4B3TL

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3tL00
4O2DA 4JI7L 1S72A 1PV4A 1ASYA 3UDIA 3ULLA 1FL0A 4HJ9A 1EQQA 1WFQA 3CMAA 2B63G 3K7AH 1XNQQ 1OXSC 3VDYA 4JI7Q 1SRUA 4IFDG 4DV2L 1CSPA 3D0FA 1G51A 4GKKL 2Q2HA 1UEBA 2WB1G 1UWVA 5LMUL 2XGTA 4R4IA 4DV2Q 1X56A 1VQHA 2DUDA 4A3IG 4JI6L 2UUAL 2NVQH 3F2DA 3GTQH 3Q8DA 4GKKQ 1PH2A 4GKJL 3G6EA 1HJPA 1IYJB 4UPAA 5LMUQ 1XJVA 2ZJQA 1VQNA 2CKZB 3KF6A 4BXXG 1QUQA 4YWLA 1CSQA 1TWHH 3S24A 3OTOL 4JI6Q 2UUAQ 4GKJQ 3PUZA 2N78A 2YTVA 2WB1E 1L0WA 5IYBH 5C4XG 3GTOH 1NE3A 4AYBG 2K5HA 2BA0A 1YI2A 3RZOH 3CPFA 4DV1L 3OTOQ 4HJ7A 2H5XA 4HJAA 1SE8A 1Q12A 1IBML 4A3BH 5GAGC 1C9OA 4KI0A 1P8LA 1X55A 2V1CC 1N9WA 1E1TA 3RLFA 3T1YQ 4DV1Q 1EFWA 4TQUS 4LF9Q 4H02A 3CCQA 1EOVA 1IBMQ 5JJIA 2JK8A 4YY3L 1KXLA 3MXNB 4J15A 1KRTA 3GTPH 4BA1I 4LUOA 4POFA 1I6HH 1W2BA 4PZ7A 3CMEA 4DUZL 3M85A 3GTKH 1A0IA 4C3HH 2OWOA 4YY3Q 2I5HA 4FDBA 2ASBA 2FXQA 2K5VA 2MO0A 3F1ZA 2I5LX 3KOJA 1X3GA 3OW2A 3ICEA 2OTJA 4DV3L 4X65L 2WP8J 2Q2TA 1AE3A 1YJWA 2R7FA 1UE1A 4DV6L 2R7ZH 3L7ZC 4Y7NH 1I3QH 2R92G 4BY1H 1GVPA 1NJIC 1SMXA 4DAYB 5M3MG 4DV3Q 3TS2A 4X65Q 3EN2A 4PZ8A 4JI8L 1X3FA 3AFPA 4DV6Q 3I4MH 3I7FA 3S2DH 1UE7A 2Q2IA 5EAYA 1LYLA 1CKNA 3KDFA 3PIOA 4GLAC 1PH6A 4DAMA 2K14A 3JAMc 2NVTH 2YYZA 4JI8Q 4B3MQ 4PZ6A 3L2PA 1Q8KA 2JA5H 1PH8A 1Y14B 2VQEL 5FJ8G 2KHJA 5M3FH 5K36G 3CAMA 2KHIA 5IYCH 4QIWE 1EWIA 1G291 1MJCA 4B3SL 1BBUA 2KBNA 1VQMA 1N34L 2VQEQ 1VQGA 3CPWA 3CCEA 1S40A 1Q1BA 2JA8G 3GDEA 1HNXL 4LF4L 4ME3A 4B3SQ 3M9BA 4UY8C 5IP9H 1N34Q 3HOXH 5C3EG 2CWPA 1WI5A 1G6PA 1NY4A 4GN4B 2EXDA 1HNXQ 4LF4Q 2JA6G 2A19A 3B6YA 3FKIH 2E2IH 1H95A 4LF5L 2JEBI 4QGUA 3KJPA 2XTIA 3RLOA 2ZM6L 3K81C 4JV5L 3RLNA 4A3JG 1L1OB 1X3EA 4LF5Q 1MKHA 1AH9A 3EBEA 1YJ9A 2ZM6Q 4JV5Q 1VQCA 4JI4L 2Z6KA 2OQ0A 5GROA 3U4ZA 1PH3A 1PH5A 5ELOA 5AJ3L 3GTJH 1NTGA 4HIMA 1JE5A 3OYYA 2ZTCA 4GOPA 2GVAA 1PVOA 3KLWA 1Y1VG 4JI4Q 4LF6L 2WFWA 4KLKA 4HIOA 1XNRQ 5AJ3Q 4DV7L 1U0LA 1Q7YC 3RNUA 1RL2A 4A3MG 3J80c 5GAEC 5C44G 3S2HH 1HH2P 1PYSB 4GLVB 4LF6Q 1TWGH 4LF8L 1FVIA 4UP9A 4JI1L 4DV7Q 1EYGA 1AE2A 4OX9L 5LMNW 4DV5L 1QZGA 5IYDH 4LF8Q 4LNQA 1HZ9A 4UP8A 3PUWA 1YHBA 2NVYH 4JI1Q 2JA7H 4A3CG 1XTDA 1JMCA 3STBC 1LM0A 3HKZG 2GN5A 4OXPA 1V9PA 2Z6KC 4DV5Q 1I94L 3CXCA 1N36L 4IPHA 1SROA 3TEHB 4GOPC 1YJNA 3KYHC 2A1AA 3JAMi 3I4NH 4P73A 3HOZH 1I94Q 1N36Q 1KD1C 1YHQA 4IFDI 5J3BA 1QZHA 3NEMA 1U5KA 1HR0L 3HKZE 2MFIA 3I55A 1J5EL 3PO3H 1Q86C 3S1QH 4BY7G 1JB7A 1YBYA 1HR0Q 2ATWA 3S1RH 1VQBA 2VY3A 3PIPA 4B3RL 3HOUG 1J5EQ 2RHSB 3KF8B 3L0OA 1VQAA 2YV5A 5JEAJ 3CCRA 4JBKA 4A3DG 1EUJA 3CCUA 1QVFA 4P71A 4B3RQ 4QQBX 2D62A 3S16H 3K8AA 5IY0A 4HIKA 4IOAA 3A0JA 5C0XJ 1B8AA 1OXUA 3KJOA 3PUXA 5M5XH 2B63H 5JJKA 5IYBG 2HIVA 1KHIA 2UXCL 1VQJA 4BBRG 3T1YL 4K0KL 3GD7A 4LF9L 1FJGL 5DLQE 2CQOA 4A3GG 3TQYA 1IBLL 5IT9c 4A3BG 4A3KG 5IE8A 3M4OH 2UXCQ 1VQLA 4K0KQ 3CD6A 3I4OA 1WYDA 1FJGQ 5M5YH 2YU9H 2PI2A 4P75A 1GM5A 1LUZA 1IBLQ 1O7IA 4A3IH 4O0AA 4X66Q 3NBHB 1ASZA 1SLJA 4NB3A 4X62L 4YCUA 4UP7A 4C3IH 1VQOA 3WWVA 3HOVH 1VS0A 2AMCB 3A5UA 2B3GA 4DV4L 1XPUA 4YCWA 5JJLA 2E8GA 4X62Q 4NXML 4GNXB 4L5TA 2Q2UA 1Q46A 4OONA 4DV4Q 4A3FG 4A3EG 3K7UC 1K8AC 2IT1A 1YNXA 1KQSA 4L5SA 2AHOB 3PUVA 4IPDA 1VQKA 2R7DA 4NXMQ 4XIGS 1EQRA 1VQEA 3CQZH 2BH2A 1IZ6A 1N8RC 4AH6A 1WCMH 4HJ8A 2UU9L 4B3ML 3CC4A 1IL2A 3I4MG 4EQ5A 3S1NH 1K0RA 2KCTA 4MZ9A 2L15A 1UE6A 1JT8A 1OXVA 2KENA 2VL6A 1K83H 2UU9Q 3HOWG 3AQQA 4DV0L 3UDGA 1NMFA 3UE0A 4JI0L 5M3FG 4DV0Q 1PH1A 4DNIA 2MO1A 4A93G 3MEFA 5C4JH 1T9HA 4NXNL 3E0EA 1Q81C 4JI0Q 2R92H 2YTYA 5M3MH 1QVCA 1VQ6A 3HKSA 3G71A 4OWWB 2PQAB 2HQLA 4DR2L 2RCNA 4NXNQ 2K50A 3TRZA 3CCSA 5IP9G 2IHEA 4DK3C 3K80C 5FLMG 3HOXG 1P16A 1XPOA 2LXJA 4GLXA 2UXBL 4BBSH 4IFDJ 2B29A 4DR2Q 3FKIG 3KDFB 4JOIA 1Y1WG 5GAHC 3HOYH 1HNZL 3J7ZC 4NPSA 3PF5A 2OCEA 4LFBL 2UXBQ 1S3OA 5FJ8H 1KAWA 2AWNA 2RHQB 3HFZB 3ULPA 4YWMA 1SFOH 4LWCA 4X64L 1VQ7A 1K8GA 3A74A 3S14H 4ALPA 1HNZQ 5C0XG 2YTXA 3GTGH 3PGZA 3GTLH 2C35B 4DK6C 4GN5A 5IWAL 4PMWA 3U58A 4LFBQ 5BR8L 1VQ5A 4KHZA 1XNRL 4X64Q 2JA8H 4R4TA 1TXYA 4A3LG 1HZBA 3UE1A 3J81c 3H0GG 2F52A 2E5LL 3PSIA 1N32Q 5IWAQ 3IRBA 4AIMA 5BR8Q 1CKOA 4OO1G 2R93G 1WJJA 2ALYB 1YITA 5E7NA 2BA1A 4DUYL 2VQFL 2E5LQ 2VZAA 4IJHA 2UXDL 2DGYA 2VS1A 4JBWA 1TWAH 3PCOB 4JOIC 4GS3A 1TWFH 4DPGA 5IP7H 1NBWA 1OXTA 1D8LA 4DUYQ 2VQFQ 4A3JH 4LFAL 3UDXA 2WAQE 1A63A 3TREA 2HT1A 2UXDQ 4LF7Q 5IYDG 2EQSA 3RR5A 1X6OA 3BZCA 1OTCA 1PH7A 3PO2H 1YZ6A 2GVBA 4MTNA 4BA2I 4LFAQ 3SGIA 1OXXK 1PH4A 4OWTB 2LXKA 4JG2A 4IO9A 1Y1VH 3M4PA 5LMNL 2F4VL 4R4OA 3I4NG 4IOCA 2NN6G 4IPCA 4A3MH 3S15H 4DR3L 3G48A 3ERSX 2IHFA 3H15A 5LMNQ 2F4VQ 3A5ZB 4DKAC 4YCVA 2ZJRA 1KC8C 1SR3A 3JC66 3CC2A 4YWKA 4DR3Q 3NENA 1GD7A 1GO3E 4A4IA 3PF4A 2CWAA 1VQDA 4A3CH 1VQFA 2R6GA 3G4SA 4JBMA 4IPGA 2VUMH 4JI3L 3S17H 1Q82C 4B3TL 4XTCS 2IX0A 1PYBA 1B7YB 3LGJA 3S1MH 4QL5A 1PA6A 1DGSA 1A8VA 2AKWB 2Z0SA 3I2ZA 4JI3Q 1X54A 1I5FA 4B3TQ 1JJCB 1E22A 1BKBA 4OWXB 2PNHA 1I50H 4DR6L 3GO5A 4LFCQ 1YHAA 4R1JA 2NVXH 1NMGA 4LW1A 4X66L 4RG1A 4BY7H 1V1QA 5HY6A 2JJQA 5H1SE 1XMQL 2IX1A 3HOUH 4DR6Q 2CFMA 3CW2C 2K52A 3T1HL 1TWCH 3ULJA 3J81i 4R4QA 4A3DH 2JEAI 2LSSA 4DR5L 4JBJA 1XMQQ 1Z9FA 1XMOL 4JC0A 2K5NA 2N8NA 2RF4A 1B70B 4LUZA 4P74A 4GNXA 3T1HQ 1VQ8A 3HOVG 4BXXH 1JJGA 4HJ5A 3J80i 3CCLA 1L2FA 4DR5Q 3KF6B 1VQ9A 3ZJYC 4QY7A 1QUQB 1WOCA 5C4XH 1XMOQ 2EIFA 1Z47A 1E24A 4BBRH 2D0PA 3BU2A 4A3GH 2VW9A 3F2BA 3UDFA 1J6QA 2R7ZG 4A3KH 4BY1G 1E3PA 3ER0A 3CCJA 4DR4L 1WCMG 2K75A 1HZAA 1Q1EA 4A75A 3AEVA 2N3SA 4WJ3M 4AYBE 1VCIA 4DR1L 4L5QA 1K3RA 3W1GA 4DR4Q 1C0AA 1YEZA 1MIUA 5ELNA 3M4QA 1BVSA 3DLLA 2ZJPA 4GNXC 4DR1Q 2JA5G 4X6AH 4C2MH 3CCVA 4A3FH 4POGA 4OX9Q 1KL9A 4DUZQ 4A3EH 2QA4A 2UUCL 5IYCG 2CCZA 2KCMA 4L5RC 2PQAA 4YHHL 2N49A 1YVCA 1PFSA 1PH9A 3KFUA 2UUCQ 2JQOA 1HZCA 1PHJA 1KRSA 4WJ4A 2QGQA 4AQYL 1LTLA 3F2CA 3CC7A 4YHHQ 1D7QA 3U4VA 2HIXA 4TVAB 4BBSG 2I0QA 3HOWH 3BZKA 1C7YA 5HGQA 4AQYQ 1CKNB 1X9NA 4JYAL 3HOYG 2VNUD 1L1OA 1A62A 5JEAG 3FHWA 5C0XI 1XPRA 1QVGA 1N33L 3E9IA 3H3VI 3F8TA 2E2HH 5FLXc 2NZOA 4DR7L 4JYAQ 4KHPL 4A93H 3TS0A 1GKHA 4MNOA 1E7ZA 4EX5A 1KIXA 3NELA 1N32L 1N33Q 4IJLA 3J81j 1IBKL 1UE5A 5GQOA 2ES2A 4DR7Q 4OO1I 4KHPQ 2ZTDA 2IY5B 4APVA 2WAQG 1RIPA 2F3IA 2OQKA 2OTLA 3DM3A 4R4CA 2ZTEA 5FLMH 5C3EH 1IBKQ 3D31A 1R9TH 1W3SA 2JE6I 2JA6H 3AFQA 1M90C 2Y0SG 1Y1WH 2D0OA 4P72A 2I5MX 4LF7L 2QEXA 1HNWL 4HIDA 2AWOA 4LUVA 2PI2E 5IP7G 1L1OC 2BH8A 1EIFA 3W5OA 5M5WH 2A8VA 1SN8A 3M3YH 3STBD 3W1BA 1K73C 4QJFA 2UUBL 1HNWQ 4JI5L 4A76A 1FGUA 1IXRA 1VQPA 3H3VH 1E1OA 4PG3A 2HHHL 1K9MC 3J7A5 2JA7G 1CKMA 3PUYA 3PO2G 3CCMA 2NN6I 2Y0SE 1EIYB 2UUBQ 1JJ2A 3PV0A 4A3LH 4JI5Q 3H0GH 4C3JH 2K4KA 2PMZE 1MJEA 1VQ4A 2HHHQ 1CUKA 2R93H 4GOPB 3HOZG 2E2JH 3K0XA 4RMFA 3E9HA 3U50C 4Y52H 2MQHA 3CP0A 3FP9A 5C44H 3CF5A 3M7NA 2MNAA 3EIVA 2JA9A 3PO3G 2ID0A 2NZHA 1M1KC 4GN3B 1X65A 5GADC 3RZDH 4JCVE 1VQIA 4JI2L 3RN2A 1V43A 1HR0W 3RN5A 2VUMG 3AYHB 1YIJA 3BJUA 3GTMH 1BBWA 3I56A 1XNQL 4JI2Q 4LFCL
chains in the Genus database with same CATH superfamily
1PV4A 2E75C 2SNMA 3UDIA 4HJ9A 1SEBD 3CMAA 4WFN3 4MIUA 5C5MA 1OXSC 3VDYA 1TQOA 1G51A 4HSPA 1BCPF 5ELFA 1UWVA 5C4JB 4JI6L 1GXDC 1PH2A 2R92B 3G6EA 1HJPA 5E3FA 4C3IG 2O2LD 4F8MA 3BG3A 1VQNA 5M9OA 4N9TA 3NWTA 1TWHH 4JI6Q 5IYBH 5C4XG 2BA0A 3RZOH 3CPFA 4LK1C 2H5XA 3GV6A 1HFNA 2VB3X 1SFOB 2V1CC 1N9WA 3S14B 4CDCC 4R8IA 4H02A 1SNOA 1KRTA 4LUOA 1LTAD 2JP1A 1FGBD 2B2WA 1FNVA 4POFA 4R8NA 3CMEA 1W2BA 2DJFC 1S5FD 4C3HH 1JWSD 4FDBA 2MO0A 2I5LX 2I46A 2F0TA 3KOJA 1X3GA 2OTJA 4HCEA 1MSGA 2WP8J 1AE3A 2N88A 2R7FA 2R7ZH 3NXWA 1GUGA 1NJIC 1EY8A 5HURA 1ET6A 1LACA 1C48A 2X6LA 2QDLA 3EN2A 1X3FA 1XWEA 1UE7A 5EAYA 1Q90A 4GLAC 3C3LA 4K2KA 4DAMA 2NVTH 4PZ6A 3L2PA 1ENAA 1Y14B 3S15B 4XYQA 1VF5C 4QIWE 1G291 1HFGA 1RDPD 1TR5A 3MZ5A 4B9WA 1N34L 4KK7A 5LL6X 3CPWA 3CCEA 2JA8G 4ME3A 1A2UA 1NR2A 2K1BA 4UY8C 1N34Q 2CWPA 3NTKA 4L8JA 2EXDA 3Q23A 3B6YA 3FKIH 5KGUA 4LF5L 2FMMA 2XTIA 3J7YW 1JOQA 3K81C 4X3SA 1GHJA 3L9AX 4LF5Q 5IT9L 1CFMA 1YJ9A 1STAA 2Z6KA 1B3QA 1SNMA 2OQ0A 2F0OA 1PH3A 1S5BD 2L11A 1JE5A 2RQXA 4HIMA 2GVAA 1Y1VG 4LF6L 1TWCB 1XNRQ 1M8AA 3HRZC 3A8KE 3S2HH 1IHZA 2RDHA 4GLVB 4LF6Q 5EBCA 1FVIA 1DM0B 1H9SB 2MP1A 3OMCA 3GQBA 5IYDH 1HHVA 3N52A 1EOTA 1AW7A 1SNPA 2NVYH 1H9RA 1XTDA 5FK9C 1JMCA 1EY0A 1V9PA 2Z6KC 4A3KB 1N36L 4IPHA 3JAMi 2NN6H 4OL7A 4DA2A 3H91A 1ZXTA 3SXHA 3K5LA 1N36Q 3N6RA 3TN2A 5CV5A 1QZHA 3VYTA 2M2LA 4X3UA 1U4LA 3I55A 1J5EL 3PO3H 1IW7D 1Q86C 5FLXE 4C2MB 1YBYA 1R4QB 4A3EB 3K57A 3S1RH 1J5EQ 1WTPA 2B8FA 4FO2A 1G8ZD 1EUJA 1PXUA 1HQMC 4K5XA 3K8AA 3I4MB 4HIKA 5C0XJ 1OXUA 4HEDA 5M5XH 3BYYB 1VQJA 1O7ZA 1EIGA 4A3GG 3P7JA 1O78A 4A3BG 4NP5A 3MXNA 5M5YH 4A93B 1CZGA 1LUZA 1O7IA 1ASZA 1SLJA 4NB3A 4B08A 4X62L 1K28A 4UP7A 4C3IH 3A8IE 1VS0A 3MHBA 3A5UA 1XPUA 3HOXB 3LWEA 2EY1A 4X62Q 1II3A 1MGSA 4A3FG 3K7UC 1K8AC 2IT1A 1ZYRC 1ESRA 1VQEA 2EDGA 5M5WB 3OSOA 4AH6A 1E2WA 3CC4A 4EQ5A 4JVZA 3TBIB 4HR7B 5CMDA 1OXVA 1K83H 4OIJA 3HOWG 3H0GB 3T53B 4C3JB 5D3IB 3UDGA 3EROA 3QWNA 4KKUA 1PRTD 4DNIA 2MO1A 3MEFA 1SE2A 2K33A 3AB9A 2C9OA 3R8BA 1F9QA 1VQ6A 2K50A 4DXFA 4DK3C 1XPOA 4DNTB 5GAHC 3X3NA 1HNZL 2B2YA 1STEA 3PF5A 1MHWC 2AWNA 4XQNA 1VQ7A 1DOMA 1FR3A 1HNZQ 3GTGH 2YTXA 3PGZA 2DJGC 4DK6C 4GN5A 4KHZA 2N55A 2JA8H 4R4TA 1ILPA 1B2TA 4N8X1 3UE1A 2F52A 3MC0B 1XYIA 3H6MA 2ALYB 2BA1A 4RKBA 2UXDL 2DGYA 3P20A 1TWAH 3S16B 1TWFH 4DPGA 3CKIB 1D8LA 1BCPC 2UXDQ 1L0YB 4LF7Q 3GTOB 1BQQT 4EQPA 3BZCA 4DGZA 4KN4C 2RVLA 3PO2H 3M4OB 1Y1VH 5I9OA 1F2ZA 4R4OA 3KUPA 1RJTA 4IPCA 2WIIB 4DR3L 1GUOA 2IHFA 4NW2A 2F1MA 4OIKA 5C3WA 2K5WA 1SR3A 4YWKA 4DR3Q 3NENA 2JYOA 1GD7A 1GO3E 1FD7D 1VMCA 2EOTA 2PQEA 4HTHA 3PF4A 3DM1A 1VQFA 2R6GA 5G3LD 1ZKOA 5KEEA 4Y7NB 2VUMH 3HEJA 1Q82C 4B3TL 1PYBA 5KIXA 1B7YB 1AEXA 3IAYA 3S1MH 1DGSA 2AKWB 2DY8A 3I3CA 3I2ZA 1X54A 1I5FA 3OMGA 4B3TQ 2IWHA 2XN9C 2F0PA 1I50H 4LFCQ 2XNAC 2JA5B 3R93A 4X66L 2PNRC 5HY6A 1U9RA 2PW5A 1SYCA 2CFMA 1SNCA 3CW2C 1YNNC 2MHVA 3J7AV 2JEAI 4JBJA 2K5NA 4P74A 1B70B 1KAAA 4BXXH 1VQ8A 3J80i 3TP6A 3CCLA 4HMJA 1SYEA 5EPJA 1WOCA 1HPCA 1CQVA 1E24A 1STHA 1BO0A 1MI2A 4A3GH 2VW9A 4JPBW 1X32A 1UNSA 2KUMA 4TRDA 4BY1G 1E3PA 4H7BA 5KYLA 4DR4L 3GTLB 3QG1A 1CT1D 1SMYC 1Q1EA 3SK6A 3AEVA 4YIJA 3RUZA 4AYBE 5KNCA 2EYFA 4DR4Q 1C0AA 5ELNA 3HZXA 5I6YA 3W3AA 5CBEE 5CORA 5EPKA 1GUSA 1U4RA 2F0UA 3SK5A 2CH4W 4B9XA 2EYLA 4X6AH 4A3FH 4POGA 1KL9A 5ISRA 3MA2B 4XQJA 1TWGB 2CCZA 4L5RC 2PQAA 1YVCA 1HZCA 1KRSA 1G2SA 3H09A 3F2CA 3CC7A 5CV9A 3SEBA 3U4VA 3HOWH 1C7YA 2VNUD 4BWGB 3FHWA 1XPRA 3HOZB 5FLXc 3CU7A 2BE5C 3R2IA 3K58A 3L3OC 2MGSA 4IJLA 1STBA 2TMPA 2ZTDA 2IY5B 4HCSA 2OQKA 3DM3A 1R9TH 2O4XA 2EXZA 1M90C 3OHXC 2Y0SG 2JA6H 1H9SA 1VDZA 2AWOA 2PI2E 2HUGA 1EIFA 1BXTA 2A8VA 3STBD 3W1BA 1K73C 1K8MA 4A76A 3H3VH 2WACA 3PUYA 2NN6I 1AZPA 2WB1B 4F87A 2K4KA 1VQ4A 4HMIA 1CUKA 2YU9B 4CKCA 1WTWA 2OF1A 4A3IB 3K0XA 4HAEA 4RMFA 3U50C 3V2TA 2FMCA 3CP0A 3FP9A 1A2TA 3EIVA 2KECA 1YNJC 4RA8A 3KBXA 2QF7A 3ZYYX 4J8QA 1LT4D 1X65A 1I4HA 1ML0D 4JI2L 2BCOA 2F0DA 3AMUA 2F0FA 3RN5A 1PLFA 4GZYC 1K3BC 3I56A 3GTMH 4FF4A 4JI2Q 4ZKBB 3S1NB 3ULLA 1FL0A 3HS0C 1WFQA 4IZ8A 2R61A 3SVMA 4IFDG 4DV2L 1CSPA 3D0FA 3KLSA 4PV1C 2Q2HA 2XGTA 2GA4B 4R4IA 4DV2Q 4IUNA 3BVZA 3T13A 4WRDA 3F2DA 3Q8DA 3GTQH 2F0HA 2ZJQA 1XJVA 2L5TA 1QUQA 1SYBA 3S24A 1RKNA 3PUZA 5EPLA 1EIHA 2WB1E 1L0WA 2F0LA 1I6VC 1KDBA 1Q12A 4KI0A 3C46A 4LF9Q 4K14A 2JK8A 2WV6D 3MXNB 2K01A 4J15A 3NE5B 3GTPH 1LTRD 1I6HH 3GTKH 4DUZL 3CRKC 5BN4A 1D1IA 2I5HA 5C3EB 2ASBA 2RSNA 3C1FA 4XDXA 3OIPA 2Q2TA 1YJWA 1T5XD 1UE1A 2PMZB 3L7ZC 2PYKA 4A3JB 4BY1H 2R92G 1KTKA 2A68D 4JI8L 3AFPA 3S2DH 3I7FA 2Q2IA 1CKNA 3PIOA 2K14A 1MD2D 4JI8Q 1DCZA 3Q24A 3DXJC 3R2TA 2VQEL 4A3MB 5M3FH 5K36G 5AFWA 1B9MA 2KHIA 4ZYSA 5C44B 2A74C 3A56A 3U9SA 2KBNA 2VQEQ 2D2CC 1VQGA 1S5ED 3KLRA 2B2UA 1SJHD 3M9BA 5IGDA 5IP9H 5K5PA 3VR5A 3NSWA 2L55A 1H95A 2E2IH 1S5DD 5KNDA 1Y69U 2JEBI 1NUCA 2ZM6L 4JV5L 3RLNA 4I7ZC 1E2ZA 1L1OB 4H44C 3W2DA 1X3EA 1AH9A 1BCPB 2ZM6Q 1A6XA 2Z1CA 4TKOB 4JV5Q 2ICEC 3U4ZA 5GROA 2NVXB 5ELOA 1EEID 3GTJH 4BY7B 2ZTCA 4GOPA 1NSNS 2B2UC 1PZKD 4HIOA 1U0LA 2NZ1D 4A3DB 1A15A 3J80c 1K8OA 1TWHB 1EYGA 3NHHA 5LMNW 1QOHA 2KCCA 4BBRB 2WINB 5IIFA 1EL0A 4A3CG 3F2UA 3HG9A 3CXCA 3RMHA 3TEHB 5A35A 4GOPC 2A1AA 3I4NH 1XTCD 4RHSA 4FXDA 2OEOA 1YHQA 3NEMA 5C4ZA 1RD9D 3QJYA 2IX3A 2B2TA 3NTHA 3S1QH 3OWEB 1JB7A 5J22A 1VQBA 4B3RL 4IUQA 1X3QA 2YV5A 1SYGA 1QVFA 4P71A 4B3RQ 1LT5D 1F9RA 2D62A 4KY7A 5IY0A 2Z4IA 4QIWB 2HIVA 3D3RA 4K0KL 1FJGL 4H13C 4IFDH 5DLQE 2XWJB 4IALA 2B2TC 1TVXA 4A3KG 1VQLA 4K0KQ 1WYDA 4F7XA 1FJGQ 2PI2A 1ENCA 4P75A 1GM5A 4PNYA 3J81L 1I4GA 2KHSA 4C1NI 2ENBA 4YCUA 1VQOA 3HOVH 4DV4L 4LAAA 2EPBA 4YCWA 4PMBA 3PIP3 4L5TA 1KNEA 1Q46A 3QO2A 3E5SA 4DV4Q 4A3EG 1Y1WB 2XIWA 1MSHA 1YNXA 4L5SA 1TT2A 3PUVA 3VA7A 1ENFA 4XIGS 3FVQA 4RKLA 1EQRA 1WCMH 1PTOD 3I4MG 1F2LA 1K0RA 4RGNA 1UE6A 3IKJA 2A6HD 3ONAB 4KKSA 2VL6A 2R93B 2F3VA 4OELB 2E2JB 4JI0L 1BNZA 1QWYA 1PH1A 3S2HB 4A93G 2MJ8A 5C4JH 1VF7A 4JI0Q 5T1IA 5IGEA 2R92H 4K2LA 2PQAB 4IUTA 2HQLA 4DR2L 2ICIA 2RCNA 1O7YA 1W6KA 3CCSA 5FLMG 3HOXG 2LXJA 1HA5A 2UXBL 4BBSH 2B29A 4DR2Q 3KDFB 3ERQA 2A5HA 3HOYH 2B39A 3J7ZC 4NPSA 2OCEA 2UXBQ 1B50A 1S3OA 2J4XA 1SFOH 4R9WA 5K36H 4J6HA 1WTXA 4YWMA 3LX0A 4X64L 3A74A 3S14H 2LY7A 1B4OA 3K7AB 4KY6A 5C0XG 4M8AA 3LNNA 1VQ5A 1XNRL 4X64Q 3S1RB 1SE3A 3H0GG 4C3JG 3PSIA 1N32Q 4OO1G 1TU2B 1WJJA 2HQEA 4DUYL 1D6EC 1GUWA 2RKSA 2BOSA 4C56C 2ZXOA 1E2VA 2VS1A 2DN8A 1I4RA 1J9OA 4MN3A 1BOSA 2A69C 1OXTA 4DUYQ 1AZQA 1HCZA 2WAQE 5M5XB 1WTHA 2EQSA 5EGTA 2MUYA 1PH7A 2GVBA 3BDLA 4BA2I 2RDGA 4KD4A 3T51B 4DK0A 2LXKA 4JG2A 1WD0A 4G7OC 2XRSD 2F4VL 3P1HA 3BZDB 3D4WA 3S15H 1TS2A 3ERSX 4IUPA 3H15A 2F4VQ 3MEHA 5I4DA 3CC2A 2EYOA 3DUZA 1D5MC 4A4IA 2L1BA 1VQDA 4A3CH 1H9KA 4IPGA 3V05A 4XYOA 4RCOA 4JI3L 2I07B 2SEBD 2Z0SA 4JI3Q 1BR9A 2JXMB 2RDFA 1A3VA 4OWXB 4CHTB 2PNHA 3VYUA 2QW7A 1GOZA 4R1JA 5KNBA 4LW1A 3BDOA 4CKEA 4RHRA 5H1SE 1XMQL 2IX1A 4L6TB 4F88A 1TWCH 2F0GA 2K6AA 4C1NK 4G4KA 3J81i 4R4QA 2LSSA 1XMQQ 2N8NA 1SJED 4GNXA 1PDQA 3DWPA 1JJGA 2X6GA 1EQVA 5C4XH 1ESFA 1QUQB 1LO5D 2EIFA 5IGFA 4RH6A 3BU2A 1B44D 2QKIC 2EVBA 4EGVA 4A3KH 5BN5A 3BYTB 1X3PA 1B9NA 3BS1A 1HZAA 3PMFA 4WJ3M 5L37A 1VCIA 3K5NA 4ILWA 1YEZA 1MIUA 2Q8RE 1SE4A 4GNXC 2JA5G 4S3SA 4C2MH 1LT6D 1IL8A 2RA4A 4A3EH 2IL8A 5IYCG 1H9JA 4H0LC 2F0QA 3I70A 4K6DA 4KV6A 2C5CA 4WJ4A 1PHJA 2QGQA 4AQYL 3PO2B 3A7AB 2JA7B 3SK4A 4EQOA 1D7QA 1ONLA 4PMCA 1M4VA 4ZKCB 2I0QA 4AQYQ 3K59A 1CKNB 1L1OA 1A62A 1QB5D 5JEAG 1QVGA 2XVSA 2L0CA 2E2HH 2KCNA 1UUPA 4A93H 4EX5A 3LWUA 1E0BA 5IT9E 4APVA 1TS4A 4OHJA 1RIPA 2F3IA 4K8IA 2ZTEA 5FLMH 1B1ZA 1PZJD 1RODA 5CV7A 1S5CD 2VUMB 1U4MA 4P72A 2I5MX 2EY5A 4LF7L 2QEXA 4LUVA 3FEWX 5IP7G 1L1OC 1RF2D 5M5WH 2K03A 3I73A 3M3YH 2B63B 1NAPA 4QJFA 1ICFB 3U9OA 1FGUA 1E1OA 2B8GA 1CKMA 1TKWB 3CCMA 3A7LA 4FYDA 1EIYB 2DNCA 2WKDA 3H0GH 4C3JH 1PTOH 1KNAA 2ZXRA 5NUCA 4GOPB 1DYQA 3HOZG 1TS3A 3T16A 2MNAA 1SNQA 2CQAA 3S9WA 4IQZA 5DAUA 3ND8A 1M1KC 4GN3B 4AYBB 5GADC 1PZID 3G7LA 2EJGC 1IYUA 3CQZB 5EKKA 4UAIA 4Q5VA 3C1EA 1BUVT 4LFCL 2EZVA 1EQQA 5JVG3 3M4YA 4XXEA 5J39A 1RTNA 1SRUA 1JOKA 3BVGA 1SBBB 4N9PA 2WB1G 1LTTD 1EY6A 1VQHA 2DUDA 4A3IG 2NVQH 2UUAL 4GKJL 2Q8TA 4UPAA 1IYJB 5M3MB 2CKZB 3KF6A 1WTRA 1CSQA 4DN4M 2UUAQ 4GKJQ 1ZYRD 2N78A 2PZTA 3PQIA 3GTOH 1NE3A 3J80E 5JJZA 4HJ7A 4HJAA 1SE8A 1SYFA 4G7ZC 5GAGC 4A3BH 1P8LA 1E1TA 3T1YQ 1EFWA 4TQUS 3CCQA 1EOVA 3FPUB 2LS01 4BA1I 1D5XC 1SXTA 5C6AA 2OWOA 4IUVA 3IFDA 2FXQA 1R9TB 3F1ZA 4NDXA 3HGBA 2JA6B 4XT1B 3MVVA 4X65L 1F77A 3Q6SA 4DV6L 4Y7NH 3KK7A 1I3QH 1GVPA 1U4PA 4DAYB 4X65Q 4DV6Q 4ULLA 2KVMA 3KDFA 2TSSA 2EYHA 3JAMc 4FXKC 4B3MQ 1DD2A 4KKTA 1Q8KA 2JA5H 5IYCH 1SNDA 5EBDA 1EWIA 1BBUA 1VQMA 2F0KA 3EFXD 1RHPA 1S40A 1HNXL 4LF4L 1V1PA 4X3KA 3NWSA 5LHY1 5C3EG 1WI5A 3HKZB 1CHQD 1DZ1A 4GN4B 1HNXQ 4LF4Q 1CHPD 1BCPD 5JEAH 4QGUA 3KJPA 1FNWA 3RLOA 4U673 4A3JG 4XT3B 4QF4A 5FO8B 2HCCA 1PVOA 2IPKD 3KLWA 3HOUB 3EVQA 2WFWA 4KLKA 4DV7L 1RL2A 4A3MG 1K0SA 2NYZD 4DAPA 5GAEC 5C44G 1HH2P 1PYSB 3E0JA 1TWGH 4LF8L 1HQRD 4DV7Q 1FNUA 4OX9L 4DV5L 1QZGA 4LF8Q 1HZ9A 3MXPA 4UP8A 1WVLA 2LKVA 1YHBA 3PUWA 1O7LA 3D4RA 5FO7B 4OX9Q 2G9HD 2GN5A 1CQFA 1PRTF 4KD3A 4DV5Q 4Z9CB 1I4QA 2EYPA 3KYHC 5IODA 4P73A 3HOZH 5J3BA 1TY0A 4LMQD 4CBVA 1I6HB 1JORA 1HR0L 3HKZE 2MFIA 1HUMA 2A6EC 1YNND 4BY7G 1HR0Q 2ATWA 3PIPA 3SR1A 1VQAA 4JBKA 4A3DG 4QQBX 3CCUA 2Q8IB 1KDAA 5CYUA 2F0WA 3K0YA 1QILA 3SK8A 4IOAA 2LFNA 3KJOA 5JJKA 1Z6HA 5IYBG 1F2MA 1JC7A 3FPPA 2UXCL 4BBRG 4O42A 1ZEQX 4LF9L 2CQOA 1W6JA 2JN4A 1IBLL 4FF2A 2SDFA 5IT9c 1SMYD 3QB3A 2LMCB 5M3FB 2UXCQ 3I4OA 4ZUJA 3X3MA 2YU9H 1IBLQ 4A3IH 4O0AA 4ABNA 4K5WA 4QUFA 3D6WA 2NBFA 3MWYW 2AMCB 5CV6A 5A2QE 3WOEA 2SOBA 4C3HG 5JAVA 1G91A 5JJLA 2E8GA 4NXML 4GNXB 3Q0AA 3QIAA 5C3XA 2E2IB 4U68A 4ZRZA 1KQSA 1Q3LA 2Z9HA 4NXMQ 4IPDA 2R7DA 2F0IA 3TZDA 5KYIA 2BH2A 1IZ6A 1T5EA 1N8RC 3SHLA 4HJ8A 2UU9L 3S1NH 2IW3A 4MZ9A 1C8CA 2L15A 1CM9A 2PZUA 3D6CA 5G3LF 2UU9Q 4BS9A 3A55A 5FOBB 4E6IA 3UE0A 2KQ3A 1NR4A 4CJ1B 4DK1A 3VR4A 3CHBD 2K28A 1F9PA 2K04A 4KHVA 1JR0D 4RAUC 1Z7TA 1QVCA 3HKSA 3G71A 4OWWB 2E74C 3RZDB 2IHEA 1P16A 5EKLA 4GLXA 4IFDJ 1PTOC 4P2CB 3FKIG 1Y1WG 4JOIA 1HTPA 3I4NB 1HTLD 3IL8A 4LFBL 1SSOA 3DMUA 3NPPA 4LWCA 1K8GA 4ALPA 2C35B 2DNEA 5IWAL 4PMWA 3U58A 4LFBQ 3S1QB 1QNKA 1Q8IA 3A8JE 2D5DA 1TXYA 3NTIA 1HZBA 5IWAQ 2EE1A 3IRBA 4AIMA 1CKOA 2R93G 1EFID 5E7NA 2VQFL 4DXGA 5JVH3 2VZAA 4PQXA 4JBWA 3PCOB 4JOIC 4GS3A 2CH4A 4LFAL 4A3JH 2VQFQ 1NCVA 2ZT9C 5IYDG 3RZOB 4MTNA 4LFAQ 1PH4A 4FNFA 2KOLA 4IO9A 4ME5A 4WORA 1DOLA 2F0JA 4IOCA 2NN6G 1KABA 3TSSA 1KLGD 4A3MH 4IUUA 2NWGA 3E6ZX 4V190 3HOVB 1TS5A 3A5ZB 4YCVA 4J1MA 1KC8C 4C3HB 1VMPA 3G4SA 4JBMA 1JQYD 2R7ZB 3S17H 4TSSA 2IX0A 1WCMB 4CDEC 4QL5A 1PA6A 4K8JA 1JJCB 1BKBA 2NVTB 4I7AA 5FLXL 1YHAA 1Y8NB 2NVXH 5I2XA 1NMGA 4BY7H 4RG1A 2HD3A 2P5ZX 1V1QA 3NBHA 5HGTA 1IW7C 3ULJA 2QDBA 4QMGA 4A3DH 1Z9FA 1XMOL 4JC0A 2RF4A 2KEDA 2K05A 4HN7A 1D2BA 2F0EA 1L2FA 3KF6B 1VQ9A 3ZJYC 4QY7A 1XMOQ 4BBSB 4RWSC 3VR2A 1Z47A 4BBRH 3FKIB 2VB2X 3HOYB 2G5DA 3F2BA 4DAYA 1J6QA 3T56B 2XRQD 2CW0D 3VR6A 5CGKA 2K75A 5FO9B 4A75A 1ET9A 1WTQA 3OOCA 1JE4A 5D65A 3VR3A 2F3WA 2WAQB 3DLLA 2ZJPA 4X3TA 2BDOA 3E3XA 2XWBB 1SDFA 3CCVA 4ZUIA 4L63B 2JQOA 3I4LA 3H3VC 4WJWA 1EYCA 1LTLA 2NVYB 2HIXA 4TVAB 1BF4A 3BZKA 1HRJA 1SYDA 2B2WC 4JYAL 1H9MA 1B53A 3H3VI 2K5QA 3KLSX 2NZOA 4DR7L 4JYAQ 4KHPL 3TS0A 1WD1A 1GKHA 1EYAA 4MNOA 3TDQA 1N32L 3PO3B 3J81j 1PRTC 1IBKL 1UE5A 5GQOA 3RD4A 1LV9A 2ES2A 4DR7Q 4KHPQ 2OTLA 1SAPA 5IGCA 1IBKQ 5EKIA 3D31A 1V1PB 2EY6A 2RSOA 1QCBD 1HXYD 2NTTA 1Y1WH 2PPBC 4HIDA 1QNUA 3W5OA 2BH8A 2L12A 3P75A 5E4WC 5ELEA 1SN8A 2AQ3B 4RGOS 3K5MA 2UUBL 4EQNA 3PIO3 1VQPA 1EY7A 3DEPA 2HHHL 2FHTA 3PO2G 2J7ZA 2JA7G 1EZ8A 5D3DA 2UUBQ 2F03A 2HHHQ 5M5YB 2G9DA 5ELDA 2R93H 3D8GA 2E2JH 1Y8OB 3QOJA 3JAME 4C3IB 3MFGA 1EY9A 3CF5A 1JICA 1TY2A 2ID0A 2J0TD 2NZHA 5C4XB 3G6JB 3NQIA 2M00A 4KN7C 1V43A 1PFNA 2VUMG 1RTOA 3AYHB 1AP0A 1EWHA 3OPOA 1XNQL 5DEHA 1V8QA 4O2DA 1XX8A 5CV8A 1S72A 1ASYA 4JI7L 5DNFA 4NKLA 2B63G 3K7AH 4KJNA 1XNQQ 1B3AA 1K83B 2F0NA 2R3ZA 4K6LA 1EYDA 2H1EA 4JI7Q 2KJXA 2FJ2A 4GKKL 1UEBA 5LMUL 1X56A 2CHBD 4I65A 4GKKQ 5LMUQ 3SDZA 4BXXG 3J81E 4YWLA 3A54A 3FMCA 3OTOL 1IYVA 2CVRA 2PW7A 2YTVA 4AYBG 2K5HA 1YI2A 1WTVA 5TSSA 4DV1L 3OTOQ 3HP3A 1IBML 1C9OA 1JWMD 3NK9A 2E2HB 2EYMA 1X55A 3MTSA 3RLFA 1QG7A 2NTSA 5BN3A 4DV1Q 3GTGB 1IBMQ 5JJIA 2AUJD 4YY3L 2MPMA 1KXLA 3TP7A 1GJXA 2JA8B 4DNRB 1D5ZC 4PZ7A 2KA7A 1HUNA 2F0MA 3M85A 1A0IA 3M7GA 4YY3Q 3J80L 2K5VA 4OEMB 5I9PA 1IKLA 1EU3A 3OW2A 3ICEA 4DV3L 1TWAB 1TWFB 3TMEA 1SMXA 5M3MG 4DV3Q 3TS2A 3M3YB 4PZ8A 1AN8A 3I4MH 5C4HA 1LYLA 3WOFA 4ODGA 1PH6A 1L0XB 1DONA 4FP5D 2F0SA 2YYZA 1PTOB 1Y1VB 3ITPA 3UI2A 4ZK9B 2Z6BA 5I2YA 2H4OA 1PH8A 3OIQA 4ZQ3A 5CC4A 5FJ8G 2KHJA 2QILA 3CAMA 1STNA 4B3SL 1MJCA 1Q1BA 3OW7A 1GHKA 3GDEA 2FINB 4B3SQ 3I8ZA 4MHEA 3HOXH 3O13A 3MAQA 1G6PA 1NY4A 2B2VA 2JA6G 2A69D 4DFAA 2A19A 1XXGA 2X69A 4G57A 3J7AF 5J1ZA 3S1MB 1MKHA 2QEJC 3EBEA 5C0XH 1I50B 1VQCA 1JB3A 4JI4L 5FKAC 1PH5A 5AJ3L 1NTGA 1PYWD 1BBXC 1UEAB 3OYYA 4DAVA 3Q22A 4JI4Q 3VA5A 4OO1H 5AJ3Q 1LT3D 4MTKA 3RNUA 1Q7YC 2NVQB 4NMZA 1PTOF 2B2VC 1R4PB 1QJOA 4UP9A 2B2YC 4JI1L 1PFBA 1AE2A 4G7HC 2PO4A 4LNQA 4ZAIA 4JI1Q 2JA7H 3VYSA 1LTID 4A3GB 3STBC 1LM0A 3HKZG 4OXPA 4A3BB 1I94L 1PMRA 2FFKB 2KEEA 1SROA 1YJNA 1LTGD 1LABA 5E4XA 1I94Q 1MBYA 1KD1C 4IFDI 1F9SA 4ZLTF 1U5KA 1DXMA 3I72A 4JK1C 4A3FB 2EYJA 3K5OA 2VY3A 2F0VA 3HOUG 2RHSB 3WDNA 3KF8B 1I3QB 3L0OA 5JEAJ 3CCRA 5T1GA 1EZ6A 4RCNA 2NUCA 3S16H 3A0JA 1B8AA 3PUXA 2B63H 4CKBA 1KHIA 3HOWB 1DOKA 5EQ0A 3T1YL 3GD7A 3TQYA 4FF1A 2K32A 3KBGA 5JOBA 5IE8A 3M4OH 3CD6A 4X66Q 3NBHB 1OO9B 1S4ZA 2XSCA 3TP5A 1JWUD 2D9UA 4FVMA 1RCVD 3V96A 3WWVA 2B3GA 3SE0A 5CV4A 2Q2UA 4OONA 2BDNA 4ZCKA 4V0BA 2A73B 2AHOB 1VQKA 3CQZH 1HA6A 2IJ0A 4K5VA 3TP8A 4B3ML 3CRLC 1IL2A 1QE6A 5A2QL 2KCTA 5EJWA 1JT8A 2KENA 1G2TA 1IKMA 3NBIA 3AQQA 4DV0L 3NUCA 1NMFA 5ELCA 5LL6S 1EQTA 5M3FG 1CA6A 4DV0Q 1T9HA 4KJOA 3E0EA 4RGMA 4NXNL 1Q81C 4M1UB 2YTYA 3R3OA 5M3MH 4UHVA 1PRTB 3NP8A 4NXNQ 2V4DA 3TRZA 5IP9G 3K80C 4IN3A 2A68C 1CZWA 1ICWA 1EWCA 2HDLA 3GTMB 3URYA 1EEFD 1DJRD 2K7VA 3EJIA 2Z4HA 5FJ8H 1KAWA 2RHQB 3HFZB 3ULPA 3GTLH 4EVOA 2PCFB 2PZWA 5BR8L 2AQ2B 4A3LG 5I6WA 2E5LL 3J81c 5BR8Q 2OXPA 5IGBA 1YITA 3GTQB 5IOCA 5CBAE 2E5LQ 4QUCA 4IJHA 1JOOA 1CK1A 1PFMA 5IP7H 1NBWA 3DWAA 3TZUA 4FF3A 4N8FA 3UDXA 1A63A 3TREA 2HT1A 5D14A 3RR5A 1OTCA 1X6OA 4UDUC 3BVMA 1YZ6A 2AQ1B 3DHQA 1CTMA 1OXXK 3SGIA 4OWTB 3QR8A 3M4PA 5LMNL 1C4QA 3I4NG 3MXGA 4JW0A 3G48A 3GTPB 5E1FA 5LMNQ 4DKAC 2ZJRA 3GTKB 2Z8LA 4ID6A 3JC66 1LTBD 2JSOA 2RCFA 3AU7A 1STYA 1I4PA 2CWAA 2DY7A 3ND9A 1LTSD 1KLUD 4KTAA 4XTCS 4BY1B 3LGJA 2F4IA 2WKCA 3EQLC 1O80A 4CDFC 3S2DB 1A8VA 1E22A 1LLRD 3QOLA 4DR6L 1A3UA 3GO5A 2M9VA 2E2DC 1GUTA 4DU9A 4RGTA 2JJQA 4DR6Q 3HOUH 5JPNC 2K52A 3T1HL 5DM63 3T4AC 3DWQA 2O5IC 4DR5L 1J8IA 1FYCA 2EJFC 3H94A 5DM73 4LUZA 3HOVG 3T1HQ 4HJ5A 1I4XA 1F2YA 4DR5Q 4HSVA 1WTOA 1CI3M 2D0PA 3UDFA 4O1NA 2R7ZG 5F2DA 3ER0A 3CCJA 2AUKA 1WCMG 2N3SA 4DR1L 5CR3A 3GTJB 4L5QA 1K3RA 3W1GA 1EU4A 3M4QA 1Y8PB 1BVSA 2HCIA 4XQQA 2BE5D 2EY2A 4DR1Q 3OWFA 3BDCA 2VXWA 2Y0SB 3I91A 4RFBA 4DUZQ 2QA4A 2UUCL 2KCMA 3FRPB 4Q0FA 4YHHL 2N49A 1PFSA 2L4NA 1PH9A 3KFUA 1EY5A 2UUCQ 3C2PA 2NB0A 2HDMA 2CW0C 4YHHQ 5JPMC 3EA6A 4BBSG 3MFYA 3MXUA 5HGQA 1X9NA 3D4DA 3HOYG 5C0XI 1TIID 2A6HC 1N33L 3E9IA 1STGA 3F8TA 3FDTA 2O5JC 2K5DA 3IFTA 1KIXA 1E7ZA 5IGGA 3NELA 1N33Q 4OO1I 2WAQG 5ELBA 1V1OA 4R4CA 5C3EH 3I90A 1W3SA 1KDCA 2JE6I 1YNJD 3S17B 3AFQA 5COYA 5C5LA 2D0OA 2E76C 1JCKB 1HNWL 4CJ2C 4QCLA 4CDDC 3VYRA 2L9HA 1HNWQ 4JI5L 3K6OA 4QB4A 1IXRA 4DF7A 1UAPA 4PG3A 1K9MC 1D1KA 3J7A5 2QCPX 4KY5A 3GV3A 2Y0SE 1A3TA 2SNSA 1JJ2A 1GUNA 3PV0A 4A3LH 4JI5Q 1BDOA 2PMZE 1MJEA 3NQTA 3E9HA 4Y52H 2MQHA 2A6ED 3DEOA 5C44H 3M7NA 4KMUC 1NNXA 4FXGC 5KRUA 4IURA 4CJ0B 1ILQA 2JA9A 2ZXPA 3PO3G 1EY4A 4OGQC 3GP7A 3KF8A 4CGYB 3RZDH 4JCVE 1VQIA 3RN2A 1CA5A 2RBMA 1HR0W 2EJMA 1AFPA 2OT2A 3BJUA 1YIJA 1BBWA 1G6ZA 4LJZC 3JAML
chains in the Genus database with same CATH topology
4O2DA 4JI7L 1S72A 1PV4A 1ASYA 3UDIA 3ULLA 1FL0A 4HJ9A 1EQQA 1WFQA 3CMAA 2B63G 3K7AH 1XNQQ 1OXSC 3VDYA 4JI7Q 1SRUA 4IFDG 4DV2L 1CSPA 3D0FA 1G51A 4GKKL 2Q2HA 1UEBA 2WB1G 1UWVA 5LMUL 2XGTA 4R4IA 4DV2Q 1X56A 1VQHA 2DUDA 4A3IG 4JI6L 2UUAL 2NVQH 3F2DA 3GTQH 3Q8DA 4GKKQ 1PH2A 4GKJL 3G6EA 1HJPA 1IYJB 4UPAA 5LMUQ 1XJVA 2ZJQA 1VQNA 2CKZB 3KF6A 4BXXG 1QUQA 4YWLA 1CSQA 1TWHH 3S24A 3OTOL 4JI6Q 2UUAQ 4GKJQ 3PUZA 2N78A 2YTVA 2WB1E 1L0WA 5IYBH 5C4XG 3GTOH 1NE3A 4AYBG 2K5HA 2BA0A 1YI2A 3RZOH 3CPFA 4DV1L 3OTOQ 4HJ7A 2H5XA 4HJAA 1SE8A 1Q12A 1IBML 4A3BH 5GAGC 1C9OA 4KI0A 1P8LA 1X55A 2V1CC 1N9WA 1E1TA 3RLFA 3T1YQ 4DV1Q 1EFWA 4TQUS 4LF9Q 4H02A 3CCQA 1EOVA 1IBMQ 5JJIA 2JK8A 4YY3L 1KXLA 3MXNB 4J15A 1KRTA 3GTPH 4BA1I 4LUOA 4POFA 1I6HH 1W2BA 4PZ7A 3CMEA 4DUZL 3M85A 3GTKH 1A0IA 4C3HH 2OWOA 4YY3Q 2I5HA 4FDBA 2ASBA 2FXQA 2K5VA 2MO0A 3F1ZA 2I5LX 3KOJA 1X3GA 3OW2A 3ICEA 2OTJA 4DV3L 4X65L 2WP8J 2Q2TA 1AE3A 1YJWA 2R7FA 1UE1A 4DV6L 2R7ZH 3L7ZC 4Y7NH 1I3QH 2R92G 4BY1H 1GVPA 1NJIC 1SMXA 4DAYB 5M3MG 4DV3Q 3TS2A 4X65Q 3EN2A 4PZ8A 4JI8L 1X3FA 3AFPA 4DV6Q 3I4MH 3I7FA 3S2DH 1UE7A 2Q2IA 5EAYA 1LYLA 1CKNA 3KDFA 3PIOA 4GLAC 1PH6A 4DAMA 2K14A 3JAMc 2NVTH 2YYZA 4JI8Q 4B3MQ 4PZ6A 3L2PA 1Q8KA 2JA5H 1PH8A 1Y14B 2VQEL 5FJ8G 2KHJA 5M3FH 5K36G 3CAMA 2KHIA 5IYCH 4QIWE 1EWIA 1G291 1MJCA 4B3SL 1BBUA 2KBNA 1VQMA 1N34L 2VQEQ 1VQGA 3CPWA 3CCEA 1S40A 1Q1BA 2JA8G 3GDEA 1HNXL 4LF4L 4ME3A 4B3SQ 3M9BA 4UY8C 5IP9H 1N34Q 3HOXH 5C3EG 2CWPA 1WI5A 1G6PA 1NY4A 4GN4B 2EXDA 1HNXQ 4LF4Q 2JA6G 2A19A 3B6YA 3FKIH 2E2IH 1H95A 4LF5L 2JEBI 4QGUA 3KJPA 2XTIA 3RLOA 2ZM6L 3K81C 4JV5L 3RLNA 4A3JG 1L1OB 1X3EA 4LF5Q 1MKHA 1AH9A 3EBEA 1YJ9A 2ZM6Q 4JV5Q 1VQCA 4JI4L 2Z6KA 2OQ0A 5GROA 3U4ZA 1PH3A 1PH5A 5ELOA 5AJ3L 3GTJH 1NTGA 4HIMA 1JE5A 3OYYA 2ZTCA 4GOPA 2GVAA 1PVOA 3KLWA 1Y1VG 4JI4Q 4LF6L 2WFWA 4KLKA 4HIOA 1XNRQ 5AJ3Q 4DV7L 1U0LA 1Q7YC 3RNUA 1RL2A 4A3MG 3J80c 5GAEC 5C44G 3S2HH 1HH2P 1PYSB 4GLVB 4LF6Q 1TWGH 4LF8L 1FVIA 4UP9A 4JI1L 4DV7Q 1EYGA 1AE2A 4OX9L 5LMNW 4DV5L 1QZGA 5IYDH 4LF8Q 4LNQA 1HZ9A 4UP8A 3PUWA 1YHBA 2NVYH 4JI1Q 2JA7H 4A3CG 1XTDA 1JMCA 3STBC 1LM0A 3HKZG 2GN5A 4OXPA 1V9PA 2Z6KC 4DV5Q 1I94L 3CXCA 1N36L 4IPHA 1SROA 3TEHB 4GOPC 1YJNA 3KYHC 2A1AA 3JAMi 3I4NH 4P73A 3HOZH 1I94Q 1N36Q 1KD1C 1YHQA 4IFDI 5J3BA 1QZHA 3NEMA 1U5KA 1HR0L 3HKZE 2MFIA 3I55A 1J5EL 3PO3H 1Q86C 3S1QH 4BY7G 1JB7A 1YBYA 1HR0Q 2ATWA 3S1RH 1VQBA 2VY3A 3PIPA 4B3RL 3HOUG 1J5EQ 2RHSB 3KF8B 3L0OA 1VQAA 2YV5A 5JEAJ 3CCRA 4JBKA 4A3DG 1EUJA 3CCUA 1QVFA 4P71A 4B3RQ 4QQBX 2D62A 3S16H 3K8AA 5IY0A 4HIKA 4IOAA 3A0JA 5C0XJ 1B8AA 1OXUA 3KJOA 3PUXA 5M5XH 2B63H 5JJKA 5IYBG 2HIVA 1KHIA 2UXCL 1VQJA 4BBRG 3T1YL 4K0KL 3GD7A 4LF9L 1FJGL 5DLQE 2CQOA 4A3GG 3TQYA 1IBLL 5IT9c 4A3BG 4A3KG 5IE8A 3M4OH 2UXCQ 1VQLA 4K0KQ 3CD6A 3I4OA 1WYDA 1FJGQ 5M5YH 2YU9H 2PI2A 4P75A 1GM5A 1LUZA 1IBLQ 1O7IA 4A3IH 4O0AA 4X66Q 3NBHB 1ASZA 1SLJA 4NB3A 4X62L 4YCUA 4UP7A 4C3IH 1VQOA 3WWVA 3HOVH 1VS0A 2AMCB 3A5UA 2B3GA 4DV4L 1XPUA 4YCWA 5JJLA 2E8GA 4X62Q 4NXML 4GNXB 4L5TA 2Q2UA 1Q46A 4OONA 4DV4Q 4A3FG 4A3EG 3K7UC 1K8AC 2IT1A 1YNXA 1KQSA 4L5SA 2AHOB 3PUVA 4IPDA 1VQKA 2R7DA 4NXMQ 4XIGS 1EQRA 1VQEA 3CQZH 2BH2A 1IZ6A 1N8RC 4AH6A 1WCMH 4HJ8A 2UU9L 4B3ML 3CC4A 1IL2A 3I4MG 4EQ5A 3S1NH 1K0RA 2KCTA 4MZ9A 2L15A 1UE6A 1JT8A 1OXVA 2KENA 2VL6A 1K83H 2UU9Q 3HOWG 3AQQA 4DV0L 3UDGA 1NMFA 3UE0A 4JI0L 5M3FG 4DV0Q 1PH1A 4DNIA 2MO1A 4A93G 3MEFA 5C4JH 1T9HA 4NXNL 3E0EA 1Q81C 4JI0Q 2R92H 2YTYA 5M3MH 1QVCA 1VQ6A 3HKSA 3G71A 4OWWB 2PQAB 2HQLA 4DR2L 2RCNA 4NXNQ 2K50A 3TRZA 3CCSA 5IP9G 2IHEA 4DK3C 3K80C 5FLMG 3HOXG 1P16A 1XPOA 2LXJA 4GLXA 2UXBL 4BBSH 4IFDJ 2B29A 4DR2Q 3FKIG 3KDFB 4JOIA 1Y1WG 5GAHC 3HOYH 1HNZL 3J7ZC 4NPSA 3PF5A 2OCEA 4LFBL 2UXBQ 1S3OA 5FJ8H 1KAWA 2AWNA 2RHQB 3HFZB 3ULPA 4YWMA 1SFOH 4LWCA 4X64L 1VQ7A 1K8GA 3A74A 3S14H 4ALPA 1HNZQ 5C0XG 2YTXA 3GTGH 3PGZA 3GTLH 2C35B 4DK6C 4GN5A 5IWAL 4PMWA 3U58A 4LFBQ 5BR8L 1VQ5A 4KHZA 1XNRL 4X64Q 2JA8H 4R4TA 1TXYA 4A3LG 1HZBA 3UE1A 3J81c 3H0GG 2F52A 2E5LL 3PSIA 1N32Q 5IWAQ 3IRBA 4AIMA 5BR8Q 1CKOA 4OO1G 2R93G 1WJJA 2ALYB 1YITA 5E7NA 2BA1A 4DUYL 2VQFL 2E5LQ 2VZAA 4IJHA 2UXDL 2DGYA 2VS1A 4JBWA 1TWAH 3PCOB 4JOIC 4GS3A 1TWFH 4DPGA 5IP7H 1NBWA 1OXTA 1D8LA 4DUYQ 2VQFQ 4A3JH 4LFAL 3UDXA 2WAQE 1A63A 3TREA 2HT1A 2UXDQ 4LF7Q 5IYDG 2EQSA 3RR5A 1X6OA 3BZCA 1OTCA 1PH7A 3PO2H 1YZ6A 2GVBA 4MTNA 4BA2I 4LFAQ 3SGIA 1OXXK 1PH4A 4OWTB 2LXKA 4JG2A 4IO9A 1Y1VH 3M4PA 5LMNL 2F4VL 4R4OA 3I4NG 4IOCA 2NN6G 4IPCA 4A3MH 3S15H 4DR3L 3G48A 3ERSX 2IHFA 3H15A 5LMNQ 2F4VQ 3A5ZB 4DKAC 4YCVA 2ZJRA 1KC8C 1SR3A 3JC66 3CC2A 4YWKA 4DR3Q 3NENA 1GD7A 1GO3E 4A4IA 3PF4A 2CWAA 1VQDA 4A3CH 1VQFA 2R6GA 3G4SA 4JBMA 4IPGA 2VUMH 4JI3L 3S17H 1Q82C 4B3TL 4XTCS 2IX0A 1PYBA 1B7YB 3LGJA 3S1MH 4QL5A 1PA6A 1DGSA 1A8VA 2AKWB 2Z0SA 3I2ZA 4JI3Q 1X54A 1I5FA 4B3TQ 1JJCB 1E22A 1BKBA 4OWXB 2PNHA 1I50H 4DR6L 3GO5A 4LFCQ 1YHAA 4R1JA 2NVXH 1NMGA 4LW1A 4X66L 4RG1A 4BY7H 1V1QA 5HY6A 2JJQA 5H1SE 1XMQL 2IX1A 3HOUH 4DR6Q 2CFMA 3CW2C 2K52A 3T1HL 1TWCH 3ULJA 3J81i 4R4QA 4A3DH 2JEAI 2LSSA 4DR5L 4JBJA 1XMQQ 1Z9FA 1XMOL 4JC0A 2K5NA 2N8NA 2RF4A 1B70B 4LUZA 4P74A 4GNXA 3T1HQ 1VQ8A 3HOVG 4BXXH 1JJGA 4HJ5A 3J80i 3CCLA 1L2FA 4DR5Q 3KF6B 1VQ9A 3ZJYC 4QY7A 1QUQB 1WOCA 5C4XH 1XMOQ 2EIFA 1Z47A 1E24A 4BBRH 2D0PA 3BU2A 4A3GH 2VW9A 3F2BA 3UDFA 1J6QA 2R7ZG 4A3KH 4BY1G 1E3PA 3ER0A 3CCJA 4DR4L 1WCMG 2K75A 1HZAA 1Q1EA 4A75A 3AEVA 2N3SA 4WJ3M 4AYBE 1VCIA 4DR1L 4L5QA 1K3RA 3W1GA 4DR4Q 1C0AA 1YEZA 1MIUA 5ELNA 3M4QA 1BVSA 3DLLA 2ZJPA 4GNXC 4DR1Q 2JA5G 4X6AH 4C2MH 3CCVA 4A3FH 4POGA 4OX9Q 1KL9A 4DUZQ 4A3EH 2QA4A 2UUCL 5IYCG 2CCZA 2KCMA 4L5RC 2PQAA 4YHHL 2N49A 1YVCA 1PFSA 1PH9A 3KFUA 2UUCQ 2JQOA 1HZCA 1PHJA 1KRSA 4WJ4A 2QGQA 4AQYL 1LTLA 3F2CA 3CC7A 4YHHQ 1D7QA 3U4VA 2HIXA 4TVAB 4BBSG 2I0QA 3HOWH 3BZKA 1C7YA 5HGQA 4AQYQ 1CKNB 1X9NA 4JYAL 3HOYG 2VNUD 1L1OA 1A62A 5JEAG 3FHWA 5C0XI 1XPRA 1QVGA 1N33L 3E9IA 3H3VI 3F8TA 2E2HH 5FLXc 2NZOA 4DR7L 4JYAQ 4KHPL 4A93H 3TS0A 1GKHA 4MNOA 1E7ZA 4EX5A 1KIXA 3NELA 1N32L 1N33Q 4IJLA 3J81j 1IBKL 1UE5A 5GQOA 2ES2A 4DR7Q 4OO1I 4KHPQ 2ZTDA 2IY5B 4APVA 2WAQG 1RIPA 2F3IA 2OQKA 2OTLA 3DM3A 4R4CA 2ZTEA 5FLMH 5C3EH 1IBKQ 3D31A 1R9TH 1W3SA 2JE6I 2JA6H 3AFQA 1M90C 2Y0SG 1Y1WH 2D0OA 4P72A 2I5MX 4LF7L 2QEXA 1HNWL 4HIDA 2AWOA 4LUVA 2PI2E 5IP7G 1L1OC 2BH8A 1EIFA 3W5OA 5M5WH 2A8VA 1SN8A 3M3YH 3STBD 3W1BA 1K73C 4QJFA 2UUBL 1HNWQ 4JI5L 4A76A 1FGUA 1IXRA 1VQPA 3H3VH 1E1OA 4PG3A 2HHHL 1K9MC 3J7A5 2JA7G 1CKMA 3PUYA 3PO2G 3CCMA 2NN6I 2Y0SE 1EIYB 2UUBQ 1JJ2A 3PV0A 4A3LH 4JI5Q 3H0GH 4C3JH 2K4KA 2PMZE 1MJEA 1VQ4A 2HHHQ 1CUKA 2R93H 4GOPB 3HOZG 2E2JH 3K0XA 4RMFA 3E9HA 3U50C 4Y52H 2MQHA 3CP0A 3FP9A 5C44H 3CF5A 3M7NA 2MNAA 3EIVA 2JA9A 3PO3G 2ID0A 2NZHA 1M1KC 4GN3B 1X65A 5GADC 3RZDH 4JCVE 1VQIA 4JI2L 3RN2A 1V43A 1HR0W 3RN5A 2VUMG 3AYHB 1YIJA 3BJUA 3GTMH 1BBWA 3I56A 1XNQL 4JI2Q 4LFCL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O2D A;  4JI7 L;  1S72 A;  1PV4 A;  1ASY A;  3UDI A;  3ULL A;  1FL0 A;  4HJ9 A;  1EQQ A;  1WFQ A;  3CMA A;  2B63 G;  3K7A H;  1XNQ Q;  1OXS C;  3VDY A;  4JI7 Q;  1SRU A;  4IFD G;  4DV2 L;  1CSP A;  3D0F A;  1G51 A;  4GKK L;  2Q2H A;  1UEB A;  2WB1 G;  1UWV A;  5LMU L;  2XGT A;  4R4I A;  4DV2 Q;  1X56 A;  1VQH A;  2DUD A;  4A3I G;  4JI6 L;  2UUA L;  2NVQ H;  3F2D A;  3GTQ H;  3Q8D A;  4GKK Q;  1PH2 A;  4GKJ L;  3G6E A;  1HJP A;  1IYJ B;  4UPA A;  5LMU Q;  1XJV A;  2ZJQ A;  1VQN A;  2CKZ B;  3KF6 A;  4BXX G;  1QUQ A;  4YWL A;  1CSQ A;  1TWH H;  3S24 A;  3OTO L;  4JI6 Q;  2UUA Q;  4GKJ Q;  3PUZ A;  2N78 A;  2YTV A;  2WB1 E;  1L0W A;  5IYB H;  5C4X G;  3GTO H;  1NE3 A;  4AYB G;  2K5H A;  2BA0 A;  1YI2 A;  3RZO H;  3CPF A;  4DV1 L;  3OTO Q;  4HJ7 A;  2H5X A;  4HJA A;  1SE8 A;  1Q12 A;  1IBM L;  4A3B H;  5GAG C;  1C9O A;  4KI0 A;  1P8L A;  1X55 A;  2V1C C;  1N9W A;  1E1T A;  3RLF A;  3T1Y Q;  4DV1 Q;  1EFW A;  4TQU S;  4LF9 Q;  4H02 A;  3CCQ A;  1EOV A;  1IBM Q;  5JJI A;  2JK8 A;  4YY3 L;  1KXL A;  3MXN B;  4J15 A;  1KRT A;  3GTP H;  4BA1 I;  4LUO A;  4POF A;  1I6H H;  1W2B A;  4PZ7 A;  3CME A;  4DUZ L;  3M85 A;  3GTK H;  1A0I A;  4C3H H;  2OWO A;  4YY3 Q;  2I5H A;  4FDB A;  2ASB A;  2FXQ A;  2K5V A;  2MO0 A;  3F1Z A;  2I5L X;  3KOJ A;  1X3G A;  3OW2 A;  3ICE A;  2OTJ A;  4DV3 L;  4X65 L;  2WP8 J;  2Q2T A;  1AE3 A;  1YJW A;  2R7F A;  1UE1 A;  4DV6 L;  2R7Z H;  3L7Z C;  4Y7N H;  1I3Q H;  2R92 G;  4BY1 H;  1GVP A;  1NJI C;  1SMX A;  4DAY B;  5M3M G;  4DV3 Q;  3TS2 A;  4X65 Q;  3EN2 A;  4PZ8 A;  4JI8 L;  1X3F A;  3AFP A;  4DV6 Q;  3I4M H;  3I7F A;  3S2D H;  1UE7 A;  2Q2I A;  5EAY A;  1LYL A;  1CKN A;  3KDF A;  3PIO A;  4GLA C;  1PH6 A;  4DAM A;  2K14 A;  3JAM c;  2NVT H;  2YYZ A;  4JI8 Q;  4B3M Q;  4PZ6 A;  3L2P A;  1Q8K A;  2JA5 H;  1PH8 A;  1Y14 B;  2VQE L;  5FJ8 G;  2KHJ A;  5M3F H;  5K36 G;  3CAM A;  2KHI A;  5IYC H;  4QIW E;  1EWI A;  1G29 1;  1MJC A;  4B3S L;  1BBU A;  2KBN A;  1VQM A;  1N34 L;  2VQE Q;  1VQG A;  3CPW A;  3CCE A;  1S40 A;  1Q1B A;  2JA8 G;  3GDE A;  1HNX L;  4LF4 L;  4ME3 A;  4B3S Q;  3M9B A;  4UY8 C;  5IP9 H;  1N34 Q;  3HOX H;  5C3E G;  2CWP A;  1WI5 A;  1G6P A;  1NY4 A;  4GN4 B;  2EXD A;  1HNX Q;  4LF4 Q;  2JA6 G;  2A19 A;  3B6Y A;  3FKI H;  2E2I H;  1H95 A;  4LF5 L;  2JEB I;  4QGU A;  3KJP A;  2XTI A;  3RLO A;  2ZM6 L;  3K81 C;  4JV5 L;  3RLN A;  4A3J G;  1L1O B;  1X3E A;  4LF5 Q;  1MKH A;  1AH9 A;  3EBE A;  1YJ9 A;  2ZM6 Q;  4JV5 Q;  1VQC A;  4JI4 L;  2Z6K A;  2OQ0 A;  5GRO A;  3U4Z A;  1PH3 A;  1PH5 A;  5ELO A;  5AJ3 L;  3GTJ H;  1NTG A;  4HIM A;  1JE5 A;  3OYY A;  2ZTC A;  4GOP A;  2GVA A;  1PVO A;  3KLW A;  1Y1V G;  4JI4 Q;  4LF6 L;  2WFW A;  4KLK A;  4HIO A;  1XNR Q;  5AJ3 Q;  4DV7 L;  1U0L A;  1Q7Y C;  3RNU A;  1RL2 A;  4A3M G;  3J80 c;  5GAE C;  5C44 G;  3S2H H;  1HH2 P;  1PYS B;  4GLV B;  4LF6 Q;  1TWG H;  4LF8 L;  1FVI A;  4UP9 A;  4JI1 L;  4DV7 Q;  1EYG A;  1AE2 A;  4OX9 L;  5LMN W;  4DV5 L;  1QZG A;  5IYD H;  4LF8 Q;  4LNQ A;  1HZ9 A;  4UP8 A;  3PUW A;  1YHB A;  2NVY H;  4JI1 Q;  2JA7 H;  4A3C G;  1XTD A;  1JMC A;  3STB C;  1LM0 A;  3HKZ G;  2GN5 A;  4OXP A;  1V9P A;  2Z6K C;  4DV5 Q;  1I94 L;  3CXC A;  1N36 L;  4IPH A;  1SRO A;  3TEH B;  4GOP C;  1YJN A;  3KYH C;  2A1A A;  3JAM i;  3I4N H;  4P73 A;  3HOZ H;  1I94 Q;  1N36 Q;  1KD1 C;  1YHQ A;  4IFD I;  5J3B A;  1QZH A;  3NEM A;  1U5K A;  1HR0 L;  3HKZ E;  2MFI A;  3I55 A;  1J5E L;  3PO3 H;  1Q86 C;  3S1Q H;  4BY7 G;  1JB7 A;  1YBY A;  1HR0 Q;  2ATW A;  3S1R H;  1VQB A;  2VY3 A;  3PIP A;  4B3R L;  3HOU G;  1J5E Q;  2RHS B;  3KF8 B;  3L0O A;  1VQA A;  2YV5 A;  5JEA J;  3CCR A;  4JBK A;  4A3D G;  1EUJ A;  3CCU A;  1QVF A;  4P71 A;  4B3R Q;  4QQB X;  2D62 A;  3S16 H;  3K8A A;  5IY0 A;  4HIK A;  4IOA A;  3A0J A;  5C0X J;  1B8A A;  1OXU A;  3KJO A;  3PUX A;  5M5X H;  2B63 H;  5JJK A;  5IYB G;  2HIV A;  1KHI A;  2UXC L;  1VQJ A;  4BBR G;  3T1Y L;  4K0K L;  3GD7 A;  4LF9 L;  1FJG L;  5DLQ E;  2CQO A;  4A3G G;  3TQY A;  1IBL L;  5IT9 c;  4A3B G;  4A3K G;  5IE8 A;  3M4O H;  2UXC Q;  1VQL A;  4K0K Q;  3CD6 A;  3I4O A;  1WYD A;  1FJG Q;  5M5Y H;  2YU9 H;  2PI2 A;  4P75 A;  1GM5 A;  1LUZ A;  1IBL Q;  1O7I A;  4A3I H;  4O0A A;  4X66 Q;  3NBH B;  1ASZ A;  1SLJ A;  4NB3 A;  4X62 L;  4YCU A;  4UP7 A;  4C3I H;  1VQO A;  3WWV A;  3HOV H;  1VS0 A;  2AMC B;  3A5U A;  2B3G A;  4DV4 L;  1XPU A;  4YCW A;  5JJL A;  2E8G A;  4X62 Q;  4NXM L;  4GNX B;  4L5T A;  2Q2U A;  1Q46 A;  4OON A;  4DV4 Q;  4A3F G;  4A3E G;  3K7U C;  1K8A C;  2IT1 A;  1YNX A;  1KQS A;  4L5S A;  2AHO B;  3PUV A;  4IPD A;  1VQK A;  2R7D A;  4NXM Q;  4XIG S;  1EQR A;  1VQE A;  3CQZ H;  2BH2 A;  1IZ6 A;  1N8R C;  4AH6 A;  1WCM H;  4HJ8 A;  2UU9 L;  4B3M L;  3CC4 A;  1IL2 A;  3I4M G;  4EQ5 A;  3S1N H;  1K0R A;  2KCT A;  4MZ9 A;  2L15 A;  1UE6 A;  1JT8 A;  1OXV A;  2KEN A;  2VL6 A;  1K83 H;  2UU9 Q;  3HOW G;  3AQQ A;  4DV0 L;  3UDG A;  1NMF A;  3UE0 A;  4JI0 L;  5M3F G;  4DV0 Q;  1PH1 A;  4DNI A;  2MO1 A;  4A93 G;  3MEF A;  5C4J H;  1T9H A;  4NXN L;  3E0E A;  1Q81 C;  4JI0 Q;  2R92 H;  2YTY A;  5M3M H;  1QVC A;  1VQ6 A;  3HKS A;  3G71 A;  4OWW B;  2PQA B;  2HQL A;  4DR2 L;  2RCN A;  4NXN Q;  2K50 A;  3TRZ A;  3CCS A;  5IP9 G;  2IHE A;  4DK3 C;  3K80 C;  5FLM G;  3HOX G;  1P16 A;  1XPO A;  2LXJ A;  4GLX A;  2UXB L;  4BBS H;  4IFD J;  2B29 A;  4DR2 Q;  3FKI G;  3KDF B;  4JOI A;  1Y1W G;  5GAH C;  3HOY H;  1HNZ L;  3J7Z C;  4NPS A;  3PF5 A;  2OCE A;  4LFB L;  2UXB Q;  1S3O A;  5FJ8 H;  1KAW A;  2AWN A;  2RHQ B;  3HFZ B;  3ULP A;  4YWM A;  1SFO H;  4LWC A;  4X64 L;  1VQ7 A;  1K8G A;  3A74 A;  3S14 H;  4ALP A;  1HNZ Q;  5C0X G;  2YTX A;  3GTG H;  3PGZ A;  3GTL H;  2C35 B;  4DK6 C;  4GN5 A;  5IWA L;  4PMW A;  3U58 A;  4LFB Q;  5BR8 L;  1VQ5 A;  4KHZ A;  1XNR L;  4X64 Q;  2JA8 H;  4R4T A;  1TXY A;  4A3L G;  1HZB A;  3UE1 A;  3J81 c;  3H0G G;  2F52 A;  2E5L L;  3PSI A;  1N32 Q;  5IWA Q;  3IRB A;  4AIM A;  5BR8 Q;  1CKO A;  4OO1 G;  2R93 G;  1WJJ A;  2ALY B;  1YIT A;  5E7N A;  2BA1 A;  4DUY L;  2VQF L;  2E5L Q;  2VZA A;  4IJH A;  2UXD L;  2DGY A;  2VS1 A;  4JBW A;  1TWA H;  3PCO B;  4JOI C;  4GS3 A;  1TWF H;  4DPG A;  5IP7 H;  1NBW A;  1OXT A;  1D8L A;  4DUY Q;  2VQF Q;  4A3J H;  4LFA L;  3UDX A;  2WAQ E;  1A63 A;  3TRE A;  2HT1 A;  2UXD Q;  4LF7 Q;  5IYD G;  2EQS A;  3RR5 A;  1X6O A;  3BZC A;  1OTC A;  1PH7 A;  3PO2 H;  1YZ6 A;  2GVB A;  4MTN A;  4BA2 I;  4LFA Q;  3SGI A;  1OXX K;  1PH4 A;  4OWT B;  2LXK A;  4JG2 A;  4IO9 A;  1Y1V H;  3M4P A;  5LMN L;  2F4V L;  4R4O A;  3I4N G;  4IOC A;  2NN6 G;  4IPC A;  4A3M H;  3S15 H;  4DR3 L;  3G48 A;  3ERS X;  2IHF A;  3H15 A;  5LMN Q;  2F4V Q;  3A5Z B;  4DKA C;  4YCV A;  2ZJR A;  1KC8 C;  1SR3 A;  3JC6 6;  3CC2 A;  4YWK A;  4DR3 Q;  3NEN A;  1GD7 A;  1GO3 E;  4A4I A;  3PF4 A;  2CWA A;  1VQD A;  4A3C H;  1VQF A;  2R6G A;  3G4S A;  4JBM A;  4IPG A;  2VUM H;  4JI3 L;  3S17 H;  1Q82 C;  4B3T L;  4XTC S;  2IX0 A;  1PYB A;  1B7Y B;  3LGJ A;  3S1M H;  4QL5 A;  1PA6 A;  1DGS A;  1A8V A;  2AKW B;  2Z0S A;  3I2Z A;  4JI3 Q;  1X54 A;  1I5F A;  4B3T Q;  1JJC B;  1E22 A;  1BKB A;  4OWX B;  2PNH A;  1I50 H;  4DR6 L;  3GO5 A;  4LFC Q;  1YHA A;  4R1J A;  2NVX H;  1NMG A;  4LW1 A;  4X66 L;  4RG1 A;  4BY7 H;  1V1Q A;  5HY6 A;  2JJQ A;  5H1S E;  1XMQ L;  2IX1 A;  3HOU H;  4DR6 Q;  2CFM A;  3CW2 C;  2K52 A;  3T1H L;  1TWC H;  3ULJ A;  3J81 i;  4R4Q A;  4A3D H;  2JEA I;  2LSS A;  4DR5 L;  4JBJ A;  1XMQ Q;  1Z9F A;  1XMO L;  4JC0 A;  2K5N A;  2N8N A;  2RF4 A;  1B70 B;  4LUZ A;  4P74 A;  4GNX A;  3T1H Q;  1VQ8 A;  3HOV G;  4BXX H;  1JJG A;  4HJ5 A;  3J80 i;  3CCL A;  1L2F A;  4DR5 Q;  3KF6 B;  1VQ9 A;  3ZJY C;  4QY7 A;  1QUQ B;  1WOC A;  5C4X H;  1XMO Q;  2EIF A;  1Z47 A;  1E24 A;  4BBR H;  2D0P A;  3BU2 A;  4A3G H;  2VW9 A;  3F2B A;  3UDF A;  1J6Q A;  2R7Z G;  4A3K H;  4BY1 G;  1E3P A;  3ER0 A;  3CCJ A;  4DR4 L;  1WCM G;  2K75 A;  1HZA A;  1Q1E A;  4A75 A;  3AEV A;  2N3S A;  4WJ3 M;  4AYB E;  1VCI A;  4DR1 L;  4L5Q A;  1K3R A;  3W1G A;  4DR4 Q;  1C0A A;  1YEZ A;  1MIU A;  5ELN A;  3M4Q A;  1BVS A;  3DLL A;  2ZJP A;  4GNX C;  4DR1 Q;  2JA5 G;  4X6A H;  4C2M H;  3CCV A;  4A3F H;  4POG A;  4OX9 Q;  1KL9 A;  4DUZ Q;  4A3E H;  2QA4 A;  2UUC L;  5IYC G;  2CCZ A;  2KCM A;  4L5R C;  2PQA A;  4YHH L;  2N49 A;  1YVC A;  1PFS A;  1PH9 A;  3KFU A;  2UUC Q;  2JQO A;  1HZC A;  1PHJ A;  1KRS A;  4WJ4 A;  2QGQ A;  4AQY L;  1LTL A;  3F2C A;  3CC7 A;  4YHH Q;  1D7Q A;  3U4V A;  2HIX A;  4TVA B;  4BBS G;  2I0Q A;  3HOW H;  3BZK A;  1C7Y A;  5HGQ A;  4AQY Q;  1CKN B;  1X9N A;  4JYA L;  3HOY G;  2VNU D;  1L1O A;  1A62 A;  5JEA G;  3FHW A;  5C0X I;  1XPR A;  1QVG A;  1N33 L;  3E9I A;  3H3V I;  3F8T A;  2E2H H;  5FLX c;  2NZO A;  4DR7 L;  4JYA Q;  4KHP L;  4A93 H;  3TS0 A;  1GKH A;  4MNO A;  1E7Z A;  4EX5 A;  1KIX A;  3NEL A;  1N32 L;  1N33 Q;  4IJL A;  3J81 j;  1IBK L;  1UE5 A;  5GQO A;  2ES2 A;  4DR7 Q;  4OO1 I;  4KHP Q;  2ZTD A;  2IY5 B;  4APV A;  2WAQ G;  1RIP A;  2F3I A;  2OQK A;  2OTL A;  3DM3 A;  4R4C A;  2ZTE A;  5FLM H;  5C3E H;  1IBK Q;  3D31 A;  1R9T H;  1W3S A;  2JE6 I;  2JA6 H;  3AFQ A;  1M90 C;  2Y0S G;  1Y1W H;  2D0O A;  4P72 A;  2I5M X;  4LF7 L;  2QEX A;  1HNW L;  4HID A;  2AWO A;  4LUV A;  2PI2 E;  5IP7 G;  1L1O C;  2BH8 A;  1EIF A;  3W5O A;  5M5W H;  2A8V A;  1SN8 A;  3M3Y H;  3STB D;  3W1B A;  1K73 C;  4QJF A;  2UUB L;  1HNW Q;  4JI5 L;  4A76 A;  1FGU A;  1IXR A;  1VQP A;  3H3V H;  1E1O A;  4PG3 A;  2HHH L;  1K9M C;  3J7A 5;  2JA7 G;  1CKM A;  3PUY A;  3PO2 G;  3CCM A;  2NN6 I;  2Y0S E;  1EIY B;  2UUB Q;  1JJ2 A;  3PV0 A;  4A3L H;  4JI5 Q;  3H0G H;  4C3J H;  2K4K A;  2PMZ E;  1MJE A;  1VQ4 A;  2HHH Q;  1CUK A;  2R93 H;  4GOP B;  3HOZ G;  2E2J H;  3K0X A;  4RMF A;  3E9H A;  3U50 C;  4Y52 H;  2MQH A;  3CP0 A;  3FP9 A;  5C44 H;  3CF5 A;  3M7N A;  2MNA A;  3EIV A;  2JA9 A;  3PO3 G;  2ID0 A;  2NZH A;  1M1K C;  4GN3 B;  1X65 A;  5GAD C;  3RZD H;  4JCV E;  1VQI A;  4JI2 L;  3RN2 A;  1V43 A;  1HR0 W;  3RN5 A;  2VUM G;  3AYH B;  1YIJ A;  3BJU A;  3GTM H;  1BBW A;  3I56 A;  1XNQ L;  4JI2 Q;  4LFC L; 
#chains in the Genus database with same CATH topology
 1PV4 A;  2E75 C;  2SNM A;  3UDI A;  4HJ9 A;  1SEB D;  3CMA A;  4WFN 3;  4MIU A;  5C5M A;  1OXS C;  3VDY A;  1TQO A;  1G51 A;  4HSP A;  1BCP F;  5ELF A;  1UWV A;  5C4J B;  4JI6 L;  1GXD C;  1PH2 A;  2R92 B;  3G6E A;  1HJP A;  5E3F A;  4C3I G;  2O2L D;  4F8M A;  3BG3 A;  1VQN A;  5M9O A;  4N9T A;  3NWT A;  1TWH H;  4JI6 Q;  5IYB H;  5C4X G;  2BA0 A;  3RZO H;  3CPF A;  4LK1 C;  2H5X A;  3GV6 A;  1HFN A;  2VB3 X;  1SFO B;  2V1C C;  1N9W A;  3S14 B;  4CDC C;  4R8I A;  4H02 A;  1SNO A;  1KRT A;  4LUO A;  1LTA D;  2JP1 A;  1FGB D;  2B2W A;  1FNV A;  4POF A;  4R8N A;  3CME A;  1W2B A;  2DJF C;  1S5F D;  4C3H H;  1JWS D;  4FDB A;  2MO0 A;  2I5L X;  2I46 A;  2F0T A;  3KOJ A;  1X3G A;  2OTJ A;  4HCE A;  1MSG A;  2WP8 J;  1AE3 A;  2N88 A;  2R7F A;  2R7Z H;  3NXW A;  1GUG A;  1NJI C;  1EY8 A;  5HUR A;  1ET6 A;  1LAC A;  1C48 A;  2X6L A;  2QDL A;  3EN2 A;  1X3F A;  1XWE A;  1UE7 A;  5EAY A;  1Q90 A;  4GLA C;  3C3L A;  4K2K A;  4DAM A;  2NVT H;  4PZ6 A;  3L2P A;  1ENA A;  1Y14 B;  3S15 B;  4XYQ A;  1VF5 C;  4QIW E;  1G29 1;  1HFG A;  1RDP D;  1TR5 A;  3MZ5 A;  4B9W A;  1N34 L;  4KK7 A;  5LL6 X;  3CPW A;  3CCE A;  2JA8 G;  4ME3 A;  1A2U A;  1NR2 A;  2K1B A;  4UY8 C;  1N34 Q;  2CWP A;  3NTK A;  4L8J A;  2EXD A;  3Q23 A;  3B6Y A;  3FKI H;  5KGU A;  4LF5 L;  2FMM A;  2XTI A;  3J7Y W;  1JOQ A;  3K81 C;  4X3S A;  1GHJ A;  3L9A X;  4LF5 Q;  5IT9 L;  1CFM A;  1YJ9 A;  1STA A;  2Z6K A;  1B3Q A;  1SNM A;  2OQ0 A;  2F0O A;  1PH3 A;  1S5B D;  2L11 A;  1JE5 A;  2RQX A;  4HIM A;  2GVA A;  1Y1V G;  4LF6 L;  1TWC B;  1XNR Q;  1M8A A;  3HRZ C;  3A8K E;  3S2H H;  1IHZ A;  2RDH A;  4GLV B;  4LF6 Q;  5EBC A;  1FVI A;  1DM0 B;  1H9S B;  2MP1 A;  3OMC A;  3GQB A;  5IYD H;  1HHV A;  3N52 A;  1EOT A;  1AW7 A;  1SNP A;  2NVY H;  1H9R A;  1XTD A;  5FK9 C;  1JMC A;  1EY0 A;  1V9P A;  2Z6K C;  4A3K B;  1N36 L;  4IPH A;  3JAM i;  2NN6 H;  4OL7 A;  4DA2 A;  3H91 A;  1ZXT A;  3SXH A;  3K5L A;  1N36 Q;  3N6R A;  3TN2 A;  5CV5 A;  1QZH A;  3VYT A;  2M2L A;  4X3U A;  1U4L A;  3I55 A;  1J5E L;  3PO3 H;  1IW7 D;  1Q86 C;  5FLX E;  4C2M B;  1YBY A;  1R4Q B;  4A3E B;  3K57 A;  3S1R H;  1J5E Q;  1WTP A;  2B8F A;  4FO2 A;  1G8Z D;  1EUJ A;  1PXU A;  1HQM C;  4K5X A;  3K8A A;  3I4M B;  4HIK A;  5C0X J;  1OXU A;  4HED A;  5M5X H;  3BYY B;  1VQJ A;  1O7Z A;  1EIG A;  4A3G G;  3P7J A;  1O78 A;  4A3B G;  4NP5 A;  3MXN A;  5M5Y H;  4A93 B;  1CZG A;  1LUZ A;  1O7I A;  1ASZ A;  1SLJ A;  4NB3 A;  4B08 A;  4X62 L;  1K28 A;  4UP7 A;  4C3I H;  3A8I E;  1VS0 A;  3MHB A;  3A5U A;  1XPU A;  3HOX B;  3LWE A;  2EY1 A;  4X62 Q;  1II3 A;  1MGS A;  4A3F G;  3K7U C;  1K8A C;  2IT1 A;  1ZYR C;  1ESR A;  1VQE A;  2EDG A;  5M5W B;  3OSO A;  4AH6 A;  1E2W A;  3CC4 A;  4EQ5 A;  4JVZ A;  3TBI B;  4HR7 B;  5CMD A;  1OXV A;  1K83 H;  4OIJ A;  3HOW G;  3H0G B;  3T53 B;  4C3J B;  5D3I B;  3UDG A;  3ERO A;  3QWN A;  4KKU A;  1PRT D;  4DNI A;  2MO1 A;  3MEF A;  1SE2 A;  2K33 A;  3AB9 A;  2C9O A;  3R8B A;  1F9Q A;  1VQ6 A;  2K50 A;  4DXF A;  4DK3 C;  1XPO A;  4DNT B;  5GAH C;  3X3N A;  1HNZ L;  2B2Y A;  1STE A;  3PF5 A;  1MHW C;  2AWN A;  4XQN A;  1VQ7 A;  1DOM A;  1FR3 A;  1HNZ Q;  3GTG H;  2YTX A;  3PGZ A;  2DJG C;  4DK6 C;  4GN5 A;  4KHZ A;  2N55 A;  2JA8 H;  4R4T A;  1ILP A;  1B2T A;  4N8X 1;  3UE1 A;  2F52 A;  3MC0 B;  1XYI A;  3H6M A;  2ALY B;  2BA1 A;  4RKB A;  2UXD L;  2DGY A;  3P20 A;  1TWA H;  3S16 B;  1TWF H;  4DPG A;  3CKI B;  1D8L A;  1BCP C;  2UXD Q;  1L0Y B;  4LF7 Q;  3GTO B;  1BQQ T;  4EQP A;  3BZC A;  4DGZ A;  4KN4 C;  2RVL A;  3PO2 H;  3M4O B;  1Y1V H;  5I9O A;  1F2Z A;  4R4O A;  3KUP A;  1RJT A;  4IPC A;  2WII B;  4DR3 L;  1GUO A;  2IHF A;  4NW2 A;  2F1M A;  4OIK A;  5C3W A;  2K5W A;  1SR3 A;  4YWK A;  4DR3 Q;  3NEN A;  2JYO A;  1GD7 A;  1GO3 E;  1FD7 D;  1VMC A;  2EOT A;  2PQE A;  4HTH A;  3PF4 A;  3DM1 A;  1VQF A;  2R6G A;  5G3L D;  1ZKO A;  5KEE A;  4Y7N B;  2VUM H;  3HEJ A;  1Q82 C;  4B3T L;  1PYB A;  5KIX A;  1B7Y B;  1AEX A;  3IAY A;  3S1M H;  1DGS A;  2AKW B;  2DY8 A;  3I3C A;  3I2Z A;  1X54 A;  1I5F A;  3OMG A;  4B3T Q;  2IWH A;  2XN9 C;  2F0P A;  1I50 H;  4LFC Q;  2XNA C;  2JA5 B;  3R93 A;  4X66 L;  2PNR C;  5HY6 A;  1U9R A;  2PW5 A;  1SYC A;  2CFM A;  1SNC A;  3CW2 C;  1YNN C;  2MHV A;  3J7A V;  2JEA I;  4JBJ A;  2K5N A;  4P74 A;  1B70 B;  1KAA A;  4BXX H;  1VQ8 A;  3J80 i;  3TP6 A;  3CCL A;  4HMJ A;  1SYE A;  5EPJ A;  1WOC A;  1HPC A;  1CQV A;  1E24 A;  1STH A;  1BO0 A;  1MI2 A;  4A3G H;  2VW9 A;  4JPB W;  1X32 A;  1UNS A;  2KUM A;  4TRD A;  4BY1 G;  1E3P A;  4H7B A;  5KYL A;  4DR4 L;  3GTL B;  3QG1 A;  1CT1 D;  1SMY C;  1Q1E A;  3SK6 A;  3AEV A;  4YIJ A;  3RUZ A;  4AYB E;  5KNC A;  2EYF A;  4DR4 Q;  1C0A A;  5ELN A;  3HZX A;  5I6Y A;  3W3A A;  5CBE E;  5COR A;  5EPK A;  1GUS A;  1U4R A;  2F0U A;  3SK5 A;  2CH4 W;  4B9X A;  2EYL A;  4X6A H;  4A3F H;  4POG A;  1KL9 A;  5ISR A;  3MA2 B;  4XQJ A;  1TWG B;  2CCZ A;  4L5R C;  2PQA A;  1YVC A;  1HZC A;  1KRS A;  1G2S A;  3H09 A;  3F2C A;  3CC7 A;  5CV9 A;  3SEB A;  3U4V A;  3HOW H;  1C7Y A;  2VNU D;  4BWG B;  3FHW A;  1XPR A;  3HOZ B;  5FLX c;  3CU7 A;  2BE5 C;  3R2I A;  3K58 A;  3L3O C;  2MGS A;  4IJL A;  1STB A;  2TMP A;  2ZTD A;  2IY5 B;  4HCS A;  2OQK A;  3DM3 A;  1R9T H;  2O4X A;  2EXZ A;  1M90 C;  3OHX C;  2Y0S G;  2JA6 H;  1H9S A;  1VDZ A;  2AWO A;  2PI2 E;  2HUG A;  1EIF A;  1BXT A;  2A8V A;  3STB D;  3W1B A;  1K73 C;  1K8M A;  4A76 A;  3H3V H;  2WAC A;  3PUY A;  2NN6 I;  1AZP A;  2WB1 B;  4F87 A;  2K4K A;  1VQ4 A;  4HMI A;  1CUK A;  2YU9 B;  4CKC A;  1WTW A;  2OF1 A;  4A3I B;  3K0X A;  4HAE A;  4RMF A;  3U50 C;  3V2T A;  2FMC A;  3CP0 A;  3FP9 A;  1A2T A;  3EIV A;  2KEC A;  1YNJ C;  4RA8 A;  3KBX A;  2QF7 A;  3ZYY X;  4J8Q A;  1LT4 D;  1X65 A;  1I4H A;  1ML0 D;  4JI2 L;  2BCO A;  2F0D A;  3AMU A;  2F0F A;  3RN5 A;  1PLF A;  4GZY C;  1K3B C;  3I56 A;  3GTM H;  4FF4 A;  4JI2 Q;  4ZKB B;  3S1N B;  3ULL A;  1FL0 A;  3HS0 C;  1WFQ A;  4IZ8 A;  2R61 A;  3SVM A;  4IFD G;  4DV2 L;  1CSP A;  3D0F A;  3KLS A;  4PV1 C;  2Q2H A;  2XGT A;  2GA4 B;  4R4I A;  4DV2 Q;  4IUN A;  3BVZ A;  3T13 A;  4WRD A;  3F2D A;  3Q8D A;  3GTQ H;  2F0H A;  2ZJQ A;  1XJV A;  2L5T A;  1QUQ A;  1SYB A;  3S24 A;  1RKN A;  3PUZ A;  5EPL A;  1EIH A;  2WB1 E;  1L0W A;  2F0L A;  1I6V C;  1KDB A;  1Q12 A;  4KI0 A;  3C46 A;  4LF9 Q;  4K14 A;  2JK8 A;  2WV6 D;  3MXN B;  2K01 A;  4J15 A;  3NE5 B;  3GTP H;  1LTR D;  1I6H H;  3GTK H;  4DUZ L;  3CRK C;  5BN4 A;  1D1I A;  2I5H A;  5C3E B;  2ASB A;  2RSN A;  3C1F A;  4XDX A;  3OIP A;  2Q2T A;  1YJW A;  1T5X D;  1UE1 A;  2PMZ B;  3L7Z C;  2PYK A;  4A3J B;  4BY1 H;  2R92 G;  1KTK A;  2A68 D;  4JI8 L;  3AFP A;  3S2D H;  3I7F A;  2Q2I A;  1CKN A;  3PIO A;  2K14 A;  1MD2 D;  4JI8 Q;  1DCZ A;  3Q24 A;  3DXJ C;  3R2T A;  2VQE L;  4A3M B;  5M3F H;  5K36 G;  5AFW A;  1B9M A;  2KHI A;  4ZYS A;  5C44 B;  2A74 C;  3A56 A;  3U9S A;  2KBN A;  2VQE Q;  2D2C C;  1VQG A;  1S5E D;  3KLR A;  2B2U A;  1SJH D;  3M9B A;  5IGD A;  5IP9 H;  5K5P A;  3VR5 A;  3NSW A;  2L55 A;  1H95 A;  2E2I H;  1S5D D;  5KND A;  1Y69 U;  2JEB I;  1NUC A;  2ZM6 L;  4JV5 L;  3RLN A;  4I7Z C;  1E2Z A;  1L1O B;  4H44 C;  3W2D A;  1X3E A;  1AH9 A;  1BCP B;  2ZM6 Q;  1A6X A;  2Z1C A;  4TKO B;  4JV5 Q;  2ICE C;  3U4Z A;  5GRO A;  2NVX B;  5ELO A;  1EEI D;  3GTJ H;  4BY7 B;  2ZTC A;  4GOP A;  1NSN S;  2B2U C;  1PZK D;  4HIO A;  1U0L A;  2NZ1 D;  4A3D B;  1A15 A;  3J80 c;  1K8O A;  1TWH B;  1EYG A;  3NHH A;  5LMN W;  1QOH A;  2KCC A;  4BBR B;  2WIN B;  5IIF A;  1EL0 A;  4A3C G;  3F2U A;  3HG9 A;  3CXC A;  3RMH A;  3TEH B;  5A35 A;  4GOP C;  2A1A A;  3I4N H;  1XTC D;  4RHS A;  4FXD A;  2OEO A;  1YHQ A;  3NEM A;  5C4Z A;  1RD9 D;  3QJY A;  2IX3 A;  2B2T A;  3NTH A;  3S1Q H;  3OWE B;  1JB7 A;  5J22 A;  1VQB A;  4B3R L;  4IUQ A;  1X3Q A;  2YV5 A;  1SYG A;  1QVF A;  4P71 A;  4B3R Q;  1LT5 D;  1F9R A;  2D62 A;  4KY7 A;  5IY0 A;  2Z4I A;  4QIW B;  2HIV A;  3D3R A;  4K0K L;  1FJG L;  4H13 C;  4IFD H;  5DLQ E;  2XWJ B;  4IAL A;  2B2T C;  1TVX A;  4A3K G;  1VQL A;  4K0K Q;  1WYD A;  4F7X A;  1FJG Q;  2PI2 A;  1ENC A;  4P75 A;  1GM5 A;  4PNY A;  3J81 L;  1I4G A;  2KHS A;  4C1N I;  2ENB A;  4YCU A;  1VQO A;  3HOV H;  4DV4 L;  4LAA A;  2EPB A;  4YCW A;  4PMB A;  3PIP 3;  4L5T A;  1KNE A;  1Q46 A;  3QO2 A;  3E5S A;  4DV4 Q;  4A3E G;  1Y1W B;  2XIW A;  1MSH A;  1YNX A;  4L5S A;  1TT2 A;  3PUV A;  3VA7 A;  1ENF A;  4XIG S;  3FVQ A;  4RKL A;  1EQR A;  1WCM H;  1PTO D;  3I4M G;  1F2L A;  1K0R A;  4RGN A;  1UE6 A;  3IKJ A;  2A6H D;  3ONA B;  4KKS A;  2VL6 A;  2R93 B;  2F3V A;  4OEL B;  2E2J B;  4JI0 L;  1BNZ A;  1QWY A;  1PH1 A;  3S2H B;  4A93 G;  2MJ8 A;  5C4J H;  1VF7 A;  4JI0 Q;  5T1I A;  5IGE A;  2R92 H;  4K2L A;  2PQA B;  4IUT A;  2HQL A;  4DR2 L;  2ICI A;  2RCN A;  1O7Y A;  1W6K A;  3CCS A;  5FLM G;  3HOX G;  2LXJ A;  1HA5 A;  2UXB L;  4BBS H;  2B29 A;  4DR2 Q;  3KDF B;  3ERQ A;  2A5H A;  3HOY H;  2B39 A;  3J7Z C;  4NPS A;  2OCE A;  2UXB Q;  1B50 A;  1S3O A;  2J4X A;  1SFO H;  4R9W A;  5K36 H;  4J6H A;  1WTX A;  4YWM A;  3LX0 A;  4X64 L;  3A74 A;  3S14 H;  2LY7 A;  1B4O A;  3K7A B;  4KY6 A;  5C0X G;  4M8A A;  3LNN A;  1VQ5 A;  1XNR L;  4X64 Q;  3S1R B;  1SE3 A;  3H0G G;  4C3J G;  3PSI A;  1N32 Q;  4OO1 G;  1TU2 B;  1WJJ A;  2HQE A;  4DUY L;  1D6E C;  1GUW A;  2RKS A;  2BOS A;  4C56 C;  2ZXO A;  1E2V A;  2VS1 A;  2DN8 A;  1I4R A;  1J9O A;  4MN3 A;  1BOS A;  2A69 C;  1OXT A;  4DUY Q;  1AZQ A;  1HCZ A;  2WAQ E;  5M5X B;  1WTH A;  2EQS A;  5EGT A;  2MUY A;  1PH7 A;  2GVB A;  3BDL A;  4BA2 I;  2RDG A;  4KD4 A;  3T51 B;  4DK0 A;  2LXK A;  4JG2 A;  1WD0 A;  4G7O C;  2XRS D;  2F4V L;  3P1H A;  3BZD B;  3D4W A;  3S15 H;  1TS2 A;  3ERS X;  4IUP A;  3H15 A;  2F4V Q;  3MEH A;  5I4D A;  3CC2 A;  2EYO A;  3DUZ A;  1D5M C;  4A4I A;  2L1B A;  1VQD A;  4A3C H;  1H9K A;  4IPG A;  3V05 A;  4XYO A;  4RCO A;  4JI3 L;  2I07 B;  2SEB D;  2Z0S A;  4JI3 Q;  1BR9 A;  2JXM B;  2RDF A;  1A3V A;  4OWX B;  4CHT B;  2PNH A;  3VYU A;  2QW7 A;  1GOZ A;  4R1J A;  5KNB A;  4LW1 A;  3BDO A;  4CKE A;  4RHR A;  5H1S E;  1XMQ L;  2IX1 A;  4L6T B;  4F88 A;  1TWC H;  2F0G A;  2K6A A;  4C1N K;  4G4K A;  3J81 i;  4R4Q A;  2LSS A;  1XMQ Q;  2N8N A;  1SJE D;  4GNX A;  1PDQ A;  3DWP A;  1JJG A;  2X6G A;  1EQV A;  5C4X H;  1ESF A;  1QUQ B;  1LO5 D;  2EIF A;  5IGF A;  4RH6 A;  3BU2 A;  1B44 D;  2QKI C;  2EVB A;  4EGV A;  4A3K H;  5BN5 A;  3BYT B;  1X3P A;  1B9N A;  3BS1 A;  1HZA A;  3PMF A;  4WJ3 M;  5L37 A;  1VCI A;  3K5N A;  4ILW A;  1YEZ A;  1MIU A;  2Q8R E;  1SE4 A;  4GNX C;  2JA5 G;  4S3S A;  4C2M H;  1LT6 D;  1IL8 A;  2RA4 A;  4A3E H;  2IL8 A;  5IYC G;  1H9J A;  4H0L C;  2F0Q A;  3I70 A;  4K6D A;  4KV6 A;  2C5C A;  4WJ4 A;  1PHJ A;  2QGQ A;  4AQY L;  3PO2 B;  3A7A B;  2JA7 B;  3SK4 A;  4EQO A;  1D7Q A;  1ONL A;  4PMC A;  1M4V A;  4ZKC B;  2I0Q A;  4AQY Q;  3K59 A;  1CKN B;  1L1O A;  1A62 A;  1QB5 D;  5JEA G;  1QVG A;  2XVS A;  2L0C A;  2E2H H;  2KCN A;  1UUP A;  4A93 H;  4EX5 A;  3LWU A;  1E0B A;  5IT9 E;  4APV A;  1TS4 A;  4OHJ A;  1RIP A;  2F3I A;  4K8I A;  2ZTE A;  5FLM H;  1B1Z A;  1PZJ D;  1ROD A;  5CV7 A;  1S5C D;  2VUM B;  1U4M A;  4P72 A;  2I5M X;  2EY5 A;  4LF7 L;  2QEX A;  4LUV A;  3FEW X;  5IP7 G;  1L1O C;  1RF2 D;  5M5W H;  2K03 A;  3I73 A;  3M3Y H;  2B63 B;  1NAP A;  4QJF A;  1ICF B;  3U9O A;  1FGU A;  1E1O A;  2B8G A;  1CKM A;  1TKW B;  3CCM A;  3A7L A;  4FYD A;  1EIY B;  2DNC A;  2WKD A;  3H0G H;  4C3J H;  1PTO H;  1KNA A;  2ZXR A;  5NUC A;  4GOP B;  1DYQ A;  3HOZ G;  1TS3 A;  3T16 A;  2MNA A;  1SNQ A;  2CQA A;  3S9W A;  4IQZ A;  5DAU A;  3ND8 A;  1M1K C;  4GN3 B;  4AYB B;  5GAD C;  1PZI D;  3G7L A;  2EJG C;  1IYU A;  3CQZ B;  5EKK A;  4UAI A;  4Q5V A;  3C1E A;  1BUV T;  4LFC L;  2EZV A;  1EQQ A;  5JVG 3;  3M4Y A;  4XXE A;  5J39 A;  1RTN A;  1SRU A;  1JOK A;  3BVG A;  1SBB B;  4N9P A;  2WB1 G;  1LTT D;  1EY6 A;  1VQH A;  2DUD A;  4A3I G;  2NVQ H;  2UUA L;  4GKJ L;  2Q8T A;  4UPA A;  1IYJ B;  5M3M B;  2CKZ B;  3KF6 A;  1WTR A;  1CSQ A;  4DN4 M;  2UUA Q;  4GKJ Q;  1ZYR D;  2N78 A;  2PZT A;  3PQI A;  3GTO H;  1NE3 A;  3J80 E;  5JJZ A;  4HJ7 A;  4HJA A;  1SE8 A;  1SYF A;  4G7Z C;  5GAG C;  4A3B H;  1P8L A;  1E1T A;  3T1Y Q;  1EFW A;  4TQU S;  3CCQ A;  1EOV A;  3FPU B;  2LS0 1;  4BA1 I;  1D5X C;  1SXT A;  5C6A A;  2OWO A;  4IUV A;  3IFD A;  2FXQ A;  1R9T B;  3F1Z A;  4NDX A;  3HGB A;  2JA6 B;  4XT1 B;  3MVV A;  4X65 L;  1F77 A;  3Q6S A;  4DV6 L;  4Y7N H;  3KK7 A;  1I3Q H;  1GVP A;  1U4P A;  4DAY B;  4X65 Q;  4DV6 Q;  4ULL A;  2KVM A;  3KDF A;  2TSS A;  2EYH A;  3JAM c;  4FXK C;  4B3M Q;  1DD2 A;  4KKT A;  1Q8K A;  2JA5 H;  5IYC H;  1SND A;  5EBD A;  1EWI A;  1BBU A;  1VQM A;  2F0K A;  3EFX D;  1RHP A;  1S40 A;  1HNX L;  4LF4 L;  1V1P A;  4X3K A;  3NWS A;  5LHY 1;  5C3E G;  1WI5 A;  3HKZ B;  1CHQ D;  1DZ1 A;  4GN4 B;  1HNX Q;  4LF4 Q;  1CHP D;  1BCP D;  5JEA H;  4QGU A;  3KJP A;  1FNW A;  3RLO A;  4U67 3;  4A3J G;  4XT3 B;  4QF4 A;  5FO8 B;  2HCC A;  1PVO A;  2IPK D;  3KLW A;  3HOU B;  3EVQ A;  2WFW A;  4KLK A;  4DV7 L;  1RL2 A;  4A3M G;  1K0S A;  2NYZ D;  4DAP A;  5GAE C;  5C44 G;  1HH2 P;  1PYS B;  3E0J A;  1TWG H;  4LF8 L;  1HQR D;  4DV7 Q;  1FNU A;  4OX9 L;  4DV5 L;  1QZG A;  4LF8 Q;  1HZ9 A;  3MXP A;  4UP8 A;  1WVL A;  2LKV A;  1YHB A;  3PUW A;  1O7L A;  3D4R A;  5FO7 B;  4OX9 Q;  2G9H D;  2GN5 A;  1CQF A;  1PRT F;  4KD3 A;  4DV5 Q;  4Z9C B;  1I4Q A;  2EYP A;  3KYH C;  5IOD A;  4P73 A;  3HOZ H;  5J3B A;  1TY0 A;  4LMQ D;  4CBV A;  1I6H B;  1JOR A;  1HR0 L;  3HKZ E;  2MFI A;  1HUM A;  2A6E C;  1YNN D;  4BY7 G;  1HR0 Q;  2ATW A;  3PIP A;  3SR1 A;  1VQA A;  4JBK A;  4A3D G;  4QQB X;  3CCU A;  2Q8I B;  1KDA A;  5CYU A;  2F0W A;  3K0Y A;  1QIL A;  3SK8 A;  4IOA A;  2LFN A;  3KJO A;  5JJK A;  1Z6H A;  5IYB G;  1F2M A;  1JC7 A;  3FPP A;  2UXC L;  4BBR G;  4O42 A;  1ZEQ X;  4LF9 L;  2CQO A;  1W6J A;  2JN4 A;  1IBL L;  4FF2 A;  2SDF A;  5IT9 c;  1SMY D;  3QB3 A;  2LMC B;  5M3F B;  2UXC Q;  3I4O A;  4ZUJ A;  3X3M A;  2YU9 H;  1IBL Q;  4A3I H;  4O0A A;  4ABN A;  4K5W A;  4QUF A;  3D6W A;  2NBF A;  3MWY W;  2AMC B;  5CV6 A;  5A2Q E;  3WOE A;  2SOB A;  4C3H G;  5JAV A;  1G91 A;  5JJL A;  2E8G A;  4NXM L;  4GNX B;  3Q0A A;  3QIA A;  5C3X A;  2E2I B;  4U68 A;  4ZRZ A;  1KQS A;  1Q3L A;  2Z9H A;  4NXM Q;  4IPD A;  2R7D A;  2F0I A;  3TZD A;  5KYI A;  2BH2 A;  1IZ6 A;  1T5E A;  1N8R C;  3SHL A;  4HJ8 A;  2UU9 L;  3S1N H;  2IW3 A;  4MZ9 A;  1C8C A;  2L15 A;  1CM9 A;  2PZU A;  3D6C A;  5G3L F;  2UU9 Q;  4BS9 A;  3A55 A;  5FOB B;  4E6I A;  3UE0 A;  2KQ3 A;  1NR4 A;  4CJ1 B;  4DK1 A;  3VR4 A;  3CHB D;  2K28 A;  1F9P A;  2K04 A;  4KHV A;  1JR0 D;  4RAU C;  1Z7T A;  1QVC A;  3HKS A;  3G71 A;  4OWW B;  2E74 C;  3RZD B;  2IHE A;  1P16 A;  5EKL A;  4GLX A;  4IFD J;  1PTO C;  4P2C B;  3FKI G;  1Y1W G;  4JOI A;  1HTP A;  3I4N B;  1HTL D;  3IL8 A;  4LFB L;  1SSO A;  3DMU A;  3NPP A;  4LWC A;  1K8G A;  4ALP A;  2C35 B;  2DNE A;  5IWA L;  4PMW A;  3U58 A;  4LFB Q;  3S1Q B;  1QNK A;  1Q8I A;  3A8J E;  2D5D A;  1TXY A;  3NTI A;  1HZB A;  5IWA Q;  2EE1 A;  3IRB A;  4AIM A;  1CKO A;  2R93 G;  1EFI D;  5E7N A;  2VQF L;  4DXG A;  5JVH 3;  2VZA A;  4PQX A;  4JBW A;  3PCO B;  4JOI C;  4GS3 A;  2CH4 A;  4LFA L;  4A3J H;  2VQF Q;  1NCV A;  2ZT9 C;  5IYD G;  3RZO B;  4MTN A;  4LFA Q;  1PH4 A;  4FNF A;  2KOL A;  4IO9 A;  4ME5 A;  4WOR A;  1DOL A;  2F0J A;  4IOC A;  2NN6 G;  1KAB A;  3TSS A;  1KLG D;  4A3M H;  4IUU A;  2NWG A;  3E6Z X;  4V19 0;  3HOV B;  1TS5 A;  3A5Z B;  4YCV A;  4J1M A;  1KC8 C;  4C3H B;  1VMP A;  3G4S A;  4JBM A;  1JQY D;  2R7Z B;  3S17 H;  4TSS A;  2IX0 A;  1WCM B;  4CDE C;  4QL5 A;  1PA6 A;  4K8J A;  1JJC B;  1BKB A;  2NVT B;  4I7A A;  5FLX L;  1YHA A;  1Y8N B;  2NVX H;  5I2X A;  1NMG A;  4BY7 H;  4RG1 A;  2HD3 A;  2P5Z X;  1V1Q A;  3NBH A;  5HGT A;  1IW7 C;  3ULJ A;  2QDB A;  4QMG A;  4A3D H;  1Z9F A;  1XMO L;  4JC0 A;  2RF4 A;  2KED A;  2K05 A;  4HN7 A;  1D2B A;  2F0E A;  1L2F A;  3KF6 B;  1VQ9 A;  3ZJY C;  4QY7 A;  1XMO Q;  4BBS B;  4RWS C;  3VR2 A;  1Z47 A;  4BBR H;  3FKI B;  2VB2 X;  3HOY B;  2G5D A;  3F2B A;  4DAY A;  1J6Q A;  3T56 B;  2XRQ D;  2CW0 D;  3VR6 A;  5CGK A;  2K75 A;  5FO9 B;  4A75 A;  1ET9 A;  1WTQ A;  3OOC A;  1JE4 A;  5D65 A;  3VR3 A;  2F3W A;  2WAQ B;  3DLL A;  2ZJP A;  4X3T A;  2BDO A;  3E3X A;  2XWB B;  1SDF A;  3CCV A;  4ZUI A;  4L63 B;  2JQO A;  3I4L A;  3H3V C;  4WJW A;  1EYC A;  1LTL A;  2NVY B;  2HIX A;  4TVA B;  1BF4 A;  3BZK A;  1HRJ A;  1SYD A;  2B2W C;  4JYA L;  1H9M A;  1B53 A;  3H3V I;  2K5Q A;  3KLS X;  2NZO A;  4DR7 L;  4JYA Q;  4KHP L;  3TS0 A;  1WD1 A;  1GKH A;  1EYA A;  4MNO A;  3TDQ A;  1N32 L;  3PO3 B;  3J81 j;  1PRT C;  1IBK L;  1UE5 A;  5GQO A;  3RD4 A;  1LV9 A;  2ES2 A;  4DR7 Q;  4KHP Q;  2OTL A;  1SAP A;  5IGC A;  1IBK Q;  5EKI A;  3D31 A;  1V1P B;  2EY6 A;  2RSO A;  1QCB D;  1HXY D;  2NTT A;  1Y1W H;  2PPB C;  4HID A;  1QNU A;  3W5O A;  2BH8 A;  2L12 A;  3P75 A;  5E4W C;  5ELE A;  1SN8 A;  2AQ3 B;  4RGO S;  3K5M A;  2UUB L;  4EQN A;  3PIO 3;  1VQP A;  1EY7 A;  3DEP A;  2HHH L;  2FHT A;  3PO2 G;  2J7Z A;  2JA7 G;  1EZ8 A;  5D3D A;  2UUB Q;  2F03 A;  2HHH Q;  5M5Y B;  2G9D A;  5ELD A;  2R93 H;  3D8G A;  2E2J H;  1Y8O B;  3QOJ A;  3JAM E;  4C3I B;  3MFG A;  1EY9 A;  3CF5 A;  1JIC A;  1TY2 A;  2ID0 A;  2J0T D;  2NZH A;  5C4X B;  3G6J B;  3NQI A;  2M00 A;  4KN7 C;  1V43 A;  1PFN A;  2VUM G;  1RTO A;  3AYH B;  1AP0 A;  1EWH A;  3OPO A;  1XNQ L;  5DEH A;  1V8Q A;  4O2D A;  1XX8 A;  5CV8 A;  1S72 A;  1ASY A;  4JI7 L;  5DNF A;  4NKL A;  2B63 G;  3K7A H;  4KJN A;  1XNQ Q;  1B3A A;  1K83 B;  2F0N A;  2R3Z A;  4K6L A;  1EYD A;  2H1E A;  4JI7 Q;  2KJX A;  2FJ2 A;  4GKK L;  1UEB A;  5LMU L;  1X56 A;  2CHB D;  4I65 A;  4GKK Q;  5LMU Q;  3SDZ A;  4BXX G;  3J81 E;  4YWL A;  3A54 A;  3FMC A;  3OTO L;  1IYV A;  2CVR A;  2PW7 A;  2YTV A;  4AYB G;  2K5H A;  1YI2 A;  1WTV A;  5TSS A;  4DV1 L;  3OTO Q;  3HP3 A;  1IBM L;  1C9O A;  1JWM D;  3NK9 A;  2E2H B;  2EYM A;  1X55 A;  3MTS A;  3RLF A;  1QG7 A;  2NTS A;  5BN3 A;  4DV1 Q;  3GTG B;  1IBM Q;  5JJI A;  2AUJ D;  4YY3 L;  2MPM A;  1KXL A;  3TP7 A;  1GJX A;  2JA8 B;  4DNR B;  1D5Z C;  4PZ7 A;  2KA7 A;  1HUN A;  2F0M A;  3M85 A;  1A0I A;  3M7G A;  4YY3 Q;  3J80 L;  2K5V A;  4OEM B;  5I9P A;  1IKL A;  1EU3 A;  3OW2 A;  3ICE A;  4DV3 L;  1TWA B;  1TWF B;  3TME A;  1SMX A;  5M3M G;  4DV3 Q;  3TS2 A;  3M3Y B;  4PZ8 A;  1AN8 A;  3I4M H;  5C4H A;  1LYL A;  3WOF A;  4ODG A;  1PH6 A;  1L0X B;  1DON A;  4FP5 D;  2F0S A;  2YYZ A;  1PTO B;  1Y1V B;  3ITP A;  3UI2 A;  4ZK9 B;  2Z6B A;  5I2Y A;  2H4O A;  1PH8 A;  3OIQ A;  4ZQ3 A;  5CC4 A;  5FJ8 G;  2KHJ A;  2QIL A;  3CAM A;  1STN A;  4B3S L;  1MJC A;  1Q1B A;  3OW7 A;  1GHK A;  3GDE A;  2FIN B;  4B3S Q;  3I8Z A;  4MHE A;  3HOX H;  3O13 A;  3MAQ A;  1G6P A;  1NY4 A;  2B2V A;  2JA6 G;  2A69 D;  4DFA A;  2A19 A;  1XXG A;  2X69 A;  4G57 A;  3J7A F;  5J1Z A;  3S1M B;  1MKH A;  2QEJ C;  3EBE A;  5C0X H;  1I50 B;  1VQC A;  1JB3 A;  4JI4 L;  5FKA C;  1PH5 A;  5AJ3 L;  1NTG A;  1PYW D;  1BBX C;  1UEA B;  3OYY A;  4DAV A;  3Q22 A;  4JI4 Q;  3VA5 A;  4OO1 H;  5AJ3 Q;  1LT3 D;  4MTK A;  3RNU A;  1Q7Y C;  2NVQ B;  4NMZ A;  1PTO F;  2B2V C;  1R4P B;  1QJO A;  4UP9 A;  2B2Y C;  4JI1 L;  1PFB A;  1AE2 A;  4G7H C;  2PO4 A;  4LNQ A;  4ZAI A;  4JI1 Q;  2JA7 H;  3VYS A;  1LTI D;  4A3G B;  3STB C;  1LM0 A;  3HKZ G;  4OXP A;  4A3B B;  1I94 L;  1PMR A;  2FFK B;  2KEE A;  1SRO A;  1YJN A;  1LTG D;  1LAB A;  5E4X A;  1I94 Q;  1MBY A;  1KD1 C;  4IFD I;  1F9S A;  4ZLT F;  1U5K A;  1DXM A;  3I72 A;  4JK1 C;  4A3F B;  2EYJ A;  3K5O A;  2VY3 A;  2F0V A;  3HOU G;  2RHS B;  3WDN A;  3KF8 B;  1I3Q B;  3L0O A;  5JEA J;  3CCR A;  5T1G A;  1EZ6 A;  4RCN A;  2NUC A;  3S16 H;  3A0J A;  1B8A A;  3PUX A;  2B63 H;  4CKB A;  1KHI A;  3HOW B;  1DOK A;  5EQ0 A;  3T1Y L;  3GD7 A;  3TQY A;  4FF1 A;  2K32 A;  3KBG A;  5JOB A;  5IE8 A;  3M4O H;  3CD6 A;  4X66 Q;  3NBH B;  1OO9 B;  1S4Z A;  2XSC A;  3TP5 A;  1JWU D;  2D9U A;  4FVM A;  1RCV D;  3V96 A;  3WWV A;  2B3G A;  3SE0 A;  5CV4 A;  2Q2U A;  4OON A;  2BDN A;  4ZCK A;  4V0B A;  2A73 B;  2AHO B;  1VQK A;  3CQZ H;  1HA6 A;  2IJ0 A;  4K5V A;  3TP8 A;  4B3M L;  3CRL C;  1IL2 A;  1QE6 A;  5A2Q L;  2KCT A;  5EJW A;  1JT8 A;  2KEN A;  1G2T A;  1IKM A;  3NBI A;  3AQQ A;  4DV0 L;  3NUC A;  1NMF A;  5ELC A;  5LL6 S;  1EQT A;  5M3F G;  1CA6 A;  4DV0 Q;  1T9H A;  4KJO A;  3E0E A;  4RGM A;  4NXN L;  1Q81 C;  4M1U B;  2YTY A;  3R3O A;  5M3M H;  4UHV A;  1PRT B;  3NP8 A;  4NXN Q;  2V4D A;  3TRZ A;  5IP9 G;  3K80 C;  4IN3 A;  2A68 C;  1CZW A;  1ICW A;  1EWC A;  2HDL A;  3GTM B;  3URY A;  1EEF D;  1DJR D;  2K7V A;  3EJI A;  2Z4H A;  5FJ8 H;  1KAW A;  2RHQ B;  3HFZ B;  3ULP A;  3GTL H;  4EVO A;  2PCF B;  2PZW A;  5BR8 L;  2AQ2 B;  4A3L G;  5I6W A;  2E5L L;  3J81 c;  5BR8 Q;  2OXP A;  5IGB A;  1YIT A;  3GTQ B;  5IOC A;  5CBA E;  2E5L Q;  4QUC A;  4IJH A;  1JOO A;  1CK1 A;  1PFM A;  5IP7 H;  1NBW A;  3DWA A;  3TZU A;  4FF3 A;  4N8F A;  3UDX A;  1A63 A;  3TRE A;  2HT1 A;  5D14 A;  3RR5 A;  1OTC A;  1X6O A;  4UDU C;  3BVM A;  1YZ6 A;  2AQ1 B;  3DHQ A;  1CTM A;  1OXX K;  3SGI A;  4OWT B;  3QR8 A;  3M4P A;  5LMN L;  1C4Q A;  3I4N G;  3MXG A;  4JW0 A;  3G48 A;  3GTP B;  5E1F A;  5LMN Q;  4DKA C;  2ZJR A;  3GTK B;  2Z8L A;  4ID6 A;  3JC6 6;  1LTB D;  2JSO A;  2RCF A;  3AU7 A;  1STY A;  1I4P A;  2CWA A;  2DY7 A;  3ND9 A;  1LTS D;  1KLU D;  4KTA A;  4XTC S;  4BY1 B;  3LGJ A;  2F4I A;  2WKC A;  3EQL C;  1O80 A;  4CDF C;  3S2D B;  1A8V A;  1E22 A;  1LLR D;  3QOL A;  4DR6 L;  1A3U A;  3GO5 A;  2M9V A;  2E2D C;  1GUT A;  4DU9 A;  4RGT A;  2JJQ A;  4DR6 Q;  3HOU H;  5JPN C;  2K52 A;  3T1H L;  5DM6 3;  3T4A C;  3DWQ A;  2O5I C;  4DR5 L;  1J8I A;  1FYC A;  2EJF C;  3H94 A;  5DM7 3;  4LUZ A;  3HOV G;  3T1H Q;  4HJ5 A;  1I4X A;  1F2Y A;  4DR5 Q;  4HSV A;  1WTO A;  1CI3 M;  2D0P A;  3UDF A;  4O1N A;  2R7Z G;  5F2D A;  3ER0 A;  3CCJ A;  2AUK A;  1WCM G;  2N3S A;  4DR1 L;  5CR3 A;  3GTJ B;  4L5Q A;  1K3R A;  3W1G A;  1EU4 A;  3M4Q A;  1Y8P B;  1BVS A;  2HCI A;  4XQQ A;  2BE5 D;  2EY2 A;  4DR1 Q;  3OWF A;  3BDC A;  2VXW A;  2Y0S B;  3I91 A;  4RFB A;  4DUZ Q;  2QA4 A;  2UUC L;  2KCM A;  3FRP B;  4Q0F A;  4YHH L;  2N49 A;  1PFS A;  2L4N A;  1PH9 A;  3KFU A;  1EY5 A;  2UUC Q;  3C2P A;  2NB0 A;  2HDM A;  2CW0 C;  4YHH Q;  5JPM C;  3EA6 A;  4BBS G;  3MFY A;  3MXU A;  5HGQ A;  1X9N A;  3D4D A;  3HOY G;  5C0X I;  1TII D;  2A6H C;  1N33 L;  3E9I A;  1STG A;  3F8T A;  3FDT A;  2O5J C;  2K5D A;  3IFT A;  1KIX A;  1E7Z A;  5IGG A;  3NEL A;  1N33 Q;  4OO1 I;  2WAQ G;  5ELB A;  1V1O A;  4R4C A;  5C3E H;  3I90 A;  1W3S A;  1KDC A;  2JE6 I;  1YNJ D;  3S17 B;  3AFQ A;  5COY A;  5C5L A;  2D0O A;  2E76 C;  1JCK B;  1HNW L;  4CJ2 C;  4QCL A;  4CDD C;  3VYR A;  2L9H A;  1HNW Q;  4JI5 L;  3K6O A;  4QB4 A;  1IXR A;  4DF7 A;  1UAP A;  4PG3 A;  1K9M C;  1D1K A;  3J7A 5;  2QCP X;  4KY5 A;  3GV3 A;  2Y0S E;  1A3T A;  2SNS A;  1JJ2 A;  1GUN A;  3PV0 A;  4A3L H;  4JI5 Q;  1BDO A;  2PMZ E;  1MJE A;  3NQT A;  3E9H A;  4Y52 H;  2MQH A;  2A6E D;  3DEO A;  5C44 H;  3M7N A;  4KMU C;  1NNX A;  4FXG C;  5KRU A;  4IUR A;  4CJ0 B;  1ILQ A;  2JA9 A;  2ZXP A;  3PO3 G;  1EY4 A;  4OGQ C;  3GP7 A;  3KF8 A;  4CGY B;  3RZD H;  4JCV E;  1VQI A;  3RN2 A;  1CA5 A;  2RBM A;  1HR0 W;  2EJM A;  1AFP A;  2OT2 A;  3BJU A;  1YIJ A;  1BBW A;  1G6Z A;  4LJZ C;  3JAM L; 
#chains in the Genus database with same CATH homology
 4O2D A;  4JI7 L;  1S72 A;  1PV4 A;  1ASY A;  3UDI A;  3ULL A;  1FL0 A;  4HJ9 A;  1EQQ A;  1WFQ A;  3CMA A;  2B63 G;  3K7A H;  1XNQ Q;  1OXS C;  3VDY A;  4JI7 Q;  1SRU A;  4IFD G;  4DV2 L;  1CSP A;  3D0F A;  1G51 A;  4GKK L;  2Q2H A;  1UEB A;  2WB1 G;  1UWV A;  5LMU L;  2XGT A;  4R4I A;  4DV2 Q;  1X56 A;  1VQH A;  2DUD A;  4A3I G;  4JI6 L;  2UUA L;  2NVQ H;  3F2D A;  3GTQ H;  3Q8D A;  4GKK Q;  1PH2 A;  4GKJ L;  3G6E A;  1HJP A;  1IYJ B;  4UPA A;  5LMU Q;  1XJV A;  2ZJQ A;  1VQN A;  2CKZ B;  3KF6 A;  4BXX G;  1QUQ A;  4YWL A;  1CSQ A;  1TWH H;  3S24 A;  3OTO L;  4JI6 Q;  2UUA Q;  4GKJ Q;  3PUZ A;  2N78 A;  2YTV A;  2WB1 E;  1L0W A;  5IYB H;  5C4X G;  3GTO H;  1NE3 A;  4AYB G;  2K5H A;  2BA0 A;  1YI2 A;  3RZO H;  3CPF A;  4DV1 L;  3OTO Q;  4HJ7 A;  2H5X A;  4HJA A;  1SE8 A;  1Q12 A;  1IBM L;  4A3B H;  5GAG C;  1C9O A;  4KI0 A;  1P8L A;  1X55 A;  2V1C C;  1N9W A;  1E1T A;  3RLF A;  3T1Y Q;  4DV1 Q;  1EFW A;  4TQU S;  4LF9 Q;  4H02 A;  3CCQ A;  1EOV A;  1IBM Q;  5JJI A;  2JK8 A;  4YY3 L;  1KXL A;  3MXN B;  4J15 A;  1KRT A;  3GTP H;  4BA1 I;  4LUO A;  4POF A;  1I6H H;  1W2B A;  4PZ7 A;  3CME A;  4DUZ L;  3M85 A;  3GTK H;  1A0I A;  4C3H H;  2OWO A;  4YY3 Q;  2I5H A;  4FDB A;  2ASB A;  2FXQ A;  2K5V A;  2MO0 A;  3F1Z A;  2I5L X;  3KOJ A;  1X3G A;  3OW2 A;  3ICE A;  2OTJ A;  4DV3 L;  4X65 L;  2WP8 J;  2Q2T A;  1AE3 A;  1YJW A;  2R7F A;  1UE1 A;  4DV6 L;  2R7Z H;  3L7Z C;  4Y7N H;  1I3Q H;  2R92 G;  4BY1 H;  1GVP A;  1NJI C;  1SMX A;  4DAY B;  5M3M G;  4DV3 Q;  3TS2 A;  4X65 Q;  3EN2 A;  4PZ8 A;  4JI8 L;  1X3F A;  3AFP A;  4DV6 Q;  3I4M H;  3I7F A;  3S2D H;  1UE7 A;  2Q2I A;  5EAY A;  1LYL A;  1CKN A;  3KDF A;  3PIO A;  4GLA C;  1PH6 A;  4DAM A;  2K14 A;  3JAM c;  2NVT H;  2YYZ A;  4JI8 Q;  4B3M Q;  4PZ6 A;  3L2P A;  1Q8K A;  2JA5 H;  1PH8 A;  1Y14 B;  2VQE L;  5FJ8 G;  2KHJ A;  5M3F H;  5K36 G;  3CAM A;  2KHI A;  5IYC H;  4QIW E;  1EWI A;  1G29 1;  1MJC A;  4B3S L;  1BBU A;  2KBN A;  1VQM A;  1N34 L;  2VQE Q;  1VQG A;  3CPW A;  3CCE A;  1S40 A;  1Q1B A;  2JA8 G;  3GDE A;  1HNX L;  4LF4 L;  4ME3 A;  4B3S Q;  3M9B A;  4UY8 C;  5IP9 H;  1N34 Q;  3HOX H;  5C3E G;  2CWP A;  1WI5 A;  1G6P A;  1NY4 A;  4GN4 B;  2EXD A;  1HNX Q;  4LF4 Q;  2JA6 G;  2A19 A;  3B6Y A;  3FKI H;  2E2I H;  1H95 A;  4LF5 L;  2JEB I;  4QGU A;  3KJP A;  2XTI A;  3RLO A;  2ZM6 L;  3K81 C;  4JV5 L;  3RLN A;  4A3J G;  1L1O B;  1X3E A;  4LF5 Q;  1MKH A;  1AH9 A;  3EBE A;  1YJ9 A;  2ZM6 Q;  4JV5 Q;  1VQC A;  4JI4 L;  2Z6K A;  2OQ0 A;  5GRO A;  3U4Z A;  1PH3 A;  1PH5 A;  5ELO A;  5AJ3 L;  3GTJ H;  1NTG A;  4HIM A;  1JE5 A;  3OYY A;  2ZTC A;  4GOP A;  2GVA A;  1PVO A;  3KLW A;  1Y1V G;  4JI4 Q;  4LF6 L;  2WFW A;  4KLK A;  4HIO A;  1XNR Q;  5AJ3 Q;  4DV7 L;  1U0L A;  1Q7Y C;  3RNU A;  1RL2 A;  4A3M G;  3J80 c;  5GAE C;  5C44 G;  3S2H H;  1HH2 P;  1PYS B;  4GLV B;  4LF6 Q;  1TWG H;  4LF8 L;  1FVI A;  4UP9 A;  4JI1 L;  4DV7 Q;  1EYG A;  1AE2 A;  4OX9 L;  5LMN W;  4DV5 L;  1QZG A;  5IYD H;  4LF8 Q;  4LNQ A;  1HZ9 A;  4UP8 A;  3PUW A;  1YHB A;  2NVY H;  4JI1 Q;  2JA7 H;  4A3C G;  1XTD A;  1JMC A;  3STB C;  1LM0 A;  3HKZ G;  2GN5 A;  4OXP A;  1V9P A;  2Z6K C;  4DV5 Q;  1I94 L;  3CXC A;  1N36 L;  4IPH A;  1SRO A;  3TEH B;  4GOP C;  1YJN A;  3KYH C;  2A1A A;  3JAM i;  3I4N H;  4P73 A;  3HOZ H;  1I94 Q;  1N36 Q;  1KD1 C;  1YHQ A;  4IFD I;  5J3B A;  1QZH A;  3NEM A;  1U5K A;  1HR0 L;  3HKZ E;  2MFI A;  3I55 A;  1J5E L;  3PO3 H;  1Q86 C;  3S1Q H;  4BY7 G;  1JB7 A;  1YBY A;  1HR0 Q;  2ATW A;  3S1R H;  1VQB A;  2VY3 A;  3PIP A;  4B3R L;  3HOU G;  1J5E Q;  2RHS B;  3KF8 B;  3L0O A;  1VQA A;  2YV5 A;  5JEA J;  3CCR A;  4JBK A;  4A3D G;  1EUJ A;  3CCU A;  1QVF A;  4P71 A;  4B3R Q;  4QQB X;  2D62 A;  3S16 H;  3K8A A;  5IY0 A;  4HIK A;  4IOA A;  3A0J A;  5C0X J;  1B8A A;  1OXU A;  3KJO A;  3PUX A;  5M5X H;  2B63 H;  5JJK A;  5IYB G;  2HIV A;  1KHI A;  2UXC L;  1VQJ A;  4BBR G;  3T1Y L;  4K0K L;  3GD7 A;  4LF9 L;  1FJG L;  5DLQ E;  2CQO A;  4A3G G;  3TQY A;  1IBL L;  5IT9 c;  4A3B G;  4A3K G;  5IE8 A;  3M4O H;  2UXC Q;  1VQL A;  4K0K Q;  3CD6 A;  3I4O A;  1WYD A;  1FJG Q;  5M5Y H;  2YU9 H;  2PI2 A;  4P75 A;  1GM5 A;  1LUZ A;  1IBL Q;  1O7I A;  4A3I H;  4O0A A;  4X66 Q;  3NBH B;  1ASZ A;  1SLJ A;  4NB3 A;  4X62 L;  4YCU A;  4UP7 A;  4C3I H;  1VQO A;  3WWV A;  3HOV H;  1VS0 A;  2AMC B;  3A5U A;  2B3G A;  4DV4 L;  1XPU A;  4YCW A;  5JJL A;  2E8G A;  4X62 Q;  4NXM L;  4GNX B;  4L5T A;  2Q2U A;  1Q46 A;  4OON A;  4DV4 Q;  4A3F G;  4A3E G;  3K7U C;  1K8A C;  2IT1 A;  1YNX A;  1KQS A;  4L5S A;  2AHO B;  3PUV A;  4IPD A;  1VQK A;  2R7D A;  4NXM Q;  4XIG S;  1EQR A;  1VQE A;  3CQZ H;  2BH2 A;  1IZ6 A;  1N8R C;  4AH6 A;  1WCM H;  4HJ8 A;  2UU9 L;  4B3M L;  3CC4 A;  1IL2 A;  3I4M G;  4EQ5 A;  3S1N H;  1K0R A;  2KCT A;  4MZ9 A;  2L15 A;  1UE6 A;  1JT8 A;  1OXV A;  2KEN A;  2VL6 A;  1K83 H;  2UU9 Q;  3HOW G;  3AQQ A;  4DV0 L;  3UDG A;  1NMF A;  3UE0 A;  4JI0 L;  5M3F G;  4DV0 Q;  1PH1 A;  4DNI A;  2MO1 A;  4A93 G;  3MEF A;  5C4J H;  1T9H A;  4NXN L;  3E0E A;  1Q81 C;  4JI0 Q;  2R92 H;  2YTY A;  5M3M H;  1QVC A;  1VQ6 A;  3HKS A;  3G71 A;  4OWW B;  2PQA B;  2HQL A;  4DR2 L;  2RCN A;  4NXN Q;  2K50 A;  3TRZ A;  3CCS A;  5IP9 G;  2IHE A;  4DK3 C;  3K80 C;  5FLM G;  3HOX G;  1P16 A;  1XPO A;  2LXJ A;  4GLX A;  2UXB L;  4BBS H;  4IFD J;  2B29 A;  4DR2 Q;  3FKI G;  3KDF B;  4JOI A;  1Y1W G;  5GAH C;  3HOY H;  1HNZ L;  3J7Z C;  4NPS A;  3PF5 A;  2OCE A;  4LFB L;  2UXB Q;  1S3O A;  5FJ8 H;  1KAW A;  2AWN A;  2RHQ B;  3HFZ B;  3ULP A;  4YWM A;  1SFO H;  4LWC A;  4X64 L;  1VQ7 A;  1K8G A;  3A74 A;  3S14 H;  4ALP A;  1HNZ Q;  5C0X G;  2YTX A;  3GTG H;  3PGZ A;  3GTL H;  2C35 B;  4DK6 C;  4GN5 A;  5IWA L;  4PMW A;  3U58 A;  4LFB Q;  5BR8 L;  1VQ5 A;  4KHZ A;  1XNR L;  4X64 Q;  2JA8 H;  4R4T A;  1TXY A;  4A3L G;  1HZB A;  3UE1 A;  3J81 c;  3H0G G;  2F52 A;  2E5L L;  3PSI A;  1N32 Q;  5IWA Q;  3IRB A;  4AIM A;  5BR8 Q;  1CKO A;  4OO1 G;  2R93 G;  1WJJ A;  2ALY B;  1YIT A;  5E7N A;  2BA1 A;  4DUY L;  2VQF L;  2E5L Q;  2VZA A;  4IJH A;  2UXD L;  2DGY A;  2VS1 A;  4JBW A;  1TWA H;  3PCO B;  4JOI C;  4GS3 A;  1TWF H;  4DPG A;  5IP7 H;  1NBW A;  1OXT A;  1D8L A;  4DUY Q;  2VQF Q;  4A3J H;  4LFA L;  3UDX A;  2WAQ E;  1A63 A;  3TRE A;  2HT1 A;  2UXD Q;  4LF7 Q;  5IYD G;  2EQS A;  3RR5 A;  1X6O A;  3BZC A;  1OTC A;  1PH7 A;  3PO2 H;  1YZ6 A;  2GVB A;  4MTN A;  4BA2 I;  4LFA Q;  3SGI A;  1OXX K;  1PH4 A;  4OWT B;  2LXK A;  4JG2 A;  4IO9 A;  1Y1V H;  3M4P A;  5LMN L;  2F4V L;  4R4O A;  3I4N G;  4IOC A;  2NN6 G;  4IPC A;  4A3M H;  3S15 H;  4DR3 L;  3G48 A;  3ERS X;  2IHF A;  3H15 A;  5LMN Q;  2F4V Q;  3A5Z B;  4DKA C;  4YCV A;  2ZJR A;  1KC8 C;  1SR3 A;  3JC6 6;  3CC2 A;  4YWK A;  4DR3 Q;  3NEN A;  1GD7 A;  1GO3 E;  4A4I A;  3PF4 A;  2CWA A;  1VQD A;  4A3C H;  1VQF A;  2R6G A;  3G4S A;  4JBM A;  4IPG A;  2VUM H;  4JI3 L;  3S17 H;  1Q82 C;  4B3T L;  4XTC S;  2IX0 A;  1PYB A;  1B7Y B;  3LGJ A;  3S1M H;  4QL5 A;  1PA6 A;  1DGS A;  1A8V A;  2AKW B;  2Z0S A;  3I2Z A;  4JI3 Q;  1X54 A;  1I5F A;  4B3T Q;  1JJC B;  1E22 A;  1BKB A;  4OWX B;  2PNH A;  1I50 H;  4DR6 L;  3GO5 A;  4LFC Q;  1YHA A;  4R1J A;  2NVX H;  1NMG A;  4LW1 A;  4X66 L;  4RG1 A;  4BY7 H;  1V1Q A;  5HY6 A;  2JJQ A;  5H1S E;  1XMQ L;  2IX1 A;  3HOU H;  4DR6 Q;  2CFM A;  3CW2 C;  2K52 A;  3T1H L;  1TWC H;  3ULJ A;  3J81 i;  4R4Q A;  4A3D H;  2JEA I;  2LSS A;  4DR5 L;  4JBJ A;  1XMQ Q;  1Z9F A;  1XMO L;  4JC0 A;  2K5N A;  2N8N A;  2RF4 A;  1B70 B;  4LUZ A;  4P74 A;  4GNX A;  3T1H Q;  1VQ8 A;  3HOV G;  4BXX H;  1JJG A;  4HJ5 A;  3J80 i;  3CCL A;  1L2F A;  4DR5 Q;  3KF6 B;  1VQ9 A;  3ZJY C;  4QY7 A;  1QUQ B;  1WOC A;  5C4X H;  1XMO Q;  2EIF A;  1Z47 A;  1E24 A;  4BBR H;  2D0P A;  3BU2 A;  4A3G H;  2VW9 A;  3F2B A;  3UDF A;  1J6Q A;  2R7Z G;  4A3K H;  4BY1 G;  1E3P A;  3ER0 A;  3CCJ A;  4DR4 L;  1WCM G;  2K75 A;  1HZA A;  1Q1E A;  4A75 A;  3AEV A;  2N3S A;  4WJ3 M;  4AYB E;  1VCI A;  4DR1 L;  4L5Q A;  1K3R A;  3W1G A;  4DR4 Q;  1C0A A;  1YEZ A;  1MIU A;  5ELN A;  3M4Q A;  1BVS A;  3DLL A;  2ZJP A;  4GNX C;  4DR1 Q;  2JA5 G;  4X6A H;  4C2M H;  3CCV A;  4A3F H;  4POG A;  4OX9 Q;  1KL9 A;  4DUZ Q;  4A3E H;  2QA4 A;  2UUC L;  5IYC G;  2CCZ A;  2KCM A;  4L5R C;  2PQA A;  4YHH L;  2N49 A;  1YVC A;  1PFS A;  1PH9 A;  3KFU A;  2UUC Q;  2JQO A;  1HZC A;  1PHJ A;  1KRS A;  4WJ4 A;  2QGQ A;  4AQY L;  1LTL A;  3F2C A;  3CC7 A;  4YHH Q;  1D7Q A;  3U4V A;  2HIX A;  4TVA B;  4BBS G;  2I0Q A;  3HOW H;  3BZK A;  1C7Y A;  5HGQ A;  4AQY Q;  1CKN B;  1X9N A;  4JYA L;  3HOY G;  2VNU D;  1L1O A;  1A62 A;  5JEA G;  3FHW A;  5C0X I;  1XPR A;  1QVG A;  1N33 L;  3E9I A;  3H3V I;  3F8T A;  2E2H H;  5FLX c;  2NZO A;  4DR7 L;  4JYA Q;  4KHP L;  4A93 H;  3TS0 A;  1GKH A;  4MNO A;  1E7Z A;  4EX5 A;  1KIX A;  3NEL A;  1N32 L;  1N33 Q;  4IJL A;  3J81 j;  1IBK L;  1UE5 A;  5GQO A;  2ES2 A;  4DR7 Q;  4OO1 I;  4KHP Q;  2ZTD A;  2IY5 B;  4APV A;  2WAQ G;  1RIP A;  2F3I A;  2OQK A;  2OTL A;  3DM3 A;  4R4C A;  2ZTE A;  5FLM H;  5C3E H;  1IBK Q;  3D31 A;  1R9T H;  1W3S A;  2JE6 I;  2JA6 H;  3AFQ A;  1M90 C;  2Y0S G;  1Y1W H;  2D0O A;  4P72 A;  2I5M X;  4LF7 L;  2QEX A;  1HNW L;  4HID A;  2AWO A;  4LUV A;  2PI2 E;  5IP7 G;  1L1O C;  2BH8 A;  1EIF A;  3W5O A;  5M5W H;  2A8V A;  1SN8 A;  3M3Y H;  3STB D;  3W1B A;  1K73 C;  4QJF A;  2UUB L;  1HNW Q;  4JI5 L;  4A76 A;  1FGU A;  1IXR A;  1VQP A;  3H3V H;  1E1O A;  4PG3 A;  2HHH L;  1K9M C;  3J7A 5;  2JA7 G;  1CKM A;  3PUY A;  3PO2 G;  3CCM A;  2NN6 I;  2Y0S E;  1EIY B;  2UUB Q;  1JJ2 A;  3PV0 A;  4A3L H;  4JI5 Q;  3H0G H;  4C3J H;  2K4K A;  2PMZ E;  1MJE A;  1VQ4 A;  2HHH Q;  1CUK A;  2R93 H;  4GOP B;  3HOZ G;  2E2J H;  3K0X A;  4RMF A;  3E9H A;  3U50 C;  4Y52 H;  2MQH A;  3CP0 A;  3FP9 A;  5C44 H;  3CF5 A;  3M7N A;  2MNA A;  3EIV A;  2JA9 A;  3PO3 G;  2ID0 A;  2NZH A;  1M1K C;  4GN3 B;  1X65 A;  5GAD C;  3RZD H;  4JCV E;  1VQI A;  4JI2 L;  3RN2 A;  1V43 A;  1HR0 W;  3RN5 A;  2VUM G;  3AYH B;  1YIJ A;  3BJU A;  3GTM H;  1BBW A;  3I56 A;  1XNQ L;  4JI2 Q;  4LFC L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...