4B3UA

Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
303
structure length
299
Chain Sequence
HHHHHHMKRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric competitive inhibitors of the glucose-1-phosphate thymidylyltransferase (RmlA) from Pseudomonas aeruginosa.
pubmed doi rcsb
molecule keywords GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
molecule tags Transferase
source organism Pseudomonas aeruginosa
total genus 97
structure length 299
sequence length 303
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.24: Glucose-1-phosphate thymidylyltransferase.
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 4b3uA00
1SS9A 1ZJ2A 2YQHA 1G3LA 3SXCA 1LZJA 2AESA 1LZIA 4B4MA 2YQSA 1ZCTA 3Q4SA 2RJ1A 2FYCB 5C4CA 1YP3A 4ARWA 1ZCUA 3JUJA 2BO7A 3V0PA 3Q80A 3OKRA 3CKVA 4KXOA 1LL2A 3I0HA 4HO4A 1TW1A 2WVMA 2RJ4A 4P00A 1XHBA 3FOQA 4EVWA 4J18A 1NQIB 2Y7AA 2WVLA 1LZ0A 5AJOA 5AJNA 2E8BA 4B2WA 4FQWA 3IOJA 5CMIA 1ON8A 4KNRA 2Y4LA 1HJLA 1K4VA 2VXMA 2VXLA 4FRMA 4KPXA 1H4DA 1H7HA 5CMHA 4ASJA 4LW6A 5DDTA 1NWGB 2AM4A 4FRAA 3SX7A 4EEMA 5BXCA 3TZTA 1NKHB 3R2WA 4BMAA 4ASYA 3CKOA 4BQHA 5FUHA 3D8VA 1VPAA 2RJ7A 1G97A 2AECA 1ZI3A 3ZLLA 1LVWA 3V0QA 2JCLA 3SXGA 2FYBA 3JTJA 5C3DA 3Q7UA 1H5TA 1NF5B 3I0FA 1G23A 1JVGA 1G8OA 1ZJ0A 5C49A 3K8EA 4KQLA 1PZYB 1S4OA 4FREA 3USRA 4DE7A 5CMJA 1ZJPA 3CKJA 2BO4A 2VFZA 4B4GA 1GX0A 2E3DA 3U0YA 5C1LA 2WEEA 1FXOA 5L6SA 1G9RA 5C48A 3O3PA 5JQQA 2FY7A 1FWYA 2ICYA 4MNDA 5AJPA 4FRBA 2DPWA 3V0LA 4K6RA 4D0TA 2FFUA 1FGXA 1MP3A 1FR8A 1TW5A 3U2UA 1H3MA 2RJ8A 2VD4A 4Y6UA 2AH9A 1H7EA 1O23B 2O1HA 2AM3A 2ZU8A 3CGXA 4EEOA 1OQMB 2A8WA 2RJ9A 1R81A 1O7QA 2P73A 3OAMA 1VM8A 2W0VA 4LW3A 4NALA 4B4BA 3OH2A 4HO5A 3SXEA 4AYLA 4EE3A 5C38A 4NANA 1HM0A 4Y9XA 5EJZA 5C4FA 1H5SD 3SPTA 3I0KA 1XZ6A 2GGOA 4HO3A 4HO0A 5C36A 2ICXA 4B42A 1H7QA 2WE9A 2AGDA 2VS3A 3I0GA 1R80A 3U2XA 3EE5A 1ZCYA 5C3AA 2RIZA 5C4BA 4ZDQA 4FRPA 4Y64A 1JYKA 1LL3A 3OC9A 3V8YA 2BO8A 1VGUA 2PA4A 1G1LA 2VS5A 4EE5A 2YC3A 1GWWA 4EE4A 4M2BA 2WAWA 2O1FA 1INJA 1G0RA 3SXDA 3U2TA 1ZIZA 3V0NA 1R7YA 2Z86A 2FYAA 1O7OA 4L41C 3CKQA 1ZDGA 3RMVA 3DUVA 4C2SA 1FXJA 2FFVA 4CJCA 4EEAA 1VGWA 2APCA 3JUKA 5CQOA 1G95A 3T7MA 2GGQA 2Y6PA 2XMHA 2X5SA 4YS8A 3SX5A 1QG8A 3E26A 3POLA 1R7TA 2RIXA 1JVDA 3OH0A 1QGQA 5C8RA 3SXAA 4HOCA 1ZDFA 3ZLKA 4Y7UA 4MYBA 3GUEA 3I0IX 4FCUA 3OH1A 1ZJ1A 2ZU7A 5CQMX 4D48A 1R7XA 1H5SB 2WGZA 2X5ZA 1H5RB 2YQJA 3I0JA 4NAKA 5C3BA 1ZJ3A 2AM5A 4HG6A 1INIA 4KC1A 2QH5A 2PGVA 4CJBA 1EZIA 3USQA 2P72A 4HO9A 3ZGFA 2JCOA 2RJ6A 2V0LA 2V0JA 1KWSA 4FRHA 4M4KA 5FTVA 1JV3A 1H5SA 4FRDA 2XWLA 1MP5A 4Y63A 2Y4MA 2V0HA 1MC3A 1H7GA 2I7BA 4EEGA 1VGTA 3DJ4A 2ZU9A 3ZF8A 1VZXA 1HV9A 2QGIA 3U2WA 2XWMA 2Z87A 2YC5A 4B2XA 5HS2A 2MZBA 1R82A 3DK5A 4FRLA 1ZI1A 3SX3A 4KC4A 2W0WA 5C4EA 1ZI5A 1W57A 1WT1A 1I52A 3T7NA 4JISA 5FV9A 3R3IA 5CQNX 1G2VA 3OH4A 2OEFA 4DDZA 1FG5N 3TQDA 4IRQA 1YP2A 1WVCA 4D0ZA 4G3QA 5FYEA 1GA8A 1VGZA 4KRVA 3IOIA 4AAWA 2PX7A 1VH1A 3U2VA 3PNNA 1H4EA 4Y7GA 2O1GA 1NHEB 4B3UA 2UX8A 1LZ7A 2NXVA 2QKXA 4E1KA 4D11A 1FRWA 4HO8A 4Y7TA 4FRQA 3V8ZA 4M28A 1PZTA 1ZJOA 1YROB 4HO6A 1JYLA 4M2AA 5CQLX 1FO8A 3I0CA 4AC3A 1EYRA 2X65A 2RJ5A 1FOAA 1QGSA 1JV1A 3LW6A 1H7LA 1FZWA 3CU0A 1IINA 2I5EA 1WT0A 2VS4A 1GWVA 2YESA 1V84A 1VZTA 1ZCVA 5FTSA 1R7VA 2D7IA 1E5KA 1GQ9A 4R7PA 1G93A 3T7OA 4Y6NA 5C1HA 3SXBA 1ZI4A 3K8DA 5FU0A 3BCVA 3V0MA 1VZUA 2OI7A 2P6WA 2FYDB 3PKQA 2VSIA 4FROA 3OGZA 2WVKA 4G3SA 1YP4A 2VSHA 4HO2A 1V83A 2PGYA 5FU8A 1TVYA 4ECMA 1ON6A 4KT7A 4HCQA 3N9WA 4GBPA 4KC2A 4D11C 3ST8A 1H5TB 3OH3A 3RMWA 3V90A 2D0JA 3PKPA 1H7TA 1H4CA 2XMEA 1MP4A 3KIAA 1R7UA 5IDSA 4FCEA 1OMXA 5L6VA 3V0OA 4CVHA 2XWNA 3F1YA 2YQCA 5DDVA 2OEGA 2Q4JA 5I1FA 1O0RA 1WSZA 5CMFX 2YCMA 1LL0A 5IDTA 5C1GA 1Z90A 4Y7FA 3I0EA 3D98A 1H5RA 1S4PA 1WT3A 4JD0A 3RSBA 1VH3A 1WT2A 1HM8A 5J49A 1W55A 4NAIA 2Y4JA 1NMMB 1FR9A 2RJ0A 5EJ1A 4DECA 2I5KA 3FWWA 4G3PA 3I0LA 1ZHJA 4Y62A 3ZGGA 1HJJA 4CJ8A 2V0KA 5IFYA 3CKNA 1OMZA 1TZFA 2Y4KA 4KNXA 1H7FA 3NGWA 1S4NA 5EIYA 2D7RA 3D5NA 2CU2A 3BRKX 2AE7A 3SX8A 1HM9A 1GQCA 4G87A 5C4DA 4KPZA 3F1CA 4Y7VA 1VICA 1IIMA 3IOHA 3QVBA 3E25A 2A8UA 4IRPA 3U0XA 1FO9A 2BO6A 5CMGX 2V0IA 2OI6A 1FGGA 1H5SC 4B5BA 2JCKA 4UEGA 2RITA 4XWIA 1V82A 5C47A 3HL3A 3V91A 4P02A 5CQPA 4AYJA 3I0DA 1QWJA 2JCJA 2OI5A 2RIYA 2X60A 1W77A 1GX4A
chains in the Genus database with same CATH superfamily
1SS9A 1ZJ2A 2YQHA 1G3LA 3SXCA 1LZJA 2AESA 1LZIA 4B4MA 2YQSA 5D91A 1ZCTA 3Q4SA 2RJ1A 2FYCB 5C4CA 1YP3A 4ARWA 1ZCUA 3JUJA 2BO7A 3V0PA 3Q80A 3OKRA 3CKVA 4KXOA 1LL2A 3I0HA 4HO4A 1TW1A 2WVMA 2RJ4A 4P00A 1XHBA 3FOQA 4EVWA 4J18A 1NQIB 2Y7AA 2WVLA 1LZ0A 5AJOA 5AJNA 2E8BA 4B2WA 4FQWA 3IOJA 5CMIA 1ON8A 4KNRA 2Y4LA 1HJLA 1K4VA 2VXMA 2VXLA 4FRMA 4KPXA 1H4DA 1H7HA 5CMHA 4ASJA 4LW6A 5DDTA 1NWGB 2AM4A 4FRAA 3SX7A 4EEMA 5BXCA 3TZTA 1NKHB 3R2WA 4BMAA 4ASYA 3CKOA 4BQHA 5FUHA 3D8VA 1VPAA 2RJ7A 1G97A 2AECA 1ZI3A 3ZLLA 1LVWA 3V0QA 2JCLA 3SXGA 2FYBA 3JTJA 5C3DA 3Q7UA 1H5TA 1NF5B 3I0FA 1G23A 1JVGA 1G8OA 1ZJ0A 5C49A 3K8EA 4KQLA 1PZYB 1S4OA 4FREA 3USRA 4DE7A 5CMJA 1ZJPA 3CKJA 2BO4A 2VFZA 4B4GA 1GX0A 2E3DA 3U0YA 5C1LA 2WEEA 1FXOA 5L6SA 1G9RA 5C48A 3O3PA 5JQQA 2FY7A 1FWYA 2ICYA 4MNDA 5AJPA 4FRBA 2DPWA 3V0LA 4K6RA 4FIXA 4D0TA 2FFUA 1FGXA 1MP3A 1FR8A 1TW5A 3U2UA 1H3MA 2RJ8A 2VD4A 4Y6UA 2AH9A 1H7EA 1O23B 2O1HA 2AM3A 2ZU8A 3CGXA 4Q7CA 4EEOA 1OQMB 4MIXA 2A8WA 2RJ9A 1R81A 1O7QA 2P73A 3OAMA 1VM8A 2W0VA 4LW3A 4NALA 4B4BA 3OH2A 4HO5A 3SXEA 4AYLA 4EE3A 5C38A 4NANA 1HM0A 4Y9XA 5EJZA 5C4FA 1H5SD 3SPTA 3I0KA 1XZ6A 2GGOA 4HO3A 4HO0A 5C36A 2ICXA 4B42A 1H7QA 2WE9A 2AGDA 2VS3A 3I0GA 1R80A 3U2XA 3EE5A 2C0NA 1ZCYA 5C3AA 2RIZA 5C4BA 4ZDQA 4FRPA 4Y64A 1JYKA 1LL3A 3OC9A 3V8YA 2BO8A 1VGUA 2PA4A 1G1LA 2VS5A 4EE5A 2YC3A 1GWWA 4EE4A 4M2BA 2WAWA 2O1FA 1INJA 1G0RA 3SXDA 3U2TA 1ZIZA 3V0NA 1R7YA 2Z86A 2FYAA 1O7OA 4L41C 3CKQA 1ZDGA 3RMVA 3DUVA 4C2SA 1FXJA 2FFVA 4CJCA 4EEAA 1VGWA 2APCA 3JUKA 5CQOA 1G95A 3T7MA 2GGQA 2Y6PA 2XMHA 2X5SA 4YS8A 3SX5A 1QG8A 3E26A 3POLA 1R7TA 2RIXA 1JVDA 3OH0A 2J0BA 1QGQA 5C8RA 3SXAA 4HOCA 1ZDFA 3ZLKA 4Y7UA 4MYBA 3GUEA 3I0IX 4FCUA 3OH1A 1ZJ1A 2ZU7A 5CQMX 4D48A 1R7XA 1H5SB 2WGZA 2X5ZA 1H5RB 2YQJA 3I0JA 4NAKA 4O6MA 5C3BA 1ZJ3A 2AM5A 4HG6A 1INIA 4KC1A 2QH5A 2PGVA 4CJBA 1EZIA 3USQA 2P72A 4HO9A 3ZGFA 2JCOA 2RJ6A 2V0LA 2V0JA 1KWSA 4FRHA 4M4KA 5FTVA 1JV3A 1H5SA 4FRDA 2XWLA 1MP5A 4Y63A 2Y4MA 2V0HA 1MC3A 1H7GA 2I7BA 4EEGA 1VGTA 3DJ4A 2ZU9A 3ZF8A 1VZXA 1HV9A 2QGIA 3U2WA 2XWMA 2Z87A 2YC5A 4B2XA 5HS2A 2MZBA 1R82A 3DK5A 4FRLA 1ZI1A 3SX3A 4KC4A 2W0WA 5C4EA 1ZI5A 1W57A 1WT1A 1I52A 3T7NA 4JISA 5FV9A 3R3IA 5CQNX 1G2VA 3OH4A 2OEFA 4DDZA 1FG5N 4O6NA 3TQDA 4IRQA 1YP2A 1WVCA 4D0ZA 4G3QA 5FYEA 2VK9A 1GA8A 1VGZA 4KRVA 3IOIA 4AAWA 2PX7A 1VH1A 3U2VA 3PNNA 1H4EA 4Y7GA 2O1GA 1NHEB 4B3UA 2UX8A 1LZ7A 2NXVA 2QKXA 4E1KA 4D11A 1FRWA 4HO8A 4Y7TA 4FRQA 3V8ZA 4M28A 1PZTA 1ZJOA 1YROB 4HO6A 1JYLA 4M2AA 5CQLX 1FO8A 3I0CA 4AC3A 1EYRA 2X65A 2RJ5A 1FOAA 1QGSA 1JV1A 3LW6A 1H7LA 1FZWA 3CU0A 1IINA 2I5EA 1WT0A 2VS4A 1GWVA 2YESA 1V84A 1VZTA 1ZCVA 5FTSA 1R7VA 2D7IA 1E5KA 1GQ9A 4R7PA 1G93A 3T7OA 4Y6NA 5C1HA 3SXBA 1ZI4A 3K8DA 5FU0A 3BCVA 3V0MA 1VZUA 2OI7A 2P6WA 2FYDB 3PKQA 2VSIA 4FROA 3OGZA 2WVKA 4G3SA 1YP4A 2VSHA 4HO2A 1V83A 2PGYA 2J0AA 1TVYA 5FU8A 4ECMA 1ON6A 4KT7A 4HCQA 3N9WA 4GBPA 4KC2A 4D11C 3ST8A 1H5TB 3OH3A 3RMWA 3V90A 2D0JA 3PKPA 1H7TA 1H4CA 2XMEA 1MP4A 3KIAA 1R7UA 5IDSA 4FCEA 1OMXA 5D92A 5L6VA 3V0OA 4CVHA 2XWNA 3F1YA 2YQCA 5DDVA 2OEGA 2Q4JA 5I1FA 1O0RA 1WSZA 5CMFX 2YCMA 1LL0A 5IDTA 5C1GA 1Z90A 4Y7FA 3I0EA 3D98A 1H5RA 1S4PA 1WT3A 4JD0A 3RSBA 1VH3A 1WT2A 1HM8A 5J49A 1W55A 4NAIA 2Y4JA 4FIYA 1NMMB 1FR9A 2RJ0A 5EJ1A 4DECA 2I5KA 3FWWA 4G3PA 3I0LA 1ZHJA 4Y62A 3ZGGA 1HJJA 4CJ8A 2V0KA 5IFYA 3CKNA 1OMZA 1TZFA 2Y4KA 4KNXA 1H7FA 3NGWA 1S4NA 5EIYA 2D7RA 3D5NA 2CU2A 3BRKX 2AE7A 3SX8A 1HM9A 1GQCA 4G87A 5C4DA 4KPZA 3F1CA 4Y7VA 1VICA 1IIMA 3IOHA 3QVBA 3E25A 2A8UA 4IRPA 3U0XA 1FO9A 2BO6A 5CMGX 2V0IA 2OI6A 1FGGA 1H5SC 4B5BA 2JCKA 4UEGA 2RITA 4XWIA 1V82A 5C47A 3HL3A 3V91A 4P02A 5CQPA 4AYJA 3I0DA 1QWJA 2JCJA 2OI5A 2RIYA 2X60A 1W77A 1GX4A
chains in the Genus database with same CATH topology
1SS9A 1ZJ2A 2YQHA 1G3LA 3SXCA 1LZJA 2AESA 1LZIA 4B4MA 2YQSA 5D91A 1ZCTA 3Q4SA 2RJ1A 2FYCB 5C4CA 1YP3A 4ARWA 1ZCUA 3JUJA 2BO7A 3V0PA 3Q80A 3OKRA 3CKVA 4KXOA 1LL2A 3I0HA 4HO4A 1TW1A 2WVMA 2RJ4A 4P00A 1XHBA 3FOQA 4EVWA 4J18A 1NQIB 2Y7AA 2WVLA 1LZ0A 5AJOA 5AJNA 2E8BA 4B2WA 4FQWA 3IOJA 5CMIA 1ON8A 4KNRA 2Y4LA 1HJLA 1K4VA 2VXMA 2VXLA 4FRMA 4KPXA 1H4DA 1H7HA 5CMHA 4ASJA 4LW6A 5DDTA 1NWGB 2AM4A 4FRAA 3SX7A 4EEMA 5BXCA 3TZTA 1NKHB 3R2WA 4BMAA 4ASYA 3CKOA 4BQHA 5FUHA 3D8VA 1VPAA 2RJ7A 1G97A 2AECA 1ZI3A 3ZLLA 1LVWA 3V0QA 2JCLA 3SXGA 2FYBA 3JTJA 5C3DA 3Q7UA 1H5TA 1NF5B 3I0FA 1G23A 1JVGA 1G8OA 1ZJ0A 5C49A 3K8EA 4KQLA 1PZYB 1S4OA 4FREA 3USRA 4DE7A 5CMJA 1ZJPA 3CKJA 2BO4A 2VFZA 4B4GA 1GX0A 2E3DA 3U0YA 5C1LA 2WEEA 1FXOA 5L6SA 1G9RA 5C48A 3O3PA 5JQQA 2FY7A 1FWYA 2ICYA 4MNDA 5AJPA 4FRBA 2DPWA 3V0LA 4K6RA 4FIXA 4D0TA 2FFUA 1FGXA 1MP3A 1FR8A 1TW5A 3U2UA 1H3MA 2RJ8A 2VD4A 4Y6UA 2AH9A 1H7EA 1O23B 2O1HA 2AM3A 2ZU8A 3CGXA 4Q7CA 4EEOA 1OQMB 4MIXA 2A8WA 2RJ9A 1R81A 1O7QA 2P73A 3OAMA 1VM8A 2W0VA 4LW3A 4NALA 4B4BA 3OH2A 4HO5A 3SXEA 4AYLA 4EE3A 5C38A 4NANA 1HM0A 4Y9XA 5EJZA 5C4FA 1H5SD 3SPTA 3I0KA 1XZ6A 2GGOA 4HO3A 4HO0A 5C36A 2ICXA 4B42A 1H7QA 2WE9A 2AGDA 2VS3A 3I0GA 1R80A 3U2XA 3EE5A 2C0NA 1ZCYA 5C3AA 2RIZA 5C4BA 4ZDQA 4FRPA 4Y64A 1JYKA 1LL3A 3OC9A 3V8YA 2BO8A 1VGUA 2PA4A 1G1LA 2VS5A 4EE5A 2YC3A 1GWWA 4EE4A 4M2BA 2WAWA 2O1FA 1INJA 1G0RA 3SXDA 3U2TA 1ZIZA 3V0NA 1R7YA 2Z86A 2FYAA 1O7OA 4L41C 3CKQA 1ZDGA 3RMVA 3DUVA 4C2SA 1FXJA 2FFVA 4CJCA 4EEAA 1VGWA 2APCA 3JUKA 5CQOA 1G95A 3T7MA 2GGQA 2Y6PA 2XMHA 2X5SA 4YS8A 3SX5A 1QG8A 3E26A 3POLA 1R7TA 2RIXA 1JVDA 3OH0A 2J0BA 1QGQA 5C8RA 3SXAA 4HOCA 1ZDFA 3ZLKA 4Y7UA 4MYBA 3GUEA 3I0IX 4FCUA 3OH1A 1ZJ1A 2ZU7A 5CQMX 4D48A 1R7XA 1H5SB 2WGZA 2X5ZA 1H5RB 2YQJA 3I0JA 4NAKA 4O6MA 5C3BA 1ZJ3A 2AM5A 4HG6A 1INIA 4KC1A 2QH5A 2PGVA 4CJBA 1EZIA 3USQA 2P72A 4HO9A 3ZGFA 2JCOA 2RJ6A 2V0LA 2V0JA 1KWSA 4FRHA 4M4KA 5FTVA 1JV3A 1H5SA 4FRDA 2XWLA 1MP5A 4Y63A 2Y4MA 2V0HA 1MC3A 1H7GA 2I7BA 4EEGA 1VGTA 3DJ4A 2ZU9A 3ZF8A 1VZXA 1HV9A 2QGIA 3U2WA 2XWMA 2Z87A 2YC5A 4B2XA 5HS2A 2MZBA 1R82A 3DK5A 4FRLA 1ZI1A 3SX3A 4KC4A 2W0WA 5C4EA 1ZI5A 1W57A 1WT1A 1I52A 3T7NA 4JISA 5FV9A 3R3IA 5CQNX 1G2VA 3OH4A 2OEFA 4DDZA 1FG5N 4O6NA 3TQDA 4IRQA 1YP2A 1WVCA 4D0ZA 4G3QA 5FYEA 2VK9A 1GA8A 1VGZA 4KRVA 3IOIA 4AAWA 2PX7A 1VH1A 3U2VA 3PNNA 1H4EA 4Y7GA 2O1GA 1NHEB 4B3UA 2UX8A 1LZ7A 2NXVA 2QKXA 4E1KA 4D11A 1FRWA 4HO8A 4Y7TA 4FRQA 3V8ZA 4M28A 1PZTA 1ZJOA 1YROB 4HO6A 1JYLA 4M2AA 5CQLX 1FO8A 3I0CA 4AC3A 1EYRA 2X65A 2RJ5A 1FOAA 1QGSA 1JV1A 3LW6A 1H7LA 1FZWA 3CU0A 1IINA 2I5EA 1WT0A 2VS4A 1GWVA 2YESA 1V84A 1VZTA 1ZCVA 5FTSA 1R7VA 2D7IA 1E5KA 1GQ9A 4R7PA 1G93A 3T7OA 4Y6NA 5C1HA 3SXBA 1ZI4A 3K8DA 5FU0A 3BCVA 3V0MA 1VZUA 2OI7A 2P6WA 2FYDB 3PKQA 2VSIA 4FROA 3OGZA 2WVKA 4G3SA 1YP4A 2VSHA 4HO2A 1V83A 2PGYA 2J0AA 1TVYA 5FU8A 4ECMA 1ON6A 4KT7A 4HCQA 3N9WA 4GBPA 4KC2A 4D11C 3ST8A 1H5TB 3OH3A 3RMWA 3V90A 2D0JA 3PKPA 1H7TA 1H4CA 2XMEA 1MP4A 3KIAA 1R7UA 5IDSA 4FCEA 1OMXA 5D92A 5L6VA 3V0OA 4CVHA 2XWNA 3F1YA 2YQCA 5DDVA 2OEGA 2Q4JA 5I1FA 1O0RA 1WSZA 5CMFX 2YCMA 1LL0A 5IDTA 5C1GA 1Z90A 4Y7FA 3I0EA 3D98A 1H5RA 1S4PA 1WT3A 4JD0A 3RSBA 1VH3A 1WT2A 1HM8A 5J49A 1W55A 4NAIA 2Y4JA 4FIYA 1NMMB 1FR9A 2RJ0A 5EJ1A 4DECA 2I5KA 3FWWA 4G3PA 3I0LA 1ZHJA 4Y62A 3ZGGA 1HJJA 4CJ8A 2V0KA 5IFYA 3CKNA 1OMZA 1TZFA 2Y4KA 4KNXA 1H7FA 3NGWA 1S4NA 5EIYA 2D7RA 3D5NA 2CU2A 3BRKX 2AE7A 3SX8A 1HM9A 1GQCA 4G87A 5C4DA 4KPZA 3F1CA 4Y7VA 1VICA 1IIMA 3IOHA 3QVBA 3E25A 2A8UA 4IRPA 3U0XA 1FO9A 2BO6A 5CMGX 2V0IA 2OI6A 1FGGA 1H5SC 4B5BA 2JCKA 4UEGA 2RITA 4XWIA 1V82A 5C47A 3HL3A 3V91A 4P02A 5CQPA 4AYJA 3I0DA 1QWJA 2JCJA 2OI5A 2RIYA 2X60A 1W77A 1GX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SS9 A;  1ZJ2 A;  2YQH A;  1G3L A;  3SXC A;  1LZJ A;  2AES A;  1LZI A;  4B4M A;  2YQS A;  1ZCT A;  3Q4S A;  2RJ1 A;  2FYC B;  5C4C A;  1YP3 A;  4ARW A;  1ZCU A;  3JUJ A;  2BO7 A;  3V0P A;  3Q80 A;  3OKR A;  3CKV A;  4KXO A;  1LL2 A;  3I0H A;  4HO4 A;  1TW1 A;  2WVM A;  2RJ4 A;  4P00 A;  1XHB A;  3FOQ A;  4EVW A;  4J18 A;  1NQI B;  2Y7A A;  2WVL A;  1LZ0 A;  5AJO A;  5AJN A;  2E8B A;  4B2W A;  4FQW A;  3IOJ A;  5CMI A;  1ON8 A;  4KNR A;  2Y4L A;  1HJL A;  1K4V A;  2VXM A;  2VXL A;  4FRM A;  4KPX A;  1H4D A;  1H7H A;  5CMH A;  4ASJ A;  4LW6 A;  5DDT A;  1NWG B;  2AM4 A;  4FRA A;  3SX7 A;  4EEM A;  5BXC A;  3TZT A;  1NKH B;  3R2W A;  4BMA A;  4ASY A;  3CKO A;  4BQH A;  5FUH A;  3D8V A;  1VPA A;  2RJ7 A;  1G97 A;  2AEC A;  1ZI3 A;  3ZLL A;  1LVW A;  3V0Q A;  2JCL A;  3SXG A;  2FYB A;  3JTJ A;  5C3D A;  3Q7U A;  1H5T A;  1NF5 B;  3I0F A;  1G23 A;  1JVG A;  1G8O A;  1ZJ0 A;  5C49 A;  3K8E A;  4KQL A;  1PZY B;  1S4O A;  4FRE A;  3USR A;  4DE7 A;  5CMJ A;  1ZJP A;  3CKJ A;  2BO4 A;  2VFZ A;  4B4G A;  1GX0 A;  2E3D A;  3U0Y A;  5C1L A;  2WEE A;  1FXO A;  5L6S A;  1G9R A;  5C48 A;  3O3P A;  5JQQ A;  2FY7 A;  1FWY A;  2ICY A;  4MND A;  5AJP A;  4FRB A;  2DPW A;  3V0L A;  4K6R A;  4D0T A;  2FFU A;  1FGX A;  1MP3 A;  1FR8 A;  1TW5 A;  3U2U A;  1H3M A;  2RJ8 A;  2VD4 A;  4Y6U A;  2AH9 A;  1H7E A;  1O23 B;  2O1H A;  2AM3 A;  2ZU8 A;  3CGX A;  4EEO A;  1OQM B;  2A8W A;  2RJ9 A;  1R81 A;  1O7Q A;  2P73 A;  3OAM A;  1VM8 A;  2W0V A;  4LW3 A;  4NAL A;  4B4B A;  3OH2 A;  4HO5 A;  3SXE A;  4AYL A;  4EE3 A;  5C38 A;  4NAN A;  1HM0 A;  4Y9X A;  5EJZ A;  5C4F A;  1H5S D;  3SPT A;  3I0K A;  1XZ6 A;  2GGO A;  4HO3 A;  4HO0 A;  5C36 A;  2ICX A;  4B42 A;  1H7Q A;  2WE9 A;  2AGD A;  2VS3 A;  3I0G A;  1R80 A;  3U2X A;  3EE5 A;  1ZCY A;  5C3A A;  2RIZ A;  5C4B A;  4ZDQ A;  4FRP A;  4Y64 A;  1JYK A;  1LL3 A;  3OC9 A;  3V8Y A;  2BO8 A;  1VGU A;  2PA4 A;  1G1L A;  2VS5 A;  4EE5 A;  2YC3 A;  1GWW A;  4EE4 A;  4M2B A;  2WAW A;  2O1F A;  1INJ A;  1G0R A;  3SXD A;  3U2T A;  1ZIZ A;  3V0N A;  1R7Y A;  2Z86 A;  2FYA A;  1O7O A;  4L41 C;  3CKQ A;  1ZDG A;  3RMV A;  3DUV A;  4C2S A;  1FXJ A;  2FFV A;  4CJC A;  4EEA A;  1VGW A;  2APC A;  3JUK A;  5CQO A;  1G95 A;  3T7M A;  2GGQ A;  2Y6P A;  2XMH A;  2X5S A;  4YS8 A;  3SX5 A;  1QG8 A;  3E26 A;  3POL A;  1R7T A;  2RIX A;  1JVD A;  3OH0 A;  1QGQ A;  5C8R A;  3SXA A;  4HOC A;  1ZDF A;  3ZLK A;  4Y7U A;  4MYB A;  3GUE A;  3I0I X;  4FCU A;  3OH1 A;  1ZJ1 A;  2ZU7 A;  5CQM X;  4D48 A;  1R7X A;  1H5S B;  2WGZ A;  2X5Z A;  1H5R B;  2YQJ A;  3I0J A;  4NAK A;  5C3B A;  1ZJ3 A;  2AM5 A;  4HG6 A;  1INI A;  4KC1 A;  2QH5 A;  2PGV A;  4CJB A;  1EZI A;  3USQ A;  2P72 A;  4HO9 A;  3ZGF A;  2JCO A;  2RJ6 A;  2V0L A;  2V0J A;  1KWS A;  4FRH A;  4M4K A;  5FTV A;  1JV3 A;  1H5S A;  4FRD A;  2XWL A;  1MP5 A;  4Y63 A;  2Y4M A;  2V0H A;  1MC3 A;  1H7G A;  2I7B A;  4EEG A;  1VGT A;  3DJ4 A;  2ZU9 A;  3ZF8 A;  1VZX A;  1HV9 A;  2QGI A;  3U2W A;  2XWM A;  2Z87 A;  2YC5 A;  4B2X A;  5HS2 A;  2MZB A;  1R82 A;  3DK5 A;  4FRL A;  1ZI1 A;  3SX3 A;  4KC4 A;  2W0W A;  5C4E A;  1ZI5 A;  1W57 A;  1WT1 A;  1I52 A;  3T7N A;  4JIS A;  5FV9 A;  3R3I A;  5CQN X;  1G2V A;  3OH4 A;  2OEF A;  4DDZ A;  1FG5 N;  3TQD A;  4IRQ A;  1YP2 A;  1WVC A;  4D0Z A;  4G3Q A;  5FYE A;  1GA8 A;  1VGZ A;  4KRV A;  3IOI A;  4AAW A;  2PX7 A;  1VH1 A;  3U2V A;  3PNN A;  1H4E A;  4Y7G A;  2O1G A;  1NHE B;  4B3U A;  2UX8 A;  1LZ7 A;  2NXV A;  2QKX A;  4E1K A;  4D11 A;  1FRW A;  4HO8 A;  4Y7T A;  4FRQ A;  3V8Z A;  4M28 A;  1PZT A;  1ZJO A;  1YRO B;  4HO6 A;  1JYL A;  4M2A A;  5CQL X;  1FO8 A;  3I0C A;  4AC3 A;  1EYR A;  2X65 A;  2RJ5 A;  1FOA A;  1QGS A;  1JV1 A;  3LW6 A;  1H7L A;  1FZW A;  3CU0 A;  1IIN A;  2I5E A;  1WT0 A;  2VS4 A;  1GWV A;  2YES A;  1V84 A;  1VZT A;  1ZCV A;  5FTS A;  1R7V A;  2D7I A;  1E5K A;  1GQ9 A;  4R7P A;  1G93 A;  3T7O A;  4Y6N A;  5C1H A;  3SXB A;  1ZI4 A;  3K8D A;  5FU0 A;  3BCV A;  3V0M A;  1VZU A;  2OI7 A;  2P6W A;  2FYD B;  3PKQ A;  2VSI A;  4FRO A;  3OGZ A;  2WVK A;  4G3S A;  1YP4 A;  2VSH A;  4HO2 A;  1V83 A;  2PGY A;  5FU8 A;  1TVY A;  4ECM A;  1ON6 A;  4KT7 A;  4HCQ A;  3N9W A;  4GBP A;  4KC2 A;  4D11 C;  3ST8 A;  1H5T B;  3OH3 A;  3RMW A;  3V90 A;  2D0J A;  3PKP A;  1H7T A;  1H4C A;  2XME A;  1MP4 A;  3KIA A;  1R7U A;  5IDS A;  4FCE A;  1OMX A;  5L6V A;  3V0O A;  4CVH A;  2XWN A;  3F1Y A;  2YQC A;  5DDV A;  2OEG A;  2Q4J A;  5I1F A;  1O0R A;  1WSZ A;  5CMF X;  2YCM A;  1LL0 A;  5IDT A;  5C1G A;  1Z90 A;  4Y7F A;  3I0E A;  3D98 A;  1H5R A;  1S4P A;  1WT3 A;  4JD0 A;  3RSB A;  1VH3 A;  1WT2 A;  1HM8 A;  5J49 A;  1W55 A;  4NAI A;  2Y4J A;  1NMM B;  1FR9 A;  2RJ0 A;  5EJ1 A;  4DEC A;  2I5K A;  3FWW A;  4G3P A;  3I0L A;  1ZHJ A;  4Y62 A;  3ZGG A;  1HJJ A;  4CJ8 A;  2V0K A;  5IFY A;  3CKN A;  1OMZ A;  1TZF A;  2Y4K A;  4KNX A;  1H7F A;  3NGW A;  1S4N A;  5EIY A;  2D7R A;  3D5N A;  2CU2 A;  3BRK X;  2AE7 A;  3SX8 A;  1HM9 A;  1GQC A;  4G87 A;  5C4D A;  4KPZ A;  3F1C A;  4Y7V A;  1VIC A;  1IIM A;  3IOH A;  3QVB A;  3E25 A;  2A8U A;  4IRP A;  3U0X A;  1FO9 A;  2BO6 A;  5CMG X;  2V0I A;  2OI6 A;  1FGG A;  1H5S C;  4B5B A;  2JCK A;  4UEG A;  2RIT A;  4XWI A;  1V82 A;  5C47 A;  3HL3 A;  3V91 A;  4P02 A;  5CQP A;  4AYJ A;  3I0D A;  1QWJ A;  2JCJ A;  2OI5 A;  2RIY A;  2X60 A;  1W77 A;  1GX4 A; 
#chains in the Genus database with same CATH topology
 1SS9 A;  1ZJ2 A;  2YQH A;  1G3L A;  3SXC A;  1LZJ A;  2AES A;  1LZI A;  4B4M A;  2YQS A;  5D91 A;  1ZCT A;  3Q4S A;  2RJ1 A;  2FYC B;  5C4C A;  1YP3 A;  4ARW A;  1ZCU A;  3JUJ A;  2BO7 A;  3V0P A;  3Q80 A;  3OKR A;  3CKV A;  4KXO A;  1LL2 A;  3I0H A;  4HO4 A;  1TW1 A;  2WVM A;  2RJ4 A;  4P00 A;  1XHB A;  3FOQ A;  4EVW A;  4J18 A;  1NQI B;  2Y7A A;  2WVL A;  1LZ0 A;  5AJO A;  5AJN A;  2E8B A;  4B2W A;  4FQW A;  3IOJ A;  5CMI A;  1ON8 A;  4KNR A;  2Y4L A;  1HJL A;  1K4V A;  2VXM A;  2VXL A;  4FRM A;  4KPX A;  1H4D A;  1H7H A;  5CMH A;  4ASJ A;  4LW6 A;  5DDT A;  1NWG B;  2AM4 A;  4FRA A;  3SX7 A;  4EEM A;  5BXC A;  3TZT A;  1NKH B;  3R2W A;  4BMA A;  4ASY A;  3CKO A;  4BQH A;  5FUH A;  3D8V A;  1VPA A;  2RJ7 A;  1G97 A;  2AEC A;  1ZI3 A;  3ZLL A;  1LVW A;  3V0Q A;  2JCL A;  3SXG A;  2FYB A;  3JTJ A;  5C3D A;  3Q7U A;  1H5T A;  1NF5 B;  3I0F A;  1G23 A;  1JVG A;  1G8O A;  1ZJ0 A;  5C49 A;  3K8E A;  4KQL A;  1PZY B;  1S4O A;  4FRE A;  3USR A;  4DE7 A;  5CMJ A;  1ZJP A;  3CKJ A;  2BO4 A;  2VFZ A;  4B4G A;  1GX0 A;  2E3D A;  3U0Y A;  5C1L A;  2WEE A;  1FXO A;  5L6S A;  1G9R A;  5C48 A;  3O3P A;  5JQQ A;  2FY7 A;  1FWY A;  2ICY A;  4MND A;  5AJP A;  4FRB A;  2DPW A;  3V0L A;  4K6R A;  4FIX A;  4D0T A;  2FFU A;  1FGX A;  1MP3 A;  1FR8 A;  1TW5 A;  3U2U A;  1H3M A;  2RJ8 A;  2VD4 A;  4Y6U A;  2AH9 A;  1H7E A;  1O23 B;  2O1H A;  2AM3 A;  2ZU8 A;  3CGX A;  4Q7C A;  4EEO A;  1OQM B;  4MIX A;  2A8W A;  2RJ9 A;  1R81 A;  1O7Q A;  2P73 A;  3OAM A;  1VM8 A;  2W0V A;  4LW3 A;  4NAL A;  4B4B A;  3OH2 A;  4HO5 A;  3SXE A;  4AYL A;  4EE3 A;  5C38 A;  4NAN A;  1HM0 A;  4Y9X A;  5EJZ A;  5C4F A;  1H5S D;  3SPT A;  3I0K A;  1XZ6 A;  2GGO A;  4HO3 A;  4HO0 A;  5C36 A;  2ICX A;  4B42 A;  1H7Q A;  2WE9 A;  2AGD A;  2VS3 A;  3I0G A;  1R80 A;  3U2X A;  3EE5 A;  2C0N A;  1ZCY A;  5C3A A;  2RIZ A;  5C4B A;  4ZDQ A;  4FRP A;  4Y64 A;  1JYK A;  1LL3 A;  3OC9 A;  3V8Y A;  2BO8 A;  1VGU A;  2PA4 A;  1G1L A;  2VS5 A;  4EE5 A;  2YC3 A;  1GWW A;  4EE4 A;  4M2B A;  2WAW A;  2O1F A;  1INJ A;  1G0R A;  3SXD A;  3U2T A;  1ZIZ A;  3V0N A;  1R7Y A;  2Z86 A;  2FYA A;  1O7O A;  4L41 C;  3CKQ A;  1ZDG A;  3RMV A;  3DUV A;  4C2S A;  1FXJ A;  2FFV A;  4CJC A;  4EEA A;  1VGW A;  2APC A;  3JUK A;  5CQO A;  1G95 A;  3T7M A;  2GGQ A;  2Y6P A;  2XMH A;  2X5S A;  4YS8 A;  3SX5 A;  1QG8 A;  3E26 A;  3POL A;  1R7T A;  2RIX A;  1JVD A;  3OH0 A;  2J0B A;  1QGQ A;  5C8R A;  3SXA A;  4HOC A;  1ZDF A;  3ZLK A;  4Y7U A;  4MYB A;  3GUE A;  3I0I X;  4FCU A;  3OH1 A;  1ZJ1 A;  2ZU7 A;  5CQM X;  4D48 A;  1R7X A;  1H5S B;  2WGZ A;  2X5Z A;  1H5R B;  2YQJ A;  3I0J A;  4NAK A;  4O6M A;  5C3B A;  1ZJ3 A;  2AM5 A;  4HG6 A;  1INI A;  4KC1 A;  2QH5 A;  2PGV A;  4CJB A;  1EZI A;  3USQ A;  2P72 A;  4HO9 A;  3ZGF A;  2JCO A;  2RJ6 A;  2V0L A;  2V0J A;  1KWS A;  4FRH A;  4M4K A;  5FTV A;  1JV3 A;  1H5S A;  4FRD A;  2XWL A;  1MP5 A;  4Y63 A;  2Y4M A;  2V0H A;  1MC3 A;  1H7G A;  2I7B A;  4EEG A;  1VGT A;  3DJ4 A;  2ZU9 A;  3ZF8 A;  1VZX A;  1HV9 A;  2QGI A;  3U2W A;  2XWM A;  2Z87 A;  2YC5 A;  4B2X A;  5HS2 A;  2MZB A;  1R82 A;  3DK5 A;  4FRL A;  1ZI1 A;  3SX3 A;  4KC4 A;  2W0W A;  5C4E A;  1ZI5 A;  1W57 A;  1WT1 A;  1I52 A;  3T7N A;  4JIS A;  5FV9 A;  3R3I A;  5CQN X;  1G2V A;  3OH4 A;  2OEF A;  4DDZ A;  1FG5 N;  4O6N A;  3TQD A;  4IRQ A;  1YP2 A;  1WVC A;  4D0Z A;  4G3Q A;  5FYE A;  2VK9 A;  1GA8 A;  1VGZ A;  4KRV A;  3IOI A;  4AAW A;  2PX7 A;  1VH1 A;  3U2V A;  3PNN A;  1H4E A;  4Y7G A;  2O1G A;  1NHE B;  4B3U A;  2UX8 A;  1LZ7 A;  2NXV A;  2QKX A;  4E1K A;  4D11 A;  1FRW A;  4HO8 A;  4Y7T A;  4FRQ A;  3V8Z A;  4M28 A;  1PZT A;  1ZJO A;  1YRO B;  4HO6 A;  1JYL A;  4M2A A;  5CQL X;  1FO8 A;  3I0C A;  4AC3 A;  1EYR A;  2X65 A;  2RJ5 A;  1FOA A;  1QGS A;  1JV1 A;  3LW6 A;  1H7L A;  1FZW A;  3CU0 A;  1IIN A;  2I5E A;  1WT0 A;  2VS4 A;  1GWV A;  2YES A;  1V84 A;  1VZT A;  1ZCV A;  5FTS A;  1R7V A;  2D7I A;  1E5K A;  1GQ9 A;  4R7P A;  1G93 A;  3T7O A;  4Y6N A;  5C1H A;  3SXB A;  1ZI4 A;  3K8D A;  5FU0 A;  3BCV A;  3V0M A;  1VZU A;  2OI7 A;  2P6W A;  2FYD B;  3PKQ A;  2VSI A;  4FRO A;  3OGZ A;  2WVK A;  4G3S A;  1YP4 A;  2VSH A;  4HO2 A;  1V83 A;  2PGY A;  2J0A A;  1TVY A;  5FU8 A;  4ECM A;  1ON6 A;  4KT7 A;  4HCQ A;  3N9W A;  4GBP A;  4KC2 A;  4D11 C;  3ST8 A;  1H5T B;  3OH3 A;  3RMW A;  3V90 A;  2D0J A;  3PKP A;  1H7T A;  1H4C A;  2XME A;  1MP4 A;  3KIA A;  1R7U A;  5IDS A;  4FCE A;  1OMX A;  5D92 A;  5L6V A;  3V0O A;  4CVH A;  2XWN A;  3F1Y A;  2YQC A;  5DDV A;  2OEG A;  2Q4J A;  5I1F A;  1O0R A;  1WSZ A;  5CMF X;  2YCM A;  1LL0 A;  5IDT A;  5C1G A;  1Z90 A;  4Y7F A;  3I0E A;  3D98 A;  1H5R A;  1S4P A;  1WT3 A;  4JD0 A;  3RSB A;  1VH3 A;  1WT2 A;  1HM8 A;  5J49 A;  1W55 A;  4NAI A;  2Y4J A;  4FIY A;  1NMM B;  1FR9 A;  2RJ0 A;  5EJ1 A;  4DEC A;  2I5K A;  3FWW A;  4G3P A;  3I0L A;  1ZHJ A;  4Y62 A;  3ZGG A;  1HJJ A;  4CJ8 A;  2V0K A;  5IFY A;  3CKN A;  1OMZ A;  1TZF A;  2Y4K A;  4KNX A;  1H7F A;  3NGW A;  1S4N A;  5EIY A;  2D7R A;  3D5N A;  2CU2 A;  3BRK X;  2AE7 A;  3SX8 A;  1HM9 A;  1GQC A;  4G87 A;  5C4D A;  4KPZ A;  3F1C A;  4Y7V A;  1VIC A;  1IIM A;  3IOH A;  3QVB A;  3E25 A;  2A8U A;  4IRP A;  3U0X A;  1FO9 A;  2BO6 A;  5CMG X;  2V0I A;  2OI6 A;  1FGG A;  1H5S C;  4B5B A;  2JCK A;  4UEG A;  2RIT A;  4XWI A;  1V82 A;  5C47 A;  3HL3 A;  3V91 A;  4P02 A;  5CQP A;  4AYJ A;  3I0D A;  1QWJ A;  2JCJ A;  2OI5 A;  2RIY A;  2X60 A;  1W77 A;  1GX4 A; 
#chains in the Genus database with same CATH homology
 1SS9 A;  1ZJ2 A;  2YQH A;  1G3L A;  3SXC A;  1LZJ A;  2AES A;  1LZI A;  4B4M A;  2YQS A;  5D91 A;  1ZCT A;  3Q4S A;  2RJ1 A;  2FYC B;  5C4C A;  1YP3 A;  4ARW A;  1ZCU A;  3JUJ A;  2BO7 A;  3V0P A;  3Q80 A;  3OKR A;  3CKV A;  4KXO A;  1LL2 A;  3I0H A;  4HO4 A;  1TW1 A;  2WVM A;  2RJ4 A;  4P00 A;  1XHB A;  3FOQ A;  4EVW A;  4J18 A;  1NQI B;  2Y7A A;  2WVL A;  1LZ0 A;  5AJO A;  5AJN A;  2E8B A;  4B2W A;  4FQW A;  3IOJ A;  5CMI A;  1ON8 A;  4KNR A;  2Y4L A;  1HJL A;  1K4V A;  2VXM A;  2VXL A;  4FRM A;  4KPX A;  1H4D A;  1H7H A;  5CMH A;  4ASJ A;  4LW6 A;  5DDT A;  1NWG B;  2AM4 A;  4FRA A;  3SX7 A;  4EEM A;  5BXC A;  3TZT A;  1NKH B;  3R2W A;  4BMA A;  4ASY A;  3CKO A;  4BQH A;  5FUH A;  3D8V A;  1VPA A;  2RJ7 A;  1G97 A;  2AEC A;  1ZI3 A;  3ZLL A;  1LVW A;  3V0Q A;  2JCL A;  3SXG A;  2FYB A;  3JTJ A;  5C3D A;  3Q7U A;  1H5T A;  1NF5 B;  3I0F A;  1G23 A;  1JVG A;  1G8O A;  1ZJ0 A;  5C49 A;  3K8E A;  4KQL A;  1PZY B;  1S4O A;  4FRE A;  3USR A;  4DE7 A;  5CMJ A;  1ZJP A;  3CKJ A;  2BO4 A;  2VFZ A;  4B4G A;  1GX0 A;  2E3D A;  3U0Y A;  5C1L A;  2WEE A;  1FXO A;  5L6S A;  1G9R A;  5C48 A;  3O3P A;  5JQQ A;  2FY7 A;  1FWY A;  2ICY A;  4MND A;  5AJP A;  4FRB A;  2DPW A;  3V0L A;  4K6R A;  4FIX A;  4D0T A;  2FFU A;  1FGX A;  1MP3 A;  1FR8 A;  1TW5 A;  3U2U A;  1H3M A;  2RJ8 A;  2VD4 A;  4Y6U A;  2AH9 A;  1H7E A;  1O23 B;  2O1H A;  2AM3 A;  2ZU8 A;  3CGX A;  4Q7C A;  4EEO A;  1OQM B;  4MIX A;  2A8W A;  2RJ9 A;  1R81 A;  1O7Q A;  2P73 A;  3OAM A;  1VM8 A;  2W0V A;  4LW3 A;  4NAL A;  4B4B A;  3OH2 A;  4HO5 A;  3SXE A;  4AYL A;  4EE3 A;  5C38 A;  4NAN A;  1HM0 A;  4Y9X A;  5EJZ A;  5C4F A;  1H5S D;  3SPT A;  3I0K A;  1XZ6 A;  2GGO A;  4HO3 A;  4HO0 A;  5C36 A;  2ICX A;  4B42 A;  1H7Q A;  2WE9 A;  2AGD A;  2VS3 A;  3I0G A;  1R80 A;  3U2X A;  3EE5 A;  2C0N A;  1ZCY A;  5C3A A;  2RIZ A;  5C4B A;  4ZDQ A;  4FRP A;  4Y64 A;  1JYK A;  1LL3 A;  3OC9 A;  3V8Y A;  2BO8 A;  1VGU A;  2PA4 A;  1G1L A;  2VS5 A;  4EE5 A;  2YC3 A;  1GWW A;  4EE4 A;  4M2B A;  2WAW A;  2O1F A;  1INJ A;  1G0R A;  3SXD A;  3U2T A;  1ZIZ A;  3V0N A;  1R7Y A;  2Z86 A;  2FYA A;  1O7O A;  4L41 C;  3CKQ A;  1ZDG A;  3RMV A;  3DUV A;  4C2S A;  1FXJ A;  2FFV A;  4CJC A;  4EEA A;  1VGW A;  2APC A;  3JUK A;  5CQO A;  1G95 A;  3T7M A;  2GGQ A;  2Y6P A;  2XMH A;  2X5S A;  4YS8 A;  3SX5 A;  1QG8 A;  3E26 A;  3POL A;  1R7T A;  2RIX A;  1JVD A;  3OH0 A;  2J0B A;  1QGQ A;  5C8R A;  3SXA A;  4HOC A;  1ZDF A;  3ZLK A;  4Y7U A;  4MYB A;  3GUE A;  3I0I X;  4FCU A;  3OH1 A;  1ZJ1 A;  2ZU7 A;  5CQM X;  4D48 A;  1R7X A;  1H5S B;  2WGZ A;  2X5Z A;  1H5R B;  2YQJ A;  3I0J A;  4NAK A;  4O6M A;  5C3B A;  1ZJ3 A;  2AM5 A;  4HG6 A;  1INI A;  4KC1 A;  2QH5 A;  2PGV A;  4CJB A;  1EZI A;  3USQ A;  2P72 A;  4HO9 A;  3ZGF A;  2JCO A;  2RJ6 A;  2V0L A;  2V0J A;  1KWS A;  4FRH A;  4M4K A;  5FTV A;  1JV3 A;  1H5S A;  4FRD A;  2XWL A;  1MP5 A;  4Y63 A;  2Y4M A;  2V0H A;  1MC3 A;  1H7G A;  2I7B A;  4EEG A;  1VGT A;  3DJ4 A;  2ZU9 A;  3ZF8 A;  1VZX A;  1HV9 A;  2QGI A;  3U2W A;  2XWM A;  2Z87 A;  2YC5 A;  4B2X A;  5HS2 A;  2MZB A;  1R82 A;  3DK5 A;  4FRL A;  1ZI1 A;  3SX3 A;  4KC4 A;  2W0W A;  5C4E A;  1ZI5 A;  1W57 A;  1WT1 A;  1I52 A;  3T7N A;  4JIS A;  5FV9 A;  3R3I A;  5CQN X;  1G2V A;  3OH4 A;  2OEF A;  4DDZ A;  1FG5 N;  4O6N A;  3TQD A;  4IRQ A;  1YP2 A;  1WVC A;  4D0Z A;  4G3Q A;  5FYE A;  2VK9 A;  1GA8 A;  1VGZ A;  4KRV A;  3IOI A;  4AAW A;  2PX7 A;  1VH1 A;  3U2V A;  3PNN A;  1H4E A;  4Y7G A;  2O1G A;  1NHE B;  4B3U A;  2UX8 A;  1LZ7 A;  2NXV A;  2QKX A;  4E1K A;  4D11 A;  1FRW A;  4HO8 A;  4Y7T A;  4FRQ A;  3V8Z A;  4M28 A;  1PZT A;  1ZJO A;  1YRO B;  4HO6 A;  1JYL A;  4M2A A;  5CQL X;  1FO8 A;  3I0C A;  4AC3 A;  1EYR A;  2X65 A;  2RJ5 A;  1FOA A;  1QGS A;  1JV1 A;  3LW6 A;  1H7L A;  1FZW A;  3CU0 A;  1IIN A;  2I5E A;  1WT0 A;  2VS4 A;  1GWV A;  2YES A;  1V84 A;  1VZT A;  1ZCV A;  5FTS A;  1R7V A;  2D7I A;  1E5K A;  1GQ9 A;  4R7P A;  1G93 A;  3T7O A;  4Y6N A;  5C1H A;  3SXB A;  1ZI4 A;  3K8D A;  5FU0 A;  3BCV A;  3V0M A;  1VZU A;  2OI7 A;  2P6W A;  2FYD B;  3PKQ A;  2VSI A;  4FRO A;  3OGZ A;  2WVK A;  4G3S A;  1YP4 A;  2VSH A;  4HO2 A;  1V83 A;  2PGY A;  2J0A A;  1TVY A;  5FU8 A;  4ECM A;  1ON6 A;  4KT7 A;  4HCQ A;  3N9W A;  4GBP A;  4KC2 A;  4D11 C;  3ST8 A;  1H5T B;  3OH3 A;  3RMW A;  3V90 A;  2D0J A;  3PKP A;  1H7T A;  1H4C A;  2XME A;  1MP4 A;  3KIA A;  1R7U A;  5IDS A;  4FCE A;  1OMX A;  5D92 A;  5L6V A;  3V0O A;  4CVH A;  2XWN A;  3F1Y A;  2YQC A;  5DDV A;  2OEG A;  2Q4J A;  5I1F A;  1O0R A;  1WSZ A;  5CMF X;  2YCM A;  1LL0 A;  5IDT A;  5C1G A;  1Z90 A;  4Y7F A;  3I0E A;  3D98 A;  1H5R A;  1S4P A;  1WT3 A;  4JD0 A;  3RSB A;  1VH3 A;  1WT2 A;  1HM8 A;  5J49 A;  1W55 A;  4NAI A;  2Y4J A;  4FIY A;  1NMM B;  1FR9 A;  2RJ0 A;  5EJ1 A;  4DEC A;  2I5K A;  3FWW A;  4G3P A;  3I0L A;  1ZHJ A;  4Y62 A;  3ZGG A;  1HJJ A;  4CJ8 A;  2V0K A;  5IFY A;  3CKN A;  1OMZ A;  1TZF A;  2Y4K A;  4KNX A;  1H7F A;  3NGW A;  1S4N A;  5EIY A;  2D7R A;  3D5N A;  2CU2 A;  3BRK X;  2AE7 A;  3SX8 A;  1HM9 A;  1GQC A;  4G87 A;  5C4D A;  4KPZ A;  3F1C A;  4Y7V A;  1VIC A;  1IIM A;  3IOH A;  3QVB A;  3E25 A;  2A8U A;  4IRP A;  3U0X A;  1FO9 A;  2BO6 A;  5CMG X;  2V0I A;  2OI6 A;  1FGG A;  1H5S C;  4B5B A;  2JCK A;  4UEG A;  2RIT A;  4XWI A;  1V82 A;  5C47 A;  3HL3 A;  3V91 A;  4P02 A;  5CQP A;  4AYJ A;  3I0D A;  1QWJ A;  2JCJ A;  2OI5 A;  2RIY A;  2X60 A;  1W77 A;  1GX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...