4B4WA

Crystal structure of acinetobacter baumannii n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) complexed with nadp cofactor and an inhibitor
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
282
structure length
282
Chain Sequence
MALVLDGRALAKQIEENLLVRVEALKAKTGRTPILATILVGDDGASATYVRMKGNACRRVGMDSLKIELPQETTTEQLLAEIEKLNANPDVHGILLQHPVPAQIDERACFDAISLAKDVDGVTCLGFGRMAMGEAAYGSATPAGIMTILKENNIEIAGKHAVVVGRSAILGKPMAMMLLQANATVTICHSRTQNLPELVKQADIIVGAVGKAELIQKDWIKQGAVVVDAGFHPRDGGGVGDIQLQGIEEIASAYTPVPGGVGPMTITTLIRQTVEAAEKALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Acinetobacter Baumannii Fold Ligand Complexes; Potent Inhibitors of Folate Metabolism and a Re-Evaluation of the Ly374571 Structure.
pubmed doi rcsb
source organism Acinetobacter baumannii atcc 19606
molecule tags Oxidoreductase
molecule keywords BIFUNCTIONAL PROTEIN FOLD
total genus 105
structure length 282
sequence length 282
chains with identical sequence B
ec nomenclature ec 1.5.1.5: Methylenetetrahydrofolate dehydrogenase (NADP(+)).
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
A PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b4wA01
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 4b4wA02
2J5KA 3A9WA 1SC6A 4GX0A 5A05A 5G4LA 3KEOA 4AJHA 1QRRA 3UUWA 5CDYA 2QZZA 1ORRA 3WFIA 2O50A 2OXIA 2BMAA 5EL0A 1YBAA 1SOVA 4MVJD 4FCCA 1HDZA 1P0CA 1Y9AA 4EDFA 2YW9A 3FPLA 1ENZA 2UAGA 3K2BA 6LDHA 1U2GA 3CZMA 3WSVA 1OMOA 3BMCB 4FPXA 3X2EA 3L9WA 4BNTA 4IM7A 2EXXA 3FCOA 3O26A 4NIMA 1A4IA 5T6BA 2W2KB 3DO5A 1T1SA 3ANMA 2HQ1A 2YQ5A 3PGXA 2FHSA 1FK8A 4EJ6A 1RYDA 4NI5A 3D4NA 2P5UA 3F46A 3RVDA 1UDAA 1UP7A 5EPOA 5G4KB 3TZHA 4CL3A 4BIIA 3DBRA 2Y1DA 5A5EA 4R16A 4NNJA 5JAIA 3P2OA 3JD3A 3Q11A 1BTOA 2Q3EA 1JVSA 1E3IA 3E9MA 1KOLA 3LC7O 3AWDA 4CLOA 4M49A 3EVNA 4RF5A 3VZSA 4CM8B 4GSKA 3PJDA 3UGKA 3BMNA 5C5IA 2B4QA 2UDPA 4Q3EA 4UUMA 3HUDA 2AEMA 1FF9A 4IJKA 3I9MA 2JD2A 4L0QA 4JN6B 3C7AA 2RHRA 1ZK0A 3H6KA 3GC6A 2IDZA 3HFGA 4QFDA 2O3JA 3K6JA 1MG5A 3C7CB 1ZEMA 5L3ZA 1XA0A 2GPTA 2YJZA 1Q0LA 5DOZA 4FB5A 3PHHA 3PJGA 1X14A 2NADA 3G17A 4L8VA 2QQ5A 2FPIA 4L4SA 1ID1A 4R3NA 3ZU5A 3QQPA 1LU9A 4CMIB 2I9PA 3VVBA 2G76A 3U4CA 3ON5A 3RUCA 3NYWA 4W7HA 1P1FA 3WGYA 2J3HA 3FBGA 1H6BA 1V8BA 3QVTA 2YV2A 1H9BA 3WQQA 4UVHA 5BSGA 3RC7A 3RUIA 3W8EA 4MP8A 2PKQP 3FRJA 2GSDA 2WJPA 1KVRA 3OFSA 3PTZA 3LSYA 2NU8A 2H9IA 4II3A 1DRWA 3AUTA 3OA2A 3G0OA 4BNVA 4TROA 1DB3A 2GGSA 4WLUA 3GMSA 4URFA 1QYXA 2PTGA 4OOEA 4NK4A 2W8ZA 1BRMA 1UXIA 4D44A 5DDIP 4DBZA 1TEHA 4ALNA 3FWZA 4FBGA 1P1RA 4DC1A 4QUKA 3T7CA 4GBJA 4QTZA 4ZQHA 2NTNA 3RAJA 3KYCA 3SVTA 1KERA 3VPFA 4IDBA 3H9JA 4OXNA 5JAZA 2QRKA 4TWRA 5AQ1A 4KZPA 2DT5A 1P44A 4QO8A 4HKTA 3JQ8A 1P3DA 3OA0A 4DGSA 4MIOA 1HTBA 2PLAA 1JTVA 2PWZA 1ZK3A 1OAAA 4MIEA 5A06A 5CEJA 4Z3KA 3I23A 5I9MA 1F8FA 1LJ8A 3GFGA 3PXXA 1LDEA 1Z73A 5TSDA 1GU7A 1H2HA 5G0VA 4IXWA 3PI7A 2X23A 2GDZA 3ZU4A 1HDCA 2BRUA 2HSDA 2YHIB 4BV9A 4CM9A 1LEHA 3NDJA 3VKUA 1UAYA 1LSOA 4RVHA 4BMSA 3PZBA 3RJ9A 3ANNA 1QORA 4UVEA 3FN4A 1TT5A 4EGFA 4S3MA 5IFLA 1K2WA 1QYWA 1IE3A 2AQ8A 5DBFA 3ZV4A 2X22A 1N9GA 4ALLA 3DAPA 1H94A 4I08A 1NHGA 4FGSA 2RH8A 1HL3A 4GL4A 2A92A 3Q3CA 4INAA 4YQZA 1BXGA 3DBLA 3HQ4O 4OM8A 4XIJA 1LI4A 3NGXA 4UUNA 5C37A 5F5LA 3QWFA 3CUKA 3KOUA 3D4OA 4IDAA 1PJ3A 3TZQA 2FY8A 1RKXA 2G5CA 1YH3A 1HT0A 3VTFA 3RC2A 2PA3A 1LDYA 5L7TA 2GERA 4D46A 4U6QA 1LDNA 2J5RA 1DJNA 3NT5A 5C7LO 1OBFO 4JBHA 3WYEA 2A9FA 3KYDB 3GNQA 3KXDA 3TZCA 1SNYA 4RGBA 1YL5A 2OORA 2VWPA 4Z6KA 4MVJM 3OJOA 1W4ZA 4O1MA 4NR0A 1Q1NA 3KSUA 3WYCA 4AG3A 4CM4A 2HMWA 1Z82A 2VN8A 1P45A 3BHJA 3L4BA 3IUPA 1RJWA 1PQUA 4CV0A 5B1YA 4XGKA 4JBIA 2X0IA 3RASA 3VPSA 3ICPA 5T64A 3H2ZA 1D1SA 1A9ZA 1AUPA 3KYBA 5KJ1A 1BWSA 3O38A 1P31A 1HDYA 3U9LA 1LQUA 5L4SA 3U4HA 4CJXA 1OC2A 1SPXA 1PGNA 3JYQA 1NVTA 2VYVA 3FSRA 2VQ3A 3OQ1A 2JHGA 2CF6A 2AA3A 3WIDA 2PKRA 3GVHA 1GPDG 4J9UE 4QQRA 4ZQEA 3I9OA 3P19A 4B4VA 1E5LA 1WPQA 4KDEA 4Y67A 4RJTA 4Q9NA 3P2YA 2IRWA 4R1TA 1H6DA 1SB9A 1PU2A 1ZK1A 1JLLA 2HLPA 2AHRA 3JQAA 8LDHA 4U0JA 3KSDO 3L6OO 2BI8A 2E6UX 3NTQA 3L6DA 1GZ3A 2XAAA 3JQBC 3AOEA 3NDIA 3AI2A 1V0JA 3OICA 4ONEA 1PGJA 1O95A 3RROA 3IUSA 3TL3A 2PKQO 5CG2A 5K9ZA 5FWNA 2EF1A 1I3KA 3S2FA 1QMGA 2PZJA 2TMGA 3ZWXA 4BV8A 4AJNA 4E32A 4D3FA 1E6WA 3ITKA 1ONNA 1B0AA 4BB5A 1XIVA 2ZTVA 4F46A 1IZ9A 4E4YA 4ID9A 1Y81A 4JBGA 1KY4A 1RM4A 3Q2KA 4MVJH 1Q0HA 4Z3DA 2C07A 3RFXA 5BSFA 5CDGA 3CEAA 4LW8A 1UXGA 3N7UA 1K6XA 2CZCA 1GL3A 1VL0A 3GVIA 1DHRA 1UXJA 4FW8A 4I9NA 7MDHA 3GZNB 4CLXA 4DWVA 1GYQA 2OFPA 3WLFA 2UV8A 3OIFA 1DDOA 2V6MA 2CY0A 3I4FA 1ISFA 2D2IA 1NQOA 1R16A 5EQFA 1Q0QA 1P33A 3DBHB 4JXKA 1E0DA 2F1KA 4LMRA 4MVJI 1VRWA 1K6IA 1W0CA 4CR6A 4FC7A 4DYDA 2AE1A 2RIRA 3ONFA 3MTGA 4J7CA 1DC5A 1O5IA 1FDWA 3OJLA 2PGDA 3F4LA 4D43A 3T4EA 1EVYA 5KKAA 4OSPA 3C8MA 3U4DA 5U4QA 1E6EA 1F14A 5JCJA 4BNNA 2PD6A 5TGDA 1WDMA 1T26A 5JMWA 1H6AA 3DMTA 4Z9YA 2OGUA 4CQMB 5ES3A 1T2EA 4GMFA 1XSEA 3PHGA 4XWYA 5TS3A 4EYEA 4TKMA 1NXQA 1DRVA 3IP3A 2NLOA 4HNGA 2UUOA 4B8WA 3ROKA 4ZHSA 3VHRA 2GN6A 3RKUA 4B4WA 4Y98A 3ASUA 4YVFA 3WDSA 4GMGA 3NDRA 1Y9EA 1SZJG 1YGYA 4RDIA 3ZNPA 1Y7TA 1YWGO 2C2YA 4L75A 1CJCA 1WXDA 4JIGA 4BNGA 2BFPA 4PN3A 2YUTA 1JU9A 2NSDA 3DXFA 3FI9A 1AHIA 3GNTA 4WOJA 3HJAA 2BI7A 1NASA 1HZZA 5LDHA 1TT7A 2EIHA 1C0IA 1ZJZA 5EINA 4BHTA 4YRDA 4BNWA 4Y6RA 3GZ4A 5KOIA 2G82A 4XEHA 2EHDA 3ZWOA 2R6JA 3V5NA 3WG9A 3F6YA 1B14A 3I9JA 2ZCVA 3RBVA 1EK6A 1B8VA 2YHUA 3F1KA 5ER6A 1AXEA 2GCGA 1I32A 1UJMA 4RF2A 4E12A 3QVSA 3SEFA 1EK5A 5G0TA 3D3EA 1WZEA 4BNKA 4XRGA 1KBZA 2QYSA 2O4CA 3A1NA 2PH5A 2ZB7A 2X6TA 5AXAA 3DZGA 3ZWBA 1Y5MA 3H9GA 3ONEA 2VUUA 4QT0A 1WVGA 1ENPA 3A4VA 3KEQA 1DHTA 2VNAA 4CLHA 2Y67A 3D64A 3RSHA 3BHMA 3UH1A 4B3IA 3ANLA 4NBVA 5IDQA 4J4TA 2VZ0A 3LVFO 3UHAA 4L74A 5EMHA 1EE2A 1KS9A 1VI2A 1CQJA 3CTMA 4XB2A 5BR7A 4FDAA 1T2AA 1UZNA 1VM6A 1WMAA 3JQGB 3MCVA 1R4MA 4BMNA 4FFOA 4H3VA 5F1PA 5MDHA 4PFJA 5CEEA 3WR5A 4QO7A 3AUSA 3M2TA 1M67A 5B4VA 2DTXA 4LK3A 4YRBA 1ZXBA 5B4TA 1EBUA 1LDMA 4J2OA 2NQTA 4FIZA 3U0BA 4GPD1 4BKUA 2OUIA 3Q2IA 1M2WA 4IY1A 4CL8A 4CUZA 1T1RA 5EQDA 2O3TA 1A7KA 1Q7GA 4AFNA 3PFWO 3AM4A 3U3XA 3C3XA 2AXQA 4LSWA 2B36A 4MOWA 3TSCA 2Q99A 4YT5A 1VKOA 4L9RA 4YJFA 1RYEA 3AJRA 2Q1SA 1EE9A 5JY6A 4CMBA 3L4BC 1HKUA 1XKQA 4J1QA 4W4TA 1MG0A 3K73O 3QLJA 2YDYA 4AJKA 2X8LA 3KSZO 3GAFA 3Q1LA 2YV1A 1NPTO 1GADO 1R4NA 2WYUA 3RFTA 4AL4A 3E03A 4II2A 3H2SA 4IINA 1HYHA 4J49A 3L0DA 4PLFA 1I24A 2B83A 2P9GA 3LC1O 1M66A 3VH3A 4O59O 1HRDA 3GDGA 1PZGA 4U6SA 4FQ8A 2Y93A 1N9GB 4K6FA 2OBNA 4GI2A 2O23A 5AVOA 3R3JA 4EUHA 1LRLA 4TVBA 1U3VA 5JS6A 2DVMA 1BW9A 3EUWA 3M1LA 2X58A 4GWGA 2Y1GA 1ZCJA 4ALMA 4BO8A 5KVSA 2C59A 2FR1A 4L73A 2DC1A 3PQEA 4J91A 2Y1FA 4XB1A 2PD3A 5CDUA 3PP8A 3CE6A 4FC6A 3VH1A 5IZCC 3UCXA 3ZNNA 5IJZA 4JCOA 4KWIA 1UH5A 3HDHA 4RVGA 3I1JA 3WGTA 2I3GA 3GLQA 3IP1A 4P4LA 3L6EA 4HFMA 1MB4A 2AG5A 5U1PA 4E21A 1P0FA 1ZIDA 2AQKA 3E8XA 3ENNA 5KIAA 2WEKA 5HWSA 4K9DA 3I4CA 4FR5A 1PJ4A 2Z1MA 1VJ0A 2B69A 2J8ZA 4B4OA 3EC7A 1G6KA 5B37A 4E2WA 1HEUA 4OAQA 4PLPA 3UAGA 1VJ1A 4OMUA 5TQVA 3LLVA 1V3UA 2FRDA 4TRNA 2WTBA 3DB2A 1AXGA 4D0SA 2AMFA 1GQYA 3DBVO 3PWSA 1NX6A 4B7CA 4WEQA 5A5FA 5CAEA 3DQPA 2BFOA 3LDHA 3I9NA 1O6ZA 1LC0A 2DBQA 1Y5RA 3QWBA 2NNLD 1U2DA 3JQAB 3WNVA 1LSJA 1Q7CA 2CDCA 2QRLA 3JQBA 4BO0A 4CLDA 3DC2A 1NPYA 4MIYA 3AY3A 2Q50A 1IPEA 1B2LA 3DWFA 4O0LA 3ENKA 4EUFA 3ETDA 2WD7A 4XR9A 4EJ0A 5BNTA 2C0CA 4JLWA 2HMVA 1EQUA 2Y1OA 4QXMA 3WWZA 3CXRA 4RQTA 3U62A 2QX7A 2C54A 3KVOA 1JWBB 4WE3A 2OHXA 4IDDA 4NH4A 4EUEA 2DM6A 3S55A 3RIHA 4AJ2A 4C4OA 2X0RA 4BO3A 2FR8A 1T2CA 4CMJA 4TZKA 4YACA 4ZN6A 1YQXA 3ZWPA 3ZW8A 2GN4A 5HS4A 3TZKA 4I5GA 1GTMA 4YR9A 1U3UA 1YS4A 3GF4A 1QSGA 1MX3A 1PSDA 5JDCC 2YZ7A 4XKJA 5KKCA 5C3MA 1LSUA 3GHYA 2J3JA 3R3SA 1ADFA 3GEMA 1N2SA 4F6LA 5KNLA 1ISHA 3QWHA 5CP8A 3OJ0A 4DIFA 4YJHB 5ICSA 3IKVA 1FMCA 4RVFA 4ALJA 1JA9A 1N8KA 5JPIA 1LDGA 1MC4A 1UP4A 1ONOA 3Q9UA 5DP1A 2HRBA 3C1AA 2IXAA 3R1IA 3D5QA 4W6ZA 5ER9A 5KJCA 3HADA 1I8TA 2VOJA 1Z75A 2AEJA 2VYND 4IPTA 4R51A 4CLOB 3ZV3A 1BMDA 3HWRA 1U1IA 3JD1A 4GH5A 3OF2A 1X1TA 1DPGA 3FPCA 1NQAO 3SLKA 4CM6A 2BKAA 4UVDA 5F5NA 3D4PA 2VZ9A 2VTDA 1ADCA 4OSOA 4CM7A 2B5VA 2XXBA 3DBRB 1HDRA 2CVOA 3INTA 5F1OA 3W6UA 5G4KA 4FGWA 2I6TA 3ZHZA 1DLJA 4WOKA 3VPGA 4YAGA 2EV9A 1B26A 3OBBA 3MJSA 1GUFA 5DBIA 5I9LA 1ISJA 1R15A 2EP5A 3ZU2A 4IUYA 4E3ZA 3JV7A 5DOVA 3WFJA 3JD4A 1VC2A 1PL8A 3KUXA 5F3RA 4CMCA 4BNLA 3FNHA 3L9XA 3PJEA 4YBZA 2I99A 2JHFA 2EWMA 2X5KO 1E3LA 1JAYA 4CQLA 3VOSA 3G1UA 1ISMA 1GPJA 3AUAA 4JJGA 4J0FA 4GLOA 4S1VA 4J1NA 1ADBA 4E33A 1Y8RA 3FHLA 1LRKA 1NNUA 1P77A 4PRLA 4RPLA 3AU9A 4WLVA 5DCYA 3LK7A 1QLJA 1YJQA 3UF0A 3GY0A 4OYRA 2X86A 2IODA 3QJ5A 3MJVA 3BXXA 1O0SA 2Z5LA 2W98A 3D7LA 4UUPA 4Z0TA 5L51A 4FN4A 1JKJA 4G65A 5I8WA 4ZVVA 2I66A 3LF1A 2BH9A 2O3RA 4NDNE 3WBBA 2PV7A 1R12A 2D5CA 4IQ0A 4QEDA 4EEXA 1NR1A 2DAPA 3B1KA 3LU1A 4LCEA 5TT0A 4XD2A 3ABIA 3IC5A 2NQ8A 1MXHA 1WZIA 1QG6A 1ZSYA 4M54A 1ZEJA 1H6CA 1UXKA 4A10A 1SOWA 3GGGA 1U7HA 4LVCA 1U5CA 5I8ZA 4MP6A 3E6AA 4J7UA 2Y0CA 1B8UA 2PFGA 3ZI0A 4OH1A 4P4NA 2I5PO 4XA8A 3O9ZA 5A9RA 2TMDA 3OECA 5HS6A 2EJVA 3LT4A 5L95A 1O9BA 4I5DA 4XYBA 2B4TO 4XGIA 3HDJA 4KUHA 4TVOA 4BNYA 4CUJA 2A94A 3JYNA 2C82A 4PLTA 4OKNA 4A2CA 1ISIA 4IDCA 4L76A 3INGA 4XQEA 6ADHA 2X0JA 2JAPA 4HV4A 4E2XA 2P2SA 4EEZA 1PX0A 2W2KA 2Y1EA 3IKTA 3ASVA 2FOIA 2QRJA 5KVQA 2NVBA 2P4QA 3KBOA 4YEDA 3UICA 2H5LA 2SCUA 1L1FA 4TZTA 3ZGYA 3TOZA 4UEJA 1DXYA 1ONPA 5HRUA 3I83A 2V7PA 3PDUA 1RPNA 4M89A 2OBYA 1B7GO 4N54A 4UAGA 5DNAA 1QR6A 1XQ6A 1ZMOA 3AI3A 3KB6A 4UVIA 3WMXA 1Y6JA 2VRBA 3H3FA 2YDXA 3WICA 2ZQYA 1BG6A 3WLEA 4ZD6A 4NFYA 3DZBA 1WWKA 1Z7BA 4PG6A 5A9SB 4R9RA 5I7FA 4ND1A 1U28A 4HWKA 1S6YA 1SBYA 4CM1A 4W82A 2X9VA 1SB8A 2HMUA 1GYRA 4RPKA 3RUEA 3VKVA 4N18A 3E5RA 5TJHA 2FP4A 5L4NA 1I10A 3PRJA 3FTPA 1RM5A 2E37A 1IULA 1YJ8A 4HUJA 4CMEA 5L7WA 3V2HA 2EP7A 1GR0A 5JW6A 3ZWNA 5DCWA 2GZ2A 4OO3A 3BMOA 4TSKA 2Q1UA 3GGOA 1LX6A 4BVAA 1CYDA 1VL8A 4CV2A 1YB4A 3COSA 1UZMA 1PJQA 2BFMA 3QY9A 1CDOA 4OIMA 2IZ1A 3JQ9A 3IMFA 4B79A 3EW7A 4IMRA 2Y66A 2QZ9A 4RO0A 3WWYA 2NVUA 2OO5A 3GRPA 2WSBA 2O7SA 1XG5A 4XJSA 1T25A 5KJFA 3O03A 1NFFA 1DOHA 1HLDA 1GYPA 5HM8A 3RU7A 1R0SA 3IJRA 3WBFA 4AJOA 3F1LA 3KHUA 3BTVA 1HF3A 5CG1A 4A7PA 1KEPA 1BHSA 3WGQA 3DL2A 4RPGA 4HFNA 3FWNA 4DMLA 4WNCA 1H9AA 1LBEA 2ZB3A 4AJIA 2P4HX 1CEQA 4RV9A 1P1JA 2C5EA 1EMDA 4MVJA 4WUVA 4Q3DA 1DEHA 1V6AA 4D3SA 1K6JA 3GVPA 3EZYA 1ADGA 2CFCA 4J4HA 2EG9A 2JL1A 2QHXA 3E5MA 1W6UA 1D3AA 3ROQA 4PLZA 4R1NA 4NBUA 1KC3A 4KQWA 4IQ8A 3RUAA 5COAA 1EQ2A 3PYXA 2P68A 4QX6A 8ADHA 2OOSA 1U8FO 3BTUA 1A71A 4R5MA 1FDTA 5A02A 4PZCA 5H83A 2YFHA 1U3WA 1BVUA 1X1EA 4PRKA 4A26A 1IYZA 1DC3A 1M6HA 1V3TA 4YAKA 4GKVA 1UP6A 4MJLA 3L4SO 4OQYA 1TVEA 4RF4A 2EJWA 3PHJA 1QYCA 3M1AA 1YQDA 2Q4EA 3JYLA 4OXYA 1IB6A 3NAQA 2GUGA 3NT2A 1NWHA 2O48X 3D1LA 3CKYA 4GX5A 5TC4A 3UFXA 2VHWA 1EUDA 5GZ6A 4R69A 4FOOA 2O2SA 2EW8A 2XF8A 5A03A 1XLTA 3PJFA 1PEDA 4LRSB 4MKXA 2FR0A 3WGIA 2BGLA 4O6VA 4BMVA 1J5PA 1E3WB 1VLLA 2PY6A 4YA6A 3PZRA 3HZZA 2POQX 4FFRA 1PJSA 2GYYA 4DLLA 1R6DA 3JQFA 3DTTA 3GK3A 2CDAA 1O8CA 4DLBA 3H9UA 4YPOA 2JAHA 3ROPA 3MWDB 3WX0A 4Q39A 4W9NA 1U4SA 1QXSA 1HYEA 1O94A 3FF4A 4MKRA 3VZQA 4JJFA 2C29D 3DR3A 1UXHA 2P91A 2RCYA 1QP8A 4N7RA 3WYBA 4CLRA 2DQ4A 3AY6A 4I9HA 1FDSA 1F17A 1ARZA 1C0KA 2R00A 1I3LA 4BNMA 1L7EA 1LTHR 2D59A 4BL5A 2VT2A 1A27A 3AW9A 4GQAA 4OOFA 3BTSA 2Q2QA 4NQZA 1I2BA 2GF2A 2X9NA 2Z1NA 2O2YA 4J43A 3MJCA 3PPIA 4MO2A 4YDRA 1C3VA 3KLPX 7ADHA 1PJ2A 2V6GA 2W2LA 3TN7A 4YXFA 5COQA 2GN9A 4D0RA 1NVMB 4GVLA 5A9TA 3WXBA 4XYGA 1P1HA 3DFZA 3I9LA 3OM9A 3BMOB 3TL2A 1DSSG 5ICMA 3RWBA 4P8RA 4KUEA 2FPPA 5L53A 2OP1A 2YYYA 2DFVA 1SAYA 1GQQA 2X9GA 2R2GA 4GKBA 3RC9A 1VE9A 4IJWA 2DBRA 4CPDA 2B37A 4D41A 2NU7A 3SJUA 5JAQA 1HSZA 2X4GA 5AXDA 1XYGA 2CNBA 1XCBA 3LF2A 4BNIA 4HXYA 5JAMA 2AEFA 3E18A 2C7VA 2Q45A 3KTDA 4ZQBA 5FI3A 1E6UA 1NM5A 1B3RA 4NK5A 4E5NA 4E5KA 2HK7A 3QE3A 1UUFA 2Y1CA 1BXZA 1DFGA 4ND4A 1KVTA 5GZ3A 3RQSA 3PHLA 4BKPA 5A1TA 5COBA 4PIVA 5ENDA 3EGOA 1PZHA 3PGJA 4OJNA 3VVCA 2AG8A 4LGVA 4YRAA 3OP4A 3F4BA 4DTIA 4J1SA 1T4DA 1RM0A 1ULUA 3HG7A 3O8QB 3Q0EA 1HETA 1X0XA 2UVDA 3MZ0A 4HNHA 4PLWA 4KMSA 5TLSA 1DIHA 4FFMA 3I6QA 5AXCA 1KVSA 2E82A 4PLCA 1ML3A 2DPHA 3I6IA 1AN9A 4HX5A 4FJ0A 4Z0PA 2X7HA 4DRYA 1NTOA 4CLEA 3VTZA 5A9SA 1D4FA 2PZLA 5IN5A 2WWRA 4WLNA 2J5QA 3E82A 2IEBA 4GAEA 4EJMA 4EW6A 4E5PA 1GCOA 4CQMD 3GFBA 1YOVA 3X2FA 1SCUA 5JE8A 3ZHBA 5B4UA 4ZU3A 1WDLA 2VCYA 3JQAD 2CVQA 4HBGA 3U09A 4HFJA 1E7YA 4J9VA 2HMSA 1E3EA 2W2LD 4P4GA 3C7DB 3S8MA 1Z74A 2FZWA 4CMAA 2I76A 2JCVA 1YL7A 4XDZA 2A4KA 1F0YA 4Z9FA 3TJRA 3W8DA 1MP0A 1I3NA 1N1GA 1ZJYA 5EESA 1V35A 3N74A 1XDWA 2VUSA 3HNPA 3GOHA 5C7OO 1YRLA 1E1NA 1ZMTA 2Q1TA 4CM5A 3VH2A 4BGIA 4LSMA 4A27A 3GMDA 4OXKA 4PG4A 4OQZA 5CDSA 5A3JA 1OZAA 4WLOA 4ZGWA 1YO6A 4YQYA 1C0LA 2VRCA 2ZB4A 5IG2A 1XELA 4CODB 4JP2A 3GHHA 3PWKA 1OFGA 5BNFA 3JQ7B 5JNLA 2NTJA 2CDBA 3W4JA 4J3FA 2NVUB 3WSWA 3W1VA 3DONA 3K2EA 4AVYA 3ZWWA 4UREA 3QHAA 3AOEC 4PG5A 5JFOA 1WAMA 3S2IA 3ZV5A 5K0ZA 4HADA 1C1XB 1ZBQA 4XYEA 3SC6A 3DAFA 2FMUA 4XZ3A 3T7EA 3BMQA 2OMEA 1BXKA 2B0JA 3ZWYA 3WJ7A 4PG8A 4XQCA 3E9QA 3BA1A 4JROA 4IBOA 4WK6A 5T67A 1GEGA 2XOXA 4YT2A 3TFOA 2GZ3A 3C85A 4AJJA 5KWEA 1YB1A 5GMOA 3IL2A 3UKOA 1E5QA 2UUPA 1FJHA 3S2EA 1SO8A 3S1LA 4D45A 1PJBA 4YAJA 4OL9A 3B20A 3DOJA 1HDGO 3SX2A 3ZNOA 4O5OA 3GDOA 4CMEC 1ULSA 5F21A 4EZBA 3E9NA 1UDBA 3NT4A 3K96A 3WJAA 2GZ1A 2LDXA 2BFAA 3JQ9C 4ZQGA 5IDYA 4YJDA 3GVCA 1D8AA 1PGPA 4GX2A 3UW3A 1DIAA 1K3TA 3M6IA 5JSFA 3W6ZA 3SC4A 1V9LA 3GRKA 2O3UA 5JYEA 2P5YA 1GY8A 4GVXA 3OHSX 3ZWCA 1E1LA 3DDNA 4MVJF 4CQLB 5JBIA 3K9QO 1JWAB 2VT3A 5BNIA 1GQ2A 4GX1A 2G1UA 4JX8A 5KCZA 2NTVA 2J3KA 4CM3A 2HRZA 1LLCA 1IY8A 3FNEA 4ZQFA 5LC1A 4J2HA 3PK0A 4R4JA 4TKLA 1U3TA 2WD8A 2FSVA 3D3WB 2D0IA 3L77A 4CR7A 3NTOA 1NHWA 1HE3A 2RAFA 3QVXA 1X0VA 3H7AA 4NJMA 3CZRA 3DHYA 2JJYA 3VDRA 5MGBA 3LYLA 3DZHA 3IAHA 4K26A 4ZA2A 1H93A 1DRUA 5JMPA 5THQA 4Z9XA 4IXTA 4KOAA 3OIGA 1M76A 4F45A 3FNGA 3BYZA 1R4NB 1JQBA 2R00C 3GDFA 2PH3A 4WCFC 4I1IA 2V65A 2YY7A 4HFRA 1DLIA 1E3SA 3UXYA 4YJGA 4DREA 2HKIA 2W4QA 4OGWA 4E31A 5TF4A 4Y9DA 5CPBA 1YB5A 2VYVD 4RL6A 2AE2A 1UDCA 4R1SA 1T2FA 3QIVA 5I9NA 5G0WA 3ZW9A 1NP3A 3C1OA 4DBVO 2VHZA 2HJSA 3EYWA 1CETA 4CMHA 4YJHA 4BO2A 2ZTMA 1CERA 2J6IA 4JJIA 2Y99A 4IGFA 4AICA 4BKRA 1VSUA 1GCUA 2Q2WA 4LVUA 1NR7A 1IL0A 1ZUD1 4BNUA 4FFNA 1Z45A 3UCEA 3VDQA 4DQXA 3A14A 3V2GA 3VZPA 1E7WA 3ZDFA 1A7AA 1Y8RB 3KM0A 1WNTA 3GPDG 1CIVA 4CUKA 5I7VA 1DC4A 1ZSNA 4IGEA 5G2OA 4DPKA 3NTRA 4CM9D 1C1DB 4WECA 9LDTA 5FF9A 3JQEA 3DOCA 4RORA 2WD7B 3WB9A 2D8AA 5JC1A 2FPGA 4Y8VA 1P74A 3DEYX 1DJQA 3KRTA 3N58A 4IMPA 4H16A 3VPHA 5JYDA 1BW9B 2CMDA 5CHEA 1PR3A 1PZEA 1EDZA 1GUZA 3MJEA 5FI5A 5ADHA 5I7EA 2X0NA 4BQRA 1EVJA 1YBMA 3W4IA 4ILKA 1PTJA 4YYZA 1CQIA 5CEFA 4RPJA 3G79A 4B3HA 1SMKA 2O3QA 2X5OA 4LCJA 4YCAA 1QV7A 1DC6A 1LA2A 3RUHA 2D4AA 1AE1A 3V8BA 1Y8QB 3PYMA 4NG5A 4IZHA 1I36A 1MUUA 1TXGA 1DO8A 4GLLA 3JQ6A 3PFFA 4R01A 4R68A 1E7QA 1HE2A 2EGGA 1T24A 3RCBA 4MINA 4BGUA 5DN9A 1WMBA 4PVCA 1R37A 3QVWA 2GRAA 3GH3A 4Q3BA 1KIFA 4E30A 4GGPA 3GN2A 4CMKA 2GNAA 4C7JA 2Q46A 4YJFB 1PL6A 4CR8A 4DIBA 2X5JO 3F3SA 4PZEA 1TI7A 1EZ4A 4BQPA 5BSHA 3JD2A 5HTOA 3AM5A 4F6CA 1XWFA 5KJ6A 3EK2A 3LT2A 2EKPA 3GEGA 1CWUA 5TNXA 1ZKMA 3RJ5A 1M6WA 2EKLA 5IN4A 1AGNA 4Z0HO 3GPIA 4WCFA 3K31A 3IQDB 1R0LA 1P1IA 4F3YA 1X13A 4TQGA 5HA5A 4BO5A 3RUDA 4M1QA 1N7GA 2FZEA 3BAZA 3OQ6A 1HE5A 2XXJA 2PR2A 1DIRA 5B12A 1MLDA 1R4MB 4RZIA 1X7GA 2Z95A 3KZVA 1KETA 1A5ZA 5IAAA 4OKIA 1DAOA 1OOEA 1PJLA 1N92A 2ZJ1A 3IIEA 4HP8A 3B1JA 2BD0A 1GDHA 2NVWA 5F1KA 4A5OA 1U5AA 1NQTA 4KP7A 2WDZA 4IS2A 2WMDA 4XIYA 3WNQA 2F00A 4M87A 5I7SA 1GZ4A 1SEVA 2HDHA 4LRTB 4QFCA 1ZSVA 3VAZA 3TQHA 3WIEA 3DOOA 3MJ4A 4XJTA 5JDCA 3JCZA 2H63A 4ND3A 5FYDA 4EBFA 2WE7A 4XR4A 4PG7A 2V6FA 1PWXA 3ZU3A 3OEYA 4JNKA 1PGOA 5EN4A 3VPXA 4CMGA 3GZNA 4NU5A 4O63O 4DQVA 4PVDA 2NACA 2VUTA 5GZ1A 3MTJA 3QV1A 1LSSA 3BIOA 1HDXA 1Y1PA 1G1AA 1MC5A 4PLGA 2ZKLA 2DFDA 1XU9A 1B16A 1W73A 3VH4A 2C7GA 2JFFA 1KY5A 2Y0EA 1MA0A 1QYVA 2BGKA 3HDYA 4E2ZA 2QIOA 1I3MA 3GQVA 3MEQA 3RBXA 1YBVA 4AJEA 4WGGA 4WLEA 3ULKA 4E6PA 4Q3NA 2NWQA 2DBZA 1U7TA 1H5QA 2E48A 3VZRA 3GT0A 3QWIA 3NJ8A 4D42A 3W8FA 4R9SA 5IXYA 3JTMA 3DZJA 4CV3A 3PLNA 3H4VA 5JXWA 4FOSA 3RBZA 3GAZA 3IDSA 4IJVA 3SJ7A 4ZICA 1B8PA 5K6AC 4Q3AA 1MGOA 2A35A 3SBOA 1QV6A 2I65A 4WJZA 3OEWA 3ZZNA 3HHPA 3I5MA 3U49A 3RU9A 2AQHA 4M8SA 4RPHA 3ZH2A 3BTOA 5K6AA 3JQDA 2P9EA 2Y0DA 2JCXA 4J0EA 3HDQA 2ZJ0A 4J90A 5CDTA 5TIIA 1LXCA 2C20A 2NM0A 5T5QA 1NYTA 2FSSA 4IIUA 1B15A 4NZ9A 1GV0A 4DXHA 1YXMA 2GASA 2PNFA 4XYLA 2D1YA 3WGHA 3QP9A 4CQMA 2NV6A 2JCYA 5JLAA 4TRRA 4RQUA 3ST7A 1NFRA 4DPLA 1WLYA 3JQCA 3OQBA 3B1FA 1OC4A 5AXBA 4NBTA 3B6ZA 3DAGA 3WMWA 2Q4BA 5EIOA 4GGOA 2VHXA 1R0KA 3PLRA 1ENYA 4IIVA 1NBOA 5IDWA 4E2YA 1BSVA 2FWMX 1PGQA 1I5RA 2HCTA 3R0IA 3ZV6A 3K30A 1ISGA 5DT9A 2VHYA 1PZFA 3F9IA 4ZRNA 3WGGA 2PGLA 3DZIA 3FR7A 5IF3A 2VWGA 5JC8A 1PQWA 1M75A 2C2XA 3F47A 3I9KA 2HK9A 4ZJUA 4N5NA 2ZYDA 4UVGA 5A3VA 4WCDA 5IXSA 3ZHXA 1P1KA 3O4RA 2Q1WA 5KVCA 3C1TA 3RC1A 4B7XA 2VOEA 5JDIA 3TOXA 2Q49A 3DMTC 5L4LA 4OHUA 2H1SA 1BDMA 2Q2VA 3OH8A 2AQIA 4AJPA 3NEPX 4NJOA 2EW2A 3D5TA 1VSVA 4L4RA 4BNFA 1G0OA 4HY3A 3JQGA 4RVSA 4B7UA 3S2GA 1H2BA 3LLSA 4YAIA 1KC1A 5AOVA 3TPCA 4FD3A 3IS3A 1X7HA 4ITUA 1DFIA 2LDBA 1K5HA 3HFSA 4NJMB 4U8GA 1J4AA 5BT9A 3M2PA 3ONDA 3ZHYA 4LN1A 3IOYA 3NRCA 3MJTA 4WCFB 4FFLA 5THKA 1CRWG 1ZK2A 3Q6IA 1YE3A 1BDBA 4P38A 1SEPA 1NAHA 3KV3O 1I2CA 3SLGA 1HWYA 1EBFA 2JD1A 2PZMA 3JD0A 1H0KA 4G2NA 5TX7A 1FDVA 4B3JA 1LLQA 1I2ZA 1B3BA 1XU7A 1A72A 2ZATA 1FXSA 4GSLA 4XYMA 2PD4A 3R6DA 3ROMA 1PR9A 4XRRA 2WM3A 4LISA 3INRA 4A0SA 1QYDA 4E5MA 1A9YA 2ZK7A 2ZYGA 4DVJA 1IOLA 3QRWA 4QSMA 1CF2O 3GG2A 5DZSA 3V1TC 4BKOA 4UEKA 1C0PA 1IPFA 3EZLA 1LNQA 5LCXA 1N1EA 3UN1A 2OP0A 1RM3A 4XCVA 4W9NC 5EJ2A 1HYGA 5ENVA 1JKIA 2JKVA 4X54A 3FTNA 2DTDA 4YB8A 4IDGA 1DIBA 1A4UA 4U7WA 3K8ZA 3KYCB 2QYTA 3WGOA 2ILTA 4YT4A 4TMFA 1EFLA 5KTKA 3RI3A 1IZ0A 3KYDA 5ITVA 4XX0A 4DIOA 2E4AA 4DQUA 3PWZA 2VRCD 4DPMA 1EFKA 3C24A 1EVZA 1P9LA 4RVUA 3T4XA 1E1MA 4DA9A 4R1UA 1C1XA 4Y6SA 5H82A 2G17A 4IDEA 5BQFA 2HJRA 2HMTA 2WYVA 3L07A 4BNHA 2EERA 1PWZA 3NUGA 1I01A 1VPDA 3NKLA 4CV1A 5AYVA 2IXBA 1C1DA 2OZPA 1HDOA 3ORFA 3AUUA 3PQFA 3HN7A 3JYPA 1GV1A 2CSUA 2VWHA 2V6BA 3F5QA 3DHNA 4FFPA 3ITDA 3MOIA 1JDJA 1HLPA 1YKFA 3D0OA 4J6FA 3OJEA 1EUCA 3Q9NA 4JQCA 3SXPA 5C7IO 1KEWA 3CPSA 4M55A 4K6CA 3DBHA 3DTYA 3QSGA 1Z6ZA 1AHHA 1LC3A 4PLYA 1K0UA 4RLSA 4AJ4A 1IHXA 3AFNA 4YTEA 1T4BA 4AJLA 3AFMA 3BZUA 4MKZA 3FR8A 1E77A 5JCJD 2UYYA 2VHVA 1MXFA 1YOVB 3TRIA 5KJEA 2P9CA 3H9QA 3H5AA 3ETGA 3JSAA 4RZHA 3ZCXA 4MP3A 5TT1A 4CM8A 1VL6A 3U4IA 2BF7A 2I3AA 1DAPA 3EVTA 3U5TA 1J0XO 4J16A 4K28A 1ZVMA 4IQGA 4ZRMA 4I5EA 3JQ8B 5DCUA 4E5YA 4J4BA 1LQTA 4N5LA 3AM3A 5EERA 4W7IA 1Y8QA 3KETA 2VYNA 3CMCO 1PIWA 4U0KA 1UZLA 2DTEA 2ZCUA 4J1TA 4PGFA 2HAEA 3AU8A 3HN2A 3QWAA 3AOGA 2X1HA 2ZIZA 3A06A 4EITA 1S7CA 2WE8A 2GR9A 1X7DA 3ETEA 1WW8A 4BUCA 4P22A 1HZJA 2QW8A 2HO5A 2D3TA 2BGMA 1XGKA 3QVOA 1MV8A 4L4XA 5L9AA 4XQ9A 4A73A 1YONA 1LLDA 1JW9B 2YHIA 1KYQA 4WKGA 5CPFA 5JO0A 1N7HA 1E7MA 3UCFA 4IJUA 2VWQA 4NU6A 3NJ4A 4FJ2A 2HK8A 1E92A 2XPCA 2J3IA 1HE4A 5JCXA 3HB4X 3PDJA 1GAEO 3DZFA 4KUGA 4CMIA 5HBRA 2QG4A 5BSEA 4R3WA 3GG9A 5L40A 5L45A 5JO9A 4JK3A 4RVDA 3PIIA 3G1TA 3UOGA 3G49A 1EUZA 3PQDA 4G5HA 4TRJA 4R5HA 4LMPA 3H65A 3CSDA 2ZTLA 4CM4B 1W8DA 3CH6A 2IE0A 5A4DA 3ZWMA 3K92A 4YWJA 3ZWVA 3P7MA 5DULA 3IJPA 2C5AA 2DKNA 1C14A 4BGVA 1PJCA 4RCVA 4DUPA 2IZ0A 1Q2XA 3TWOA 4E0BA 4R54A 4ND5A 3V2UA 3P5SA 2RH4A 4BO9A 4DC0A 1EEHA 3BMQB 3RUFA 1TLTA 2DPGA 3H8VA 4DMMA 4YJGB 2FN7A 5FEUA 3TDKA 4MVJG 5LDGA 4K1LA 3WOHA 1XR3A 5T8KA 3PEFA 4ALIA 3QW2A 4XQGA 4BO1A 3OIDA 5G0SA 5U9CA 4UUOA 3JQ7A 4BB6A 3EY4A 1J49A 4XDYA 1E7SA 4NFSA 2BHLA 9LDBA 1N5DA 2GD1O 1BXGB 3DBLB 1I33A 2DUWA 1GD1O 2O7QA 3V1UA 1U9JA 3JQFC 3GUCA 3O8QA 4ND2A 3FD8A 3HE3A 5L7YA 1E7RA 2JD0A 3WS7A 1IHYA 3GGPA 1TT5B 2EEZA 3LT1A 3PYLA 3PVZA 3D3WA 3RFVA 4XGNA 4I5FA 5GY7A 1ENOA 3MWEB 3NX4A 4H7PA 1E1KA 4JGBA 1HSOA 3GEDA 3OETA 1EDOA 4BO4A 2VTEA 1PS9A 5A04A 1KEVA 4H15A 1ZNQO 2RBEA 3WQSB 2H6EA 3DFUA 3OSUA 4RLHA 5ILGA 1WP4A 3KLMX 1XHLA 3ZN2A 3QA9A 2CD9A 3H5NA 2JFHA 3HB5X 3I52A 3UVEA 2CUKA 1O89A 1U4OA 1PS8A 1TA4A 1DBVO 1DFHA 3A28A 3STHA 3ZWAA 3JYOA 2PGJA 2GLXA 1BGVA 5JY1A 3K5PA 4BS9A 1LLUA 2ZYAA 5CFZA 2VZ8A 4D79A 2YQ4A 3FBTA 5J23A 1X15A 1ZZEA 4KQXA 3CMMA 3I3OA 4MVJE 4C7KA 3TFQA 1EVIA 2CVZA 4MDHA 2D5AA 3OJFA 3GVXA 4WLFA 1ZFNA 2VNSA 2ZB8A 1F8GA 3GN1A 2RHCA 4WASA 4PLVA 3LZ6A 4BOYA 4DYVA 1PL7A 1XQ1A 1MFPA 1NFQA 2YFQA 3BMCA 1JAXA 1ZXLA 3GNSA 2DUUA 4NBRA 5G0UA 1L7DA 5IZ4A 1T2DA 4EI2A 3GA0A 4ROSA 4KTTE 4E13A 3ZNQA 4NPCA 4WPGA 1U8XX 4KWHA 2E49A 4WNIA 4M86A 4IS3A 4KTVE 2B5WA 4A03A 1YL6A 4FJ1A 3RD5A 3GUYA 4TRMA 1YDWA 5JDIC 1YDEA 4UEOA 3FNFA 4U5QA 3TZ6A 4IDFA 1I30A 3G3EA 2OL4A 4FSHA 1LRJA 2O3SA 2BELA 3F5SA 4I9UA 2BLLA 3CIFA 1E3WA 5ITWA 3GR6A 2GN8A 3H9EO 1TB4A 2JFGA 2Y05A 1F12A 4NFHA 2I67A 4I8XA 3EAGA 4B8ZA 1WDKA 4MVJP 5DF1A 3BMNB 2PK3A 2NUAA 2ZTUA 3ICCA 4G81A 1NQ5A 1Q7BA 3AY7A 5DBGA 1ZO8A 2G0TA 1R66A 1PJTA 1NAIA 4BO6A 4PCVA 1ZH8A 1GZ6A 4BO7A 1UAGA 5KVVA 1K89A 1GEEA 5TJ9A 1E3JA 3WTBA 2B4RO 3H5RA 2CF5A 3ADPA 2IZZA 3AK4A 2DLDA 1VJTA 4W99A 1OI7A 5IDXA 3E48A 1DIGA 2AW5A 1BVRA 2NU9A 3MOGA 2IYPA 3EMKA 3DHEA 3EHEA 1HXHA 4AJ1A 4CLRB 2DBVO 4R41A 3KO8A 1D7OA 3LT0A 2EKQA 1G0NA 4IZIA 5T8KC 1KEUA 1YQGA 4PZDA 4BGEA 3RKRA 2IYOA 4ESOA 3PIDA 3NV9A 4NHEA 4WEOA 3VC7A 5TRTA 3AI1A 2B35A 3BHIA 4D3DA 1KVUA 4BKQA 4YT8A 4DLAA 3HSKA 4J7XA 4QECA 1LUAA 1V3VA 4RF3A 3WTCA 4BNJA 4RDHA 4DL9A 4Y6PA 1XEAA 1PS0A 3TNLA 3W4KA 1JKFA 1QLHA 3CINA 2WYWA 3EDMA 4UULA 3TF5A 4KDFA 1GUYA 3H3JA 4GWKA 3LC2O 3DZKA 1QKIA 1Z7EA 2Y68A 1YVEI 3ADOA 4NMHA 2ZQZA 3OMLA 4BNXA 2GO1A 4Q3CA 4D7AA 4N5MA 1JN0A 5T57A 1IUKA 2NU6A 4ALKA 5FFFA 1RWBA 1UR5A 3LQFA 1I0ZA 3DMYA 1JVBA 1ZW1A 1NVGA 1PQPA 2O4UX 4PLHA 1NPDA 1NWCA 1VKNA 3PHIA 2HU2A 5IZCA 1FDUA 2DU8A 1KVQA 2PZKA 4MPDA 1MFZA 3WQRA 1D1TA 4BNZA 4FS3A 3B70A 2EGHA 3NGLA 2HUNA 1GFSA 1ZK4A 2YV3A 4NBWA 5DP2A 3E1KA 3V1YA 5ILOA 5H81A 1J6UA 1LDBA 2ET6A 2IEDA 4B4UA 2W90A 4YAEA 1F06A 4JP3A 3WGZA
chains in the Genus database with same CATH superfamily
5A05A 2GZRA 2XVXA 5DIFA 5E3IA 2W93A 3OF5A 3KEOA 1QRRA 3F8WA 2QVCA 4MR8B 2CLEB 3VR2D 3AB3A 3H75A 2QZZA 1ORRA 3H2IA 1AKVA 2IEYA 2ZT6A 3WFIA 2PBFA 5AVYA 1VJ5A 5EL0A 3VSBA 3ZCQA 2MYTA 4V0OA 4FCCA 4J16C 2EZ9A 1VFNA 1Y9AA 3JAKA 3ZY2A 3QHQA 3FPLA 4B85A 3LP8A 3NC1C 4EDFA 4F60A 3KQNA 1CY7A 4P2GA 3CKLA 4FZJA 1ULHA 6LDHA 4B6EA 3M6WA 3WSVA 3IA7A 1OMOA 3X2EA 2GFQA 4FPXA 2KLBA 3AVYA 5BVGB 3E22B 4ICIA 1K68A 2G1KA 2ZFUA 4LOKA 3O26A 2HSGA 2W2KB 5BVHB 2GPNA 1II8B 2FK8A 3TIGA 4EZIA 5HZKA 5DXFA 3ZKWA 4Z4GA 4Y0NA 2IYUA 3PGXA 4LWZA 4HBZA 1QHHB 1KZ1A 1RYDA 1OLUA 1SHTX 1CUXA 1GCAA 1L4KA 1P5FA 1XJ5A 3R5JA 3F46A 4GMDA 1DAGA 3RVDA 3PXDA 4LF4B 5EPOA 3TZHA 5CH8A 1S3SA 1VECA 2RGAA 2Y1DA 3OWOA 4H17A 5FHRA 5A5EA 5JFGA 2J6BA 2CL5A 3CCFA 3LNTA 4M1YA 4DEXA 1F4LA 1Y1TA 4RTOA 3DZ8A 3U3KA 3PFGA 5IT4A 1JDTA 3KUCA 3P2OA 3Q11A 2X2FA 3T0IA 4D3YA 3AETB 1IC6A 3E4DA 2JF0A 1K7EB 1DV1A 1JVSA 2AWOA 5DVZA 4CEHB 3E70C 1X7ZA 4WZAA 2N1BA 3KQWA 2QUZA 5I51A 1KOLA 3B38A 4G0XA 1EIZA 2NZVG 5G02A 3DVQX 3MC1A 3RGGA 5BQ3A 4G0VA 1CX9B 3UGKA 3BMNA 4COKA 1WX1A 1X70A 4HLUC 5BOSB 2PL5A 1VGRA 4UUMA 1JYSA 5K0TA 1GP2A 2JD2A 4E5VA 2J9GA 3SM9A 1PR1A 2RHRA 3DMNA 3H6KA 1E9CA 1C2YA 5C8XA 5J4VA 1RWWA 2H1FA 2O3JA 3EFHA 4P53A 5LKRA 1MG5A 3OCCA 1DBIA 4J94A 3X1MA 5FB3A 2Q0QA 2J4DA 5L3ZA 2GPTA 3KDPA 1FSGA 2C1XA 2NPOA 1D4AA 2BGUA 2PWBA 1H8HA 1RJ9B 3MWEA 3PHHA 3GW8A 1X14A 1ZMBA 3LWZA 3UV7A 5KYKA 4KQEA 2X8BA 3R6WA 3VU1A 4L4SA 1U8YA 4CF5A 4G1MB 1TZCA 4KGXA 3ZU5A 1LU9A 2QM8A 3VVBA 1NOKA 1II0A 4CMIB 2I9KA 1KR5A 2DECA 3RUCA 4EJ2A 3O4VA 3OQOA 3WGYA 4XFDA 4LE0A 1H6BA 1V8BA 3BDAA 2YV2A 2PFSA 2JVJA 3RC7A 3W8EA 4MP8A 4KQJA 5FNVA 2WJPA 4PFSA 3DTVD 3V9AA 3LSYA 2XCTB 2BMVA 4II3A 4QASA 3ZZMA 5AW8A 4BNVA 1OA0A 1A5BB 1G20B 1C9EA 5EIAA 2ZRNA 5DXAA 5KZMB 3DQQA 4M9QA 3I05A 4FEEA 1FRZA 3T61A 2UYCA 2PTGA 3QF4A 1ULTA 4NZMA 5ALOA 2W8ZA 5C8DA 3WYNA 2CMHA 5C52B 4L57A 1A9QA 3U1TA 1ZIXA 1VPLA 1UEXC 3F3YA 4GZ5A 4FBGA 4ALNA 1KS2A 3T7CA 3TECE 4GBJA 1SXHA 5K7SA 4ZQHA 1EA5A 2P6OA 3QBVA 3KYCA 3A1VA 1XJQA 5KTPA 3CVWA 4IDQA 2C9YA 3ZWQA 4LCBA 5JSZB 3R5XA 1R4ZA 3O8DA 2AFRA 2YVQA 4IRXA 4V0MA 4XAQA 3FETA 3K6SB 3VNVA 1JHQA 5AQ1A 2UYQA 2F2TA 1FUEA 4GKAA 3M6XA 2ZJOA 1CVLA 5ECYA 4OQDA 1P3DA 2DG2A 2XQVA 4LYGA 2BM9A 5G3ZA 4KQKA 3HM9A 1HTBA 3AR2A 3OU6A 4EWLA 3ES9A 1ZK3A 1OAAA 1ZYUA 2JEOA 3IPAA 5A06A 4K9NA 1ZDMA 1YI1A 4MZDA 1F8FA 3AZPA 1LJ8A 5I9MA 1U0BB 4UHDA 2BH2A 3ZBTA 4DDMA 2WJHA 3PXXA 1GZUA 4BFWA 5IJ0A 1LPPA 4AWAA 2CHGA 4IXWA 4JVSB 3CNOA 2GDZA 1KO8A 1DX4A 3JVUA 3OVMA 3ZU4A 3MSXA 2R1TB 3C87A 3CBGA 1XYVA 4IUCS 5D3MB 3N2GA 2SHKA 1NXSA 2LKDA 1EG2A 4P4TA 2RGRA 2WNIA 5KOYA 1A96A 3U6KA 1LSOA 5DHQA 3KPWA 1W5BA 4I1VA 2X8JB 3PZBA 3HHEA 4PQGA 2BRUC 4UVEA 3RGWS 4YMTA 4KXUA 2VEOA 3RUPA 1AUVA 3LOQA 2VDWB 1TT5A 2ZE8A 4AYWA 4LVOA 4DVGA 1QYWA 1Y7PA 1IE3A 4OUDB 3W6OA 3ZV4A 5SYAA 2CGEA 1CJBA 1IXZA 3RRFA 1N9GA 1QO9A 1H94A 3ZV7A 3FM9A 4YO8A 2JPDA 4DADA 1NHGA 3LHDA 1VFPA 5KSZA 1FJGB 4GL4A 3NBYC 3IKLA 4AZ0A 2ACVA 1FNCA 1EWTA 1XLWA 3HQ4O 4OM8A 4RD0A 4UNSA 5I9TA 7GPBA 3RSSA 2O9JA 3GRUA 3HA2A 1XTZA 2VI5A 3I8OA 2WQ7A 1QH1B 1SQGA 3CUKA 3ED5A 2G7MC 3GJ6A 3DMDA 4IDAA 2QPLA 2X0DA 1PYGA 3KT0A 4A8JA 1P6QA 3QXJA 1E8MA 4UHCA 2XA2A 1JAIA 3GD7A 2WRZA 1HT0A 3IHWA 1G21B 4XWAA 3VTFA 4J0HA 5AVRA 5L7TA 4LK2A 4FM9A 2GERA 4JASB 3NTLA 2JIZA 2J5RA 2OO5C 3QXXA 3AUJB 3L49A 1DJNA 4RLFA 5EUBA 4YN3A 2J9XB 1JF8A 1TKRA 3IQWA 4JBHA 3E05A 3OQIB 1SXJE 2NSYA 3Q41A 3BRCA 2WUVA 3RKSA 3TZCA 1QDUA 1H22A 1I4EB 1SNYA 4RGBA 4NG4A 1EDBA 2RIPA 4QGBA 2OAGA 2YH2A 5KBYA 1H66A 4RGVA 1GLNA 3OJOA 3D0RA 2W8BA 1Q1NA 3D5EA 3OEHA 4FSXA 3F0TA 3JPYA 3TNDA 3PFHA 4CM4A 3MCUA 1QGDA 2O0MA 4HTAA 5FBZA 5G1PA 4AK9A 4C4SA 2ZPTX 2WJAA 5IWCA 1G2IA 4G1CA 1PQUA 1JFFA 2IY9A 2A14A 2Q7XA 4XGKA 3G6KA 5KCMA 1KE2A 4QYSA 1FJ2A 2O7RA 3KXLA 4H3SA 1BKDR 3FWYA 3C3BA 2Y1XA 2NP7A 1AUPA 3O38A 4UCWA 4NPAA 4UBKA 2O5EA 2CB0A 2JCBA 2RDMA 5FPTA 4J07A 5L4SA 1YBHA 2ZM5A 1XPUA 3IXQA 3W5VA 1Z4LA 2IS6A 4FUQA 4AKHA 3F5MA 2FEPA 2JIPA 5BSKA 4GI3A 1NJ8A 2KX7A 1ACLA 4M36A 2JHGA 4G5QA 2AUNA 4X94A 5EJ5A 3TDMA 3DV9A 2PKRA 4ZREA 1HYQA 2I34A 4QQRA 3BGWA 3ZQUA 4DEYA 2QEQA 3GLKA 3Q7EA 4KHPB 3RYIB 3R5SA 2G5TA 3KR0A 1YGPA 5AP9A 2HLPA 4KW7A 8LDHA 5C8YA 3OCYA 3KSDO 3L6OO 4LRQA 2BT4A 1P8JA 4LXUA 3ICEA 3ETNA 3M83A 5SYMA 3MT0A 1JFRA 3B6MA 3V33A 1QDEA 3K15A 1OI3A 2FH5B 2P3QA 1V0JA 1WPGA 2C9DA 2QX8A 2WJ4A 4ONEA 3A1TA 2CZGA 1W59A 3DSRA 3RROA 3VR5D 5CG2A 8MHTA 1NN3A 2ODWA 1ZINA 3HXPA 4QAQA 1L4EA 5K9ZA 5K3CA 4JT2A 1R18A 1KDYA 3QFRA 2WZDA 1F1JA 2TMGA 3D81A 4XIGS 4BV8A 1FP7A 4MAAA 5FO1A 4D3FA 3NANA 1GTZA 1OE0A 4G97A 1J8FA 1R0YA 1XIVA 5HX7A 4F46A 1Z4KA 5B2ZA 4N48A 1EP1B 5BNZA 2FEKA 1M6YA 4ID9A 3R4VA 2VZLA 2ZU6A 4Y7DA 1YUNA 1EINA 3DWIA 4Z3DA 5BSFA 4MICA 1V5EA 3HJHA 3CEAA 4YRZA 4RXUA 2Z4RA 1K6XA 3TOCA 4G0OA 2MSLA 2ZQ5A 4G09A 4K9LA 4A1OA 2WSSA 5KJFA 1THZA 3WDMA 2Q0HA 2W6IA 2L42A 3EG9A 1O96B 3HSYA 3GZNB 4TOIA 4EQZA 4DWVA 4RENA 2OFPA 3FROA 5IEBA 3WLFA 1DU4A 4RA6B 3CG4A 1NQOA 5CYGA 5IC4A 4KXNA 1Q0QA 1P33A 3DBHB 5ALHA 1E0DA 2ZVJA 2ZP1A 1OJLA 5GM2A 1KK0A 4GSYA 2PLWA 1QP4A 1K86A 1GLGA 2AX3A 2P4UA 3AFIA 1XB2A 4TVSA 2FUG1 2V8OA 3V1LA 4J7CA 3VSDA 3HJUA 1DC5A 1XN1A 3G2NA 1FDWA 2ZSJA 2PGDA 2F8LA 2A5DA 4EUKA 1E9VA 2IW3A 4C78A 1EVYA 2QW0X 4KHZA 2O14A 3K8YA 4ZYXA 1G6OA 1AGRA 1E6EA 5SZKB 3AHFA 3ZDBA 4MQUA 4DUZB 1T9HA 4RFSB 4WN3A 4NENB 3GLIB 2R3SA 1T26A 3G8DA 3P9YA 5DWVA 3C3KA 1H6AA 4K8OA 4RNDB 4Z4FA 1KAQA 1MOSA 1MENA 3DMTA 4LQLA 4V02A 4Z9YA 4CQMB 1T2EA 5LA6A 3FTEA 4Z5XA 2F62A 3PHGA 4XWYA 2AL7A 2JI6A 2R5FA 1NXQA 1DRVA 3VI3B 1SBHA 2INGX 2UUOA 4CYMA 1RAFA 4HNAA 4O2BA 4ZALA 3ROKA 3ZK9A 4KE8A 2QD2A 1T2NA 1HNXB 5DSZA 2NZXA 2ZU0C 3B89A 3J7TA 1R5NA 3RKUA 2XYQA 2PS1A 3OCUA 1JBEA 1MW9X 4FGZA 1QO0A 4FEGA 4Y98A 5F4BA 3I64A 4D4JA 4NZNA 2ASVA 1T0UA 5FR1A 1YZHA 2YWDA 4FKBA 3P2EA 1DKLA 3ZNPA 1Y7TA 1YWGO 1K75A 1TKCA 4MNTA 4J8PA 1GKYA 3NOVA 2AJ8A 2BFPA 4NYJQ 2A3NA 4JYCA 4PN3A 2GB4A 2XECA 3SSNA 3LUFA 1A04A 2V7BA 2IDJA 1JECA 2EDCA 2RG1A 3DLTA 1C0IA 1W9MA 5EINA 4JH0A 4BTLA 4EK9A 4O4LF 4YRDA 3SKYA 2P0EA 3HYNA 1CVRA 1WTCA 5F5XA 2AJCA 3E9CA 2WU3A 3NVDA 4XEHA 5DI3A 3ZIAD 2R6JA 3EBLA 1R3UA 4PC7A 4Z4QA 3SDBA 3J80A 4MQ6A 1B8VA 5P21A 5BP7A 3BL5A 1G8GA 1X7WA 1ZOOA 2J46A 2GCGA 5AM1A 3MSCA 4Y7CA 4AECA 3SEFA 1NZFA 2IXTA 1X9GA 3L0CA 2ZYIA 4EYQA 4BE4A 4MEBA 4UOZA 5CURA 1CQIB 2QYSA 1AUQA 4DY4A 1Y6GA 4XLLA 3JZMA 3TCXB 3AEXA 2BR4A 2V7VA 3ABSB 1J2TA 1FTWA 3GPBA 4L5YA 2GO7A 4ZCMA 3KFVA 4JEIA 1Y4ZA 4Z8YA 2FVYA 3NV7A 1BRTA 3D64A 5FEMA 3HP7A 3S5UA 4K9MA 4NSNA 4AG6A 1RWNA 3G85A 3QITA 4JP1A 1X9IA 3ANLA 2ZWAA 1TQ4A 2ZE6A 2VZ0A 1QF7A 1XRQA 3UHAA 4P82A 2XRFA 1FIUA 4ZVSA 1GN9A 1QFJA 3CTMA 3DNFA 2W9XA 3ESCA 1EG7A 5BSRA 2IH2A 2H1LA 1X8JA 4WK2B 1CJVC 5SICE 2PA0A 2C4WA 3SFVA 1O97C 2G04A 3REQB 1WMAA 3JQGB 3MCVA 2ZIEA 3I34X 4I50B 3WRYC 3GFVA 3VVLA 3KE9A 1WZUA 4FFOA 1GM5A 3P9RA 2RGCA 3MELA 2PT5A 8OHMA 5CEEA 3WR5A 2WV7A 3M2TA 2EG5A 3C1UA 2ZJAA 4UATA 4YRBA 2FU5C 2RK3A 3C16C 4TWJA 5GJCA 4IOLA 1G3UA 1EBUA 2BGIA 3CRNA 3HFJA 3FHJA 4OJMX 2HOQA 5BWOA 3VR4A 1MB2A 1U0GA 2ZRPA 4X24A 3S70A 1DG1G 5KKNB 3EX7C 2R79A 4YCBA 3AG6A 3TX6A 4CUZA 1I7LA 5ELMA 3WHKA 2O3TA 5DISB 4PYNA 4G9EA 2IHJA 2Q4TA 2XUAA 1FNSA 2H52A 2IYAA 3R3YA 3C3XA 3E7XA 3OX2A 4G41A 4OI1A 2AXQA 2B36A 3TSCA 2Q99A 4YT5A 2VJOA 3WK7A 1IIBA 3G8CA 1AA9A 2UZIR 3GUHA 2QUJA 4P3OA 2HUPA 3L4BC 1IXYA 4RAOA 1LWOA 1XKQA 2P65A 3NTXA 4J1QA 4MR9B 3QOXA 4IO1A 4JZYA 2OKGA 4XM2A 4YP0A 3SM3A 1UM9B 2ZIUB 2P7IA 2VR1A 5SZHB 5KYYB 2X8LA 3KSZO 4BZZA 1ZA1A 2OC4A 1R4NA 2QUHA 3SLRA 3CZCA 3RFTA 4BFYA 3WLAA 2WLTA 4II2A 5CIYA 4IINA 4JI8B 1WSDA 4KAFA 4J49A 4D8YA 2P8JA 2V7GA 3CH5A 3L0DA 3S99A 4AZ0B 2P9GA 2VQEB 3ZGXA 1M66A 3E8MA 5IAOA 4WY8A 3WGNA 2DQYA 4RWEA 5BV2P 2QB5A 3GDGA 4OGLA 2FCRA 1I7SB 3KALA 4NX2A 3UUEA 4GI2A 3UENA 3VR4D 3RS2A 1S9HA 5KQMA 2VP4A 3QVGA 3VPBA 4WZZA 2EBUA 2P79A 3AUYA 2UXDB 4Q9LA 1FTYA 3EUWA 5ALJA 2FHPA 3SDZA 1K8QA 2PX4A 3FUWA 1AS0A 1RMYA 2FX3A 2L19A 2QRQA 4GWGA 4R6XA 2IYWA 1PV1A 1RBYA 2IYFA 1FP6A 2CYAA 2FR1A 4TN1A 4I3GA 1S2GA 2DC1A 4XB1A 4JLJA 5CDUA 3LJKA 3N2EA 1FDIA 3UCXA 4PZUA 2JFPA 5IJZA 2GK3A 3SQLA 4KWIA 3TJMA 4CHTA 4RVGA 1IXRC 3L6EA 4Z1OA 2Z98A 2HGSA 1FFEA 1QWSA 1ZIDA 5HOQA 3A2KA 3E8XA 2WTEA 3IE2A 3NBAA 3V6MA 4Z7JA 4ARUA 1SKMA 3W7VA 3VO8A 2AUTA 4DABA 4DMGA 2QWXA 4X84A 4LV5B 1L7NA 2O8CA 2QQFA 3W6NA 3HABA 3MCTA 1USUA 4U7DA 1HEUA 4PLPA 1QZ3A 1QG2A 3JU3A 3COPA 3QKRB 3UAGA 1VJ1A 4MS3B 4OMUA 1JXOA 3LLVA 3K70D 2WVAA 2FRDA 4RA9B 4RTLA 5DTMA 5JVDF 1AXGA 1JG3A 2IITA 2BFBA 4KQ2A 5LD2C 3USES 1NX6A 2CLCX 1WHTA 5AWFC 3S1AA 3EBOA 3H84A 2EF0A 4HWOA 4LQ4A 1Z5NA 3LDHA 4D9JA 1WMSA 3O9MA 2L18A 2W0SA 1SOAA 2G08A 4RZ3A 5ALNA 3IOBA 2J31A 3O2NA 3BS4A 3CUVA 2K7ZA 1NXOA 3O73A 4MH0R 1B6RA 2BFNA 4MIYA 2FW6A 2XWSA 2HM7A 1P4JA 2JZNA 3G88A 4I36A 4JD5A 3DWFA 4RGQA 2WWHA 4O0LA 1L7MA 4UHEA 3RYHA 3UEOA 1NBWB 3BH0A 1GG9A 3ENKA 2WD7A 2F7SA 2C0CA 4C7MA 4JLWA 2HMVA 2YWJA 3CXRA 1EHCA 1N0UA 2QX7A 1S1CA 4OL0A 3U62A 3KSRA 2GPAA 1BO6A 4B84A 4BQPA 1Q91A 5AW2A 2XSZD 4LBVA 1XNGA 1XZHA 3PQ6A 4AJ2A 4UTPA 3S4YA 1MD9A 1ZQ1A 4L0CA 1T8PA 2C42A 1YACA 1N4AA 3GQBB 2XKKA 4X6LA 3VMFA 3OF3A 1U99A 2CJXA 2JIQA 4YDSA 4ZAGA 3H2JA 4A0QA 5J58A 4ZEVA 3ETLA 2JLRA 1MQ8B 2PUHA 1E1RA 3U44A 4QBIA 1W49A 1SXJD 4OQEA 1NJGA 2AH5A 3WGLA 4C1NA 3BBLA 4GGMX 2WSSD 1IOZA 3FPBA 4GMKA 5CVJA 4YR9A 1U3UA 1YS4A 2IPXA 1QSGA 1PSDA 2QJOA 3LV8A 3N0WA 3N8GA 3ZHQA 4F4JA 3HXOA 5C3MA 1LSUA 5DYIA 4YMIA 4LTMA 1GG2A 3GEMA 3GIDA 5JANA 5KNLA 3HLYA 4MVYA 1QIHA 3TUJC 3OJ0A 4BASA 3WLKX 3USCS 3T5PA 4OQQA 3IKVA 3DL4A 4DY6A 2GKOA 4LOHA 1FMCA 2A7XA 3OE7A 2ZUTA 4OHBA 1SKBA 4ALJA 4WXHA 4WBNA 2P6PA 2FUKA 5PGMA 5CNIA 5AOAA 5T4HA 1SCUB 2VP3A 2XQKA 2OCGA 4UPDA 1N25A 3Q9UA 5DT2A 3C1AA 4L3WA 5ER9A 3D59A 4S05A 1I8TA 2VOJA 2AEJA 3UG7A 5TARA 4JYZA 1P4AA 1E0SA 2J0SA 1QQAA 3RK4A 4R7TA 6PFKA 4BFZA 3ESDA 3L7IA 4GH5A 4KYVA 3I61A 4ID3A 1UOPA 1Z4JA 2WTXA 1QRAA 4LSZA 3VJLA 4CM6A 5BWBA 4JQZA 2G1AA 2CFRA 2IXGA 4X9XA 2VTDA 5DBHX 4B0OA 3JY6A 4HRAA 5C32A 2VH1A 1YZKA 1WB5A 2OAEA 4HF7A 1AV6A 1KYVA 1FYEA 3D8NA 3DBRB 4F5DA 1HDRA 3W6UA 3B1VA 5F1OA 3JVDA 4FGWA 3SQXA 3WL4A 2D13A 5CT6A 3ZHZA 3VU0A 4WKOA 4D82A 1OLUB 1SKYB 3NEJA 4IP0A 2EJTA 1X1SA 1ESEA 3MJSA 5E6RA 1GUFA 5DBIA 3TD9A 4NMLA 1ISJA 2JBAA 3BMXA 1ISRA 2VJNA 1XTBA 1XU4A 1FDOA 1YB2A 2DETA 4ECEA 1XNRB 1E4YA 3ZXSA 1RCFA 3OLZA 3PJEA 2FSHA 4I8IA 1X1QA 2VDLB 1R88A 2O05A 5JJKA 4I7EA 1M74A 1KFJB 2A9OA 2X5KO 4RSHA 4JC8A 4MW9A 2R7NA 3OPQA 4FLFA 4QWWA 1YHZA 3T9DA 4JJGA 4GLOA 1CUIA 4S1VA 1ADBA 5DU2A 4DBLE 3PXAA 1Y8RA 3CVVA 4RPLA 1NNUA 2D2FA 3OLVA 4PRLA 3AU9A 5EHIA 1Y82A 4KIUA 3MQ4A 3OZXA 3T5TA 3GY0A 1Z6TA 3PD7A 3I0MA 5E7QA 1TUBB 1RU3A 1B43A 5AVSA 3BXXA 1ODIA 1X42A 4TTVA 2W98A 4GR9A 1B1AA 4G65A 4ZYZA 5I8WA 5GVSA 2ATCA 4ZVVA 5K03A 2I66A 1O6GA 1FFHA 5FKJA 4MLDA 3FUVA 1J2JA 4CIYA 1D2RA 3QNWA 3HJNA 4ZEWA 3SEZA 1R12A 4MW6A 1M8FA 3DZDA 3WBBA 2ECKA 1OI4A 4QEDA 1C7ZA 1F2UB 3B1KA 2V74B 4UBOA 2HSJA 2AOXA 1FFBA 2FETA 5EPUA 1AMUA 3ABIA 3K05A 5DM1A 1WZIA 4L8GA 4ROTA 4E03A 4M54A 1ZEJA 2XE4A 3H18A 3I76A 4A10A 3GGGA 2XHEA 1O5OA 1R3DA 5GONB 4BZPA 4MP6A 2HQBA 2O1SA 4H31A 1OAKA 2X41A 3ESYA 3CCCA 4J7UA 2Y0CA 2OENG 3IHTA 4WFQA 2VAXA 4OH1A 1NU8A 2I5PO 2QY6A 4XA8A 3T06B 3WDLA 1GSOA 5A9RA 5IM4F 2VAWA 4RD3A 3DLAA 3GEEA 3ICOA 4IG4A 4S1NA 4D74A 4B46A 3IP9A 3TAHA 5CLGA 4PW0A 2W4IA 4KRGA 1CS4C 4Q02A 2FDRA 2B4TO 1AKTA 1ZM9A 3UJCA 2GH1A 4XGIA 3UK6A 4C7OA 4KUHA 1DJLA 3PKJA 1BEEA 4TYWA 2YWEA 3BWMA 4CUJA 1QOZA 3H5VA 3DV0B 6REQA 5GONF 3CIOA 3JYNA 4C43A 1AB5A 1U4NA 1HK7A 2CDRA 1ISIA 2H16A 4XQEA 1E8NA 1GRCA 4RD6A 3RVMA 1ES9A 4WXRA 4B83A 1L7AA 2P2SA 4EEZA 4GC9A 1Y8ZA 1OFUA 4IKPA 1OZ0A 5CLLA 4LZNA 4AY3A 2FOIA 2QRJA 2QGNA 4MQEA 4KO3S 2YHBA 3DVLA 1JA1A 5FA6A 2P4QA 4FHGA 4OHMA 3I09A 4IDNA 2WYOA 3PU6A 3ZGYA 2SCUA 3QLEA 4TZTA 3TOZA 2WPDA 1ZGBA 2GK7A 3I83A 4RXTA 4YCSA 4FDMA 1X92A 1RIIA 1B7GO 1SM4A 4HDNB 4HYEA 1GWNA 5DNAA 2X13A 1RXCA 4IVPA 4KN9S 1EZ1A 1ZMOA 2CXHA 3B7GA 3T7DA 3TLMA 5KO2A 2GRUA 2YDXA 3H3FA 4JODA 3A4NA 3DE3X 3WICA 1DGQA 3TD6A 1P60A 3MT9A 4C9BA 1HI9A 3GLGE 4YNBA 5AHWA 3DZBA 5I7FA 5A9SB 3C5EA 4U39A 1YZQA 1X19A 4G1EB 4FYXA 4CM1A 4AN1A 2X9VA 1OD6A 1GYRA 3R76A 1JR3A 3VR3A 3VKVA 2YXLA 5G1NA 4CIXA 5TJHA 1I10A 1NG1A 3I2IA 2GXUA 1O03A 2X42A 3PRJA 4WA7A 3RTBA 2H54A 2H92A 3SC2A 1IULA 4WNAB 1Q74A 3NIBA 2YZNA 4UDXX 3V2HA 1SH7A 2DY1A 2ZI4A 3VOTA 3LHSA 3P2IA 5DCWA 2GZ2A 4TSKA 2WSMA 5KTRA 5IJ9A 1LX6A 1CYDA 3ACDA 2IHKA 1R6XA 4RHCA 1SWVA 1PJQA 3A6FA 3R3HA 1CJTC 1XAIA 1V7PC 4NWIA 2B1GA 2DR0A 3E9ZA 3K8QA 4C0JA 1O4VA 2IZ1A 3JQ9A 4NEGA 3I12A 3IMFA 4GZ6A 4WKPA 1F6BA 2Z04A 3BF7A 3RAPR 4IMRA 2Y66A 3W2FA 4RO0A 4Q12A 2OO5A 3AIMA 4ZZIA 2RJNA 4MWEA 5F3DA 1Z0IA 4F12A 2ZUBA 4ZEXA 2FEAA 1DOHA 1V4BA 1GYPA 2VCHA 4TV9A 3PHCA 3UC9A 1WBJB 3IJRA 4QUAA 5CG1A 1HF3A 2XA9A 4D4LA 4GOLD 1KEPA 1QAOA 4FX2A 2Y77A 1BHSA 1WRBA 4RPGA 2VP9A 4JL6A 3VTKA 1TCBA 4QGGA 3V80A 1KKUA 1EM6A 3F5DA 2ZB3A 4BCDA 2PUBA 1FX0B 3BWYA 5IULC 1KSGA 2O8EA 4Q3DA 3NKFA 5FBRB 1AQNA 3NM4A 4QU8A 3SSMA 4EL5A 3L0PA 3HY4A 3TAUA 4LJ4A 3EZYA 2ZI9A 1FTQA 3E58A 1T9GR 3UHPA 1XVAA 3B78A 3D8BA 5C7YA 2IL1A 3LWBA 3W06A 3E5MA 1ZR2A 5FPPA 5T41A 5BNWA 2WKQA 1W75A 2HWKA 4PLZA 4R1NA 3UB3A 4KQWA 3BJRA 4QJ3A 1QK3A 4GOKA 4NEQA 4KC0A 4REQB 3ZGOA 2A9VA 5JZ9A 3TGPA 5D84A 3NAMA 3PGKA 3E2IA 3R7FA 1TFUA 4ZOLA 4EATA 2E87A 5A62A 5U4XA 2DWPA 2OOSA 3BTUA 3G23A 3TTUA 1ZLYA 2C5BA 2A0XA 3L43A 4EHAA 4R5MA 5BUCA 4KR0A 4B6PA 5HCIA 4A26A 1R0WA 1PHPA 3PC8A 1M6HA 4YAKA 5INTA 4LFBB 1IAQA 1N2CE 4TLCA 4BLUA 4X7BA 3BT7A 1TVEA 5FTWA 4KR2A 4EYSA 3CA8A 3PHJA 3S0JA 4EMTA 3ZZTA 3FHCB 3M1AA 3OE4A 3LW8A 1XEXB 3F3MA 4FYMA 2ERXA 4OXYA 5TC4A 5KOHB 3UFXA 3SZRA 1UANA 2V6IA 1E18A 1ORWA 1Z36A 1NRIA 1OX6A 2AD1A 3VBEA 4RTMA 3D2LA 3GJ5A 4HDCA 4XXHA 5TPZD 4HAWA 2R7MA 4MLCA 5I9SA 3P9CA 3CUSA 2RSLA 5EKDA 3MOSA 4Q4JB 2QXUA 4LF7B 4FK8A 4YA6A 3JASB 5EXDA 2ZIVB 1KDVA 1PJZA 4QNRA 1OB2A 4PHCA 1EXWA 3AL3A 1PJSA 5DNCA 3O1LA 3JQFA 4ZRDA 3DTTA 2P3SA 2VJYA 4RHXA 1FUUA 3JWHA 4X0EA 5G41A 4I4TA 2XVYA 3SHVA 4DLBA 3W5JA 3G9TA 4CGZA 3JWGA 5K01A 1M33A 1X74A 3QJGA 3HPQA 3MWDB 4LXQA 4YLGA 3WX0A 4PTLA 3L0SA 4W9NA 4QEZA 4TLAA 3HXMA 5K51A 3GH1A 5EP2A 4MKRA 1BCRA 1R9MA 1KEKA 2ZUEA 4GT1A 1Z68A 3I5AA 4K0KB 4P7KA 2DGDA 5BURA 3MJRA 4RAQA 4WBNF 4BRSA 1G9SA 2QUAA 2VPYA 1F17A 2YWXA 4NJEB 1ARZA 1W34A 5FYQA 3OSZA 3JAMA 1I3LA 3R3WA 3NUQA 1WUKS 4RE5A 2Z9CA 4BN4A 5HJ5A 2C7RA 1GTSA 2HEGA 3EQ2A 2BKEA 1A27A 4AUNA 1C81A 4K9OA 4K40A 1EFPB 4HDOB 5C5DA 1TZMA 5F33A 2HXGA 4NQZA 4B3GA 3HUFA 3M3PA 3TQQA 2O2YA 4A4DA 2TMYA 2A5JA 3KLPX 3RRYA 1R9GA 1NONA 3N6VA 1JSXA 4PZZA 5I5GA 1NVMB 2RHJA 4GVLA 1P1HA 1ZU4A 2FQYA 2ZS7A 5IKEA 4RIEA 1DSSG 4KEAA 4LYAA 5KWVA 3NM6B 5HKLA 2ZJYA 3JSXA 4P8RA 1XRSB 3S6JA 1IZ7A 1HEIA 2DFVA 1SAYA 3DW3X 2X9GA 4JUCA 4ERNA 5ADWA 1WEHA 3ONWA 1NLZA 3GJ8A 4PCAA 2DZDA 1E99A 5AJVB 2IX3A 5AW3A 3OWHA 4R1OA 1QRDA 2DQZA 1VE9A 2JI7A 1V4NA 2O8EB 4YRJA 1IEXA 4CPDA 5HUHA 4YCDA 3UJNA 2E2WA 2H4XA 5DLDA 3IHKA 1EFTA 5JAQA 4KQIA 3QYJA 2CCJA 1JL3A 1DWUA 3B2QA 3DDCA 2CL0X 1J97A 1NBMA 1SZPA 4JGIA 1XCBA 5AXDA 1Z4QA 2G9UA 3MWLA 2W42A 4HXYA 4D5EA 3KTDA 2Q45A 3RK1A 4AS2A 2JZCA 3HEBA 5CFPA 1QO7A 1FLAA 3C43A 1B3RA 4Q19A 4RTQA 4POOA 3KAQA 1JEEA 2ADMA 2CLSA 4EHNA 1UUFA 1Y6QA 3QTLA 2PH7A 1RPAA 1ADJA 1L4NA 1XTTA 3DFKA 3H1BA 3STTA 4KPGA 1HV8A 1YAJA 2H06A 2P6MA 2SCUB 1PJ8A 4PSVA 4DLUA 1QGUB 1W581 1F5SA 1Z6PA 4RKEA 1QIEA 1XMQB 5JSQA 5HOEA 2UVPB 4WDRA 3SKXA 1P39A 3EOAI 1TK9A 3KHKA 3KZ1E 3PGJA 2PX0A 3HU5A 4F1KA 1U1DA 3ZW7A 5JRZA 1O5TA 2ID8A 2Z4SA 1N6HA 1R74A 4YRAA 1NW4A 2B1QA 2HY7A 4DTIA 1AF7A 1F3OA 1YA6A 3GRRA 1RDFA 1U5BB 1T4DA 4GZ3A 3O8QB 4QOIA 3LE8A 3Q0EA 4I6JA 4OLHA 2E4YA 1HETA 4NHOA 3PXEA 5CD9A 4HR7A 6CHYA 5TLSA 2H0QA 4PLWA 1DIHA 4Y3UA 4TL7A 1KVSA 4YRCA 5AXCA 2ZSFA 1XBTA 2P2ZA 5DEIA 1TJPB 4D9BA 4ZFNA 1L3CA 3OOHA 1ZRHA 2JANA 3HL4A 4I0WB 1O6CA 2QN1A 4Z0PA 4KO8A 3QSYA 1W1IA 1NTOA 5D85A 1UXOA 4XD7A 5J1TB 1JRLA 2WJVA 2PZ8A 3T3MB 3KDSE 3VTZA 4CLEA 3O3NB 4S0ZA 3QKSA 2FPMA 1S89A 1JXAA 1QWOA 2WWRA 4FEYA 3B3FA 2OV3A 4R98A 5K05A 4PHGA 2C2MA 3ESRA 4XSGA 2CLOB 1X1CA 3RRXA 4FMDF 1CY8A 1Y1KE 3G2KA 2OGZA 2TYSB 4UQOA 3THYA 3RHZA 3HJBA 1JE0A 3AQ4A 5JE8A 3AYZB 3JVVA 4M1EA 3ZHBA 1AVTA 4N3GA 3AR5A 1FFWA 2FLVA 2HA6A 2CVQA 3NHBA 3ZJYA 4HFJA 3R9WA 3ORYA 1E7YA 1CCWA 1RYBA 1U7UA 2D54A 1E3EA 2P9FA 1QE0A 2W2LD 4P08A 5DTEA 2FZWA 5H9VA 3WMFA 1ZW6A 3CLTD 2FNAA 4IQFA 2JCVA 1YL7A 4NC9A 1NBHA 1JKJB 3ZEIA 4NMMA 3CC8A 5FCDA 2JLWA 2Q1XA 4DM4A 4ZI3A 1I3NA 1N1GA 2YOFA 3L8DA 1UBFA 2WR8A 1JT9A 3U4GA 3GOHA 3TVTA 1FU7A 3V7WA 1NNSA 2G83A 2Q1TA 4E7OA 1S5PA 1IDOA 4FOPA 3FMFA 5BSUA 3KSBC 4IXMA 1BWQA 1YO6A 1V16A 4URWR 4YQYA 3Q3VA 5LLSA 2WIAA 1NURA 1C0LA 2C9MA 2JFUA 4MUEA 1UBTS 5D00A 3RVJA 2GM4A 2VVTA 1RAIA 5B6IA 5BN3A 2XYHA 1OFGA 5BNFA 4G07A 1QH9A 2JJ2D 4QWMA 5KHAA 4KQCA 2PNJA 4AC9A 4RPCA 2O8BA 1Q0TA 3R41A 4JSYA 1EGVB 3FX2A 3QHAA 5K8UA 1GRRA 3GFPA 2G72A 3ZV5A 5EP3A 3BE5A 3Q7TA 1RQGA 4HADA 2JLUA 5E2AA 3HRHA 3N76A 1NN0A 3IRVA 5KNDH 1TM7E 2FMUA 3UGTA 4NBNA 5F76A 1QHYA 3CM0A 6GPBA 4TXJA 1BXKA 1G59A 3WJ7A 2HIMA 3E9QA 5KU7A 3OZCA 4IBOA 4ML3A 1OIVA 1GEGA 2LGJA 5T67A 1YDFA 1F8UA 2G6TA 4YT2A 2XR1A 1DIOB 1WULS 4PHTA 3ANXA 3O92A 3QXHA 4F4FA 5ALPA 3BCHA 3EZ2A 4QKQA 3IL2A 4URZR 3UKOA 1ZH2A 2C8LA 1D1PA 1PAUA 3N2KA 3HEMA 1C4KA 4U2GA 4X1OA 1C8LA 4UXIA 3S1LA 1XKLA 2WFLB 1P2GA 3IO3A 2GLTA 3B20A 5KAMA 2WKRA 2YWHA 1RE0A 3KTFA 2QE7D 2O0KA 4GRIA 4B32A 4GLJA 2IZOA 3ACBA 5F21A 1GPAA 3E9NA 3ZS9A 1UDBA 3FDZB 3K96A 3NT4A 5DCLA 1Z3IX 1BHO1 2AF3C 2LDXA 3BIWA 5DLYA 5ALGA 4AKSA 1KDTA 4LUCA 3V3TA 2IV7A 3FPHA 5ICEA 3SQOA 2R1VB 3H9BA 5JSFA 3H2YA 5BR4A 1AZWA 5LXTF 3IQZA 4D4MA 5CCXA 1M2GA 4QUJA 1C1YA 5JXHA 1RQXA 2WIDA 1GY8A 2VSYA 3OHSX 3RHSA 5EUQB 5I4BA 1F38A 1QH0A 3NI2A 2OHVA 3Q3GE 1KMMA 4MVJF 4DZTA 1JWAB 2BEVA 2XCIA 2G1UA 3A1SA 4M46A 3TL6A 5KCZA 4M8LA 4CM3A 4G3XA 1IY8A 3WQBA 3P2MA 3GOQA 3R74A 1WXXA 1GARA 3PK0A 4RHFA 2QXYA 4DA7A 4L9AA 4EHDA 5AMXA 1U3TA 1SXIA 3FPGA 2WBLC 2FSVA 3AL2A 2SICE 1N6IA 2XNJA 3COYA 5E6RB 1NHWA 1RSZA 2RAFA 4UTXA 3QVGB 3L7YA 3ZJ5A 1YFJA 1SG9A 2ZBEA 3MCWA 1R5JA 1WXGA 3MUOA 4TTAA 3THRA 2H8KA 1FNNA 1MQAA 3LYLA 4JHLA 3DLPX 1SU6A 1AXRA 1CTQA 1DO0A 4BU1A 1RBQA 4ZA2A 3IPCA 4TWAA 1DRUA 1A4RA 3AF0A 3OD5A 2W2NA 1L4FA 3MGKA 2GAIA 3OCWA 3D8HA 1K0FA 3EWSA 3KBBA 4FYYA 4MWCA 3BYZA 3IV7A 2JDIA 1R4NB 1PR4A 2P30A 4WAUA 4E09A 4UOQA 3KD2A 4EFDA 2FXVA 5KTSA 4HFRA 3UXYA 1E3QA 1AHNA 4D81A 3M81A 3DEHA 3JPWA 1VTKA 2OILA 2C3OA 4Y9DA 3GDHA 3Q9SA 1UKEA 3Q8LA 4RL6A 3KJZA 1T5HX 1TUEA 1UDCA 4R1SA 1T2FA 3FDJA 2HLHA 5A4IS 3HDTA 3ZW9A 5ITZA 2JGIA 4MYRA 4NS4A 4X97A 1VPWA 2NO5A 3TM5A 4UZEA 2VHZA 5CXSA 2XDQA 4CU5A 2GZHA 1CETA 5AQEA 4M8KA 2E9SA 4KN8A 2ZZMA 3HVIA 1QONA 2AK2A 5YASA 3SZUA 4BFXA 4XWWA 1LS6A 2Q2WA 2ROQA 4D4IA 1GVNB 3ERCA 5JISA 3QLTA 4OK3A 3RQIA 1U9IA 2IHNA 2PSFA 3SK0A 2Q7DA 3EDYA 5JECA 1KO4A 4FFNA 1CZRA 1YOBA 1Z45A 3KR9A 4YROA 1WO8A 2AC4A 2VDUE 3T0GA 1E7WA 1EA7A 1A7AA 1BEZA 1RWVA 4MCAA 3ZDFA 1A9XA 2ZEJA 2H00A 1YB7A 2QRHA 1CIVA 3HUEA 3UWMA 4X65B 2F43B 1CQWA 2HLDD 1ZSNA 2LV8A 4IGEA 5D3QA 3SEAA 4CM9D 3THWB 1C1DB 4BX8A 2YJNA 1U8ZA 3KZKA 3OJXA 5DNEA 9LDTA 1GRNA 2ODAA 3G7UA 2B8JA 5CFMA 3KQUA 2WD7B 1JIUA 1UMBA 2F59A 2D8AA 5JMOA 2C4MA 4Y8VA 5HILA 1FPQA 3DEYX 1DTEA 1RFLA 4HLUA 1GSHA 1YCDA 1QVAA 1BFKA 3N58A 1ZAYA 4HQNA 4H16A 4YV0A 1ZP6A