15 A;  2QA4 A;  1XMQ Q;  4HIO A;  2ZTD A;  1E24 A;  1SN8 A;  4MZ9 A;  4YWL A;  4LF7 Q;  4GS3 A;  4LUO A;  4EX5 A;  1NMF A;  4A3L G;  3I55 A;  2NZO A;  2YV5 A;  4IPD A;  4OWT B;  5IP9 G;  1X55 A;  5GRO A;  1FL0 A;  1VCI A;  1HNZ L;  1TWA H;  3BJU A;  3NEL A;  1WCM G;  2N3S A;  4TQU S;  1IZ6 A;  3K0X A;  1VQL A;  1JB7 A;  4X64 Q;  4H02 A;  4A3F G;  3CMA A;  3ICE A;  1V1Q A;  3PO2 G;  4J15 A;  3U4V A;  3JC6 6;  4C3H H;  3IRB A;  3I4N G;  4IPC A;  1LM0 A;  2ZTE A;  2MFI A;  4JOI C;  2WB1 E;  1E1O A;  3W1B A;  5GAG C;  2ZM6 Q;  4LFB Q;  3H3V H;  1WYD A;  3CCS A;  4R4I A;  3GTK H;  4JI4 L;  5C3E G;  1YEZ A;  2UXC L;  4JI2 L;  4YHH L;  1MKH A;  1PYS B;  4AIM A;  1J5E L;  3ULL A;  2ATW A;  2A19 A;  1A0I A;  2WB1 G;  3NBH B;  4DV6 L;  3K8A A;  1IBM L;  4LNQ A;  1HNX Q;  1XPO A;  5J3B A;  2AWN A;  2EQS A;  1KRT A;  4YCW A;  4X65 L;  4P71 A;  4A3B G;  4A3C H;  1I5F A;  2MO1 A;  4DR1 Q;  3GTL H;  4O2D A;  2EXD A;  5IYB G;  2JA7 G;  3J81 i;  2IT1 A;  2N49 A;  3T1Y L;  1YHQ A;  4LF8 Q;  1HNW Q;  1NE3 A;  3CF5 A;  2ID0 A;  4DR2 L;  4JI3 L;  4DUY L;  1RIP A;  1IBK Q;  3FKI G;  1WI5 A;  3L0O A;  5DLQ E;  4LF9 Q;  2B63 H;  2LXJ A;  2JK8 A;  1XPU A;  5FJ8 G;  3U58 A;  1N32 Q;  3ERS X;  1AH9 A;  1OXT A;  1YHB A;  5M3M H;  2NN6 G;  4PMW A;  4XTC S;  4KHP L;  4BY1 H;  1EYG A;  4JI8 Q;  2VQF L;  4GOP A;  1QZG A;  1VQH A;  2N78 A;  1QUQ B;  3J80 i;  5AJ3 L;  2JA5 G;  5M5X H;  4DV5 Q;  2R93 G;  4A3J H;  3Q8D A;  2Q2I A;  3KOJ A;  1D8L A;  2F4V Q;  5IYD G;  4LF5 Q;  2BA0 A;  2E2I H;  1VQ6 A;  3E9H A;  5C44 G;  1BBU A;  3UE0 A;  2HT1 A;  2Q2U A;  2VQE L;  1GVP A;  2N8N A;  3I4O A;  4DV4 L;  3HOZ H;  2IY5 B;  3CCL A;  1Z47 A;  4NPS A;  3WWV A;  3HOW H;  4A93 G;  2RF4 A;  3KF6 A;  3F1Z A;  3ULP A;  4B3R L;  3U50 C;  2K75 A;  4JI0 Q;  1XMO Q;  4DV1 L;  5FLM H;  3CCR A;  1PH9 A;  2NVY H;  4DR4 Q;  5IYC G;  4JOI A;  3S2D H;  1B8A A;  2GN5 A;  2HHH L;  3GTG H;  4QY7 A;  4XIG S;  3RLN A;  3UDG A;  3L2P A;  2FXQ A;  2MQH A;  1HZC A;  2GVA A;  2OQ0 A;  4PZ7 A;  3KYH C;  4NXN Q;  3EBE A;  1N33 Q;  2D62 A;  4YCU A;  1I6H H;  5GAD C;  4WJ3 M;  4IO9 A;  3H0G G;  4A3K G;  1YJN A;  1VQG A;  1AE2 A;  3S15 H;  3K7A H;  4JI6 Q;  4RG1 A;  1QVC A;  1I94 L;  5BR8 L;  2JA6 H;  4BXX H;  3T1H L;  2UXD Q;  4FDB A;  2WP8 J;  5H1S E;  2Q2T A;  5GAE C;  3FHW A;  4BBR H;  4BBS G;  2K4K A;  4YY3 Q;  3GDE A;  4K0K L;  2NZH A;  1YNX A;  3K81 C;  3S1R H;  2XGT A;  2YTX A;  4QJF A;  2ZTC A;  4EQ5 A;  4GNX B;  3PSI A;  3VDY A;  1HR0 Q;  2ES2 A;  3UDX A;  2OWO A;  1ASY A;  4B3T L;  4LF4 L;  2OTJ A;  1Z9F A;  2WAQ G;  4HID A;  3PIP A;  4JCV E;  4NB3 A;  2UU9 Q;  1M1K C;  2XTI A;  4DV3 L;  3F2C A;  2D0O A;  2NN6 I;  3J7A 5;  5C0X G;  4BY7 H;  1YJ9 A;  1EUJ A;  3RLO A;  3CD6 A;  2CFM A;  4IPG A;  4X62 Q;  5LMN W;  3W1G A;  1NBW A;  2Z6K A;  1IXR A;  3F8T A;  3A74 A;  4LUV A;  2HQL A;  1A8V A;  2PMZ E;  1CKM A;  1GD7 A;  4A3L H;  4QGU A;  5IP9 H;  4DR3 Q;  2EIF A;  3GTJ H;  4DV2 Q;  1KL9 A;  2UUA Q;  1KHI A;  1WCM H;  3PF4 A;  3HKZ E;  1UE6 A;  4DK6 C;  2YYZ A;  2CWA A;  2I0Q A;  2NVX H;  2UUB L;  2R6G A;  1YIJ A;  1YI2 A;  4A3F H;  4ALP A;  1VQA A;  3RNU A;  3PO2 H;  3CQZ H;  1HZB A;  3JAM i;  4KLK A;  3I4N H;  3D31 A;  2MO0 A;  3HKZ G;  3G4S A;  1K73 C;  2OTL A;  2R7Z H;  2GVB A;  1YHA A;  1SLJ A;  5EAY A;  1LYL A;  2K52 A;  4AYB E;  4DR7 L;  4GKJ L;  2V1C C;  5C3E H;  4P72 A;  4LF7 L;  4BA2 I;  1SR3 A;  2NVT H;  1VQO A;  1N8R C;  1PH7 A;  1E1T A;  1X3G A;  2JE6 I;  3BU2 A;  4X66 Q;  4AYB G;  4A3B H;  1Q1B A;  3SGI A;  1Y1W G;  4IOC A;  1B70 B;  1CKN A;  1J6Q A;  1K9M C;  3HKS A;  4APV A;  4C2M H;  5IYB H;  2JA7 H;  3M4O H;  5HY6 A;  2CQO A;  4LW1 A;  3GTQ H;  4PG3 A;  1ASZ A;  1EFW A;  3GO5 A;  4UP8 A;  1L2F A;  3HOX G;  4A3I G;  2WFW A;  1WFQ A;  4GKK L;  4L5S A;  3FKI H;  1RL2 A;  1NJI C;  3HOV G;  2Y0S G;  1IBL L;  5M5W H;  2YU9 H;  2UXB Q;  1VQP A;  1L1O B;  4OXP A;  3UDI A;  3EN2 A;  1PYB A;  1PH1 A;  2YTY A;  1SMX A;  1HZA A;  4IJH A;  2IX1 A;  1L0W A;  3BZK A;  3J7Z C;  1LUZ A;  4UY8 C;  1OXS C;  5LMU Q;  3M4P A;  2UXC Q;  2PQA A;  4MTN A;  3MXN B;  1S40 A;  4BA1 I;  1TWF H;  1TXY A;  5C4J H;  1J5E Q;  1HNX L;  2JA5 H;  4HJ7 A;  1Q46 A;  3PUW A;  4JV5 L;  2R93 H;  1HH2 P;  3UDF A;  3GD7 A;  4DR1 L;  1SRO A;  2RHS B;  1KIX A;  1XPR A;  2LSS A;  3ER0 A;  4P75 A;  5C0X I;  1EQQ A;  4LF8 L;  2QEX A;  5IY0 A;  3RN2 A;  2E8G A;  3W5O A;  5IYD H;  1B7Y B;  1X3F A;  4LF6 Q;  4IJL A;  4QL5 A;  2AMC B;  1K83 H;  3A0J A;  2R7F A;  3I2Z A;  5C4X H;  1K3R A;  5C44 H;  4HJA A;  4DR5 Q;  1CKN B;  1NTG A;  4HJ5 A;  1OXU A;  3S1N H;  2KEN A;  5GAH C;  1R9T H;  1E7Z A;  4JI5 L;  3GTO H;  4A93 H;  1NY4 A;  1QVG A;  2CCZ A;  1KQS A;  3I56 A;  2Z6K C;  1VQM A;  1V9P A;  4JI8 L;  1PH3 A;  1UE1 A;  4A76 A;  1G51 A;  3J81 c;  3CCE A;  3PGZ A;  3G6E A;  4DV5 L;  1JT8 A;  5IYC H;  2VQF Q;  1MJC A;  1SE8 A;  4B3S Q;  1V43 A;  1VQB A;  3S16 H;  1VQJ A;  2IHE A;  4B3M L;  2R92 G;  4A3E G;  5M5Y H;  4IOA A;  5LMN L;  4LF5 L;  2IX0 A;  2KCT A;  4DK3 C;  4OWW B;  3S2H H;  4IFD J;  2ZJQ A;  1GO3 E;  3KFU A;  4L5R C;  2B3G A;  3AFP A;  4IPH A;  1JMC A;  3PO3 G;  5ELN A;  2JJQ A;  1PFS A;  1XTD A;  3STB C;  1JJG A;  3H0G H;  2F52 A;  4DUZ L;  4A3K H;  3M7N A;  3J80 c;  4TVA B;  1SRU A;  1XJV A;  4DV7 Q;  4JYA Q;  1MJE A;  3RLF A;  2IHF A;  4GN3 B;  3NEN A;  1Q81 C;  5M3M G;  3LGJ A;  4GOP B;  3STB D;  1S3O A;  4DR4 L;  4BBS H;  4R1J A;  4DV1 Q;  4ME3 A;  1Y1V G;  4LFA Q;  2A8V A;  4UP7 A;  1K8G A;  3GTM H;  4A4I A;  1KRS A;  1N9W A;  3F2D A;  4MNO A;  3M3Y H;  4DR6 L;  2B29 A;  1AE3 A;  1FGU A;  3OTO Q;  4JBJ A;  4NXN L;  1N33 L;  4NXM Q;  4C3J H;  1UE5 A;  2PI2 A;  4R4Q A;  4HJ8 A;  3I4M G;  3AFQ A;  2WAQ E;  2RCN A;  2E5L Q;  2RHQ B;  1YJW A;  3PCO B;  4JI6 L;  1VQC A;  3KF6 B;  3PUV A;  1D7Q A;  2VL6 A;  2VY3 A;  4LFC Q;  1VQI A;  4OO1 G;  1OXV A;  4JBW A;  4DV0 L;  3AYH B;  2VUM G;  3M85 A;  1I94 Q;  4P74 A;  2MNA A;  4YY3 L;  2UUC Q;  3T1H Q;  3PIO A;  4L5Q A;  4DAY B;  4A3M G;  4JBM A;  4A3D G;  2BH2 A;  1I50 H;  2YTV A;  1KAW A;  1YVC A;  5E7N A;  4K0K Q;  5IWA Q;  1S72 A;  3HOY H;  4A75 A;  1N34 Q;  1VQD A;  5JEA J;  1VQK A;  3CC2 A;  5ELO A;  4OX9 Q;  2KHI A;  1HZ9 A;  3RZD H;  1PH6 A;  4GLV B;  1CSQ A;  1W3S A;  1IYJ B;  3GTP H;  1YIT A;  1N36 Q;  2I5M X;  3CP0 A;  2R7D A;  3I7F A;  3S1Q H;  2VS1 A;  5IP7 G;  1EQR A;  4X62 L;  4QQB X;  3BZC A;  4LWC A;  1Q7Y C;  4JI7 L;  4HIK A;  1XNR Q;  2KHJ A;  1VQ7 A;  1G29 1;  3TRE A;  4GLX A;  1JJ2 A;  1FJG Q;  4DR3 L;  2JA8 G;  1X6O A;  4DV2 L;  1PH8 A;  4JI1 Q;  1PH4 A;  4AQY L;  2Q2H A;  4Y7N H;  3OW2 A;  1Y1W H;  3K80 C;  3CCQ A;  3A5U A;  2OQK A;  2C35 B;  1X54 A;  3TS2 A;  1H95 A;  1XMQ L;  4DKA C;  3AEV A;  3G48 A;  1XNQ Q;  2NVQ H;  3TRZ A;  3HOX H;  1PHJ A;  4A3I H;  2AHO B;  3HOV H;  2K5N A;  1VQF A;  3CC4 A;  1QZH A;  3KJO A;  4A3G G;  1T9H A;  2DUD A;  1LTL A;  3CPW A;  4BY7 G;  3PUY A;  1BVS A;  4JBK A;  1HNZ Q;  2Y0S E;  4X64 L;  4Y52 H;  2KBN A;  3HOU G;  4GKJ Q;  4DAM A;  4X66 L;  1Q1E A;  3KDF A;  1YZ6 A;  1HR0 W;  2ZM6 L;  1X9N A;  3JAM c;  4LFB L;  4JC0 A;  1VQE A;  5FJ8 H;  2BA1 A;  3M4Q A;  2D0P A;  3TEH B;  1VQ4 A;  4UPA A;  3PUZ A;  5M3F G;  4GNX C;  1IL2 A;  4WJ4 A;  3TS0 A;  4OO1 I;  1C9O A;  5JJI A;  3CME A;  4JI4 Q;  2UXB L;  1CUK A;  1EOV A;  4JI2 Q;  4DNI A;  1BBW A;  4YHH Q;  3U4Z A;  4O0A A;  2CWP A;  2R7Z G;  4GKK Q;  4KI0 A;  4DV6 Q;  1SFO H;  4GN4 B;  1IBL Q;  4R4C A;  1IBM Q;  1QUQ A;  3EIV A;  3OYY A;  3ZJY C;  4X65 Q;  5LMU L;  3UE1 A;  1HNW L;  3KF8 B;  1U0L A;  4YWM A;  1GM5 A;  2VW9 A;  1JE5 A;  1PH5 A;  3T1Y Q;  1IBK L;  4LF9 L;  1WOC A;  2CKZ B;  1CSP A;  3CC7 A;  3NEM A;  4DR2 Q;  1M90 C;  3RN5 A;  4JI3 Q;  2K5V A;  3K7U C;  5GQO A;  4DUY Q;  4P73 A;  2R92 H;  4A3E H;  3CXC A;  4JV5 Q;  1N32 L;  4LF6 L;  3KDF B;  2JQO A;  1I3Q H;  3J81 j;  1NMG A;  5JJK A;  2K50 A;  4DR5 L;  3PO3 H;  2A1A A;  4DPG A;  3KJP A;  4IFD G;  4POG A;  4KHP Q;  1X3E A;  1PH2 A;  1WJJ A;  2ALY B;  4A3C G;  5AJ3 Q;  3CCU A;  1PA6 A;  3CAM A;  1K8A C;  2F4V L;  1HJP A;  4JI5 Q;  2PQA B;  1Q12 A;  1OXX K;  2AWO A;  2DGY A;  2H5X A;  3E9I A;  1Y1V H;  3CCM A;  4B3S L;  2E2H H;  2JEA I;  2K14 A;  1KD1 C;  2VNU D;  3L7Z C;  3A5Z B;  1EIY B;  2B63 G;  4JG2 A; 
#chains in the Genus database with same CATH topology
 3S1M H;  4CKB A;  1GOZ A;  1KDC A;  1QG7 A;  1WVL A;  1K0S A;  2BDO A;  2LS0 1;  2LKV A;  4HIM A;  2VZA A;  5JOB A;  3I4M H;  3K5L A;  5M3M B;  4BY1 G;  1EY7 A;  4DV7 L;  1EIF A;  4BY1 B;  1Q82 C;  4RGN A;  3EFX D;  2EYO A;  2XWB B;  2HHH Q;  3DM3 A;  3CCJ A;  3DLL A;  2ZXO A;  2AKW B;  3OIQ A;  3N6R A;  3A8I E;  5FLX c;  1BBX C;  2J7Z A;  3HOW G;  3QO2 A;  3VYT A;  4FXK C;  3HOW B;  3VR3 A;  2E5L L;  2XN9 C;  3RZO H;  5FLM G;  1CM9 A;  4XXE A;  1HR0 L;  4AH6 A;  3T16 A;  1BCP D;  1A3V A;  1PXU A;  2QEJ C;  3TZU A;  1IW7 C;  3G71 A;  4LF4 Q;  4DV0 Q;  3OMG A;  2O5J C;  4IN3 A;  4DV3 Q;  1CKO A;  4HJ9 A;  1M8A A;  5C3X A;  1KLG D;  5EPK A;  3D0F A;  2M2L A;  2PNH A;  1UE7 A;  1F2L A;  1U5K A;  2JA6 G;  1NCV A;  3KLS A;  3TQY A;  1GUW A;  2JA6 B;  5C6A A;  5E4X A;  2ASB A;  3Q24 A;  4TKO B;  4PZ8 A;  3S17 B;  3K0Y A;  4YCV A;  4DF7 A;  4JI7 Q;  1UAP A;  5C0X J;  2UUB Q;  1W2B A;  4JI1 L;  4XQN A;  1H9R A;  3FVQ A;  5G3L F;  5KYL A;  4EVO A;  4JVZ A;  5DAU A;  3MXG A;  3E0E A;  3HOY G;  1JOR A;  2FMM A;  1NR4 A;  1EWI A;  3H15 A;  2RBM A;  4GS3 A;  2YV5 A;  5I9O A;  1STG A;  1X55 A;  1HNZ L;  1EEF D;  3BJU A;  3NEL A;  1WCM G;  2N3S A;  1GUO A;  1WCM B;  1SJH D;  3ICE A;  4C3H H;  3BYY B;  3CQZ B;  3D4W A;  3H3V H;  3ND9 A;  3CCS A;  2F0E A;  4R4I A;  3GTK H;  4AIM A;  1J5E L;  1EY5 A;  1JQY D;  3NP8 A;  4DV6 L;  2WB1 G;  3NBH B;  1LT5 D;  2NVT B;  2CHB D;  1HNX Q;  3H6M A;  2WB1 B;  2EQS A;  2KHS A;  2MP1 A;  2NWG A;  4YCW A;  4HED A;  1JE4 A;  2Z8L A;  3QWN A;  2N49 A;  3T1Y L;  4C2M B;  3M4O B;  1KAA A;  3QOL A;  1LT4 D;  1XTC D;  1RIP A;  2EZV A;  5DLQ E;  3C46 A;  2JK8 A;  1GHJ A;  5M5W B;  1N32 Q;  1AH9 A;  3H94 A;  3NTH A;  5M3M H;  2NN6 G;  4X3T A;  4BY1 H;  2VQF L;  2J4X A;  4GOP A;  1A3U A;  1VQH A;  5EQ0 A;  3J80 i;  1QUQ B;  4DV5 Q;  2R93 G;  2O2L D;  3RD4 A;  2R93 B;  3X3N A;  5IYD G;  5CV5 A;  3E9H A;  1BBU A;  4FF4 A;  2Q2U A;  2IY5 B;  3CCL A;  1ENF A;  3HOW H;  3KF6 A;  4HTH A;  2KEE A;  1VF5 C;  1R9T B;  1D6E C;  2K75 A;  5DEH A;  1C4Q A;  4A3J B;  4DV1 L;  1XMO Q;  1AW7 A;  3R2T A;  5FLM H;  1PH9 A;  3R2I A;  5KEE A;  2F0H A;  3BVZ A;  4P2C B;  4QY7 A;  4XIG S;  4DNR B;  3RLN A;  3L2P A;  2FXQ A;  4DXG A;  4PZ7 A;  2L5T A;  5M5Y B;  4NXN Q;  1N33 Q;  3TP8 A;  1I6H H;  4K8I A;  4CDE C;  1EY6 A;  1K28 A;  3FEW X;  1VQG A;  1AE2 A;  3PIP 3;  4JI6 Q;  4UAI A;  1QVC A;  4UHV A;  1U4P A;  1I94 L;  4DA2 A;  4M8A A;  2JA6 H;  3S2D B;  1KDA A;  3T1H L;  2X69 A;  2OEO A;  1TKW B;  2Q2T A;  3CHB D;  3EQL C;  2B2W C;  1JOK A;  3H09 A;  3K81 C;  1YNX A;  2YTX A;  4EQ5 A;  4GNX B;  4B3T L;  3GTM B;  5IGF A;  1AZQ A;  3PIP A;  4NB3 A;  2XTI A;  1QB5 D;  1DYQ A;  3TME A;  1EUJ A;  3CD6 A;  2CFM A;  4IPG A;  2LMC B;  4RWS C;  2Z6K A;  1DOK A;  1A8V A;  1CKM A;  2F0O A;  1Z6H A;  3VYR A;  1BXT A;  2EIF A;  4DV2 Q;  1CT1 D;  1WCM H;  5I6W A;  4DK6 C;  1UE6 A;  2TSS A;  2YYZ A;  5C4H A;  2CWA A;  2I0Q A;  2VB2 X;  1YIJ A;  4ALP A;  5ELF A;  3CQZ H;  3JAM L;  3RZD B;  1LTA D;  5DNF A;  3D31 A;  2IW3 A;  5CBA E;  1SLJ A;  5EAY A;  2IWH A;  4DR7 L;  3DXJ C;  4GKJ L;  2B8F A;  1ZXT A;  2NVT H;  1PH7 A;  1B2T A;  3T51 B;  3BU2 A;  4A3F B;  4KY6 A;  4PV1 C;  3OOC A;  3FDT A;  1TT2 A;  4IOC A;  1CKN A;  1J6Q A;  4C2M H;  3M4O H;  4Y7N B;  2CQO A;  1S5D D;  3BVG A;  1PYW D;  4PG3 A;  1EFW A;  3GO5 A;  3LWU A;  4EGV A;  4X3S A;  4L5S A;  5J22 A;  1IBL L;  5M5W H;  2YU9 H;  2KEC A;  1UUP A;  2ICI A;  3MWY W;  1PH1 A;  1PYB A;  1HZA A;  2NN6 H;  1LUZ A;  3J81 L;  2JA7 B;  4BA1 I;  1TXY A;  5C4J H;  2DNC A;  4N9P A;  1R4P B;  3I4L A;  3PUW A;  3WOE A;  4HJ7 A;  4JV5 L;  1HH2 P;  2R93 H;  1KNE A;  4L63 B;  1SRO A;  2RHS B;  1VMC A;  1KIX A;  3ER0 A;  1EQQ A;  3URY A;  3BYT B;  2XRQ D;  1CI3 M;  1O78 A;  3RN2 A;  2RDH A;  5IYD H;  4LF6 Q;  4IJL A;  5FKA C;  1PZI D;  1PTO F;  2F0T A;  1K3R A;  4N8X 1;  3QIA A;  2KEN A;  5GAH C;  4ZLT F;  1R9T H;  2QW7 A;  1E7Z A;  1II3 A;  2L1B A;  2SEB D;  4V0B A;  3GTO H;  3HS0 C;  2J0T D;  1QVG A;  3I56 A;  1PFB A;  4A76 A;  3J81 c;  3PGZ A;  1WTW A;  1V43 A;  1VQB A;  5C44 B;  2R92 G;  5M5Y H;  5LMN L;  1CK1 A;  2R92 B;  4OWW B;  4IFD J;  3AFP A;  4IPH A;  4CHT B;  3PO3 G;  2EXZ A;  2JJQ A;  1F9R A;  1PFS A;  1XTD A;  1JJG A;  3PO3 B;  1S5C D;  1SRU A;  3GV3 A;  3TP6 A;  5D3I B;  4H13 C;  1HRJ A;  3LGJ A;  4IZ8 A;  3RMH A;  1CZG A;  3S2H B;  1R4Q B;  2WII B;  3QG1 A;  1JIC A;  4XYQ A;  3GTM H;  3BDC A;  1GUN A;  3M3Y H;  2E2H B;  2B29 A;  1AE3 A;  1B44 D;  4A3K B;  4C3I G;  4M1U B;  4R4Q A;  5FK9 C;  3OSO A;  3CRL C;  3AFQ A;  2WAQ E;  4H7B A;  4OL7 A;  1U9R A;  3VYS A;  1YJW A;  2SNS A;  1VQC A;  3PUV A;  1LTG D;  2VL6 A;  4LFC Q;  4U67 3;  3QOJ A;  3Q23 A;  2PW5 A;  4OGQ C;  1CQF A;  2VUM G;  4KJO A;  4DGZ A;  2WIN B;  1SYE A;  3GV6 A;  3A7A B;  4JBM A;  4A3D G;  4FP5 D;  2BH2 A;  1I50 H;  2F03 A;  1S72 A;  3V05 A;  4A75 A;  1N34 Q;  5JEA J;  5COR A;  4OX9 Q;  2KHI A;  1HZ9 A;  3RZD H;  1EY9 A;  1W3S A;  1IYJ B;  1ZYR D;  2F0G A;  4U68 A;  5TSS A;  1YIT A;  2I5M X;  3BZC A;  1Q7Y C;  1CHP D;  5IT9 E;  3C2P A;  3TN2 A;  1A15 A;  3T13 A;  1X6O A;  1PH8 A;  1RTO A;  4Y7N H;  3CCQ A;  1FR3 A;  2C35 B;  1G2T A;  3TS2 A;  1H95 A;  3AEV A;  2PZW A;  4K8J A;  4B08 A;  2BDN A;  2B2Y A;  1AEX A;  4ZUJ A;  3CPW A;  5EBC A;  4ZUI A;  1HUM A;  1BQQ T;  1TVX A;  4X66 L;  1PFN A;  1Q1E A;  1JC7 A;  1X9N A;  4LFB L;  4JC0 A;  4GZY C;  2PZU A;  2Y0S B;  4HAE A;  1S5F D;  3M4Q A;  3PUZ A;  5M3F G;  4WJ4 A;  3F2U A;  4OO1 I;  1C9O A;  2R3Z A;  1EOV A;  4JI2 Q;  4YHH Q;  2QCP X;  3RUZ A;  3K6O A;  1IBM Q;  1QUQ A;  3EIV A;  3H91 A;  2WKD A;  1TWA B;  1ICF B;  3KF8 B;  3WDN A;  2FJ2 A;  4R9W A;  1IBK L;  4LF9 L;  1WOC A;  1M90 C;  4HR7 B;  4JI3 Q;  1SE2 A;  4XYO A;  2R92 H;  4PMB A;  5KGU A;  3G6J B;  5I2X A;  5JJK A;  1NMG A;  1BNZ A;  4ZCK A;  1C48 A;  4DR5 L;  1I6V C;  2EY5 A;  3PO3 H;  4O1N A;  4K5V A;  2NUC A;  4POG A;  1X3E A;  1PH2 A;  4KHP Q;  4QUC A;  2G5D A;  4A3C G;  3CCU A;  3SR1 A;  3FPP A;  3HRZ C;  1OXX K;  5BN4 A;  1YNJ D;  3E9I A;  2H5X A;  4Z9C B;  2F0V A;  1I3Q B;  1PRT F;  2E2H H;  2BCO A;  5FO7 B;  1KD1 C;  3L7Z C;  1GUT A;  2B63 G;  4JG2 A;  1EFI D;  2VQE Q;  1XWE A;  1PV4 A;  3K59 A;  4DV4 Q;  2B63 B;  4JI0 L;  3M7G A;  4C3I H;  5DM6 3;  4B3R Q;  2I5L X;  2K01 A;  5C4X G;  1KC8 C;  3MEF A;  4RH6 A;  3O13 A;  1PZJ D;  4OON A;  1Y1V B;  2KCM A;  4DUZ Q;  1Q8K A;  5M5X B;  2VUM H;  4GNX A;  1C7Y A;  4YIJ A;  2K5D A;  4A3D H;  1DM0 B;  5CV8 A;  2E2I B;  1IL8 A;  3I4M B;  3CRK C;  5FO8 B;  3OTO L;  4NXM L;  4GLA C;  1K3B C;  4DR6 Q;  2F0F A;  1TS4 A;  1BCP C;  4R4O A;  1VS0 A;  5M9O A;  1B1Z A;  1KAB A;  1TWG H;  4DAP A;  1XXG A;  3PF5 A;  3KLW A;  5HGQ A;  4PMC A;  3NWS A;  2PI2 E;  2UUC L;  2UU9 L;  1QVF A;  3D6W A;  2BH8 A;  2F0J A;  2A6E D;  2EY1 A;  2JA9 A;  5IWA L;  2L55 A;  1HQR D;  1BKB A;  1YBY A;  3E0J A;  4DU9 A;  4KK7 A;  1SNO A;  3RZO B;  4BXX G;  1MSG A;  4QIW B;  2M9V A;  1HA6 A;  1UEB A;  2NYZ D;  4BWG B;  3B6Y A;  3IL8 A;  1HXY D;  4J8Q A;  3PV0 A;  2AQ2 B;  1TWC H;  4GN5 A;  1PTO B;  3VR5 A;  1MSH A;  1J8I A;  1KXL A;  2EE1 A;  4X3U A;  4GOP C;  3S24 A;  1Q86 C;  2F0K A;  4FXG C;  5AFW A;  3P7J A;  4R4T A;  3A8J E;  4ZQ3 A;  1O7I A;  2DJF C;  5M3F H;  2QA4 A;  3IFD A;  1XMQ Q;  5G3L D;  1SN8 A;  2K32 A;  4LUO A;  1NMF A;  4CJ2 C;  3ITP A;  1I4G A;  3EA6 A;  1FL0 A;  5GRO A;  1TWA H;  1IZ6 A;  3K0X A;  1LTB D;  1JB7 A;  4X64 Q;  2KVM A;  3KLS X;  4K5X A;  3T53 B;  3X3M A;  3SK8 A;  3VA7 A;  2PZT A;  2OT2 A;  4CKE A;  5GAG C;  4Q0F A;  2ZM6 Q;  1E1O A;  1FYC A;  3L3O C;  2R7Z B;  4HSV A;  3ZYY X;  4JI4 L;  5C3E G;  1YEZ A;  3K5O A;  4JK1 C;  4CJ1 B;  1BF4 A;  3ULL A;  2ATW A;  3V2T A;  2A19 A;  1A0I A;  3OWF A;  1B9N A;  1XPO A;  4A3C H;  5KRU A;  1KRT A;  4X65 L;  4P71 A;  1I5F A;  4PNY A;  3NE5 B;  4C3H B;  1L0Y B;  5IYB G;  1I4X A;  1YHQ A;  4LF8 Q;  1HNW Q;  3DUZ A;  2ID0 A;  3GTK B;  4DR2 L;  1F9Q A;  4EQN A;  3MHB A;  4DUY L;  5EKK A;  1X3Q A;  3MTS A;  2K6A A;  2B63 H;  2LXJ A;  3OIP A;  2F0S A;  4N8F A;  4EQP A;  3SXH A;  4XTC S;  5CV7 A;  1EYG A;  1QZG A;  1B9M A;  5AJ3 L;  2JA5 G;  5M5X H;  5FO9 B;  1TWF B;  3Q8D A;  2JA5 B;  4LF5 Q;  2E2I H;  5IGD A;  1UNS A;  3Q22 A;  1A2U A;  2CH4 A;  2N8N A;  3NTK A;  1CZW A;  2EYH A;  4NPS A;  4A93 G;  5DM7 3;  2RF4 A;  1NSN S;  5JJZ A;  1TQO A;  3CCR A;  4DR4 Q;  3ND8 A;  5D65 A;  1FNU A;  3IKJ A;  2MJ8 A;  4JPB W;  2HHH L;  3GTG H;  3P20 A;  1B3A A;  2OQ0 A;  2MQH A;  2GVA A;  1X3P A;  3QR8 A;  2D62 A;  4UDU C;  4IO9 A;  2MHV A;  1YJN A;  3S15 H;  4BXX H;  4FDB A;  5H1S E;  3Q6S A;  4H44 C;  2K4K A;  4YY3 Q;  3NPP A;  3CKI B;  1CA6 A;  1HR0 Q;  1FD7 D;  1I6H B;  3PSI A;  1PTO H;  2OTJ A;  3R3O A;  4LF4 L;  1Z9F A;  2WAQ G;  2X6L A;  4HID A;  4DV3 L;  1HPC A;  2D0O A;  3J7A 5;  1ROD A;  3MEH A;  4H0L C;  3W2D A;  1HTP A;  2HDL A;  4X62 Q;  4XQQ A;  2CH4 W;  4B9X A;  3TSS A;  2HQL A;  2NB0 A;  5CV9 A;  1MD2 D;  4DR3 Q;  3I70 A;  1KL9 A;  1T5X D;  2KCN A;  2UUB L;  3HOY B;  1VQA A;  1ET6 A;  3RNU A;  1QOH A;  1G6Z A;  4KLK A;  3K5N A;  1YNN C;  3HKZ G;  1CFM A;  2R7Z H;  3GTP B;  1YHA A;  3HKZ B;  2EJG C;  4AYB E;  2Z4H A;  1G91 A;  3SK5 A;  5C3E H;  2F1M A;  4P72 A;  1SR3 A;  1VQO A;  1PRT B;  1GUG A;  1E1T A;  1X3G A;  2JE6 I;  3KF8 A;  1Y1W G;  5HGT A;  4APV A;  2DN8 A;  1V1O A;  5IYB H;  1LTT D;  1Y1W B;  5CC4 A;  4TRD A;  2D2C C;  4GKK L;  2NVQ B;  1RL2 A;  1CTM A;  4KN7 C;  4WFN 3;  1L1O B;  3EN2 A;  3MXU A;  2YTY A;  2IX1 A;  3I90 A;  4PQX A;  2C9O A;  4MTN A;  3DM1 A;  1TWF H;  2B2T A;  2A68 D;  1J5E Q;  1HNX L;  2JA5 H;  1GHK A;  3HG9 A;  3E6Z X;  4OEM B;  5C0X I;  2YU9 B;  3W5O A;  1X3F A;  3VR6 A;  4QL5 A;  2AMC B;  2DJG C;  1JWM D;  3A0J A;  1RF2 D;  4HJA A;  1NTG A;  2IX3 A;  3NBI A;  1ILQ A;  4HCS A;  1HTL D;  4JI5 L;  5C4J B;  4A93 H;  3A55 A;  3OW7 A;  2CCZ A;  1T5E A;  1PTO D;  1ZKO A;  2QKI C;  3CCE A;  4O42 A;  2WKC A;  4DV5 L;  1JT8 A;  2NTT A;  2VQF Q;  4B3S Q;  1VQJ A;  3BDL A;  3J80 E;  4B3M L;  1TY0 A;  3D8G A;  1H9S B;  2IX0 A;  1GO3 E;  3KFU A;  3GTO B;  5I4D A;  2F0M A;  2F3V A;  4KV6 A;  4E6I A;  4JYA Q;  3EJI A;  4K6L A;  2IHF A;  2Q8R E;  3NEN A;  4KKS A;  3DEO A;  3STB D;  4R1J A;  2B2Y C;  4DV1 Q;  4ME3 A;  4LFA Q;  4IUV A;  1K8G A;  2WV6 D;  4A4I A;  4KHV A;  5FLX E;  1TY2 A;  2K03 A;  4OIK A;  4NXN L;  1QJO A;  4LJZ C;  1N33 L;  3FRP B;  4RGO S;  5KND A;  2E2J B;  2RCN A;  1SYB A;  2HCC A;  2K7V A;  4JI6 L;  2VY3 A;  4OO1 G;  1EYD A;  1WTO A;  3M3Y B;  1I94 Q;  4P74 A;  1SNQ A;  2MNA A;  2EYP A;  3T1H Q;  3S14 B;  2LY7 A;  4DAY B;  1TWH B;  3V96 A;  1ZYR C;  1KDB A;  1D1K A;  2PNR C;  1V8Q A;  1L0X B;  1AFP A;  3HOY H;  2D5D A;  2EPB A;  5IT9 L;  3I3C A;  1BOS A;  5ELO A;  2N88 A;  2RSN A;  4FNF A;  1RDP D;  3GTP H;  1N36 Q;  2CQA A;  3CP0 A;  1HUN A;  1STH A;  2B2U A;  1EQR A;  3OHX C;  4LMQ D;  4LWC A;  3NWT A;  1CA5 A;  3AB9 A;  1W6K A;  4FF1 A;  3K58 A;  1I50 B;  1H9K A;  1PFM A;  5JVH 3;  1XNR Q;  1VQ7 A;  1G29 1;  4GLX A;  1FJG Q;  1F2Z A;  2EOT A;  4DV2 L;  2K5Q A;  1B4O A;  4AQY L;  2Q2H A;  3OW2 A;  1Y1W H;  5KIX A;  3DHQ A;  1BO0 A;  2VXW A;  4DKA C;  1XNQ Q;  1EZ8 A;  2NVQ H;  2AHO B;  1VQF A;  1SJE D;  3K57 A;  3KJO A;  4A3G G;  4BY7 G;  3PUY A;  1WTV A;  4JBK A;  4A3G B;  3HOU G;  3NQI A;  4DAM A;  4GKJ Q;  2AUJ D;  1HR0 W;  3JAM c;  4ZKB B;  1RCV D;  3BZD B;  1VQ4 A;  4GNX C;  3TS0 A;  4G4K A;  4N9T A;  2JYO A;  4O0A A;  2BE5 D;  2CWP A;  4ZK9 B;  4GN4 B;  1IBL Q;  4R4C A;  3OYY A;  4CKC A;  1Y8N B;  4LK1 C;  1ET9 A;  1BUV T;  1EIH A;  1SYC A;  1JE5 A;  5KNB A;  2I07 B;  1PH5 A;  1ILP A;  5I2Y A;  4I7Z C;  4JV5 Q;  5GQO A;  4P73 A;  4LF6 L;  3KDF B;  1JWU D;  1LLR D;  1DCZ A;  1SMY D;  2K50 A;  1LTI D;  1O7Y A;  4QCL A;  4DPG A;  3KJP A;  1I4P A;  1YNJ C;  5LHY 1;  1HHV A;  2RVL A;  1PA6 A;  2F4V L;  4CDD C;  2PQA B;  1Q12 A;  3LNN A;  3MXP A;  2E2D C;  2OF1 A;  3CCM A;  4IUP A;  5FOB B;  1D5Z C;  2VNU D;  1EIY B;  5EBD A;  4ID6 A;  4UP9 A;  2GA4 B;  5LMN Q;  2E2J H;  1X65 A;  2F0Q A;  1PRT D;  2LXK A;  4R8N A;  4YWK A;  3I8Z A;  5BN5 A;  1F2Y A;  4OO1 H;  1SXT A;  1PVO A;  2JEB I;  3S14 H;  5JJL A;  1E3P A;  1K0R A;  1TWH H;  1PLF A;  2QDL A;  4C3I B;  4CJ0 B;  3J7Y W;  1HCZ A;  2RA4 A;  4LUZ A;  2F0P A;  4OWX B;  3D6C A;  2UXD L;  3FP9 A;  2EYM A;  4FVM A;  1Y14 B;  5BR8 Q;  4RMF A;  4V19 0;  2VUM B;  5HUR A;  2F0D A;  3HP3 A;  4LFC L;  1SEB D;  2A6E C;  4A3D B;  3MC0 B;  2K1B A;  1C0A A;  1F9P A;  4L5T A;  2G9H D;  3ONA B;  1TS2 A;  3UI2 A;  2HIX A;  1N34 L;  1C8C A;  3IFT A;  4IFD I;  2F3I A;  4OX9 L;  1TWG B;  2EDG A;  1FGB D;  5K36 G;  1E2W A;  4PZ6 A;  4KHZ A;  4A3G H;  4RCO A;  2UUA L;  2L15 A;  5ELE A;  1VDZ A;  3CW2 C;  3S1R B;  3HOU H;  1A62 A;  1DD2 A;  3RR5 A;  1QWY A;  5JAV A;  2C5C A;  1A63 A;  2L4N A;  2E76 C;  2NBF A;  4QB4 A;  3TP5 A;  3HFZ B;  1P8L A;  3M4Y A;  1CHQ D;  1D1I A;  3NBH A;  1P16 A;  1D5X C;  1OTC A;  1L1O A;  2QF7 A;  3NSW A;  2ZTD A;  1E24 A;  4MZ9 A;  1XX8 A;  4YWL A;  4LF7 Q;  4EX5 A;  2EY6 A;  3OMC A;  1TWC B;  3Q0A A;  1JWS D;  2NZO A;  2QDB A;  4OWT B;  4IPD A;  2RCF A;  4RGM A;  4A3L G;  1VCI A;  4KKU A;  1Q8I A;  4TQU S;  3GTJ B;  1MGS A;  2DNE A;  4L8J A;  1V1Q A;  5M3F B;  2ZT9 C;  1Y8O B;  3HZX A;  3JC6 6;  2AQ1 B;  2F3W A;  4IPC A;  5CV6 A;  2DY7 A;  2MFI A;  2WB1 E;  4LFB Q;  1SAP A;  1WYD A;  2IPK D;  4XQJ A;  4S3S A;  3I91 A;  4DK0 A;  3TP7 A;  2UXC L;  4JI2 L;  4YHH L;  1PYS B;  4MN3 A;  3CU7 A;  3K8A A;  1IBM L;  5J3B A;  4A3B G;  5CBE E;  4DR1 Q;  2HD3 A;  3GTL H;  4A3B B;  2EXD A;  5IGE A;  3J81 i;  2IT1 A;  1H9S A;  4LAA A;  1NE3 A;  1AN8 A;  2L9H A;  3QB3 A;  3TBI B;  3GTQ B;  1XYI A;  4JI3 L;  1IBK Q;  3L0O A;  1U4L A;  4LF9 Q;  3KLR A;  5FJ8 G;  3T56 B;  3U58 A;  1YHB A;  3IAY A;  3J81 E;  4KHP L;  2A6H D;  4JI8 Q;  4HMJ A;  3NUC A;  4TSS A;  2B2V A;  2Q2I A;  1PMR A;  1QIL A;  1LAB A;  4WOR A;  5EJW A;  3TZD A;  1HA5 A;  5ELD A;  4G7O C;  3UE0 A;  2HT1 A;  2VQE L;  3WOF A;  1K83 B;  1GVP A;  2RQX A;  4DV4 L;  1WTP A;  5C4X B;  1Z47 A;  3WWV A;  5LL6 X;  2CVR A;  4B3R L;  3F1Z A;  4WRD A;  1TII D;  4JI0 Q;  1STA A;  1TS3 A;  2NZ1 D;  2R61 A;  2B39 A;  5IYC G;  4DAY A;  4JOI A;  5IGC A;  1B8A A;  1NUC A;  4CBV A;  3GQB A;  3UDG A;  4DFA A;  1WD0 A;  3S16 B;  1QNU A;  1IYV A;  3KYH C;  3BS1 A;  1RTN A;  4B9W A;  4WJ3 M;  4FF2 A;  1ONL A;  1BDO A;  2OXP A;  4RG1 A;  5E3F A;  1A6X A;  2DY8 A;  2WP8 J;  3GTG B;  5T1I A;  1ENA A;  4NDX A;  4RFB A;  4R8I A;  3GDE A;  4K0K L;  3VR2 A;  3S1R H;  2XGT A;  4DXF A;  2OWO A;  5IIF A;  4RKB A;  2A73 B;  1ASY A;  3J7A F;  1LV9 A;  3S15 B;  2UU9 Q;  1M1K C;  2SOB A;  2B2T C;  3F2C A;  2M00 A;  5C0X G;  1YJ9 A;  3RLO A;  2KJX A;  5LMN W;  1EIG A;  4BS9 A;  3W1G A;  1NBW A;  1IXR A;  2JXM B;  1Q3L A;  2X6G A;  1GD7 A;  4A3L H;  1EL0 A;  3T4A C;  4NW2 A;  3GTJ H;  1VMP A;  1I4R A;  1KHI A;  5KNC A;  2FHT A;  2R6G A;  1YI2 A;  1PZK D;  2SDF A;  1MBY A;  3G4S A;  2H1E A;  1O7L A;  4RA8 A;  3S1Q B;  1F2M A;  1WTR A;  5CR3 A;  3SDZ A;  4A3B H;  1Q1B A;  2RSO A;  5CGK A;  1K9M C;  3D4D A;  3HKS A;  5HY6 A;  4LW1 A;  1SNM A;  3GTQ H;  1L2F A;  5C3E B;  4A3I G;  1JR0 D;  1NJI C;  2UXB Q;  4XT3 B;  1S4Z A;  2A68 C;  4OXP A;  1F77 A;  1SMX A;  4IJH A;  1Y8P B;  1EY0 A;  3BZK A;  4UY8 C;  5LMU Q;  3NK9 A;  2HQE A;  2PQA A;  1WTX A;  3MXN B;  4K2L A;  5E4W C;  5J39 A;  5A35 A;  4F8M A;  1Q46 A;  3GD7 A;  4F87 A;  4HMI A;  5EGT A;  1I4Q A;  2LSS A;  4LF8 L;  2QEX A;  2EJF C;  2E8G A;  1B7Y B;  1M4V A;  1K83 H;  4HCE A;  5C4X H;  3I2Z A;  1PTO C;  1CKN B;  3J80 L;  4RKL A;  1NY4 A;  1SFO B;  2VB3 X;  1KQS A;  1JB3 A;  2Z6K C;  1VQM A;  3MA2 B;  2EJM A;  1PH3 A;  1G51 A;  1F9S A;  3G6E A;  1X32 A;  4FXD A;  5IYC H;  3DWA A;  1A2T A;  1MJC A;  1SE8 A;  3S16 H;  4ME5 A;  4NKL A;  4A3E G;  4LF5 L;  4DK3 C;  2ZJQ A;  4A93 B;  4L5R C;  3STB C;  2F52 A;  3M7N A;  2PO4 A;  3J80 c;  5FLX L;  1XJV A;  4DV7 Q;  1IYU A;  1DJR D;  3RLF A;  1Z7T A;  5M3M G;  4DR4 L;  1B53 A;  3A8K E;  2V4D A;  4IAL A;  1E0B A;  4UP7 A;  2E75 C;  2Z9H A;  1KRS A;  1N9W A;  1Q90 A;  4JBJ A;  2KQ3 A;  3H3V C;  2E5L Q;  5C0X H;  3PCO B;  2KCC A;  1D7Q A;  1PDQ A;  1VQI A;  1OXV A;  2FIN B;  1RHP A;  4DV0 L;  4YY3 L;  4L5Q A;  2HDM A;  2WAQ B;  1GJX A;  4A3M G;  1HFN A;  1U4M A;  1YVC A;  5E7N A;  4A3M B;  1D5M C;  2EYJ A;  1LAC A;  1QNK A;  4J6H A;  4GLV B;  4IUT A;  2R7D A;  3I7F A;  3S1Q H;  5IP7 G;  4X62 L;  4XT1 B;  4JI7 L;  1B50 A;  1SSO A;  4HIK A;  2KHJ A;  3NHH A;  2PMZ B;  4DR3 L;  2JA8 G;  4JI1 Q;  2JA8 B;  1SE4 A;  3VR4 A;  1KLU D;  3K80 C;  2KUM A;  2L12 A;  1X54 A;  3D3R A;  2K04 A;  3G48 A;  3TRZ A;  1H9M A;  4A3I H;  5EPL A;  2EVB A;  2HUG A;  2K5N A;  5A2Q E;  1QZH A;  1T9H A;  2DUD A;  1BVS A;  2Z6B A;  3SK4 A;  1HNZ Q;  2Y0S E;  4Y52 H;  2KBN A;  4I7A A;  1JCK B;  2EYL A;  1EYA A;  3KK7 A;  4G57 A;  3E5S A;  1YZ6 A;  2BOS A;  4K5W A;  1B3Q A;  2AUK A;  2BE5 C;  4KD3 A;  2A74 C;  4HSP A;  4KD4 A;  3R93 A;  5JJI A;  3CME A;  1CUK A;  3U9S A;  4GKK Q;  1Y69 U;  4KI0 A;  4DV6 Q;  4RCN A;  2CW0 D;  3MZ5 A;  1SFO H;  3ZJY C;  3C3L A;  4G7Z C;  3P1H A;  1U0L A;  1GM5 A;  1IKL A;  1SMY C;  3KBX A;  3T1Y Q;  2F0N A;  4QUF A;  1CSP A;  4JW0 A;  3NEM A;  2K5V A;  1N32 L;  4A3E H;  3CXC A;  2IJ0 A;  1DOL A;  1SNC A;  4DN4 M;  4RHS A;  1LO5 D;  1EU3 A;  5I9P A;  5JPM C;  4IFD G;  4J1M A;  1EEI D;  2ALY B;  2EYF A;  2JP1 A;  1K8A C;  4JI5 Q;  2Q8I B;  1STB A;  2AWO A;  1STN A;  4B3S L;  2JEA I;  1PRT C;  1UWV A;  4B3M Q;  2QGQ A;  3PQI A;  1XMO L;  1EY4 A;  3TDQ A;  1EU4 A;  2A69 D;  5JPN C;  4ILW A;  4POF A;  3MVV A;  1J9O A;  3ULJ A;  4JYA L;  1FVI A;  4CDF C;  1GKH A;  4ZKC B;  1SE3 A;  4A3J G;  2EY2 A;  1VQ8 A;  1G6P A;  2L0C A;  1L1O C;  1HFG A;  3GP7 A;  4LFA L;  2KA7 A;  3M9B A;  2QIL A;  4A3M H;  2PPB C;  3NQT A;  4NMZ A;  1DGS A;  4K14 A;  2ZXP A;  2F0U A;  3HOZ G;  2PYK A;  1BCP F;  3HOZ B;  5I6Y A;  4QMG A;  4ZYS A;  2ZJR A;  5JEA G;  1RKN A;  1MIU A;  3NTI A;  4FF3 A;  5IP7 H;  1I4H A;  2NVY B;  1KNA A;  2HIV A;  3QJY A;  5C3W A;  2Z0S A;  1OO9 B;  4B3T Q;  3CPF A;  3H3V I;  4X6A H;  3OWE B;  4RGT A;  2OCE A;  2Q8T A;  2JA8 H;  4QIW E;  3PUX A;  2FFK B;  1VQ9 A;  2JSO A;  3S17 H;  2I5H A;  3DWP A;  1O80 A;  1IW7 D;  1EQV A;  1N36 L;  1NNX A;  3K7A B;  1JJC B;  3N52 A;  3LX0 A;  5CMD A;  2XIW A;  4BBR G;  1E22 A;  2ZJP A;  1EQT A;  3CCV A;  3F2B A;  2KED A;  4BBR B;  3E3X A;  5IOD A;  1NAP A;  5BN3 A;  1VQ5 A;  1XNR L;  5IT9 c;  1A3T A;  3AQQ A;  1FJG L;  1LT3 D;  1WTQ A;  1X56 A;  1NR2 A;  3A7L A;  4KMU C;  4RHR A;  4X3K A;  1VQN A;  4G7H C;  2K5H A;  4AQY Q;  1SNP A;  2B2V C;  3K5M A;  5IE8 A;  1XNQ L;  1EY8 A;  4BY7 B;  4DR7 Q;  1WTH A;  2Z1C A;  4HIO A;  3HOU B;  1D2B A;  3I55 A;  1DON A;  3MFY A;  5IP9 G;  3MXN A;  2TMP A;  4DNT B;  3FPU B;  2ICE C;  1VQL A;  5IOC A;  4H02 A;  1YNN D;  4A3F G;  3CMA A;  2NVX B;  3PO2 G;  4J15 A;  3U4V A;  4MIU A;  3IRB A;  3I4N G;  1LM0 A;  4IUU A;  3PO2 B;  2ZTE A;  4JOI C;  3W1B A;  5KYI A;  1S5B D;  2PQE A;  3I4N B;  4MTK A;  3D4R A;  4EQO A;  1CQV A;  1RJT A;  1MKH A;  3VA5 A;  2MPM A;  4IQZ A;  2RDG A;  4IFD H;  5ELB A;  4LNQ A;  2AWN A;  1V1P B;  2MO1 A;  4O2D A;  1U4R A;  3C1E A;  2JA7 G;  5C4Z A;  4CGY B;  1DZ1 A;  3CF5 A;  5J1Z A;  2HCI A;  2XRS D;  3FKI G;  1WI5 A;  1E2V A;  2A6H C;  3FKI B;  4I65 A;  1XPU A;  3ERS X;  3DEP A;  1OXT A;  4F88 A;  4PMW A;  3SHL A;  1FNV A;  1EWH A;  3MFG A;  2PCF B;  3J7A V;  3GTL B;  1JOQ A;  2N78 A;  4A3J H;  5L37 A;  3PMF A;  3KOJ A;  2K5W A;  1D8L A;  2F4V Q;  1EZ6 A;  2BA0 A;  4ABN A;  1VQ6 A;  4KN4 C;  3AU7 A;  5C44 G;  3FMC A;  2L11 A;  3I4O A;  3HOZ H;  4C1N I;  3S1N B;  2O4X A;  3ERO A;  3ULP A;  3U50 C;  5JEA H;  4KY5 A;  2NVY H;  1KTK A;  4ZRZ A;  3S2D H;  1O7Z A;  2GN5 A;  1QE6 A;  3P75 A;  1HZC A;  3VYU A;  4QF4 A;  3EBE A;  5ELC A;  2WAC A;  4YCU A;  3SEB A;  5GAD C;  1FNW A;  4F7X A;  3H0G G;  4A3K G;  3K7A H;  3H0G B;  2MUY A;  3A56 A;  5F2D A;  5BR8 L;  2UXD Q;  5GAE C;  3FHW A;  4BBR H;  4BBS G;  1EOT A;  3G7L A;  2NZH A;  4BBS B;  4OHJ A;  4QJF A;  3VDY A;  2ZTC A;  2ES2 A;  3UDX A;  4CDC C;  3S9W A;  3C1F A;  3L9A X;  1SYD A;  4C3J G;  4JCV E;  4C3J B;  2NN6 I;  3SK6 A;  4BY7 H;  2LFN A;  1SYG A;  3F8T A;  3A74 A;  1GXD C;  4LUV A;  2PMZ E;  1STY A;  4QGU A;  5IP9 H;  4C1N K;  2UUA Q;  2NTS A;  1MHW C;  2K28 A;  3PF4 A;  3HKZ E;  1HQM C;  2NVX H;  2K33 A;  4OIJ A;  4A3F H;  3AMU A;  4XDX A;  3PO2 H;  1HZB A;  3JAM i;  3I4N H;  2XNA C;  2MO0 A;  1K73 C;  2OTL A;  1K8M A;  2GVB A;  1LYL A;  2K52 A;  2V1C C;  4LF7 L;  4BA2 I;  1N8R C;  4X66 Q;  2O5I C;  3JAM E;  4AYB G;  2K05 A;  5IGB A;  4KJN A;  3SGI A;  4AYB B;  4NP5 A;  1B70 B;  2ZXR A;  2XSC A;  2JA7 H;  4Q5V A;  1ASZ A;  5EPJ A;  4UP8 A;  1LTR D;  2RDF A;  3HOX G;  2WFW A;  1WFQ A;  1TR5 A;  2B2W A;  3FKI H;  3HOX B;  3HOV G;  2Y0S G;  1STE A;  2RKS A;  5LL6 S;  3HOV B;  1VQP A;  1ZEQ X;  4ODG A;  4DAV A;  3UDI A;  1K8O A;  3U9O A;  1L0W A;  3J7Z C;  1OXS C;  3NXW A;  3M4P A;  2UXC Q;  3I73 A;  1S40 A;  4RAU C;  3UDF A;  2F0L A;  4DR1 L;  1BCP B;  1XPR A;  4P75 A;  5IY0 A;  4K2K A;  3SVM A;  5C44 H;  2R7F A;  3ERQ A;  3S1N H;  4DR5 Q;  4HJ5 A;  1OXU A;  3LWE A;  1V9P A;  1W6J A;  4KTA A;  4KKT A;  4JI8 L;  1UE1 A;  4OEL B;  2IHE A;  2Z4I A;  2AQ3 B;  4K6D A;  4IOA A;  3S2H H;  2IL8 A;  2KCT A;  1BR9 A;  2B3G A;  5EKL A;  2XVS A;  1JMC A;  5ELN A;  1IKM A;  1TS5 A;  3H0G H;  4C56 C;  4DUZ L;  4A3K H;  3KBG A;  2I46 A;  4TVA B;  4MHE A;  5NUC A;  1MJE A;  3A54 A;  1DXM A;  4GN3 B;  1Q81 C;  1H9J A;  2ENB A;  4GOP B;  3HEJ A;  1S3O A;  2JN4 A;  5JVG 3;  3DWQ A;  4BBS H;  4IUN A;  1Y1V G;  1SND A;  2A8V A;  1IHZ A;  1ESR A;  3F2D A;  4FO2 A;  4MNO A;  4DR6 L;  3DMU A;  1FGU A;  3PIO 3;  3OTO Q;  4NXM Q;  4C3J H;  4WJW A;  3S1M B;  1UE5 A;  1VF7 A;  2P5Z X;  2PI2 A;  5K36 H;  4HJ8 A;  3I4M G;  5D14 A;  2RHQ B;  3KF6 B;  5COY A;  4JBW A;  3AYH B;  3M85 A;  4IUQ A;  2UUC Q;  3PIO A;  1MI2 A;  1AP0 A;  2YTV A;  1KAW A;  4K0K Q;  5IWA Q;  1G2S A;  1VQD A;  1VQK A;  5K5P A;  3CC2 A;  1RD9 D;  2KOL A;  1PH6 A;  1CSQ A;  3I72 A;  2G9D A;  3EVQ A;  4ZAI A;  4HN7 A;  2VS1 A;  3HGB A;  4QQB X;  1LT6 D;  2E74 C;  3OPO A;  2F0W A;  1E2Z A;  3BVM A;  2D9U A;  1ICW A;  3TRE A;  1JJ2 A;  5A2Q L;  1PH4 A;  5CYU A;  3A5U A;  2OQK A;  1XMQ L;  3HOX H;  1PHJ A;  3BDO A;  3HOV H;  5E1F A;  3CC4 A;  1GUS A;  1DOM A;  1LTL A;  5T1G A;  2F0I A;  2B8G A;  5IGG A;  1SDF A;  4X64 L;  1V1P A;  4IUR A;  4L6T B;  3KDF A;  2MGS A;  2H4O A;  2PW7 A;  5ISR A;  2ZM6 L;  4A3I B;  1VQE A;  1WD1 A;  5FJ8 H;  2BA1 A;  3TEH B;  2D0P A;  2CW0 C;  4ULL A;  4UPA A;  1IL2 A;  4JI4 Q;  2UXB L;  4DNI A;  1BBW A;  3U4Z A;  3MAQ A;  2R7Z G;  3R8B A;  4FYD A;  1ML0 D;  5EKI A;  4X65 Q;  5LMU L;  3UE1 A;  1HNW L;  4DK1 A;  4YWM A;  2VW9 A;  5CV4 A;  5D3D A;  1EYC A;  5C5L A;  1LTS D;  2CKZ B;  3CC7 A;  4C3H G;  4DR2 Q;  3RN5 A;  3K7U C;  4DUY Q;  2A5H A;  3W3A A;  1ENC A;  2JQO A;  1I3Q H;  3J81 j;  3KUP A;  1SYF A;  2FMC A;  2SNM A;  1JOO A;  1S5E D;  1SBB B;  4KY7 A;  1EWC A;  2A1A A;  3BG3 A;  1UEA B;  2F4I A;  2B2U C;  1WJJ A;  5AJ3 Q;  2N55 A;  3CAM A;  1HJP A;  1G8Z D;  5C5M A;  4A3E B;  1ESF A;  2DGY A;  3SE0 A;  1AZP A;  1Y1V H;  1QCB D;  2A69 C;  2XWJ B;  1TU2 B;  2K14 A;  3A5Z B; 
#chains in the Genus database with same CATH homology
 2VQE Q;  3S1M H;  1PV4 A;  1UWV A;  4DV4 Q;  4UP9 A;  4B3M Q;  4JI0 L;  2QGQ A;  1XMO L;  4C3I H;  5LMN Q;  2E2J H;  1X65 A;  4B3R Q;  2I5L X;  3I4M H;  4HIM A;  2VZA A;  2LXK A;  5C4X G;  4POF A;  4YWK A;  3MEF A;  4BY1 G;  1KC8 C;  4OON A;  4JYA L;  3ULJ A;  4DV7 L;  1EIF A;  1FVI A;  1Q82 C;  2KCM A;  4DUZ Q;  1GKH A;  4A3J G;  1Q8K A;  1VQ8 A;  1G6P A;  2VUM H;  4GNX A;  2JEB I;  1L1O C;  1C7Y A;  2HHH Q;  3S14 H;  1E3P A;  1PVO A;  1K0R A;  5JJL A;  1TWH H;  4LFA L;  3M9B A;  3DM3 A;  3CCJ A;  4A3M H;  4A3D H;  3DLL A;  1DGS A;  2AKW B;  4LUZ A;  4OWX B;  3OTO L;  3HOZ G;  4NXM L;  4GLA C;  5FLX c;  2UXD L;  3HOW G;  4DR6 Q;  3FP9 A;  2ZJR A;  4R4O A;  1VS0 A;  1Y14 B;  4RMF A;  5BR8 Q;  5JEA G;  2E5L L;  1MIU A;  3RZO H;  1TWG H;  5IP7 H;  5FLM G;  1HR0 L;  4LFC L;  3PF5 A;  4AH6 A;  3KLW A;  5HGQ A;  2HIV A;  1C0A A;  2Z0S A;  2PI2 E;  2UUC L;  4B3T Q;  2UU9 L;  3CPF A;  4L5T A;  3G71 A;  1QVF A;  4LF4 Q;  3H3V I;  4X6A H;  4DV0 Q;  2OCE A;  2JA8 H;  2BH8 A;  4QIW E;  3PUX A;  2JA9 A;  5IWA L;  1VQ9 A;  1YBY A;  1BKB A;  1CKO A;  2HIX A;  2I5H A;  4DV3 Q;  1N34 L;  3S17 H;  4IFD I;  2F3I A;  4OX9 L;  4HJ9 A;  3D0F A;  2PNH A;  1N36 L;  1UE7 A;  1U5K A;  2JA6 G;  4BXX G;  1JJC B;  3TQY A;  4PZ6 A;  5K36 G;  4KHZ A;  4A3G H;  4BBR G;  1UEB A;  2UUA L;  1E22 A;  2L15 A;  2ASB A;  2ZJP A;  3CCV A;  3F2B A;  3CW2 C;  3B6Y A;  1VQ5 A;  4PZ8 A;  1XNR L;  3HOU H;  5IT9 c;  1A62 A;  4YCV A;  3PV0 A;  3AQQ A;  3RR5 A;  1FJG L;  4JI7 Q;  1TWC H;  4GN5 A;  1X56 A;  5C0X J;  2UUB Q;  1W2B A;  4JI1 L;  1A63 A;  1KXL A;  1VQN A;  4GOP C;  3S24 A;  3HFZ B;  1Q86 C;  2K5H A;  1P8L A;  4R4T A;  4AQY Q;  3E0E A;  3HOY G;  1P16 A;  1O7I A;  1OTC A;  5IE8 A;  5M3F H;  1EWI A;  1XNQ L;  4DR7 Q;  1L1O A;  3H15 A;  2QA4 A;  1XMQ Q;  4HIO A;  2ZTD A;  1E24 A;  1SN8 A;  4MZ9 A;  4YWL A;  4LF7 Q;  4GS3 A;  4LUO A;  4EX5 A;  1NMF A;  4A3L G;  3I55 A;  2NZO A;  2YV5 A;  4IPD A;  4OWT B;  5IP9 G;  1X55 A;  5GRO A;  1FL0 A;  1VCI A;  1HNZ L;  1TWA H;  3BJU A;  3NEL A;  1WCM G;  2N3S A;  4TQU S;  1IZ6 A;  3K0X A;  1VQL A;  1JB7 A;  4X64 Q;  4H02 A;  4A3F G;  3CMA A;  3ICE A;  1V1Q A;  3PO2 G;  4J15 A;  3U4V A;  3JC6 6;  4C3H H;  3IRB A;  3I4N G;  4IPC A;  1LM0 A;  2ZTE A;  2MFI A;  4JOI C;  2WB1 E;  1E1O A;  3W1B A;  5GAG C;  2ZM6 Q;  4LFB Q;  3H3V H;  1WYD A;  3CCS A;  4R4I A;  3GTK H;  4JI4 L;  5C3E G;  1YEZ A;  2UXC L;  4JI2 L;  4YHH L;  1MKH A;  1PYS B;  4AIM A;  1J5E L;  3ULL A;  2ATW A;  2A19 A;  1A0I A;  2WB1 G;  3NBH B;  4DV6 L;  3K8A A;  1IBM L;  4LNQ A;  1HNX Q;  1XPO A;  5J3B A;  2AWN A;  2EQS A;  1KRT A;  4YCW A;  4X65 L;  4P71 A;  4A3B G;  4A3C H;  1I5F A;  2MO1 A;  4DR1 Q;  3GTL H;  4O2D A;  2EXD A;  5IYB G;  2JA7 G;  3J81 i;  2IT1 A;  2N49 A;  3T1Y L;  1YHQ A;  4LF8 Q;  1HNW Q;  1NE3 A;  3CF5 A;  2ID0 A;  4DR2 L;  4JI3 L;  4DUY L;  1RIP A;  1IBK Q;  3FKI G;  1WI5 A;  3L0O A;  5DLQ E;  4LF9 Q;  2B63 H;  2LXJ A;  2JK8 A;  1XPU A;  5FJ8 G;  3U58 A;  1N32 Q;  3ERS X;  1AH9 A;  1OXT A;  1YHB A;  5M3M H;  2NN6 G;  4PMW A;  4XTC S;  4KHP L;  4BY1 H;  1EYG A;  4JI8 Q;  2VQF L;  4GOP A;  1QZG A;  1VQH A;  2N78 A;  1QUQ B;  3J80 i;  5AJ3 L;  2JA5 G;  5M5X H;  4DV5 Q;  2R93 G;  4A3J H;  3Q8D A;  2Q2I A;  3KOJ A;  1D8L A;  2F4V Q;  5IYD G;  4LF5 Q;  2BA0 A;  2E2I H;  1VQ6 A;  3E9H A;  5C44 G;  1BBU A;  3UE0 A;  2HT1 A;  2Q2U A;  2VQE L;  1GVP A;  2N8N A;  3I4O A;  4DV4 L;  3HOZ H;  2IY5 B;  3CCL A;  1Z47 A;  4NPS A;  3WWV A;  3HOW H;  4A93 G;  2RF4 A;  3KF6 A;  3F1Z A;  3ULP A;  4B3R L;  3U50 C;  2K75 A;  4JI0 Q;  1XMO Q;  4DV1 L;  5FLM H;  3CCR A;  1PH9 A;  2NVY H;  4DR4 Q;  5IYC G;  4JOI A;  3S2D H;  1B8A A;  2GN5 A;  2HHH L;  3GTG H;  4QY7 A;  4XIG S;  3RLN A;  3UDG A;  3L2P A;  2FXQ A;  2MQH A;  1HZC A;  2GVA A;  2OQ0 A;  4PZ7 A;  3KYH C;  4NXN Q;  3EBE A;  1N33 Q;  2D62 A;  4YCU A;  1I6H H;  5GAD C;  4WJ3 M;  4IO9 A;  3H0G G;  4A3K G;  1YJN A;  1VQG A;  1AE2 A;  3S15 H;  3K7A H;  4JI6 Q;  4RG1 A;  1QVC A;  1I94 L;  5BR8 L;  2JA6 H;  4BXX H;  3T1H L;  2UXD Q;  4FDB A;  2WP8 J;  5H1S E;  2Q2T A;  5GAE C;  3FHW A;  4BBR H;  4BBS G;  2K4K A;  4YY3 Q;  3GDE A;  4K0K L;  2NZH A;  1YNX A;  3K81 C;  3S1R H;  2XGT A;  2YTX A;  4QJF A;  2ZTC A;  4EQ5 A;  4GNX B;  3PSI A;  3VDY A;  1HR0 Q;  2ES2 A;  3UDX A;  2OWO A;  1ASY A;  4B3T L;  4LF4 L;  2OTJ A;  1Z9F A;  2WAQ G;  4HID A;  3PIP A;  4JCV E;  4NB3 A;  2UU9 Q;  1M1K C;  2XTI A;  4DV3 L;  3F2C A;  2D0O A;  2NN6 I;  3J7A 5;  5C0X G;  4BY7 H;  1YJ9 A;  1EUJ A;  3RLO A;  3CD6 A;  2CFM A;  4IPG A;  4X62 Q;  5LMN W;  3W1G A;  1NBW A;  2Z6K A;  1IXR A;  3F8T A;  3A74 A;  4LUV A;  2HQL A;  1A8V A;  2PMZ E;  1CKM A;  1GD7 A;  4A3L H;  4QGU A;  5IP9 H;  4DR3 Q;  2EIF A;  3GTJ H;  4DV2 Q;  1KL9 A;  2UUA Q;  1KHI A;  1WCM H;  3PF4 A;  3HKZ E;  1UE6 A;  4DK6 C;  2YYZ A;  2CWA A;  2I0Q A;  2NVX H;  2UUB L;  2R6G A;  1YIJ A;  1YI2 A;  4A3F H;  4ALP A;  1VQA A;  3RNU A;  3PO2 H;  3CQZ H;  1HZB A;  3JAM i;  4KLK A;  3I4N H;  3D31 A;  2MO0 A;  3HKZ G;  3G4S A;  1K73 C;  2OTL A;  2R7Z H;  2GVB A;  1YHA A;  1SLJ A;  5EAY A;  1LYL A;  2K52 A;  4AYB E;  4DR7 L;  4GKJ L;  2V1C C;  5C3E H;  4P72 A;  4LF7 L;  4BA2 I;  1SR3 A;  2NVT H;  1VQO A;  1N8R C;  1PH7 A;  1E1T A;  1X3G A;  2JE6 I;  3BU2 A;  4X66 Q;  4AYB G;  4A3B H;  1Q1B A;  3SGI A;  1Y1W G;  4IOC A;  1B70 B;  1CKN A;  1J6Q A;  1K9M C;  3HKS A;  4APV A;  4C2M H;  5IYB H;  2JA7 H;  3M4O H;  5HY6 A;  2CQO A;  4LW1 A;  3GTQ H;  4PG3 A;  1ASZ A;  1EFW A;  3GO5 A;  4UP8 A;  1L2F A;  3HOX G;  4A3I G;  2WFW A;  1WFQ A;  4GKK L;  4L5S A;  3FKI H;  1RL2 A;  1NJI C;  3HOV G;  2Y0S G;  1IBL L;  5M5W H;  2YU9 H;  2UXB Q;  1VQP A;  1L1O B;  4OXP A;  3UDI A;  3EN2 A;  1PYB A;  1PH1 A;  2YTY A;  1SMX A;  1HZA A;  4IJH A;  2IX1 A;  1L0W A;  3BZK A;  3J7Z C;  1LUZ A;  4UY8 C;  1OXS C;  5LMU Q;  3M4P A;  2UXC Q;  2PQA A;  4MTN A;  3MXN B;  1S40 A;  4BA1 I;  1TWF H;  1TXY A;  5C4J H;  1J5E Q;  1HNX L;  2JA5 H;  4HJ7 A;  1Q46 A;  3PUW A;  4JV5 L;  2R93 H;  1HH2 P;  3UDF A;  3GD7 A;  4DR1 L;  1SRO A;  2RHS B;  1KIX A;  1XPR A;  2LSS A;  3ER0 A;  4P75 A;  5C0X I;  1EQQ A;  4LF8 L;  2QEX A;  5IY0 A;  3RN2 A;  2E8G A;  3W5O A;  5IYD H;  1B7Y B;  1X3F A;  4LF6 Q;  4IJL A;  4QL5 A;  2AMC B;  1K83 H;  3A0J A;  2R7F A;  3I2Z A;  5C4X H;  1K3R A;  5C44 H;  4HJA A;  4DR5 Q;  1CKN B;  1NTG A;  4HJ5 A;  1OXU A;  3S1N H;  2KEN A;  5GAH C;  1R9T H;  1E7Z A;  4JI5 L;  3GTO H;  4A93 H;  1NY4 A;  1QVG A;  2CCZ A;  1KQS A;  3I56 A;  2Z6K C;  1VQM A;  1V9P A;  4JI8 L;  1PH3 A;  1UE1 A;  4A76 A;  1G51 A;  3J81 c;  3CCE A;  3PGZ A;  3G6E A;  4DV5 L;  1JT8 A;  5IYC H;  2VQF Q;  1MJC A;  1SE8 A;  4B3S Q;  1V43 A;  1VQB A;  3S16 H;  1VQJ A;  2IHE A;  4B3M L;  2R92 G;  4A3E G;  5M5Y H;  4IOA A;  5LMN L;  4LF5 L;  2IX0 A;  2KCT A;  4DK3 C;  4OWW B;  3S2H H;  4IFD J;  2ZJQ A;  1GO3 E;  3KFU A;  4L5R C;  2B3G A;  3AFP A;  4IPH A;  1JMC A;  3PO3 G;  5ELN A;  2JJQ A;  1PFS A;  1XTD A;  3STB C;  1JJG A;  3H0G H;  2F52 A;  4DUZ L;  4A3K H;  3M7N A;  3J80 c;  4TVA B;  1SRU A;  1XJV A;  4DV7 Q;  4JYA Q;  1MJE A;  3RLF A;  2IHF A;  4GN3 B;  3NEN A;  1Q81 C;  5M3M G;  3LGJ A;  4GOP B;  3STB D;  1S3O A;  4DR4 L;  4BBS H;  4R1J A;  4DV1 Q;  4ME3 A;  1Y1V G;  4LFA Q;  2A8V A;  4UP7 A;  1K8G A;  3GTM H;  4A4I A;  1KRS A;  1N9W A;  3F2D A;  4MNO A;  3M3Y H;  4DR6 L;  2B29 A;  1AE3 A;  1FGU A;  3OTO Q;  4JBJ A;  4NXN L;  1N33 L;  4NXM Q;  4C3J H;  1UE5 A;  2PI2 A;  4R4Q A;  4HJ8 A;  3I4M G;  3AFQ A;  2WAQ E;  2RCN A;  2E5L Q;  2RHQ B;  1YJW A;  3PCO B;  4JI6 L;  1VQC A;  3KF6 B;  3PUV A;  1D7Q A;  2VL6 A;  2VY3 A;  4LFC Q;  1VQI A;  4OO1 G;  1OXV A;  4JBW A;  4DV0 L;  3AYH B;  2VUM G;  3M85 A;  1I94 Q;  4P74 A;  2MNA A;  4YY3 L;  2UUC Q;  3T1H Q;  3PIO A;  4L5Q A;  4DAY B;  4A3M G;  4JBM A;  4A3D G;  2BH2 A;  1I50 H;  2YTV A;  1KAW A;  1YVC A;  5E7N A;  4K0K Q;  5IWA Q;  1S72 A;  3HOY H;  4A75 A;  1N34 Q;  1VQD A;  5JEA J;  1VQK A;  3CC2 A;  5ELO A;  4OX9 Q;  2KHI A;  1HZ9 A;  3RZD H;  1PH6 A;  4GLV B;  1CSQ A;  1W3S A;  1IYJ B;  3GTP H;  1YIT A;  1N36 Q;  2I5M X;  3CP0 A;  2R7D A;  3I7F A;  3S1Q H;  2VS1 A;  5IP7 G;  1EQR A;  4X62 L;  4QQB X;  3BZC A;  4LWC A;  1Q7Y C;  4JI7 L;  4HIK A;  1XNR Q;  2KHJ A;  1VQ7 A;  1G29 1;  3TRE A;  4GLX A;  1JJ2 A;  1FJG Q;  4DR3 L;  2JA8 G;  1X6O A;  4DV2 L;  1PH8 A;  4JI1 Q;  1PH4 A;  4AQY L;  2Q2H A;  4Y7N H;  3OW2 A;  1Y1W H;  3K80 C;  3CCQ A;  3A5U A;  2OQK A;  2C35 B;  1X54 A;  3TS2 A;  1H95 A;  1XMQ L;  4DKA C;  3AEV A;  3G48 A;  1XNQ Q;  2NVQ H;  3TRZ A;  3HOX H;  1PHJ A;  4A3I H;  2AHO B;  3HOV H;  2K5N A;  1VQF A;  3CC4 A;  1QZH A;  3KJO A;  4A3G G;  1T9H A;  2DUD A;  1LTL A;  3CPW A;  4BY7 G;  3PUY A;  1BVS A;  4JBK A;  1HNZ Q;  2Y0S E;  4X64 L;  4Y52 H;  2KBN A;  3HOU G;  4GKJ Q;  4DAM A;  4X66 L;  1Q1E A;  3KDF A;  1YZ6 A;  1HR0 W;  2ZM6 L;  1X9N A;  3JAM c;  4LFB L;  4JC0 A;  1VQE A;  5FJ8 H;  2BA1 A;  3M4Q A;  2D0P A;  3TEH B;  1VQ4 A;  4UPA A;  3PUZ A;  5M3F G;  4GNX C;  1IL2 A;  4WJ4 A;  3TS0 A;  4OO1 I;  1C9O A;  5JJI A;  3CME A;  4JI4 Q;  2UXB L;  1CUK A;  1EOV A;  4JI2 Q;  4DNI A;  1BBW A;  4YHH Q;  3U4Z A;  4O0A A;  2CWP A;  2R7Z G;  4GKK Q;  4KI0 A;  4DV6 Q;  1SFO H;  4GN4 B;  1IBL Q;  4R4C A;  1IBM Q;  1QUQ A;  3EIV A;  3OYY A;  3ZJY C;  4X65 Q;  5LMU L;  3UE1 A;  1HNW L;  3KF8 B;  1U0L A;  4YWM A;  1GM5 A;  2VW9 A;  1JE5 A;  1PH5 A;  3T1Y Q;  1IBK L;  4LF9 L;  1WOC A;  2CKZ B;  1CSP A;  3CC7 A;  3NEM A;  4DR2 Q;  1M90 C;  3RN5 A;  4JI3 Q;  2K5V A;  3K7U C;  5GQO A;  4DUY Q;  4P73 A;  2R92 H;  4A3E H;  3CXC A;  4JV5 Q;  1N32 L;  4LF6 L;  3KDF B;  2JQO A;  1I3Q H;  3J81 j;  1NMG A;  5JJK A;  2K50 A;  4DR5 L;  3PO3 H;  2A1A A;  4DPG A;  3KJP A;  4IFD G;  4POG A;  4KHP Q;  1X3E A;  1PH2 A;  1WJJ A;  2ALY B;  4A3C G;  5AJ3 Q;  3CCU A;  1PA6 A;  3CAM A;  1K8A C;  2F4V L;  1HJP A;  4JI5 Q;  2PQA B;  1Q12 A;  1OXX K;  2AWO A;  2DGY A;  2H5X A;  3E9I A;  1Y1V H;  3CCM A;  4B3S L;  2E2H H;  2JEA I;  2K14 A;  1KD1 C;  2VNU D;  3L7Z C;  3A5Z B;  1EIY B;  2B63 G;  4JG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...