4B4WA

Crystal structure of acinetobacter baumannii n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) complexed with nadp cofactor and an inhibitor
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
282
structure length
282
Chain Sequence
MALVLDGRALAKQIEENLLVRVEALKAKTGRTPILATILVGDDGASATYVRMKGNACRRVGMDSLKIELPQETTTEQLLAEIEKLNANPDVHGILLQHPVPAQIDERACFDAISLAKDVDGVTCLGFGRMAMGEAAYGSATPAGIMTILKENNIEIAGKHAVVVGRSAILGKPMAMMLLQANATVTICHSRTQNLPELVKQADIIVGAVGKAELIQKDWIKQGAVVVDAGFHPRDGGGVGDIQLQGIEEIASAYTPVPGGVGPMTITTLIRQTVEAAEKALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL PROTEIN FOLD
publication title Acinetobacter Baumannii Fold Ligand Complexes; Potent Inhibitors of Folate Metabolism and a Re-Evaluation of the Ly374571 Structure.
pubmed doi rcsb
source organism Acinetobacter baumannii atcc 19606
molecule tags Oxidoreductase
total genus 105
structure length 282
sequence length 282
chains with identical sequence B
ec nomenclature ec 1.5.1.5: Methylenetetrahydrofolate dehydrogenase (NADP(+)).
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
A PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b4wA01
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 4b4wA02
1YRLA 5I7SA 1LRLA 5A3JA 1X14A 4NI5A 4TRMA 4TVBA 1N8KA 1N1GA 2NTVA 2PD4A 4ZA2A 3RJ9A 4FDAA 5CPFA 1ORRA 4CM8B 1XGKA 1AHHA 2GZ2A 1XR3A 1ZMOA 3TZCA 1E5LA 3U62A 4KOAA 3W4JA 1QYXA 3WYEA 1CQJA 2C07A 4IXTA 4RV9A 1IUKA 1P3DA 3H9JA 2P68A 3ENNA 3VVCA 4IDFA 1DSSG 1IOLA 1DC5A 2W4QA 2WE7A 5IJZA 5BSGA 4GMFA 3OJFA 3ZWCA 5A9SB 4FJ2A 1LXCA 1X0XA 4H3VA 2H6EA 2DAPA 3BMNA 1O0SA 4BV9A 3TL2A 5L51A 1ADFA 4XRRA 1HDZA 3VPXA 3UICA 1K5HA 3WIDA 2DUWA 4IIUA 3K2EA 2VZ9A 1FDUA 4Q3CA 1PR9A 1Y7TA 2R6JA 3OHSX 1A71A 1ZMTA 4A10A 3JQ9C 2NLOA 2GN8A 1Q1NA 2W2LA 1QRRA 2X8LA 4ALKA 1HTBA 4HNHA 1I2CA 3GUCA 3IOYA 3JQFC 3AOEC 4CM3A 2FSSA 1EBUA 1GTMA 1KVSA 5IDWA 2UV8A 1U3TA 1GUZA 2AQKA 2EJWA 3RVDA 1YJQA 5EN4A 4YACA 1CQIA 4XGNA 1OC2A 5GY7A 5CAEA 4Z6KA 2J3KA 4J16A 3NT2A 3KZVA 3GVCA 2NVBA 1E6UA 1HRDA 4R1SA 3WGZA 1BHSA 1EVJA 1U2DA 4HUJA 3CMCO 2X0IA 4KDEA 3HQ4O 4PLVA 1E0DA 1PQWA 2CMDA 2RH8A 2OOSA 5FFFA 4A2CA 3JQBC 1UP6A 1MX3A 2C2YA 1I24A 2V6FA 4ALMA 3KLMX 5T5QA 3LSYA 3GN1A 4WPGA 2VWQA 3QA9A 4E2XA 1W6UA 3ZNNA 4RJTA 4LSMA 1YB4A 1DDOA 4MKXA 1DIGA 1CJCA 4KWIA 5L4NA 1LTHR 2YHIA 1K89A 3UAGA 2I65A 3M2PA 4OQZA 2AE1A 4CMHA 3PRJA 4F6CA 3UCXA 5KIAA 3PYLA 2AQIA 3DZJA 3OJOA 2AXQA 3RC9A 1KC1A 4B79A 5C5IA 4LSWA 2JAHA 2WJPA 3GMSA 4O6VA 4GGPA 4B7CA 3TSCA 4IGFA 4XYMA 3KSUA 4AJLA 4QO8A 5K0ZA 3NT5A 1XSEA 1ZK1A 1HDRA 4ZU3A 1SOWA 3C8MA 1CWUA 1J5PA 3FI9A 2HSDA 4D7AA 3H6KA 2XXJA 5AQ1A 4AJEA 2FR0A 4R54A 2A94A 4HNGA 1KYQA 3GEDA 3WWZA 5CDSA 2OO5A 3ZHZA 2BFAA 1KVQA 2VUSA 1WXDA 1I33A 3VZPA 4TMFA 1VPDA 1MXFA 4Z3DA 1EK6A 3G1UA 4JJFA 2FRDA 3OBBA 3KM0A 3BMNB 1QYCA 5B1YA 2DVMA 4DPKA 2NVUB 3GPDG 4OGWA 1HLDA 3MTJA 2GCGA 4AJPA 1ISGA 2OHXA 5JPIA 5THKA 4FQ8A 4GX5A 2OUIA 4Z3KA 1T2EA 5TLSA 5TQVA 1RWBA 1O9BA 1RKXA 1V9LA 4RVUA 5CEFA 4Q3NA 4WUVA 3DMYA 4B7UA 1V3VA 3WGOA 3MJSA 4YJHA 1HYGA 3PYMA 2GGSA 2NNLD 4GLOA 3E03A 1DB3A 4FS3A 5IXSA 3ADPA 2ZQYA 4RPGA 1VE9A 2VWHA 2WD7A 2WEKA 1H6BA 4LRSB 2VTEA 2E82A 4J91A 4CV3A 1PEDA 3WOHA 4ZGWA 3E1KA 1B16A 1PGOA 3S8MA 4Q3BA 4D41A 4RORA 2PTGA 1R66A 3FWZA 1HETA 2JFGA 1WZEA 4BO1A 3CSDA 4CUJA 3NDIA 1GYQA 2DLDA 2D4AA 3LT1A 4K26A 3S55A 1UZLA 1DPGA 1A7KA 2PH3A 1KVUA 2PA3A 4ND2A 3PJFA 5IFLA 3IC5A 1FDTA 2ZB3A 5HA5A 1FK8A 4E5PA 4GQAA 2HKIA 2YYYA 2HO5A 3ASUA 3KVOA 5F3RA 3PLNA 5U9CA 2Q2VA 2YHIB 3CXRA 5C7OO 2DT5A 2CZCA 5TSDA 4PLWA 3IJPA 3QWHA 4JBGA 5LCXA 3ZHBA 3FCOA 4GPD1 2DKNA 2ZQZA 3OJLA 3QVOA 4RZHA 4BO7A 2PH5A 4XGKA 5T8KA 3GZNA 4DPMA 2B4TO 1U7HA 1Z7BA 4DBVO 4E31A 5G4KB 5JYDA 5TRTA 1YDWA 3GHYA 3RUHA 4FGWA 2P5UA 2GYYA 3K30A 2J3HA 4YJFA 1KS9A 3UF0A 3MJVA 2VNSA 3EZYA 3NDRA 1O8CA 4W99A 5BSHA 8ADHA 3TNLA 3IL2A 2NQ8A 5H83A 4J49A 1NVMB 3P7MA 3UUWA 3GFBA 4PZDA 1TLTA 3OECA 2Q4EA 2A9FA 4CQMA 4UUNA 1PWXA 1PWZA 2EW8A 2W98A 2Y93A 3RSHA 1JU9A 4YEDA 3BHMA 1VSVA 3JQAD 3KEQA 1GY8A 1Z45A 3CH6A 1P74A 2VCYA 4YYZA 3DZHA 2EP5A 1R16A 1PL6A 4LGVA 4BB5A 3KYDA 1GADO 3RFXA 2I3AA 1H6DA 2OMEA 2C5AA 4IS2A 4F6LA 3GGGA 3V5NA 2CNBA 5JDIC 1I5RA 8LDHA 1Q0HA 1N7HA 4N18A 4XYEA 1SC6A 3A14A 1D1SA 1BVUA 1Z7EA 3WNVA 4CV0A 3U4IA 4RPHA 5GZ3A 1RJWA 1E1NA 3TFOA 4XZ3A 5KOIA 1T1SA 3PHLA 1U4OA 4KTTE 1OMOA 4IJKA 2D5CA 2HMVA 2FPPA 1O5IA 3ZNQA 1ISIA 4JROA 3V8BA 2OZPA 4RF2A 1BG6A 2DBQA 3KXDA 3ROKA 3D5QA 4BNTA 4EEZA 1VL6A 4YT4A 3L77A 1E3JA 3KLPX 1SBYA 4II3A 1D4FA 3D5TA 3PHJA 5EL0A 4DC1A 3WDSA 3FHLA 4YCAA 1MFZA 3GY0A 3QP9A 4NPCA 2VYND 4BNIA 2PGDA 4EYEA 1GZ4A 2C59A 3RKRA 3KRTA 3E48A 2FPIA 4I5FA 4LISA 3FNHA 5CFZA 1R0KA 4S1VA 3UKOA 1WW8A 4CM7A 1R4MA 1QXSA 5T6BA 4YA6A 3VKUA 4A0SA 2PKQP 3TQHA 5EINA 4AJOA 1X7DA 3EVNA 3GMDA 1DXYA 1I3KA 3GF4A 2WE8A 1AXGA 4AJIA 3GZNB 2P5YA 1PGQA 4XR4A 4OSPA 2Z5LA 3PEFA 2IEBA 2Q45A 3M2TA 2AEJA 4R69A 5KKAA 1E3SA 2V7PA 5IF3A 4CLEA 3Q11A 2BELA 2NQTA 1HYEA 4QFCA 1NVTA 2Y0CA 4BO8A 4YQYA 4PN3A 4NJMA 4N7RA 1SMKA 3M1AA 1GFSA 5HRUA 4JJIA 1U8XX 4J1TA 4NDNE 3TOXA 3D7LA 1YB5A 3H9GA 4PLZA 5CHEA 3O8QA 4MVJM 3ZWNA 1UXJA 5L53A 5COQA 4Y6SA 4BHTA 1A5ZA 3HG7A 3T7CA 4BNJA 1PJ3A 4J4HA 5CPBA 4B4UA 1F12A 5DN9A 1EVZA 4RVDA 4CLHA 4HKTA 3KYDB 1E1LA 4JBHA 4LRTB 1P77A 3R6DA 3VH4A 4PLPA 4FPXA 3QE3A 2IDZA 4YRDA 2VHYA 2QYTA 1HWYA 1Y6JA 5DBIA 1GAEO 4CMIA 5BSFA 2EERA 5HTOA 1Y9EA 2X1HA 4IDDA 5A03A 1NQ5A 2JFFA 1UDCA 1ZO8A 4R68A 4CUKA 2CVQA 1NR1A 1YL6A 3AK4A 1MC5A 1SO8A 4HY3A 1MP0A 1RYDA 1SZJG 2H1SA 1GV1A 3OSUA 3NGXA 3RBVA 2NU6A 3DZBA 3QQPA 1ZH8A 3R3SA 3ZWVA 2UUPA 4LCJA 1E92A 2Q4BA 4FC6A 2O3QA 3VH3A 4JNKA 1NR7A 1ZEMA 3TF5A 1JKJA 2P9EA 4MO2A 3ZWPA 3EY4A 3M6IA 2OXIA 1E1KA 3PIDA 1P44A 2X9VA 4NR0A 2GN9A 1DLIA 1WDLA 1DAPA 1PZGA 4H15A 1YQGA 4MP8A 4HWKA 5TNXA 5A3VA 4ALIA 2O3SA 3UFXA 2DTEA 4RVGA 3DEYX 3VDQA 3O03A 4H16A 1NWHA 4BGUA 5BQFA 5IAAA 2E37A 2PD6A 3JQ9A 5U1PA 3VHRA 4UEJA 5ICSA 4FR5A 3AY3A 4AJ1A 4HFNA 4B8ZA 3H4VA 1DO8A 4P4NA 4A27A 1FDSA 3D4OA 3JQFA 3AOEA 5A5EA 4J1SA 4AJ4A 5LDHA 4XB2A 3F6YA 4GVXA 3N74A 4DRYA 5I9NA 3A4VA 1LSOA 5DOZA 4FB5A 4CL8A 2GRAA 3R0IA 2NADA 4ZQFA 4BV8A 1WDKA 4CLRA 2EJVA 1GL3A 4YAEA 3C85A 4WCFC 2PGLA 5JBIA 2RAFA 4NJMB 2NV6A 3ETEA 5TX7A 3G1TA 2F1KA 2RIRA 1YVEI 1GQQA 4R3NA 2AW5A 2O50A 1N92A 2PZLA 3F1KA 3JQBA 5KVCA 4KDFA 4YPOA 1KVTA 3RAJA 1SEVA 1LRJA 1Q7GA 3VZRA 2EGHA 3MJEA 2PZJA 2O3TA 4BQPA 3INGA 2JHFA 2FMUA 3JYNA 2ET6A 2GPTA 1S6YA 3AUAA 2VRBA 3NJ4A 3JYLA 4BO3A 2G17A 2BGLA 3AUSA 1ZEJA 3ZNPA 1H5QA 1ZNQO 3H3FA 3LU1A 2WYUA 3BMOA 5AVOA 2D8AA 4CMIB 4J4BA 4RVSA 3WG9A 1YOVA 1D7OA 3GLQA 4ND3A 4Y98A 5AOVA 3V1UA 4C7KA 1N1EA 2AE2A 4BMVA 1NQTA 5DULA 4BKRA 4MVJF 2CVOA 3ZU2A 3JYPA 1ONPA 1K3TA 4MOWA 3JV7A 2R2GA 4KUHA 3ZNOA 4GSKA 4RF5A 3ZWOA 4DYVA 2SCUA 3WYBA 3NDJA 3PGXA 4ZHSA 4G2NA 2FN7A 2NVWA 4YJGB 3MZ0A 4IQ8A 4DTIA 1K0UA 3R1IA 1L7DA 2D0IA 4YDRA 2ZTMA 1M76A 3ZWXA 2O4UX 1YWGO 3WS7A 3BZUA 1PJ2A 3DOCA 1DFGA 3E9NA 2E49A 1X1EA 3MWDB 2JJYA 4OM8A 4DQXA 2D1YA 3I1JA 2J3JA 3TZHA 4AFNA 1M2WA 3W6ZA 1T26A 3UH1A 3F1LA 4CR7A 2ILTA 4IDEA 5I7FA 2IZ1A 1HZZA 3QWFA 1K2WA 5CEEA 3LQFA 4I5DA 2HJRA 3WQSB 3AM4A 1LA2A 1W8DA 4WGGA 5G0WA 1BVRA 1LSJA 3ZHYA 4EDFA 2Q99A 2RHCA 3CE6A 3PHGA 1O6ZA 4M49A 1LI4A 1NXQA 5TC4A 4YAKA 4OAQA 1JAXA 2HDHA 1EUZA 4L0QA 4TRNA 3RFTA 4YR9A 2C2XA 1GDHA 3OFSA 4Q3EA 3VPHA 4UEOA 4IJVA 1BXKA 4J43A 5F5NA 3K2BA 2BH9A 3SC6A 2VT3A 3RWBA 4U8GA 3A9WA 1I0ZA 1XYGA 4RQTA 4A73A 1HE2A 3L6DA 3IUSA 3BHIA 3ZV4A 3I6QA 2PY6A 1PIWA 3CIFA 3S2FA 3K73O 4OOEA 3S2IA 4XX0A 5DBFA 4FC7A 5J23A 4DGSA 3S2EA 1EBFA 1RM0A 3SXPA 5L7WA 3ULKA 5FWNA 1T2FA 1GPDG 4PG5A 4D43A 1ARZA 2Q49A 3M1LA 4J1NA 2YQ4A 3DBLA 1Z75A 3OEWA 1KVRA 3W8EA 1MUUA 3GPIA 2OFPA 3QVTA 1PGJA 2DBVO 3DWFA 3ETGA 4R1UA 5JSFA 3X2FA 3BMOB 1LX6A 3I83A 4RVHA 4E2WA 4CJXA 4XJTA 1YOVB 2GD1O 2X0RA 3LC7O 4NBVA 1N2SA 2X4GA 2Q2QA 2X23A 3RJ5A 2PWZA 4E21A 2CUKA 3OMLA 3CUKA 1E7RA 1BDMA 3RC7A 4TZKA 4NFSA 1P33A 3GVPA 4UUPA 3DC2A 3RBZA 2VQ3A 4MPDA 2AQ8A 3U9LA 3HUDA 1DIBA 4QUKA 1Y5RA 4UVGA 4M1QA 4E5KA 1A72A 3LT0A 5JCJD 2YHUA 3IIEA 1ADCA 4YWJA 2XOXA 1UXKA 3WMXA 4L4XA 5THQA 2C7VA 5CEJA 2QRJA 4WASA 2DPGA 3JQGA 3AUUA 5DBGA 2P91A 1UAGA 3FTPA 4ALLA 5L9AA 4NU6A 1LDNA 3ZH2A 3DL2A 3E18A 5I8WA 1HSOA 1OAAA 4U0JA 1FDWA 4G5HA 3I9JA 2Q3EA 3LC2O 3MTGA 3LC1O 1BRMA 4TVOA 4CM1A 1XA0A 3U0BA 4D44A 1ZK3A 1M6WA 1UZNA 3GQVA 5JDIA 1UP4A 1ZK4A 3WLEA 3JQ7A 3SBOA 3DHEA 3GGOA 3N58A 3KUXA 2E48A 4GSLA 1E7SA 3NYWA 4D3FA 5FI5A 4YT8A 3G3EA 4YAJA 4ITUA 2YV3A 2Y1CA 3GNSA 1E3LA 1AXEA 2I3GA 1LEHA 1Z74A 4GWKA 2YUTA 3PJGA 4I8XA 4CR6A 3B1KA 3HFGA 2XXBA 5F1KA 2PV7A 1M75A 4MP3A 4ESOA 3GDFA 3VKVA 2JCXA 1DHTA 1HZJA 3B1FA 3Q1LA 3QWIA 4MINA 5TGDA 1R4NA 1X15A 4AJNA 1FJHA 5JW6A 1DFIA 4PLHA 1E7MA 4JX8A 3WGHA 4R5HA 2QYSA 3WGIA 1VJ1A 2VTDA 4IUYA 3ANLA 2QHXA 1RYEA 3F9IA 1JW9B 3OQBA 4C7JA 3UCEA 1NFQA 1YL7A 2ZB8A 2I9PA 3I9OA 5F5LA 1Y8QA 1WVGA 3DAGA 3B1JA 2JD2A 3L4SO 2IXBA 1E7WA 2JAPA 3H3JA 5H81A 5L7YA 3LVFO 2VUUA 2CDBA 3QVXA 2G1UA 4OJNA 3WTCA 4DVJA 1ISHA 4ZQBA 5L40A 2H9IA 1IE3A 3WQQA 2Y1GA 3W1VA 1MXHA 2QX7A 3OF2A 4L4RA 1A4UA 4M8SA 1SAYA 1C1DA 3H9EO 3AY6A 5K6AC 3HHPA 2GZ1A 4EEXA 4JIGA 4TSKA 4FGSA 1WP4A 2OBYA 2BFOA 1V6AA 1LQTA 1H2BA 2XAAA 3DZFA 4WNCA 1WLYA 4IM7A 1PZHA 4YT5A 2R00C 2X0JA 4IMRA 3E82A 1XWFA 4R1NA 3SC4A 3VOSA 3JQGB 4AVYA 5LC1A 1PZFA 2VWGA 1JWAB 1EVYA 4R51A 2BI8A 3INRA 4XYLA 2IYPA 4H7PA 2OP1A 4MVJH 1H9BA 1NQOA 1RM3A 1E3WA 3SLGA 4AICA 4NFYA 4L74A 2PKQO 1IPFA 5JE8A 4FSHA 5KTKA 1PS9A 4W9NC 4Q9NA 5KJFA 3JQ7B 3EHEA 1Z6ZA 3ZHXA 4CLXA 1I36A 2ZATA 1PSDA 4AJHA 3U09A 3MCVA 4PLTA 3WYCA 1J4AA 3HDYA 1VKOA 3AI1A 1DFHA 1I30A 3D4NA 2EKQA 4WK6A 3GN2A 1TT5A 4URFA 5TT0A 3F5SA 3P5SA 2YY7A 1Y1PA 2BFPA 4R16A 1FMCA 5TJHA 2CD9A 2I66A 1OC4A 3WGQA 1WPQA 2UYYA 3ONFA 4NK4A 5I7VA 3PQEA 4XRGA 2DBRA 3PQFA 4FFPA 4IBOA 2GDZA 3HNPA 3NRCA 3ZW8A 4BGIA 1R4NB 4NG5A 1X0VA 1NAIA 4XCVA 4ONEA 4RVFA 3K92A 1ZSVA 1ZXBA 2NTNA 5JDCC 1QMGA 3NKLA 4WECA 2I99A 4IXWA 1YH3A 4PVCA 2VHXA 3DZKA 3ANMA 3U3XA 3HB4X 3OP4A 3I4FA 5JC1A 1W73A 3MJTA 4NBUA 3Q2IA 5ENVA 1W4ZA 1PJSA 2G5CA 2YJZA 3GVIA 4YRBA 5CDUA 1YB1A 3ZCXA 1Y8QB 5JLAA 2ZYDA 3PTZA 4BO6A 4OL9A 3BAZA 1ISJA 2RH4A 1NFRA 5EIOA 5TS3A 1ZZEA 1H93A 3KYBA 3PWSA 4W6ZA 3VPSA 2QZ9A 2VZ8A 2VHVA 4LMPA 2H63A 2BGMA 1BXZA 3F5QA 3JQAA 1EMDA 3WFJA 1E6EA 4WCFA 1PL7A 1G1AA 1E7QA 1KETA 4HP8A 2EHDA 3V1TC 1XG5A 1JVSA 3A1NA 3WBFA 1PJQA 4QQRA 4YT2A 3SJUA 1AN9A 2IYOA 3HSKA 4Y9DA 4D3DA 2YQ5A 2PR2A 4CR8A 2DUUA 5B12A 3NGLA 5TIIA 2JCVA 4KUEA 1ZSNA 3I52A 4FJ1A 4BO5A 5A5FA 1CEQA 3QWBA 3G79A 1OOEA 4CQLA 4OXKA 1C1XA 1LRKA 4E5NA 1PQPA 1PR3A 2EIHA 2EG9A 3LLVA 3OIDA 4BO0A 4M55A 5KJ1A 1E3WB 3GUYA 4XDZA 3HB5X 4U6QA 1B8PA 4UULA 4GL4A 4O5OA 3ENKA 3TZ6A 2AG5A 3I9KA 3S1LA 1AGNA 4GH5A 4OYRA 1AHIA 3D4PA 4O0LA 5I9LA 4FFRA 2DTDA 2Y68A 3KSZO 4W4TA 2DFVA 3ICCA 1DRWA 2VYNA 1HXHA 4I1IA 9LDBA 4CM6A 3LYLA 1TT5B 4YVFA 2NACA 1UH5A 1PX0A 4ID9A 3TPCA 5B4TA 4NHEA 2HMUA 4JJGA 1WNTA 1ADBA 1CYDA 1TT7A 4CMGA 1VC2A 1LU9A 4DMLA 4PG4A 3AU8A 3NTOA 1MA0A 4BO9A 3RUIA 3AUTA 2ZJ1A 4U6SA 4E2YA 3N7UA 4PZEA 3T4XA 4P38A 3GRPA 4XDYA 2GN6A 1Y9AA 4NU5A 4HFMA 3F4LA 4IZHA 3ONEA 3PDJA 4IJUA 4QTZA 4IPTA 1NHGA 3DOJA 3K8ZA 1DC4A 1MLDA 4R41A 3I9LA 1ML3A 4MVJP 4XGIA 1KOLA 7MDHA 4TRJA 3DMTC 4QX6A 3NEPX 1NTOA 3DDNA 2W2KA 4WOJA 4YJHB 2EXXA 1GUFA 1QORA 3QV1A 5T67A 5AXDA 3I3OA 2YV2A 1EQUA 3C1AA 4XQ9A 2X7HA 4GBJA 3OICA 3LF1A 1SEPA 3IP3A 3W4IA 5CDGA 2HK7A 5L4SA 1KBZA 2UUOA 2WD7B 1KEUA 3E5MA 2ZJ0A 1SB8A 3V1YA 5IXYA 2DC1A 4UVDA 5BT9A 5AXBA 4BNZA 1TA4A 4IDGA 2HMWA 4EBFA 4WCFB 1PZEA 2B0JA 2J6IA 2CVZA 3IKTA 1ZJYA 1HE4A 1SCUA 4DQUA 2ZB7A 1ADGA 3RFVA 2DQ4A 2JCYA 1DC6A 1EVIA 4RL6A 1MG5A 1B2LA 4OO3A 2B36A 1T2AA 1C0KA 4O1MA 4CQLB 3RUEA 1C1XB 1P1JA 3SX2A 4EUHA 3RUAA 4ZICA 2GR9A 3D3WA 1DOHA 2IE0A 1LLDA 4E0BA 4O63O 2QIOA 1YBMA 3HJAA 1I10A 1YBVA 1Q7BA 4QSMA 1SNYA 1LDGA 3OIGA 3LLSA 5L95A 3PLRA 4DUPA 4Z0PA 1ONOA 3ZN2A 5C7IO 4RGBA 5A04A 3D1LA 3PJEA 2J5KA 4WLOA 1BW9A 2QQ5A 3IQDB 4G81A 4JN6B 4CMKA 1ZFNA 4D79A 1DRVA 1P31A 2JKVA 3ETDA 4GWGA 4YJFB 5COBA 3UVEA 4D42A 4KQXA 1Y8RA 2J3IA 4U7WA 2C7GA 1IPEA 1P0FA 1BDBA 4CMEC 1CDOA 4BVAA 2HCTA 3OQ1A 4DMMA 5LDGA 4CQMB 3DFUA 4LK3A 1K6XA 5CDYA 3HDQA 3NUGA 2F00A 2LDBA 1GEGA 4AL4A 3KYCA 1LDMA 4WJZA 4U0KA 1H6CA 4K1LA 4LW8A 4BNGA 4FW8A 5ITVA 1HL3A 2HLPA 4MJLA 2ZYAA 4EUEA 1D8AA 1J49A 1U28A 5EESA 2UVDA 2RBEA 4PGFA 4CV1A 4CM4A 3BYZA 5KJCA 1ONNA 3C7AA 4MP6A 2W2KB 1H6AA 5JY1A 4EITA 4RPKA 3GAZA 2Y0DA 3TFQA 4HBGA 4M54A 4BKPA 1U4SA 1EDZA 1YE3A 1DBVO 4QO7A 3CTMA 5DCYA 1KY5A 1XU7A 2B4RO 4MVJD 3VZQA 3DQPA 2GO1A 3JCZA 2IRWA 5DCUA 1BMDA 3W8DA 5JYEA 1N5DA 1TXGA 4IQGA 2O2YA 4CUZA 1M67A 3AFMA 3GEMA 2O7SA 1HEUA 1EDOA 3DONA 3ON5A 3AI2A 2IXAA 1I32A 2ZB4A 3INTA 2NU9A 4B8WA 3BHJA 4BGEA 1JN0A 3ICPA 4LCEA 3NAQA 4IGEA 4JQCA 1GU7A 4CMBA 1EE9A 4E5YA 2HQ1A 5IDYA 5ES3A 1DHRA 3VC7A 1GYRA 4IZIA 2TMGA 1ENYA 1VJTA 5IZCC 1LDBA 2O3RA 1E5QA 1R4MB 1UDAA 2IZ0A 2B83A 5G4LA 5KVQA 2FZEA 2HMSA 1LBEA 5C3MA 2Y1EA 3VTZA 5B37A 3D3WB 5ER6A 1G0NA 2ZK7A 4RLSA 1ULSA 3JQDA 2B5VA 1R0SA 1X1TA 3ZV6A 3WLFA 2X5JO 1TI7A 1NPTO 4I9NA 2ZTLA 5ENDA 5GZ6A 5HS4A 1BW9B 1NBOA 1QR6A 1TB4A 3CKYA 2BHLA 3PQDA 1GEEA 4INAA 4N5LA 1N9GA 1QSGA 3WXBA 2GSDA 2J5RA 4OKIA 1B26A 4BS9A 1Y8RB 3KOUA 1SB9A 5KJEA 4BKUA 1GPJA 2E6UX 4IQ0A 5K6AA 4WLNA 5KVVA 3DTYA 1XIVA 2EF1A 4B3IA 3I6IA 3WMWA 3DHYA 4OOFA 2ZYGA 1SOVA 2R00A 2FZWA 1ID1A 1IYZA 1K6JA 1O95A 3O8QB 4LN1A 3OA0A 5IG2A 3OJ0A 2YFQA 1F0YA 2AEMA 2H5LA 3C24A 3GAFA 1VJ0A 1DJNA 2B35A 3PHHA 1EEHA 4IDCA 1PQUA 2OP0A 1MV8A 3PWZA 3FBGA 2WWRA 3JQEA 4XIJA 3KO8A 4HXYA 1KIFA 2X58A 2P4QA 3I23A 3ZWWA 2QRLA 4XQCA 1BGVA 4W9NA 4DREA 3Q9NA 1C14A 3VPGA 3V2HA 3WSVA 4EGFA 3C3XA 4GX1A 1I3NA 2NU8A 4PLYA 3QVWA 2WM3A 3ZU5A 1NQAO 3A06A 4GKBA 2W90A 3F4BA 4J2OA 2HK9A 4E6PA 5BSEA 1E6WA 1DEHA 5GZ1A 2GZ3A 3ABIA 3BTOA 2JHGA 3HDJA 4XKJA 1LQUA 1HE5A 2DTXA 1XLTA 2DU8A 2I67A 4A7PA 2ZCUA 3HDHA 4CPDA 3HWRA 4YB8A 4CLOA 1XQ6A 1KEWA 3OEYA 4MVJE 4IJWA 1HDYA 3O26A 3GOHA 4ZRMA 3I5MA 5A02A 2O3JA 4K9DA 2PNFA 2RCYA 5JDCA 2Y67A 1JKFA 2OORA 3GDGA 3FNEA 5DNAA 3W8FA 4BNUA 4RZIA 4E32A 3ADOA 3PZBA 1DIAA 1LLUA 1YONA 3GH3A 2G82A 3JQ6A 3AI3A 1IZ0A 1Q7CA 1JA9A 3WIEA 3DXFA 1V0JA 5JCJA 5KWEA 4QXMA 5L45A 4J2HA 1AUPA 4LVCA 4RF3A 3PWKA 4ZD6A 2VNAA 2PLAA 1N9GB 1I8TA 1GV0A 1PGPA 2BLLA 4IDAA 4YXFA 4CLRB 4CM9D 5KVSA 2NWQA 1YQDA 4BMSA 3DTTA 5CDTA 1ZJZA 3AM5A 3E9QA 3WB9A 2ZIZA 5JCXA 1J6UA 4L4SA 3K9QO 4I5EA 1LC0A 1UDBA 1YGYA 3AWDA 3BXXA 1ZKMA 2PKRA 2QRKA 1PJ4A 4I9HA 1N7GA 2D5AA 1L7EA 1PJCA 1W0CA 2VRCD 3ZWBA 4CM5A 1PTJA 3W6UA 4E13A 2ZTVA 2CF5A 2XPCA 3JQCA 4UUOA 1IY8A 1PJLA 2A4KA 4J4TA 3WBBA 1HDXA 4BIIA 2FWMX 4J9UE 5ILGA 3ZDFA 1LDYA 2HAEA 4BNXA 5A9TA 4DLAA 4D3SA 3RI3A 1UAYA 3H65A 1Z73A 5JY6A 5FF9A 3RC1A 3C1TA 1ZIDA 3Q6IA 1DC3A 1V3TA 1TVEA 1A4IA 5BNTA 2O48X 4BUCA 3RROA 2Z95A 3QWAA 4NK5A 3C7DB 3ROQA 1CRWG 1EQ2A 3B70A 2C29D 4GX0A 4JBIA 3FRJA 4BNLA 1QP8A 1FF9A 1MG0A 4ZN6A 4R9SA 1ISFA 1ZK0A 3AOGA 3O4RA 1PL8A 4PRKA 4BNVA 5A1TA 1I3LA 3E8XA 5ER9A 4BNWA 3DO5A 4DPLA 5JAIA 3AW9A 1GQ2A 2Z1MA 3RUDA 3LT2A 1BSVA 3MWEB 4FFMA 2VHWA 1VL0A 1XU9A 2Q46A 3H2ZA 4R9RA 5EPOA 5TT1A 1LSSA 2YZ7A 1BTOA 4MIEA 3U4CA 1IULA 1DLJA 3LT4A 5GMOA 1U3VA 1V3UA 2RHRA 4RPLA 3FN4A 3HE3A 2Y0EA 2VWPA 3GNTA 4WE3A 5EERA 4XA8A 1PJTA 4BKQA 2Q1TA 4QFDA 4D45A 4JGBA 2YFHA 1GCUA 1FXSA 4F45A 2FR1A 1ENOA 1WMAA 3DMTA 4P22A 1QLHA 3AJRA 2X9GA 3QHAA 5JMPA 3B6ZA 3T7EA 2QZZA 4TKLA 2IZZA 3L4BC 1CERA 2YV1A 3P2YA 5T57A 4E12A 1F8FA 4PCVA 1PJBA 4IS3A 4HV4A 1EUCA 3ORFA 4B4VA 4BB6A 3G49A 1FDVA 1WWKA 1U8FO 2I6TA 2X5KO 5JXWA 4Z0HO 4WLFA 4BO4A 3TOZA 2AQHA 3B20A 3FTNA 1OI7A 2GUGA 1HDCA 4YTEA 4MKRA 2I5PO 4QECA 1H9AA 2EW2A 2POQX 3EYWA 3RBXA 4KP7A 5AYVA 1ISMA 2GASA 3RU7A 4K6CA 1M66A 2P2SA 3RASA 4MKZA 1GZ3A 3IP1A 4TQGA 4DLBA 3JD1A 2HUNA 2A92A 3DBLB 5G2OA 3SJ7A 1U1IA 2NSDA 1WZIA 5A05A 3DBHA 1ZUD1 1C0PA 4FFOA 1A9ZA 4TROA 4YQZA 1ZBQA 4J0FA 1B7GO 4PLGA 4GLLA 4UVHA 3V2UA 5AXAA 2PZMA 1NAHA 2Y1DA 1I2BA 3WTBA 2BD0A 4J9VA 1UZMA 1YQXA 2Y1OA 2JD1A 3WWYA 1BWSA 4DLLA 2NVUA 2HU2A 4P4LA 5FEUA 2G0TA 4U5QA 4RCVA 3UN1A 2WDZA 2PZKA 2BF7A 3ZWAA 3FF4A 1JAYA 3F3SA 1E3EA 3MEQA 4EJ6A 2HMTA 3K96A 1QV6A 2EGGA 4ND5A 4E33A 1CF2O 3AFNA 3CZMA 2C0CA 2GF2A 1PGNA 5I9MA 2AG8A 4CMEA 4ZVVA 3FPCA 3H7AA 1G0OA 3ZWYA 3H5AA 5A06A 1JWBB 3TZQA 3VAZA 3KTDA 2WTBA 4BNNA 4PFJA 3A28A 3JD0A 3VDRA 1GR0A 1JTVA 5T64A 4AJ2A 2JFHA 3LDHA 1B3RA 4E4YA 1HDGO 3PZRA 2V6MA 3JD2A 4EI2A 4JLWA 4UREA 2VT2A 1YXMA 2AHRA 3PPIA 4GVLA 4OXYA 5L3ZA 4NH4A 2X9NA 4XEHA 3EMKA 3VH1A 2Q1UA 3FPLA 1T25A 3OETA 4RLHA 4XIYA 2E4AA 3EGOA 3P19A 4ND4A 1HSZA 3I9NA 5IN5A 3RU9A 5JO9A 4CMJA 2HRZA 4B4OA 6LDHA 4EUFA 2HRBA 4M86A 5JAMA 3ZU4A 3UW3A 1XCBA 4PLFA 3KB6A 3L6OO 4JXKA 5G0SA 5KNLA 3NTQA 1JVBA 1HE3A 4FN4A 1IL0A 3FR8A 3AM3A 3LZ6A 3WNQA 5JS6A 1YO6A 5TJ9A 4ZRNA 3ZW9A 1EFKA 1KEPA 3C1OA 3P2OA 4PLCA 1JDJA 4CMCA 3E6AA 3TRIA 3PVZA 1X7GA 2Q1SA 5JNLA 1NM5A 4BNFA 3Q0EA 4XQGA 3GHHA 5G4KA 1R15A 1MFPA 2NUAA 3ZGYA 3K5PA 4D0RA 1TEHA 1YKFA 5IZCA 2Q50A 2W2LD 5ICMA 3WFIA 2EV9A 3EC7A 1Q2XA 5A9RA 1O94A 3AU9A 2D2IA 4KWHA 3DBHB 1KY4A 3OQ6A 4CV2A 4FBGA 1PS8A 1P1RA 4LVUA 1HDOA 1F17A 3BTSA 1H2HA 2O2SA 4GKVA 2WYWA 4MVJI 4Y67A 4EZBA 3L07A 2JL1A 1YDEA 3H2SA 3IS3A 4K6FA 4OQYA 3GVXA 4PG8A 4J1QA 4MDHA 3WJAA 3CINA 3I9MA 3H9QA 1R37A 5I8ZA 1XELA 4J7UA 2D3TA 5JAZA 2UAGA 5KKCA 1V8BA 3GC6A 5EJ2A 4L76A 1C1DB 1EUDA 1UXHA 2UDPA 4BNKA 1L1FA 4MIOA 3H5NA 3ZZNA 1IZ9A 1MGOA 1DRUA 3TZKA 2GN4A 3BMCA 5MDHA 2C5EA 4RO0A 3E5RA 3PP8A 1B15A 3DR3A 4CL3A 1NPYA 1E77A 5JFOA 4DL9A 1LLQA 1RM4A 1P1HA 3ROMA 3WICA 3RQSA 2FHSA 4E3ZA 5DCWA 3IMFA 4Z0TA 4Z9YA 1GZ6A 4BKOA 4BQRA 5L4LA 1B0AA 1UUFA 2IODA 2FY8A 4Q39A 3OH8A 4JCOA 4EJ0A 2X22A 4GAEA 4IINA 4W82A 3RIHA 3GEGA 3VPFA 2VOJA 5KJ6A 1U2GA 3QLJA 4XYGA 1CETA 1YBAA 3GNQA 4FFLA 3GRKA 4XYBA 4I5GA 4AJJA 3MOIA 4I9UA 3KV3O 4OH1A 4L73A 5ADHA 4DIFA 3EZLA 1MC4A 1KERA 4ZQEA 2EWMA 1SPXA 2EKPA 4DXHA 1T2CA 2BI7A 3UHAA 3T4EA 3SEFA 5HWSA 1BXGA 2CF6A 2WD8A 2Y99A 1HKUA 1VKNA 4PG6A 2VZ0A 1CIVA 1Y5MA 4DWVA 4WLVA 3CMMA 4FFNA 4N54A 3DAPA 4KQWA 2EKLA 4Y6PA 4I08A 1XKQA 2P9GA 3ZI0A 4A03A 1JQBA 2P4HX 3CEAA 3IUPA 3X2EA 3GFGA 5L7TA 1GD1O 1LC3A 4ALJA 5TF4A 2X6TA 7ADHA 4JK3A 5ILOA 4Q3DA 1OBFO 3E9MA 3ONDA 3W4KA 3DB2A 4D0SA 4E2ZA 1XDWA 1GQYA 4OIMA 5JC8A 3HADA 3FNFA 1WDMA 1F06A 2GNAA 4PG7A 1VSUA 4HFJA 1Y81A 2AMFA 3JQAB 1U5CA 3RD5A 3LK7A 5H82A 3D64A 4NZ9A 3GZ4A 4Q3AA 3HZZA 4NIMA 3FBTA 9LDTA 4M87A 4AJKA 4J90A 1NPDA 4K28A 3CZRA 2EEZA 2TMDA 4R01A 1LDEA 1QLJA 2C20A 1P1KA 1OFGA 2CDCA 2X86A 3UGKA 1QYVA 2OGUA 5CG1A 3BMCB 4PIVA 1F8GA 1DAOA 1UJMA 3OM9A 4ROSA 2GERA 1JKIA 4B7XA 4PVDA 6ADHA 3KSDO 1RM5A 2CSUA 4NMHA 4W7IA 3GGPA 4MVJA 3JYQA 4Z9FA 3S2GA 4YAGA 3WGYA 1LUAA 4FCCA 4X54A 3ASVA 3U4DA 4YBZA 4R4JA 3WGGA 4WKGA 1E3IA 3I4CA 1T24A 5EQFA 2O7QA 4YRAA 4ZQHA 4XQEA 1T2DA 4OSOA 3WGTA 3KBOA 3EAGA 3QSGA 5F21A 4WLUA 1PS0A 5JAQA 2Z1NA 4FJ0A 4CQMD 5JO0A 1NWCA 3BMQA 4KTVE 2VOEA 1I01A 3EVTA 3QIVA 1DJQA 4OMUA 4KMSA 2BKAA 4WNIA 1U7TA 4DQVA 3O38A 3IJRA 3RC2A 3G17A 3ITDA 5BR7A 3ITKA 3STHA 5AXCA 5F1PA 4N5NA 3CPSA 1NYTA 4G65A 4DA9A 4OKNA 3DZGA 1A9YA 2DM6A 4L8VA 4GX2A 3U5TA 1YJ8A 2VYVA 3DOOA 1BXGB 3BIOA 3PI7A 1R0LA 4FOOA 1P1FA 4J7XA 2CDAA 3RKUA 1U3WA 3GA0A 2Y66A 1QV7A 4DC0A 1UP7A 3WX0A 4JP2A 3ROPA 3L6EA 3H5RA 1DIRA 4JP3A 1IHYA 4O59O 5EQDA 1D3AA 3OJEA 3L4BA 4IDBA 2AEFA 4EJMA 3DBRA 2FP4A 3RUCA 1VLLA 3WR5A 2P9CA 3VTFA 5C7LO 3FR7A 3PGJA 1NFFA 4C4OA 2D59A 2VHZA 1V35A 3K6JA 1X13A 1ZCJA 2HK8A 2OBNA 3Q2KA 1B14A 3FD8A 2FOIA 4WOKA 1GCOA 4BNMA 4XJSA 1B3BA 3JQ8A 3OA2A 2IEDA 1ULUA 4UAGA 2Y1FA 4KZPA 1RPNA 4HX5A 3IKVA 4L9RA 3U49A 1IB6A 3WJ7A 5C37A 2B37A 5IN4A 3NJ8A 3RCBA 2I76A 1YL5A 1QYDA 3JTMA 2BFMA 5DP2A 3EK2A 4GGOA 2OL4A 3KETA 4YJGA 3UCFA 4ZJUA 1B8UA 4Y6RA 3PDUA 2DPHA 4M89A 3GK3A 5DDIP 3ANNA 1R6DA 3GG2A 4LMRA 4DYDA 1U3UA 5ITWA 4RDIA 3IAHA 2VYVD 1QG6A 2J8ZA 3ZV5A 4WEOA 1WAMA 5BNIA 2GLXA 1K6IA 1IHXA 1MB4A 1ENPA 3DAFA 4RPJA 2C54A 3QY9A 1DIHA 4TZTA 1VRWA 5HM8A 3K31A 3L0DA 4NQZA 2PD3A 4ILKA 2O4CA 3PHIA 3D0OA 2YW9A 5JMWA 3BMQB 2Q1WA 2V65A 4NNJA 4P8RA 1ZK2A 2PFGA 3L9WA 3WSWA 2YDYA 1GUYA 1UXGA 3TJRA 4B4WA 3UXYA 3H8VA 4QT0A 1NASA 5HBRA 1HT0A 4L75A 3KHUA 3LF2A 5HS6A 1PU2A 3SLKA 2NU7A 3H9UA 5DP1A 2FSVA 4BL5A 4Z9XA 1A7AA 3KYCB 4NJOA 1LJ8A 1XQ1A 3ZV3A 5MGBA 3RUFA 4A26A 1YS4A 4WEQA 4BGVA 1A27A 4CM4B 3JD3A 4XWYA 3GT0A 4IIVA 4NFHA 4XD2A 4CMAA 3VH2A 2J5QA 4CM9A 1D1TA 1EZ4A 1WMBA 4R5MA 2G76A 3NV9A 2B69A 3DBRB 3DHNA 4DIBA 5CP8A 5BNFA 1O89A 1R12A 1NVGA 1E7YA 2Y05A 4OXNA 5IZ4A 3KEOA 4NBRA 2V6BA 2VRCA 1C0LA 1ZXLA 4BNYA 4OHUA 2LDXA 3EUWA 1F14A 4KUGA 4J6FA 3HFSA 3JQ8B 2NTJA 4BOYA 4N5MA 2QW8A 5FI3A 4TRRA 3TDKA 4PRLA 1C0IA 3NTRA 4D46A 1HLPA 2WMDA 4F46A 1B8VA 4E30A 5EMHA 5T8KC 1Q0LA 1ZW1A 2ZKLA 1KEVA 5U4QA 1EE2A 1XEAA 1H0KA 3PIIA 1M6HA 5DT9A 3C7CB 3VVBA 1Q0QA 5B4VA 1P1IA 1HF3A 3EDMA 3PK0A 3COSA 5FYDA 1EK5A 4DBZA 3BTVA 1P0CA 2BRUA 3F47A 4PZCA 5G0UA 5IDQA 1P45A 4B3JA 2PK3A 3GDOA 3G0OA 4RQUA 4HFRA 2DFDA 1OZAA 4AG3A 3TWOA 1T4BA 2W8ZA 3O9ZA 4ALNA 3V2GA 5KCZA 1T4DA 2CY0A 1UXIA 3ST7A 2EP7A 1GYPA 2X0NA 3R3JA 3QRWA 3OIFA 3QW2A 5G0VA 3WQRA 3DBVO 4GI2A 2O3UA 4F3YA 1ENZA 2WYVA 4UVIA 1I2ZA 4IMPA 2ZTUA 3ZWMA 3IDSA 3U4HA 4XB1A 4E5MA 4A5OA 4ND1A 4CM8A 4DIOA 3FWNA 4S3MA 1HYHA 2AA3A 2QG4A 4NBWA 1NHWA 3JYOA 2PGJA 1X7HA 2JD0A 3EW7A 1T1RA 3BA1A 3QVSA 3F46A 2FPGA 3AY7A 1VI2A 2C82A 1H94A 1QYWA 1UR5A 2DBZA 4P4GA 4EW6A 4RDHA 3JSAA 5B4UA 2Q2WA 3PYXA 2WSBA 4WLEA 2YDXA 5A4DA 1VM6A 3VZSA 4FIZA 4FOSA 3SVTA 5A9SA 4W7HA 1LNQA 2VN8A 4CODB 3GG9A 1S7CA 4MVJG 1VL8A 2B4QA 4UUMA 4TWRA 4WCDA 3FSRA 3BTUA 3D3EA 4J0EA 1U5AA 4BO2A 4R3WA 1J0XO 2BMAA 4R1TA 2BGKA 4BMNA 4YAIA 4Y8VA 1QKIA 4XR9A 4HADA 3HN2A 5I7EA 4CLOB 3HN7A 5F1OA 1EFLA 3ZU3A 3MJCA 2VUTA 5DOVA 1Z82A 3Q9UA 3TN7A 4J7CA 4IY1A 1XHLA 4QEDA 4CLDA 1E1MA 3PFWO 5IDXA 1NX6A 4YJDA 1C3VA 4RF4A 3PFFA 4MIYA 4II2A 5DF1A 3MJ4A 3L9XA 1NNUA 3TL3A 3FNGA 1ZSYA 1LLCA 4BNHA 1NP3A 2HJSA 4TKMA 2O23A 3JD4A 4NBTA 3GVHA 4J3FA 5COAA 2X5OA 2A35A 3GR6A 2FR8A 4FD3A 4UVEA 3UOGA 2XF8A 4ZQGA 1G6KA 5CG2A 1AE1A 2V6GA 4B3HA 1I3MA 1JLLA 1KC3A 4GMGA 3NX4A 1P9LA 1LSUA 1U9JA 3NT4A 5DZSA 2ZCVA 1ZVMA 3DZIA 3DFZA 3PJDA 5G0TA 5K9ZA 2CFCA 2B5WA 3PXXA 4UEKA 2NM0A 3Q3CA 3QJ5A 3MOGA
chains in the Genus database with same CATH superfamily
1YRLA 5TEWA 3CH5A 3KS9A 1A7JA 4FZRA 1X14A 4U8HA 3TW0A 4BWYA 1N4DA 2CNLA 5CFMA 3L04A 1B0UA 1CE8B 1CR1A 2XCSB 2IELA 2NTVA 3FNQA 2FSFA 2R4UA 1Z47A 3MERA 1W4RA 3RVSA 5FOUA 4O25A 1ZD2P 2Z2YA 4CM8B 1POXA 4L9SA 1RYZA 4DW8A 2MT9A 1ZMOA 2YV5A 4OLFA 5K05A 3GEPA 5J3JA 1AC5A 1ODSA 2FZ5A 3K0CC 5FJIA 1YAHA 3WYEA 1CQJA 1F5SA 1XTQA 4CCYB 2QT1A 5EGSA 1JT9A 1IUKA 1P3DA 3MMXA 3H9JA 3IUYA 3F78A 4IDFA 4KWCA 2MSNA 3PGLA 4YN3A 5K0SA 3REQA 4G2TA 4M1OA 2FFHA 2W4QA 4JEHA 3SFZA 2OCBA 5ALDA 1BS9A 1R8SA 1S3GA 4MUHA 5IJZA 2AOUA 1AQIA 4GBED 4ND8A 1BX0A 3ZWCA 1FVHA 2IQ5A 1IM5A 1X0XA 3RAPR 1AOXA 2DAPA 5KMGB 1CJKC 2WG2A 1F0PA 1XK6A 3CF0A 4BNDA 4XRRA 5I9TA 1J22A 1Q50A 3UICA 4NS4A 5EJ8A 4PO3X 5IFKA 3K2EA 3PNSA 2HYDA 3HN6A 3L01A 2O8BB 3KU4A 4EY5A 1PR9A 2FEKA 3JQ9C 1KAHA 5LDDC 4FKMA 3QUTA 4G9EA 3WMFA 5LKRA 2NLOA 5DVZA 1U0OC 1Q1NA 1KZYC 1MR3F 1QRRA 2REXB 3ILHA 4XI9A 4A0HA 1SA0B 1UM9B 1WHSB 1Z6XA 1VE7A 3CH4B 3K5HA 3U81A 2V96A 3AOEC 1UBUS 1K5GA 1CZRA 1H8ED 3IQGX 3L4KA 5HQ3B 1GTMA 4RXMA 5EN4A 2W83A 4YACA 5DEIA 2PS3A 4MQEB 3NH9A 1V6SA 1VRVA 3GARA 4FN5A 3Q1KA 4J16A 5HQJA 1GDDA 3KZVA 1CIPA 3ZHOA 3GVCA 2NVBA 1WS6A 3A6FA 1UEXC 3O4VA 4HDSA 3NHWA 3WGZA 1KAQA 4EG4A 1W4LA 1K08A 4G0QA 4UM5A 1PK9A 3WGJA 1P5FA 2FDRA 5TQ2B 5BNZA 5H70A 3K0FA 1QZXA 3K9HA 4G1EB 4H3KB 3N8NA 4K0KB 4LV6A 5ICFA 5DTEA 3JQBC 3R5XA 2C2YA 2R6HA 3QPCA 4BIMA 4MMZB 4I8DA 3OZIA 5T5QA 4HNSA 1A2QA 3GN1A 1NVAA 3NFRA 5LZ8A 5K0LA 1CUZA 1KP3A 2KLHA 2CHFA 4E2XA 2IZOA 3LX6A 4X8HA 3QE9Y 4RSMA 4TXJA 3BB1A 3Q9SA 3FROA 5EP1A 3P9PA 4BFXA 1G55A 1OFHA 1YB4A 3LRPA 3SS7X 4DM4A 4KWIA 1QCZA 1ISSA 5ALVA 2FEPA 2I65A 1LS1A 3EVDA 1G2QA 3M2PA 5CYFA 2IU6A 4QPCA 2WJ6A 3FLMA 3PRJA 2G09A 4U7JA 5KX5F 3R8FA 2QUJA 2RBGA 3EB9A 4DG5A 3KEMA 1GNVA 1VI5A 3OJOA 1JTEA 2V9ZA 2WJPA 4BFUA 1B00A 3UT6A 4JI7B 2XBMA 3SEAA 1EA5A 3EFOB 4IGFA 1HFWA 2ATEA 3EN0A 1RZUA 5JROA 5JSUA 4QO8A 2CJWA 3IKLA 4BECA 3K0BA 3DOFA 1XSEA 2NO4A 7REQB 3AVOA 1ZZGA 2WAMA 1G63A 1WMSA 2GJ4A 3L3BA 3EA4A 1LI7A 2PH1A 5K1ZA 2DFPA 3EIHA 3OESA 4D6YA 2Q5LA 2XA9A 4FXOA 2XXJA 1SIWA 4H4DA 3EEOA 5EMKA 4JLKA 4R54A 3GEDA 2NXNA 3NPMA 4W8GA 2OO5A 3ZHZA 4DSNA 1WXDA 1X7ZA 3VZPA 4DZRA 1Y7PA 4JJAA 4WXEA 1MXFA 1UBNA 1SG9A 4JL6A 4Z3DA 4DSUA 4GOJA 3OBBA 5BYBA 1JR2A 1JSLA 7MHTA 1O5OA 5DDIP 2DVMA 4DPKA 5B1YA 3GPDG 3LWNA 2IIQA 3BDAA 1YQUA 3C16C 4AJPA 2R6ZA 3NZEA 1KXJA 2Q1XA 4UNRA 3QSYA 4Z3KA 1T2EA 3GP5A 2ZRMA 1SG0A 2NVOA 5TQVA 1RWBA 1B0ZA 2AR0A 1HR0B 4ARCA 4KL8S 1V9LA 3K8YA 4HDNA 3ZE1B 3BRWA 1EXNA 3PC8C 1HYGA 1SCAA 2J48A 2HMYB 2OD9A 1EM6A 4GLOA 4NWIA 4IDNA 3E03A 1DB3A 4XTRA 3TOVA 4BMDA 5JARA 4EFDA 5DTQA 3OFNA 2CHUA 4EYSA 3BH7A 1CVRA 1VE9A 2OOKA 2VWHA 2ZAOA 4J07A 1N0VC 2VTEA 3QUSA 2E82A 3G5LA 3MWKA 4WFQA 2J0UA 4CV3A 4OX9B 2ECFA 1Y6QA 1S8FA 1NVWQ 3Q40A 1MBZA 4B1FA 3A32A 2OZLB 3AB3A 2WIBA 3O95A 2M32A 3BWDD 3N3BC 5CLHA 2W42A 4YCMA 2P1DA 5C1PA 3G9ZA 1C4KA 1Z0KA 3HEMA 4QTUB 1OSNA 5KDOA 2VJYA 3S5UA 4BC0A 2WYIA 2IZ7A 5JJBA 2D4AA 2IUYA 4HEA1 1D2EA 3UJNA 1RI4A 5C31A 4ETIA 3S55A 1DPGA 1T9BA 1COWD 1KVUA 4RELA 1WXIA 4BP1A 1GGHA 3L92A 3ROZA 4TSRA 5HBGA 4KR6A 4FYMA 2AX3A 5LP6F 1DXQA 3IC5A 3MTQA 1E69A 4FUTA 3A3NA 2XKJE 3O4IA 2HKIA 1KJWA 1M34A 2WMNB 2EP8A 3CLHA 4GQAA 3ZGVA 4M7PA 4KODA 4EX6A 3KVOA 1KEZA 3ASUA 3JATA 4MJ7A 3Q9LA 3DEIA 5AK5A 1BFUA 3FMGA 3DLBA 2AMLA 4KVZA 4M0EA 2DT5A 1SY7A 5TSDA 1CNMA 4PLWA 2PM8A 5I7UA 4GPD1 2ZQZA 5EJ5A 2WQ7A 4RZHA 1K88A 2R1VA 3X1ZA 3WYAA 1GGEA 5HQTA 2YZKA 1MJNA 1TA0A 2QXYA 1TAQA 1Z7BA 1NT2A 1RWWA 3LVRE 4WZAE 5EXSA 5G4KB 3LGAA 4MQ5A 5TRTA 3UIEA 3PG5A 3R9IA 5FT9A 2V7GA 3K30A 1FLDA 2J3HA 3TSYA 2NW6A 1KS9A 4AYWA 1FTNA 3QITA 3UF0A 4E94A 2VNSA 3NDRA 3QUBA 1O8CA 2AG6A 4K6GA 3I62A 4PRZA 4MXDA 4DV4B 5JZBA 3LX8A 2FW6A 5JFGA 1GZ7A 2BFDB 5CCEA 4IXDA 1K7SN 4KN5A 4RTKA 4O2BF 1BZYA 3F9RA 5EXEA 1GLVA 4QODA 1S2OA 3G68A 3VX3A 1L1EA 2EW8A 1UKZA 2F3SA 2W98A 4X44A 1RLOA 3FKSD 4Y1RA 5JSYA 4TLAA 1JU9A 3FVVA 2EWWA 3OZCA 2YBEA 3GGJA 1VSVA 2EKDA 3JQAD 2HD4A 3NYRA 5AR1A 3CH6A 4X7MA 4WOCA 4ZVUA 4YYZA 2R7LA 3UB3A 5ICCA 5F9HA 1PL6A 4LGVA 1YB6A 2VDUE 3W5CA 1QX3A 2IYRA 4WX2B 3VR6A 5ESDA 3QKRA 4HAUA 1IATA 4Y3UA 1RVV1 2KBEA 2FEOA 2B7LA 5SYAA 2C5AA 4DSOA 4QBTA 3QY0A 1CR4A 2PL1A 1T5DX 1U98A 2G08A 3MTAA 3V4PB 5JDIC 1I5RA 4UBJA 3QEAZ 2YJ3A 5LIPA 2P6MA 1Q0HA 4KX5A 4LJLA 4IG9A 1YTUA 4CIAA 1JXOA 1D1SA 1BVUA 3O21A 5JV5A 4YAUA 1WOMA 2YY6A 1FMJA 1M10A 3BZWA 4H59A 3D8HA 1Y98A 4UZFA 1NNLA 5LN1A 5CW2A 3NIBA 4WNYA 1TJ4A 1A1SA 4KTTE 3LV8A 2HMVA 3FM9A 2AOWA 2YCLA 1XE3A 3NHYA 2D00A 4TMYA 3V8BA 2OZPA 3H5OA 2DBQA 3HZRA 2VUHB 2NV2B 3ROKA 4BNTA 2HNBA 2D1RA 3CRW1 4II3A 1YKGA 4WA8A 5GPBA 3OQNA 3OM1A 3UENA 3QP9A 4DF3A 5C34B 3C43A 1TZMA 2PGDA 1KKUA 2Y71A 1AQNA 2QRUA 3ZR4B 1M0TA 5BN5A 2NSJA 2FCAA 2W2QA 4I5FA 2YWDA 5AW6A 4EFMA 1Z26A 1JB1A 3BGOS 2XWSA 1TF7A 2HSGA 5LZ5A 1R4MA 1QXSA 4IUBS 5T6BA 4H35A 5FAKA 4H7EA 4YA6A 4ZOCA 1X9GA 1RYMA 4ZODA 3PVCA 3AERB 2PKQP 3TB4A 4ESEA 2A9QA 1YNSA 3UFBA 1E79A 4KMMA 5ISMA 3KWJA 3JVEA 3IAM6 1ZC4A 2QJWA 1AS3A 5BVGA 2W6JA 3EVNA 1DXYA 1HYQA 4AP5A 3WLLA 4X1YA 3GLRA 3L18A 2JVKA 2PQMA 4KR0A 1AXGA 4AJIA 4OA5A 2ERXA 2ZBDA 3GZNB 5JR3A 2P5YA 5I01A 2GBFA 4I55B 3OQPA 1AJEA 2I0FA 1LFDB 3HCDA 4G01B 1Q77A 5DRTA 2AEJA 4R69A 1NBAA 2H85A 1ZPDA 3CT6A 3NHMA 5JS2A 4EPTA 2V7PA 3SIPA 2DUMA 5IF3A 3Q85A 3ZJTA 1HYEA 3CNOA 1NVTA 3CWQA 2FOXA 2SKCA 4YQYA 3RPEA 4COKA 4LZZA 2XCRB 2E0IA 2H57A 3FFWA 4XARA 1OXKB 4ENVA 2GXAA 2PQ0A 4IRXA 4Q93A 4D8TA 5L3RA 4U3JA 3I05A 1H5UA 4EB6A 4J1TA 5EP4A 4PLZA 3LDFA 4BE4A 3FAZA 1JMYA 2JGNA 2QRVA 4KB5A 4G5QA 4LXXA 5EMNA 4KFUA 4BHTA 3GP3A 3HG7A 3WISA 2FOLA 2R6GA 1M8JA 3EIWA 4RPCA 3L8EA 1FFBA 4BLOA 3GH1A 1VL5A 1M6YA 4FPXA 4D99A 3C3CA 4QKQA 1UPFA 2DPXA 3QE0A 2IQIA 2WWWA 3CQ9A 1USKA 3WRWA 4RX1A 1O96B 3KSRA 4DMKA 5KINB 1KI3A 5E6UB 5BVHB 2R86A 1JQEA 1UDCA 2XGMA 1U99A 4CUKA 2CVQA 3AR5A 1NR1A 2MR5A 2CCGA 4N0QA 1V4VA 1YL6A 1ZOSA 4GBGA 1X7XB 4BVEA 1B8NA 3AW8A 1D8TA 4IF4A 4XASA 2BCJQ 5DYYA 3MTDA 4H6PA 3L7CA 2H1SA 3QOYA 1GV1A 3OSUA 3NGXA 3RBVA 4AS2A 2FFBA 3DZBA 1E1QD 1U2SA 2Q07A 4CRWB 1ZH8A 4WFKA 2UUPA 3BCHA 4FYPA 1YZHA 2QTFA 2TECE 3VDNB 1E8MA 4FC6A 2UYOA 2X7JA 4JZKA 3VH3A 1NZJA 4JNKA 1ACJA 4EX7A 3KQKA 1BJKA 2QTVB 1UIRA 4GP9A 4Q9AA 2EDAA 3P0EA 4UNQA 3LBYA 4URYR 4Y30A 2Z3WA 2PMCA 2ZSUA 3L7KA 4HMQA 2CMHA 4B82A 2O2JA 3H17A 3OX1A 3ZLTA 3EY4A 3M5CA 4RMNA 4YRSA 1JIVA 1FLAA 1FA9A 2Y2UA 3O9MA 1RABA 4C0HA 2ST1A 2WTAA 2XE6A 5BWLA 2OEPA 4U7DA 4YMLA 1YRBA 3HCBA 2O3SA 2Y1XA 4AF7A 3I04A 4LZJA 1QIJA 2DTEA 3WVNA 4C0AC 4HXFB 3TDMA 4H16A 1NWHA 4UPDA 3WL8A 1T35A 3FHJA 1VFNA 3ZS9A 5JTUA 2D8MA 3NHSA 4AJ1A 5EUMA 3PDHA 1B1AA 4BMZA 4D02A 5L3VA 1WMDA 3W3AA 4MKGA 4Z4FA 2I3ZA 4TX1A 3AJAA 4M7RA 1JMVA 4J1SA 2X8WA 4F93B 3V33A 1A3CA 3OOEA 3F6YA 5EFZA 1L1RA 4UTVA 4DRYA 4HWOA 2OG1A 3G2IA 2IYFA 5FBZA 5BV0A 4YJ2B 5I9NA 2BFEA 1YCDA 2I8AA 4A4DA 3OIYA 2C92A 4BFCA 2N3ZA 2P0EA 2ZYVX 2WKWA 1Y9ZA 1KI6B 4AP6A 4BV8A 2AGVA 2QW1A 2ETXA 3LQKA 2C9OA 3R9XB 2HCJB 2IHBA 4WCFC 3I61A 2XZDA 1BHQ1 2PGLA 4V38A 1CF4A 4J0JA 3E9EA 3ICVA 4UXIA 4NJMB 2NV6A 1X94A 2PE5A 5HRCA 4Z9AA 2V3CC 2RIRA 5LYJF 3V97A 1SGWA 2OBFA 2PZLA 3F1KA 2YVQA 4XIGS 3CLVA 4MRMB 1XLVA 1YS2X 4KDFA 3Q3JB 5KUTA 1T3GA 4H08A 5LBIA 5B1EA 2Z56A 1JDVA 2CB0A 2EGHA 1CJBA 1HK7A 2J3EA 2PZJA 2R1TB 3H3XA 3VZRA 3WO0A 4AMYA 5IM4F 5KPJA 3IR7A 1OLUA 2VRBA 3JYLA 2A3NA 3E1GA 4BO3A 1YKSA 4O4HA 1ORVA 3S7TA 2JAOA 2BYTA 4JBLA 3AUSA 1BHO1 2HRDA 3ZNPA 2O8DB 5IW8A 3LU1A 4QOIA 4TMZA 3AVVA 2NXCA 1KZGB 4Y98A 1ZBDA 4KIGA 3EEFA 3HJUA 2NO9A 3Q3HA 4BMVA 4IHQA 4BKRA 3N39C 3UHJA 3ZU2A 3JYPA 4MV9A 3CYFA 4ZMRA 1CC1S 1H0RA 3KZNA 1UC8A 1QWSA 2PXXA 4KH1A 3WV4A 3USZA 2R2GA 4JFRA 1AMOA 4GSKA 4YQFA 4G36A 3CCCA 4Y0AA 3UHPA 4DYVA 4PYOA 3GL9A 3VZBA 3FTEA 3PD1A 2I7TA 4Z7OB 1RU3A 3BJZA 3RSLA 3CR7A 2NVWA 4RH0A 1PV2A 1PRYA 4YJGB 5DXJA 4IQ8A 3VM6A 3SYRA 2ZZMA 3R1IA 3I32A 4KLRA 4PO9A 4NCXA 2IEIA 2O4UX 5CBPB 2A5FA 4B71A 1NUQA 4XCQA 1BWQA 3TE6A 1PJ2A 1A2OA 1PAUA 3DOCA 3PFBA 4ZOLB 1XC7A 2CW5A 2Y92A 4BATA 3MWDB 4C5AA 1CJSA 2WD9A 1G4HA 3CNHA 4U7GA 1AUXA 2I4TA 1AKQA 5F3DA 3AJDA 2PUDA 2J3JA 2PQ6A 4KBYA 4R81A 5J2UB 3F1LA 2NTYC 4QQFA 4TTAA 5I7FA 2IZ1A 5AJZA 4L9AA 3LQFA 4I5DA 4R2WA 2WZBA 2ZSAA 3CEMA 4IO0A 3F6EX 4XWWA 1G64A 3T9FA 4IFTA 2I2AA 1W8DA 4K88A 2COKA 2VJBA 2XQJA 4LVNA 5J4VA 4CYMA 4MEJA 4EDFA 1L3CA 1RPAA 1UWCA 1X2BA 2A0UA 4UCXA 1KFEB 1O6ZA 2XRYA 4DM7A 2VPWA 1LI4A 1NXQA 2X76A 3T5TA 1HKHA 1O87A 1DS6A 5FWAA 2HDHA 3VYSB 1XZHA 2A2ZA 3HCAA 4L0QA 2HQRA 1EGMB 4YR9A 5DN6D 4CKEA 4EJ2A 3OFSA 3D31A 4PPQA 3WYNA 3ZCVA 4D82A 5IHPA 1ZIPA 2JDIA 2VSXA 2NUPB 3ZKAA 2WSSD 4TUYB 3U1VA 5JLJA 1EEXB 2A9VA 2CVFA 1M7BA 1XJQA 1C7FA 1XYGA 4H7HA 4R1LA 4MQUA 3VKWA 3ZPXA 2ZYRA 5LL6P 5LNK1 2G71A 3IUSA 3SKVA 3CIFA 3K73O 5J2TF 4IFIA 1LBSA 5DBFA 4ZVRA 4W8OA 2ZBPA 3WMGA 5KYYA 4CDNA 5IKXA 2XR1A 2VP0A 1RM0A 3SXPA 5L7WA 1YCHA 3AVUA 3UNXA 5IRCD 1T6ZA 4C76A 3UWPA 1C3OA 1T2FA 4EZEA 4YMVA 1SUFA 3IUEA 2Q49A 2QX8A 4Y2SA 3U26A 3VDMA 3DBLA 2GEJA 1E8DA 1FSZA 3KYIB 2RHWA 5EWLB 2E7ZA 1KTIA 2XOKD 4RGYA 2H7CA 2XKBA 5F2KA 1K92A 3W8EA 2C77A 1SELA 1SU6A 2OFPA 2JIMA 1VHTA 1LK0A 4K9SA 4AN4A 3KQSA 1QQBA 1UZAA 4PAMA 4YMSA 5JZOA 1XEFA 1LX6A 2ORVA 3CT4A 4RVHA 4V0KA 4E2WA 4GI7A 4RTQA 3A6EA 4BEVA 2AVNA 1TUBA 1YOVB 4B73A 5MHTA 3WOVA 4AW9A 2AZMA 2X0RA 3LC7O 4NBVA 4U02A 2X4GA 1EFCA 3RJ5A 1M5UA 1E98A 5K45A 3M1YA 2XQVA 1DAKA 1STOA 5CDHA 1E7RA 5CURA 1AKVA 3RC7A 2I4OA 1J0CA 2ZIWB 4ZVLA 3PR3A 4LJYA 1P33A 4B35A 3HU5A 4ZU6X 1G38A 2SCUB 2VQ3A 2L0XA 2AQ8A 3FGZA 2POCA 1Y3DE 1Y5RA 4C0KA 4CNBA 1XMSA 3G89A 3URMA 4D4JA 5ALXA 1XFDA 3RJTA 1E3MA 3AG5A 3R7DA 1KGDA 1UXKA 1BN6A 1FTSA 1YZKA 5THQA 4KQFA 9ATCA 2G6BA 4G23A 2YL2A 1QZZA 3D6HA 3BWMA 1JWLA 3AVXA 3AUUA 1KZHA 4K9PA 2P91A 1UAGA 3FTPA 1P9OA 3JAWA 1UCFA 2MSDB 1SVWA 3L8MA 2AC4A 3ZH2A 5LVAA 4R9UC 4EVQA 1HSOA 2UVQA 5F7JA 3HVRA 4JJZA 4GC9A 1OAAA 4LAFA 1U28C 4R8KA 4Q9KA 4B7AA 5TARA 2GEDA 4MVXA 1G8FA 4B3XA 4CM1A 5JH7F 1R27A 1BEZA 4X3OA 5JJKA 1ZK3A 2QEQA 3BPSA 4M46A 1ZK4A 5E1OA 2BEVA 1GRCA 1B6TA 3DHEA 3N58A 3FTFA 3KUXA 1E7SA 3ZHSA 1QDLB 4JOSA 3NYWA 3UK2A 4O4IA 5FI5A 1H1LA 4TV9F 2Q3HA 4EHAA 4YT8A 4D80A 2R62A 2BHRA 2YV3A 1SBQA 2Y1CA 3I58A 4MDYA 1E3LA 2I3GA 4KMOA 2JCGA 3SD7A 3K9LA 4G5XA 5AVXA 4RHYA 2J45A 2C9BA 1Z74A 2P7HA 4D3YA 1C5KA 1P2DA 2FFAA 1RADA 4LIPD 2PMEA 1Z4PX 2F3QA 3B1KA 2H1FA 4QDUA 3T9EA 1NQWA 3JQPA 5F1KA 5LU8A 1L6RA 3I01M 3N0XA 1HL7A 2WUDA 5HK9A 1TJPB 4UHFA 2A30A 1C7QA 2QY6A 3GDFA 4MINA 4U00A 1SC3A 4AJNA 1FJHA 2X40A 5AW4A 4LSGA 4JX8A 4RKYA 2A9KA 5DMXA 3WGHA 3KKEA 3SQLA 4XUCA 1WCV1 3WGIA 4WBNB 2AC7A 1VJ1A 1XPJA 1AY0A 1N3BA 2R8YA 4V0ME 3SWWA 3D6UA 1M6EX 1NSFA 1F0KA 3GRYA 1JDUA 4PNZA 1D04A 5DFAA 4EHIA 4IVNA 2GKSA 2EJUA 5H16A 1GKIA 3E8MA 3V1MA 1PZNA 1RXSA 3RIGA 5LJLA 2M2IA 4NENA 1SKMA 1ZL0A 2FWRA 4MRAA 3QM1A 1P5RA 3I9OA 2FDCA 4P1ZA 4Z53A 2V5AA 3GAMA 3DAGA 1TQDA 1GDTA 1KE1A 4LY6A 1QRAA 3H3JA 2OZKA 2WOOA 2J7PD 3D6TB 3EFHA 1P7WA 5JYCA 5JBQA 3UWOA 3HNRA 3AR7A 1QVRA 4BJ3A 2CDBA 4O2BA 2G1UA 4WZZA 3LTNC 1G8GA 3WTCA 2R96A 5ERXA 4DVJA 4ZQBA 5K2OA 1IE3A 2XB6A 4XGQA 3V4SA 3W1VA 3B51X 3ZGNA 4Z1MA 2BF4A 3IHKA 4D8WA 2O0LA 3KXPA 3QXHA 3H9EO 4QJ4A 3SAJA 1F8UA 4GDMA 4HYQA 3HHPA 4O29A 1M5TA 5BR1A 1GA4A 4FGSA 4AM8A 5HZGA 2XAAA 1H2BA 5DYNA 1V7ZA 3L7YA 2BGGA 1WLYA 2WIAA 1PZHA 4EJSA 2PUVA 2X0JA 3KJEA 3E82A 4IMRA 3WKCA 3F3KA 4V03A 1THGA 2E4YA 3VOSA 4YCNA 3JQGB 1JYFA 3KQQA 3RWOA 2TYSB 2ZYIA 2VWGA 1JWAB 2PSJA 2VJDA 2BEUB 2BI8A 4WKOA 5ALOA 3RNOA 2PGAA 2IYPA 1J0BA 4Q21A 3TLEA 3ELDA 2VDWA 4ZDIA 1SBCA 2XQKA 1KK1A 3LHFA 2AFHE 1NQOA 3I2HA 2WF8A 3KQHA 3T5BA 4AICA 1D6SA 2XUZA 3O93A 2LIVA 1DKOA 4KNWA 4L74A 5JE8A 1GUDA 3TIFA 4E70A 3KB8A 2PMBA 1KPGA 1UBCA 3HB7A 4Q9NA 4UFPA 1Z6ZA 3ZHXA 1F6WA 1RNLA 2ZATA 1L3IA 1Y7LA 3K5IA 1MTZA 1D6NA 1VPEA 1DX9A 4YAWA 2OR3A 2CVPA 1I30A 2R0QC 1NF3A 4M1ZA 1SCBA 3LXXA 1W0JA 5AKIA 4AZ3A 1NXSA 1UADA 5ELLA 2YY7A 3FRHA 4B45A 1E9AA 1UBLS 2WWXA 4DBLE 5KAPA 5FA5A 1JLMA 2DR0A 3UT0A 4H1UA 2CD9A 2I66A 3PNKA 4OQEA 4MA0A 1YS7A 1RAGA 2I8CA 4WZAB 1H2YA 3S29A 2X7XA 3ZY4A 1MOQA 1T0HB 2DBRA 3M1IA 2XVAA 4IV8A 4MI1A 1TJ5A 2GDZA 3L7BA 5LBUA 3ZD8A 4GPEA 1GZVA 1JKMA 3ZW8A 4R1MA 3VYVA 4OHWA 1CUIA 4NG5A 2HX1A 4OQQA 4BNDB 4KLCA 2P5SA 3VSBA 3K92A 1FTYA 3LBIA 1KO7A 1QMGA 2ERCA 2OORC 4WECA 2I99A 3VR2D 3DVAB 1FYDA 1YH3A 4PVCA 3DAOA 2AJCA 2BI4A 3D7KA 3VR0A 3ZHUA 1UFKA 3ANMA 3OE4A 3OP4A 2A14A 4J0IA 2OYRA 1E96A 1Q2UA 1W73A 1TU0A 4R0MA 2P9ZA 2GPYA 4QVGA 1OB2A 5ENVA 1JEYA 2EF0A 3FMPB 4GMXA 3OAAA 3ZCXA 2F3TA 2WJZB 3EX7C 5FAXA 3DQZA 1IY0A 1CDDA 5E0KB 1IUPA 1D1PA 3C2QA 4NH0A 3PGKA 3OTOB 2IY7A 5EIOA 4OHMA 4ZVMA 4RZUA 5TS3A 3KYBA 1WR8A 2WIKA 4W6ZA 3TRHA 2QZ9A 3DE0X 1QOQB 3IEVA 1KRWA 1GM5A 2BGMA 3TMAA 3IOMA 3B6MA 3AFIA 2Z2ZA 2MMCA 3A6GA 3IIJA 1E6EA 4ECEA 3PRYA 5CHYA 2WLTA 1FS6A 2WIJA 3VOBA 4BRWA 4BWFB 2EHDA 2ZUEA 2PLRA 1XG5A 1EBBA 2J5BA 3WBFA 4YT2A 2PKCA 3K0FB 3VI3B 3NEJA 2UZ4A 4JYZA 2IHYA 1DELA 1VLHA 1U7DA 1WUYA 3MK31 4DIEA 2YQ5A 4G24A 4NP6A 5G3ZA 3TD6A 4CR8A 1Q0UA 4G0UA 3DPUA 2P9JA 4ZCPA 2ZE8A 4QBGB 4KUEA 1G19A 3N07A 3I52A 5E1MA 4PZZA 4BO5A 1CEQA 2CNWA 3DTVB 4WNAA 3Q10A 4M0LA 1SXJD 1Y1SA 1CUBA 4OXKA 3NVDA 3VV2A 2J7KA 5KYWA 1C1XA 5MFPA 2IHZA 2JH3A 3BC1A 1OU0A 4UBOA 2CE2X 1VE6A 4LXYA 1PQPA 2EIHA 4EGAA 2Q0XA 3AQ4A 4M7OA 5ALPA 2ECQA 4G0OA 4M55A 5KJ1A 1E3WB 1GNTA 1YI0A 2DY1A 4F4FA 2QAIA 1C29B 1B8PA 3EGEA 5IANA 1J56A 3EPHA 1U1FA 1XMXA 3ENKA 4NYMR 4XSHA 3I9KA 2XZPA 4LZAA 2E1PA 2RBKA 1I1HA 1QB7A 3ACDA 3D4PA 3MQFA 4DILA 1G8PA 4LWOA 5I9LA 4AAYA 4FFRA 4JH0A 5JQWA 4AZSA 3MUNA 2VEDA 1IQPA 2I33A 1IIBA 1YCGA 3JWGA 3K9GA 3KE8A 1BEUB 4P2BA 5JS7A 4XUGB 2BBTA 2DYKA 1WU8A 2VYNA 2H1WA 2AR9A 3DA8A 1QZ3A 3N2GA 4YVFA 2CJWB 4F04A 1YACA 2NACA 1RWXA 4NOMA 2XNHA 3DE5X 4NHEA 4QGBA 4KHZA 4LHZA 2PBZA 1MVOA 1MJ5A 1Z5PA 4GE3A 1JPUA 1EXWA 2P1RA 4IDQA 4CMGA 5HUQA 4YUYA 3H5LA 3AU8A 5DLEA 5FUMA 3NTOA 5K8UA 3ICQB 4XE5A 3H4IA 3VOTA 1GLNA 3QBJA 4NPHA 3A9SA 1L5RA 1X7ZB 2GPNA 3DFKA 1KARA 1OLSA 3D3JA 4FZ3A 2GLTA 2GN6A 1WOYA 1IBMB 5CM9C 1W96A 1FMFA 3FYTA 4IJUA 1DU4A 4K5QA 4W8HA 4HRAA 1NHGA 4JVNA 2BKVA 1P8AA 4PRYA 4DUGA 2JH9A 1NNSA 4DDWA 5IYZB 3K8ZA 1DC4A 4PTLA 1NULA 4MR9B 1GHTA 5JRZA 3LNTA 4MGHA 1TLLA 1JR3D 4LF9B 1V1JA 4UATA 1RRPA 1LV8A 1L4NA 2WHRA 4HDKA 4QX6A 1WY7A 3SR4A 1YB2A 4TN1A 3V4ZA 2DQSA 5T67A 4C4AA 3OE7D 3I3OA 3R44A 2XA2A 2UZAA 2YV2A 3C1AA 3EIFA 5AXDA 3UHFA 2B8EA 3V2IA 4ZGBA 3HKDA 4EHDA 1WXEA 2WWVD 3W2HA 5CLIA 1MOZA 5L4SA 2UUOA 2VK2A 2X8BA 3TVTA 4OATA 1KEUA 3I72A 2QLTA 3E5MA 5D2CA 2KWIA 4OHRA 5I5GA 4BUJA 1PHPA 2FWJA 2ZJ0A 3AEKB 1PKEA 3V1YA 2GBPA 5FI1B 2V3WA 1GT91 3HA5A 3GEIA 2HPZA 4JP8A 1TA4A 4JB8A 3NETA 1W0KD 4Q3KA 2HMWA 3EF3A 3GD5A 1X1DA 4PZAA 1ZU4A 1N25A 4DAOA 4EQ6A 5AP9A 2QRNA 2QVZX 3EYAA 1N33B 3IKTA 1LF0A 1HE4A 3FHCB 4L95C 1IWBB 1MB9A 2XNKA 4Y2JA 3OU7A 3UQYS 3R9KA 3RFVA 2DQ4A 2E5WA 2JCYA 3A25A 1K8YB 2QN7A 2QROA 4BVGA 4DLZA 4RC9A 4UHDA 4CIYA 3QXXA 1UBTS 2CL6X 3QH4A 1YV9A 2PEYA 4J0DA 3WK4A 1PW7A 1R4ZA 3CPEA 1QE5A 1XDSA 1XD9A 5JWRA 5EZYF 5LA6F 2RFLA 2OM6A 4EUHA 4ZICA 5JVDB 2GR9A 2PWBA 3JATB 3HDGA 1H8HA 1M8KA 2QA5A 5A7FA 3W5JA 3OSZA 4NE2A 4E0BA 2QIOA 1IB0A 1USWA 1AGYA 3RK4A 3HJAA 3N2LA 4MULA 3MINB 1DMRA 1Q7BA 3A7DA 3OIGA 4QSMA 5DHPA 3LLSA 3Q88A 3ROFA 4ARAA 5KC9A 3KD2A 4RBNA 3ZN2A 2R1VB 5C7IO 3D1LA 2P67A 3T7KA 3OKAA 1H2ZA 1VG1A 1ZGZA 1JBQA 4EW2A 1HORA 2QPOA 4G81A 3KKLA 3ZGOA 1XZFA 2IIVA 2X8JB 1P31A 2PO7A 1OREA 1PNQA 2JKVA 2Z08A 3ETDA 5COBA 5H5JA 1BWRA 3T7AA 5P21A 1PI3A 4CL2A 2CC2A 2J3IA 2ZIFA 3CNLA 3DNMA 1JEJA 3RYHA 2C7GA 2JFBA 2YYZA 1WB9A 1WB5A 4A8JB 4D25A 3RW9A 1NUSA 3DLCA 1Q0RA 2GK7A 3PSAA 1BQ3A 1AUOA 5CA0B 1KSHA 2A9PA 2HCTA 1K3FA 5LDGA 2VPXA 3KC2A 1P9RA 2HLHA 1M1NB 2LZ0A 4UTZA 5EGNA 3R20A 2PUEA 4X1KA 4A8JA 4Y1RB 3NUGA 1CP2A 2ZIEA 1GEGA 2WPDA 3HVKA 4N0MA 4X41A 2QL6A 1PR0A 3PXUA 1Y4ZA 4H0CA 3CRRA 4ASUD 4BNGA 5ITVA 1T0IA 1HL3A 1HDEA 4MJLA 4NCKA 2ZYAA 1J49A 4W5WA 5AKJA 4B33A 2UVDA 3OURA 3WK6A 1LWNA 4ZVTA 4FYVA 2HT6A 3BYZA 2OZVA 3C7AA 3KYJB 1DIOB 1GG5A 1DUVG 2GYUA 3PUJA 4Y9UA 5HKBA 2WTXA 4LGYA 2JLRA 4RPKA 3B5JA 3H2BA 1SCKA 4YK7A 1TCVA 1EGQA 5C3UA 2QMHA 4QO7A 1U8EA 1LBHA 3AVWA 4F8YA 1K2VN 4HTFA 4XWOA 2X3YA 3DE4X 3WGKA 3EOAI 4MIKA 2EU8A 3T7JA 3D8NA 3LA6A 1TXGA 2BM1A 3ZKWB 4Z1OA 1XTPA 4RHTA 1CSEE 4GQBA 3GEMA 1X1CA 1U2TA 2A0WA 1KJZA 3BJIC 3WK8A 1HNWB 1BE0A 1OA1A 1YRAA 2FXIA 3DONA 1RFGE 4Q4HA 1SXJC 4RMHA 1KMNA 3AI2A 4CKZA 4ARIA 4GP6A 3HVJA 3EXEB 2A67A 3G0HA 4QPJC 2QV0A 1SCUB 4JQOA 4OFXA 4KLNA 4KX3A 4B8WA 3BHJA 1KH2A 1DCTA 4LYJA 1VMAA 4LCEA 1V71A 4IGEA 2WJWA 4JQCA 3IJ5A 1EE9A 4Q9JA 5DKFA 5GM2A 3TM5A 4B44A 1OPXA 4BQNA 4D0NA 1DHRA 3FZNA 1BO6A 1U5BA 2F67A 2H3EA 2TMGA 4JJ4A 3VC7A 5F33A 1E2LA 1W36D 2O3RA 1XTSA 2R1ZA 3FPKA 4GPAA 5HCIA 3SBXA 1R4MB 2IZ0A 5G4LA 3VR5D 3INYA 3OWOA 4OHXA 4S35A 5TDHA 2HMSA 4EI7A 2GNOA 2C9ZA 3AIMA 3CM0A 4HTAA 5ER6A 3ZJ4A 1MORA 4YQEA 2IPMA 1B74A 1YQWA 5BVGB 3B3FA 1X1TA 1D2AA 1YU6A 1AQUA 3OPXA 4IICA 1EI9A 2BFCA 2FHPA 2C8KA 3VMFA 3EZ6A 2ISQA 4C2BA 5KHLB 3CUUA 4NRDA 2ZTLA 4NYMQ 5ECWA 3TX6A 2AKAB 2CWWA 1BW9B 1NBOA 4JDUA 4WV3A 4Q4CA 4ZCMA 4N5LA 1AKTA 3T5PA 1N9GA 2AMYA 1BH2A 1ZXXA 2GSDA 1W76A 3EZNA 3TG8A 3GJQA 2HDWA 3ITNA 4OKIA 1EUYA 3IMKA 2HK6A 1NDQA 4GM0A 4LYEA 3W7VA 1KQ3A 1SB9A 4FD2A 1V16B 1T8TA 3ZC3A 5K6AA 4AKTA 1YE5A 1JR6A 1E1DA 4NYJR 3GLHE 1CRZA 3NUZA 1EXMA 2VRWA 1NBWB 1FP4A 1UBSB 4U3JB 5FTMA 1GPBA 4BX0A 1GAXA 2BJVA 1LPSA 3T1YB 1IYZA 4KH0A 2A9RA 4LYHA 3I2IA 1NNI1 1HT2E 2WJYA 3CSSA 3LUGA 4LYAA 4ND5A 2VT7A 1P7ZA 3PHHA 2KQUA 2BEWB 3GAFA 1Y7HA 2XUAA 3N5KA 1EEHA 2RC5A 4IDCA 4BPRA 3ZXIA 1OWLA 1NV9A 4P82A 2IP4A 3SYLA 3PWZA 3VRHA 3D5EA 3DEHA 4B83A 1U7WA 4TV9A 1CLUA 1GLGA 1KIFA 3TQCA 1E5DA 3DHWC 4FYKA 1YJAA 2P4QA 3UMFA 3ZWWA 3D7NA 2G9RA 1NVFA 3IAM1 2ACEA 3WRVA 3WQHA 2P2ZA 1KYZA 4GQIA 3TLCA 1JFSA 3VPGA 1BDJA 1DDGA 2C61A 2C2OA 2OXFA 1QCDA 4AO8A 3GW8A 3EY9A 1I3NA 2WM3A 3DEZA 3A06A 4HH3C 5CT4A 3ZU5A 1Q3KA 2J41A 3MWJA 3P94A 4RK5A 4XIFA 5EEHA 5AVVA 1QHSA 2IKQA 5IT4A 3UAXA 4B43A 1QOZA 3H1FA 3KCNA 4KBGA 1PBTA 3TTSA 3LCVB 3BT7A 2HK9A 4ISBA 1JQ3A 1J00A 2V98A 2WM9B 3IBYA 3FCXA 1E6WA 5A7HA 5HZKA 5KYXB 4DCSA 5GZ1A 1ZWKA 3LIIA 3WBJA 4CFSA 3HDJA 4K0RA 2I67A 4RABA 4WD3A 3JX9A 2GZHA 5L3SB 2ZCUA 4YB8A 3SF8B 4OJMX 4U2DA 4YC7A 1HDYA 3C3YA 4ER5A 3N70A 1AVTA 4K8OA 2ANBA 5IS2A 4MAAA 4HH0A 4K9DA 1VLVA 5HJEA 2A3RA 3UC9A 4XEUA 2PUAA 1SC9A 1ZGHA 2CYAA 3AEUB 3Q8XB 4QLBA 1Z6YA 3GX1A 1R2QA 5DNAA 1L4KA 3UAYA 4MR7A 2ID8A 5JZVA 4RZIA 1I7DA 3ADOA 2Y77A 3CR8A 1WPRA 3NVAA 2XE7A 1Q22A 4PZPA 4IQ4A 5AM1A 2AUTA 3AI3A 3V8NA 1NF2A 4H3SA 3ABQB 3X43A 2GD2A 3H0EA 5JSZB 5JCJA 4HEJA 1L2TA 1P60A 1K4MA 4YMIA 5KWEA 1EWQA 2H9AA 3B3AA 4G5OA 2QZ4A 1AQLA 2D5IA 2VNAA 3H9BA 4UTOA 5ALJA 5DLQC 2YNMD 6YASA 3EASA 2O5RA 5CA1B 3R09A 4HGYA 1OHHD 4LSZA 3AUYA 1Y3BE 4TV8F 4H18A 4UAJA 2EJTA 5KNDA 3VFDA 5IJ9A 4UMFA 3AM5A 3DVLA 3WIUA 4ZI7B 3DEKA 2O1SA 3MLAA 1JDZA 2ZIZA 5JCXA 4C6HA 3ZE7A 1O3YA 3K9QO 3UT5A 1CZHA 5AK3A 5BN3B 4PXSA 1YZUA 1D0VA 2PKRA 4L85A 2QRKA 2SKDA 1E9EA 4PQYA 2A0KA 1N7GA 3ZWBA 1PJCA 4DDVA 5JFTA 3FSGD 4J03A 4MUIA 2ZVJA 2ZTVA 4JQZA 1YR6A 4KPGA 5LXTF 2CF5A 1TIPA 2XPCA 4IIJF 1XCOA 3AKDA 1NF9A 5SZIA 3WBBA 1KOFA 4BIIA 1HMPA 3OZVA 1XZIA 3ZDFA 2B3TA 1LDYA 4GW3A 1RQ2A 5A9TA 5T7BA 4O4HB 3VNQA 4D3SA 2AK3A 2XTMA 3NM6B 4DLUA 1E2NA 1UAYA 4LE0A 4TT8A 5JY6A 1JEDA 4Q1FA 2Q5QA 4BWGA 2FW8A 3BERA 3KFLA 1E2FA 1ZIDA 3Q6IA 1X6VA 2P5TB 2IOYA 1T9DA 1A5AB 1TVEA 3MCAA