4B4WA

Crystal structure of acinetobacter baumannii n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) complexed with nadp cofactor and an inhibitor
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
282
structure length
282
Chain Sequence
b'MALVLDGRALAKQIEENLLVRVEALKAKTGRTPILATILVGDDGASATYVRMKGNACRRVGMDSLKIELPQETTTEQLLAEIEKLNANPDVHGILLQHPVPAQIDERACFDAISLAKDVDGVTCLGFGRMAMGEAAYGSATPAGIMTILKENNIEIAGKHAVVVGRSAILGKPMAMMLLQANATVTICHSRTQNLPELVKQADIIVGAVGKAELIQKDWIKQGAVVVDAGFHPRDGGGVGDIQLQGIEEIASAYTPVPGGVGPMTITTLIRQTVEAAEKALG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL PROTEIN FOLD
publication title Acinetobacter Baumannii Fold Ligand Complexes; Potent Inhibitors of Folate Metabolism and a Re-Evaluation of the Ly374571 Structure.
pubmed doi rcsb
source organism Acinetobacter baumannii atcc 19606
molecule tags Oxidoreductase
total genus 105
structure length 282
sequence length 282
chains with identical sequence B
ec nomenclature ec 1.5.1.5: Methylenetetrahydrofolate dehydrogenase (NADP(+)).
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
A PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b4wA01
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 4b4wA02
4JXKA 1ZNQO 2JFFA 3ZWAA 4FBGA 1ADCA 3ENNA 3ETEA 2HCTA 5JAQA 4EYEA 2GZ2A 2XXBA 2YV1A 4OOEA 4NBVA 5CFZA 5G0UA 4CLDA 3H6KA 4ZQEA 1IYZA 3C1AA 3KETA 3RKRA 4GQAA 5CPBA 2GYYA 5GZ3A 4RDHA 4KDFA 1YDWA 1AXEA 3K5PA 3W6ZA 1JWBB 4C7JA 4YXFA 2PKQP 1JU9A 1N9GA 1NQTA 2VRBA 4JNKA 4FJ0A 2WMDA 3DBVO 4E2YA 3BIOA 3GUCA 5BR7A 2EKLA 1YWGO 4DLLA 4I8XA 3AI1A 4WOJA 2DTEA 3ZV4A 3U49A 5H81A 3VZSA 2B37A 3GVHA 3UOGA 4BGEA 1X15A 1KETA 3GDOA 2J8ZA 4FFRA 4CUJA 4QTZA 4NBWA 1ZK0A 1ZO8A 1NQAO 1GD1O 3JSAA 4DYDA 2QIOA 3QA9A 4WGGA 5JCJA 5JYEA 2EJWA 4YJDA 5ES3A 3RBVA 1Y7TA 4YJGA 5HA5A 1KYQA 3ZWWA 1HE5A 1E1NA 2ZCVA 5DP1A 4L74A 1AUPA 5I8WA 1I3MA 1ZKMA 3OQ6A 2ILTA 5U9CA 5F1PA 3NJ4A 1VLLA 3OSUA 5LCXA 4PIVA 3WFIA 3WQQA 4CLOB 4JROA 4TMFA 1JKIA 3INTA 1HDCA 3DEYX 1DSSG 1VSUA 4O1MA 4GX1A 5A3VA 5G0VA 1JTVA 1DPGA 5KVQA 1WNTA 4W82A 2NADA 1Y81A 2Q2QA 3QV1A 4J4TA 3T4EA 2VZ0A 2HK7A 1RKXA 4E21A 4HADA 3TRIA 1Q0HA 3OH8A 4FFNA 2FMUA 3ZZNA 1HYEA 3ST7A 4B3HA 1DIRA 2GF2A 5A04A 2G82A 3ULKA 2G0TA 5TRTA 4EZBA 4QFDA 2PH5A 1T2AA 3FN4A 5JNLA 1ZK3A 5DP2A 1WDLA 1FMCA 5DN9A 4KZPA 1F17A 1M6HA 2DM6A 2XF8A 3QWHA 2EF1A 4GX5A 3JQDA 1OI7A 2PLAA 4MPDA 4R68A 3EW7A 5CPFA 3FWNA 5IDXA 5EN4A 1H2HA 4E5KA 5JCJD 1J4AA 1XG5A 2B69A 1PGJA 3NUGA 3TOZA 1X7HA 2NVBA 3OJFA 2EV9A 4R51A 1HE3A 4K6FA 4ZRNA 3VHRA 3I4CA 3W4JA 4F3YA 2IE0A 1RYDA 4OOFA 3H9UA 5JLAA 3X2FA 3U5TA 1WDKA 2AQKA 4B4WA 3H8VA 1P0FA 2J3JA 2Y99A 3NGXA 4OKNA 2X7HA 1M6WA 3H65A 1YJQA 4NU5A 2YDYA 1DC3A 1LSJA 1ZSYA 2BFPA 3BMNA 4IS2A 5JYDA 1P1JA 3PEFA 2BI7A 1N92A 1H9BA 5AYVA 2B4QA 4K9DA 2GLXA 4O59O 1DIGA 1C0KA 4WKGA 2JKVA 5FFFA 1LDMA 2QX7A 2VHXA 5G4KB 1E1LA 2CY0A 3JD1A 3UXYA 4BB5A 2GPTA 5F1KA 1E7SA 1NVGA 1ZJYA 2EWMA 3GHHA 1B8PA 1GCOA 5AOVA 2BGKA 4GAEA 4P22A 4DGSA 2C29D 2V7PA 4CM6A 1Z7BA 4J9VA 4O5OA 2AMFA 2GN6A 3VPHA 5COAA 3VZPA 4JBHA 1NXQA 1XIVA 2UDPA 3H9EO 1LA2A 3R3JA 2WYWA 1EE9A 1E3JA 2IZZA 4XDZA 1K89A 4DVJA 1XDWA 4E33A 1CYDA 2VTEA 4ILKA 5A05A 1DC5A 2W2KB 3L0DA 1R12A 3H3FA 1O8CA 3ANNA 4B79A 4RL6A 2NTJA 1ZBQA 4NFSA 4LVCA 1EDOA 3DMTC 4PRKA 4R69A 4CM9A 4DLBA 2CUKA 3PDJA 1B3BA 5ICSA 3AFMA 3DMYA 3V2UA 3A28A 2C07A 5EPOA 5C37A 2WEKA 1ZK4A 3HUDA 1JLLA 3S2GA 1Y5MA 2RHRA 3PIIA 3A9WA 2VHZA 2O3UA 4TRJA 2GNAA 2DAPA 1R4MA 2SCUA 4HWKA 4J1TA 1P33A 1T26A 5ITVA 1O6ZA 3KB6A 2GCGA 1K5HA 3DWFA 4YJFB 5AXBA 3KV3O 2YYYA 5L40A 2YW9A 4OXNA 4R3NA 3M2TA 2NTNA 1N9GB 1F8GA 2Y1DA 4MVJI 4DRYA 2X0IA 2Y66A 4B3IA 3ZHXA 2G17A 3ONFA 3RJ9A 4WE3A 4CQMA 1MP0A 4O0LA 4E13A 5K6AA 2VOJA 4RZIA 4NBRA 4IJUA 3ROKA 1EVJA 4WNIA 3GQVA 3F47A 4LMRA 4Y6SA 2J6IA 1BXKA 3DAPA 4NFYA 1E7YA 1P9LA 3GEDA 4D46A 4Z6KA 4HNHA 1LSOA 1V3UA 3B1KA 4TKLA 3F1KA 2CF6A 4GWGA 1X13A 4LW8A 1PGQA 1LTHR 3EYWA 1NR7A 2Q4EA 4A0SA 1EUDA 4TZKA 1BDBA 2CZCA 1PGOA 4OL9A 3GZNB 2V6BA 4CM9D 3TFOA 4OQZA 4FC6A 4NIMA 3M1LA 1KERA 4MDHA 2HK9A 3I1JA 2H6EA 3PJGA 4I5GA 3ZDFA 3V2GA 5DULA 3JQBA 3RAJA 4F46A 1LNQA 1W0CA 4PLGA 2D59A 4RF5A 4GI2A 1XELA 4L75A 2GZ1A 4YJHB 1MB4A 3GVPA 1K0UA 2HMWA 3IUSA 1V3VA 3TDKA 4PCVA 3ZU4A 1HZZA 3GVXA 3E03A 1Y6JA 3F4LA 3I9OA 4AJ2A 1U8FO 2AQHA 4DYVA 1SEPA 4XA8A 1Y5RA 1UXKA 2OORA 4AJKA 3H5NA 3L6OO 2P5YA 1G0NA 2R2GA 1F12A 3SVTA 4W6ZA 1VSVA 4AFNA 1DC6A 3KM0A 5KJEA 4CQMD 1NR1A 2ZTLA 3OP4A 4OSPA 2O3RA 1QLJA 3PIDA 2P5UA 4A03A 2IXAA 3FD8A 4BNVA 1XSEA 2Q1WA 3G17A 3WLEA 2JFGA 4GKVA 1P1HA 2IXBA 1VL6A 5TSDA 1OFGA 1X7DA 1NHGA 5AXDA 3TZQA 3HDJA 4DXHA 5KJ6A 2JHFA 1B0AA 2GDZA 5IDYA 3RUFA 4BNZA 2BHLA 4N5LA 2VWPA 4DPLA 4EBFA 3MWEB 1Z73A 2CSUA 2VUUA 1I3LA 3K9QO 2DT5A 3EZLA 3TNLA 4UVDA 5COBA 3KTDA 1WW8A 3QVWA 4CODB 1GAEO 3ITKA 3NEPX 5CEJA 4CLRA 5KCZA 1LRKA 2G76A 3WYBA 1B8UA 4HX5A 2QRLA 5IAAA 2HO5A 4OMUA 3IKVA 1RJWA 4BQRA 1K2WA 4N5MA 1YGYA 5H82A 1A7KA 1T2FA 3VKUA 4BVAA 2NACA 2OO5A 3PI7A 4Z9XA 4DBZA 2FRDA 3CEAA 3OJOA 2EJVA 2WYUA 1C0PA 1E3WA 2VT3A 1ULUA 4ZQGA 6ADHA 3LSYA 1U4SA 3ZWYA 4BO2A 5ENVA 2B5WA 3QWBA 3O38A 2GD1O 1EFKA 3PLRA 5L7YA 4CV1A 3MOGA 2X4GA 4CMEA 2I66A 2OGUA 4PLWA 4J3FA 1PEDA 5T5QA 4AJHA 3PGXA 4KQXA 2JCXA 2P9CA 2UUPA 3OJ0A 4QO7A 2ZB3A 4XB2A 2OUIA 2Q46A 1V35A 1MG0A 3FR8A 1Y9EA 3DBLB 1PGNA 4D0SA 3TQHA 2V6GA 1NAHA 3KVOA 2OL4A 1LX6A 2V65A 2AXQA 4TVBA 1VE9A 3GY0A 4TZTA 1CF2O 3NKLA 2C20A 1E6EA 4WCFA 2D3TA 4ZU3A 3GHYA 2IZ0A 4U0KA 4YBZA 1X1TA 2Q1SA 3RUHA 1A5ZA 4CM5A 5C7LO 1IUKA 1NX6A 4AVYA 4RGBA 2I6TA 3NX4A 1GEGA 3SLKA 3KRTA 1PS8A 4A27A 5L4LA 1HLPA 2C5AA 2ZYAA 3HZZA 2GRAA 1O0SA 4NI5A 2PZMA 2IDZA 3FHLA 2O48X 1ZSNA 2ET6A 1PZEA 3EK2A 3JD0A 3LYLA 3I83A 8LDHA 3GN2A 1UZMA 2P9GA 3K30A 3KSZO 3N74A 3LLSA 2HUNA 1GUFA 5K6AC 1ZVMA 3LT1A 1MFZA 3OQ1A 3NT2A 4JJGA 3BA1A 2QG4A 4RPKA 2E6UX 4UVHA 5LDGA 2VT2A 2DBRA 3TZKA 1YDEA 3I4FA 4RDIA 2OXIA 3V5NA 3TL2A 1H6CA 5IJZA 3FRJA 5EINA 1EEHA 4XYLA 2CF5A 2R6JA 1HE4A 4KDEA 4RV9A 4YTEA 4BMSA 4F6LA 3AUSA 3F1LA 4XCVA 5CEFA 3MJTA 4JBIA 3KSUA 4O6VA 1W6UA 2EGHA 1OOEA 3AM4A 1LC3A 3GRKA 3ROQA 1U3TA 1PJSA 2I3GA 3ADPA 1PL8A 3OECA 4D79A 1ZXLA 2GO1A 4BO7A 4UAGA 3TPCA 5EMHA 1Q1NA 2NNLD 3AUUA 1P45A 2BMAA 4GLOA 4E5PA 3SC4A 4MVJF 2X9NA 3GOHA 1B7GO 2Q3EA 4G65A 2D1YA 2ZQZA 3HFGA 1QSGA 4F6CA 4BNMA 5TQVA 4GL4A 1M2WA 2X6TA 3CKYA 2YQ4A 3CIFA 2X0NA 1P77A 5TJ9A 1W73A 1I3KA 1A9YA 1KVRA 3UW3A 5KKCA 2OHXA 2CFCA 1V3TA 2QW8A 3R3SA 4J0FA 2JCYA 3CUKA 4FCCA 3DR3A 3BMQA 2Y1EA 3GDFA 2DU8A 4RORA 3I6QA 1GEEA 3DOOA 3FBTA 1I24A 2DBQA 1TT7A 2DVMA 3UH1A 1TI7A 3O4RA 2PGLA 1EK6A 2OBNA 4II2A 4EI2A 1D4FA 4FDAA 5BSGA 4XQEA 4ALKA 1YVEI 2Y67A 2DKNA 2GN8A 2YHIA 5BSEA 1ISGA 3D64A 4CMKA 4Q3EA 1B2LA 3WIDA 5BQFA 5EESA 1MC4A 3PHLA 4XR4A 4ALNA 1X1EA 3EHEA 4ALLA 3RC7A 4BGIA 1NWHA 1CQIA 1T4BA 2DFDA 5ER6A 7ADHA 3KO8A 4I5DA 2O3QA 3B6ZA 1IHYA 1LQTA 4PZDA 1P74A 3QRWA 3ZW9A 1WPQA 5DT9A 4Q3CA 1DO8A 5DDIP 4CMJA 3MOIA 3QVXA 3A06A 5GMOA 1HT0A 1OMOA 4BO1A 3E82A 4URFA 5IZCA 4E2XA 4GGPA 3DHEA 5ILGA 2NSDA 4ALJA 4JQCA 2ZTVA 4UVEA 2Q2VA 1T2EA 3MEQA 1I36A 3RC9A 3VPGA 4FGSA 4M89A 2JD1A 3DBHB 1NFFA 1I3NA 3H2ZA 2X23A 5JPIA 1MLDA 3RU7A 2AEJA 4PRLA 3WGHA 4B4OA 3JD2A 4ZHSA 1E3WB 1VJ0A 3FSRA 2RHCA 5JC8A 1PU2A 1DLIA 3GH3A 4XZ3A 3KZVA 3OHSX 1HKUA 4E3ZA 3O03A 5JC1A 1ZK2A 4IMPA 4R1NA 3AY3A 5KVSA 3MCVA 1BXGB 4AG3A 2BGLA 3GMDA 4FB5A 2ZJ0A 1KC1A 1MUUA 5JMWA 4YEDA 4DMLA 4GX0A 5JCXA 3OJEA 4RQTA 2X9GA 4XIJA 4BO0A 1KVSA 2E37A 3DQPA 4DLAA 3KYDB 1R4NA 3GAZA 4WCFB 4LVUA 3VDQA 2EHDA 2R00C 1KEWA 1BDMA 1KC3A 1E6UA 1LRJA 3JQ6A 1LLQA 4H7PA 3KBOA 3PPIA 2PNFA 4BNIA 2WTBA 3X2EA 4LISA 1M75A 3G49A 5JBIA 3LF2A 4CL8A 4IM7A 5BNTA 1VC2A 4CLXA 3EUWA 3TN7A 4NU6A 1GYQA 4FD3A 4E0BA 5A9SA 1LBEA 3D5TA 1GPJA 2NU9A 4HY3A 4DWVA 3JQCA 2B4RO 1GZ6A 1UAYA 4BV8A 3K6JA 1QXSA 1U3WA 4WEOA 2PZLA 1VPDA 3RUAA 3D1LA 1ZEJA 3PYMA 4OHUA 4CPDA 3EMKA 5TNXA 1BRMA 1UDAA 4DC1A 5BNFA 5JMPA 5JDIC 3PHJA 1ZK1A 5LC1A 1ONNA 2D8AA 3G0OA 4A7PA 4WLUA 1MA0A 4PVCA 1UXIA 1IULA 2JAPA 3S55A 4DPMA 3AJRA 3WIEA 2CVOA 5KNLA 1ISHA 3C7CB 4DQUA 3GZ4A 2DPGA 2P68A 9LDTA 4ONEA 4D42A 2ZKLA 1DRWA 1DC4A 3L6DA 2CDCA 1XA0A 3CXRA 3L9WA 3DMTA 3RCBA 5CDSA 3OIFA 3ZWPA 5B1YA 1Y8RA 3QWAA 2Y0DA 5CHEA 3WWYA 1C1DB 2RH4A 4GMGA 3CZRA 4E12A 1SOVA 4Q39A 1JVSA 2ZYDA 1UZNA 1KS9A 2D5AA 3WNVA 5I9MA 4I9UA 1M76A 3VPXA 5ITWA 4IPTA 4YWJA 4OXKA 4XYBA 3ZHYA 2HU2A 5I7FA 4KMSA 2TMGA 1SO8A 5JW6A 3DONA 4PLCA 1B8VA 3I9JA 1I2BA 5THQA 1KIFA 5L7WA 5IF3A 1P31A 1TEHA 3KLPX 4UEJA 1HDRA 1NPTO 1YL7A 2VYNA 3PWKA 2VRCA 3E1KA 4ZICA 2EW8A 1UZLA 3IDSA 3QHAA 2WSBA 5F21A 4IDCA 5KKAA 3RC2A 3SEFA 2YFQA 1ENZA 4ESOA 3HHPA 1X0VA 4BNGA 4KOAA 1RWBA 2NM0A 3F5SA 2YDXA 4RVDA 4ZJUA 4A73A 1DIHA 1I0ZA 3WFJA 4LRSB 1SBYA 1FXSA 2RH8A 2V6FA 3UGKA 1C0IA 1GPDG 2QHXA 3B1JA 3V8BA 1NAIA 1B16A 5EQDA 2YQ5A 2GERA 4ND3A 2OZPA 3T4XA 3U62A 3GFBA 4ALIA 4BV9A 3CSDA 4DBVO 4IDGA 1VL8A 4GKBA 1SAYA 4M55A 4IGEA 5IZCC 4R01A 1GR0A 2GUGA 2J3IA 2OMEA 1PX0A 1ADFA 4R4JA 4HFMA 4JJIA 3JQ7B 4OSOA 2CVZA 4LN1A 5KJ1A 3FNEA 2NQ8A 3F46A 3P5SA 1YB5A 3LC2O 4IUYA 3RUDA 2AQ8A 3PZBA 1EMDA 5IN4A 4OIMA 2O7QA 1YQXA 1LRLA 2JD0A 4BNLA 2VYND 4U6QA 3U4IA 1Q7CA 4YAIA 3ENKA 2VRCD 1O5IA 4JN6B 1DLJA 2C82A 3H4VA 3PLNA 4E5NA 1R66A 5JDCC 4D0RA 1ULSA 2NUAA 2VCYA 4L9RA 3UICA 2PH3A 2PWZA 2Z1MA 3IP1A 1DHTA 3H5RA 4BNYA 3QWIA 3PQFA 2EEZA 4W99A 1E0DA 3TL3A 2E82A 5KJFA 2GGSA 2ZATA 3IUPA 4CV0A 3JCZA 4BNNA 2ZIZA 6LDHA 2PGDA 4A2CA 4IY1A 1PTJA 4IGFA 4J49A 1YOVA 2UV8A 1S7CA 1K6JA 4AICA 4RVUA 4ND4A 3WGGA 3JYOA 3WDSA 3ICPA 4Y98A 1QKIA 3WWZA 1E5QA 2C7VA 2C7GA 3ZWVA 1JWAB 1ZEMA 3U4HA 1R4NB 2YFHA 1L1FA 4WK6A 2LDXA 3LK7A 4Y6PA 1LDYA 1GTMA 4TWRA 2DUUA 1SC6A 5CDGA 1U4OA 3AI3A 1I30A 1ZMOA 1NWCA 4JIGA 2A94A 1X7GA 1Y8QB 2WD7A 3EY4A 1ADBA 2WYVA 4RPGA 1Y9AA 2JJYA 3W8DA 4HKTA 4TSKA 1SB9A 5A9SB 3VKVA 5H83A 3RIHA 1I8TA 3GFGA 3MJSA 4WLEA 1BXZA 3IQDB 3GEMA 2V6MA 1G1AA 1TLTA 2NVUA 3A4VA 4OQYA 4PLVA 3DL2A 1R6DA 4R54A 5DCUA 3I3OA 2W4QA 3SJUA 2IYPA 1R0KA 3ZW8A 1NYTA 4J2HA 4DREA 1XU7A 2JHGA 5EL0A 4HBGA 1VM6A 3MJVA 3W4KA 1LSUA 1HXHA 2WD8A 1C0LA 2PD4A 4XR9A 3ZU2A 4HFRA 3NGLA 1L7DA 5DF1A 4AJNA 1GV0A 2Z5LA 1Y1PA 2GZ3A 3DDNA 2A4KA 3QP9A 3WMWA 1WLYA 3MWDB 4M1QA 4PFJA 4R41A 1T25A 4L73A 5DBGA 1J49A 3ICCA 2AE2A 3WGQA 2BRUA 1Q0QA 1SCUA 1EVYA 2FWMX 4WEQA 1U5CA 1EQUA 3IS3A 1ZH8A 1NVMB 4J43A 4LMPA 3LVFO 4B7CA 2CD9A 4Z9YA 3RBXA 5FYDA 4IIVA 3HADA 1L7EA 4E2WA 1E92A 4UULA 1PR9A 1ONPA 3IKTA 1TT5A 1GU7A 2B5VA 4FR5A 1K3TA 4R1TA 3OBBA 3VC7A 1NQOA 1HDZA 1TA4A 5B37A 4B8WA 1D3AA 2W98A 3RD5A 1XYGA 4EJ0A 2FSVA 4W4TA 1W4ZA 5A02A 4UUMA 3LF1A 1YB4A 1YBAA 1MXFA 4LSWA 2PV7A 3PRJA 2EP7A 4MKXA 4TRMA 4RVSA 2QQ5A 1IZ9A 4YRAA 4W7HA 5HS4A 4KP7A 1PJQA 5HWSA 1KEPA 4IXWA 2DTDA 3TFQA 3KYCA 1YL6A 2H1SA 4U7WA 2NLOA 4TRRA 3KEQA 4E31A 3QVTA 4GPD1 1P1RA 5L53A 2Q4BA 4CV3A 2EKPA 3OIGA 1QORA 1WMBA 2ZYGA 4DL9A 4I9HA 1SOWA 1YBVA 4YQZA 1N2SA 1VL0A 1DIBA 1WZIA 2PK3A 1DXYA 3AW9A 3CPSA 4YJGB 5F5NA 5AXCA 1PQPA 3F4BA 3MTJA 5IN5A 3IMFA 3VVCA 2EXXA 1PJBA 4DUPA 3MZ0A 5DCWA 4N18A 4H15A 4NJMA 4BKRA 1JVBA 1D8AA 2DLDA 1HE2A 1QV6A 1YH3A 3QQPA 3ANLA 1EUZA 3D0OA 4WLOA 4IQGA 4J90A 4EITA 3WQSB 2HMTA 3Q3CA 4WLVA 4B3JA 3H9GA 4YAJA 2CDAA 3CH6A 5L3ZA 4XX0A 1YE3A 2QZZA 2X5OA 4MJLA 4RLHA 5L51A 1OC4A 1LQUA 4OM8A 4IJVA 4AJ1A 1LC0A 3BAZA 3ANMA 2JAHA 3DAFA 4MKZA 3KOUA 5G4LA 4CR6A 4BO8A 4PZCA 3ETDA 4MP3A 4YA6A 1XQ6A 1EVZA 1PIWA 3NJ8A 2ZB7A 4OGWA 2J3HA 4CLHA 3WBFA 3WBBA 1MXHA 2NQTA 2OP1A 3OA0A 4S3MA 4YRDA 4R5HA 3RUIA 1E3IA 1PJ3A 3PHGA 4GX2A 3HN2A 2GN4A 4ZQBA 3OEWA 2B0JA 3QSGA 3VTFA 2DBVO 3VTZA 3VPFA 4AJPA 3VAZA 4J1SA 3HWRA 2E49A 3GVCA 3U3XA 4GVLA 2UAGA 1NP3A 1AGNA 2E48A 3ZV6A 4ZD6A 5TIIA 1HETA 1DFIA 4IDBA 2QZ9A 3RASA 1M67A 5IDWA 3IP3A 4NQZA 4CQLA 5GY7A 3E5RA 1FK8A 3I9MA 5G0WA 3WGIA 4TROA 2HMSA 4CM8A 2HLPA 1YQDA 4RF4A 1VJ1A 2VZ9A 2Q1TA 1FDVA 4FGWA 3GUYA 2QRKA 2NU8A 4MINA 3BMNB 1NM5A 2OFPA 3MJEA 4CR8A 4DIBA 3HDQA 1QRRA 1E1MA 3BTOA 3CINA 4UREA 1R37A 3LQFA 4TQGA 4FQ8A 2BFAA 5JO9A 3GGOA 3WICA 4B8ZA 3DZHA 3P7MA 4ITUA 2I99A 2VNAA 3OFSA 8ADHA 3FPLA 3UAGA 2EGGA 5JAZA 4IXTA 3EDMA 1ID1A 3ZWOA 3AM5A 5I7VA 1QYDA 2OBYA 1VKNA 3SJ7A 1HSOA 4I9NA 1EUCA 1GCUA 3ZGYA 3D7LA 4M49A 3DTYA 4UVIA 1S6YA 5FI3A 5TT1A 4IBOA 3TF5A 1ARZA 2RBEA 2YJZA 3HDYA 3RSHA 5T6BA 4YT4A 1A4UA 3VZQA 3E8XA 5FF9A 3OICA 5DOVA 2HRZA 1E7RA 2FSSA 3NTRA 5AVOA 3JQAD 4NMHA 3G1UA 2AG5A 3JYQA 2CMDA 3IL2A 4PN3A 3DBRA 3WQRA 1SZJG 4CM4A 3R6DA 1HDGO 4DIFA 3AM3A 3JYPA 1E3EA 3PHIA 3Q9NA 1IHXA 1ML3A 3BHIA 2AA3A 3FTPA 1N7HA 1PGPA 3JD3A 3P19A 3P2OA 2R00A 1GUYA 2HKIA 4UVGA 1E7QA 1R4MB 3RWBA 3CZMA 2HJSA 3EAGA 3LT2A 1V0JA 2F00A 3QY9A 4XGKA 1V9LA 3WLFA 1U2DA 4C7KA 3PQDA 2DC1A 2PFGA 4ND2A 4NH4A 3WJAA 1F06A 1KVQA 1WDMA 2HDHA 4BNFA 4YAKA 3AOEC 3ZWBA 4KTTE 2POQX 4ZVVA 4LRTB 2GR9A 3ZNQA 4BO3A 5T57A 1SMKA 5IZ4A 1T24A 5DNAA 3VZRA 2VOEA 2B4TO 2NU6A 1A27A 1B3RA 3L4BC 4JX8A 4X54A 4BGVA 4CV2A 2IRWA 5JS6A 1YXMA 2ZB4A 5I8ZA 2FR8A 4MVJA 4J7UA 3ZI0A 4CQMB 1RM0A 3AOGA 5IDQA 5TLSA 3WYCA 1P0CA 2VWHA 3DXFA 4NZ9A 2UVDA 2PY6A 1K6IA 5JDIA 3FF4A 3GR6A 3FI9A 3IC5A 4YT8A 1PQWA 1H9AA 3KHUA 2DFVA 3K31A 3LT4A 4O63O 1HRDA 5A3JA 3D3WA 3WG9A 2O2YA 5G0TA 3SX2A 3W8FA 2QRJA 1J5PA 2J5RA 1XGKA 2ZK7A 3DTTA 2NVWA 4EW6A 1E6WA 1HSZA 2DQ4A 2CDBA 2P4HX 4Y9DA 3HSKA 1EBUA 1HDXA 3DC2A 3ZH2A 4IS3A 1PS0A 2G1UA 3ITDA 2O4UX 2PZJA 3PXXA 1C14A 4J91A 3ZWCA 5CEEA 4NDNE 4Q9NA 4DMMA 3GEGA 1DAOA 5C7OO 4XYGA 1NFRA 1CEQA 3LZ6A 3JQ9C 4OH1A 4M86A 3GNQA 4PLZA 1F8FA 1DRVA 3H7AA 1LDBA 3KXDA 3MJ4A 3ZNNA 3IJPA 3L6EA 1LLDA 1HWYA 3H2SA 5AQ1A 2EIHA 3BMCA 5HM8A 4WLNA 3RUCA 5C5IA 2YV3A 4WOKA 4BHTA 2RCYA 1BWSA 3ORFA 5U1PA 2Y1OA 4GMFA 2OOSA 3ETGA 2Q50A 3I5MA 4KUGA 4M8SA 3DOCA 2DUWA 3ONEA 2CNBA 2FZWA 4MVJD 3UKOA 2YUTA 3N7UA 1HEUA 4WJZA 3TZ6A 4BIIA 1NNUA 3GVIA 2IEBA 3FBGA 3PZRA 2IYOA 4AL4A 4D44A 2RAFA 4MIYA 4Y8VA 4LCJA 3C3XA 4KWHA 3V1UA 4B4VA 3L9XA 3PYLA 1GYRA 4UEOA 4FOSA 2YHUA 4QQRA 4YPOA 5L4NA 2CVQA 4D45A 1DAPA 3FR7A 5ER9A 1N1EA 4W9NA 4CQLB 4P38A 1Z7EA 2W2LA 3DFUA 4ND5A 3GAFA 4TVOA 1A7AA 3O8QA 3PYXA 4B7XA 4L8VA 1GY8A 4NFHA 5MGBA 1O89A 1XHLA 3DZIA 3TJRA 4FPXA 3FWZA 3LDHA 3LLVA 4IDFA 4XRGA 4PG5A 1CRWG 2P91A 1AE1A 1U1IA 4CLRB 2AEFA 3I6IA 3OIDA 2AG8A 5KTKA 1OZAA 3QVSA 3WGTA 3JTMA 2FZEA 4E2ZA 4DC0A 1GL3A 4MKRA 2J3KA 3STHA 1I2CA 3IIEA 4MIOA 5CDUA 3I23A 1BTOA 1YQGA 4OKIA 4PGFA 4QX6A 1CQJA 4RPLA 3OM9A 3F5QA 3S1LA 4IZHA 3ROMA 4Z0PA 3BYZA 3ZHZA 4XQGA 3WTCA 4A26A 5JDCA 4ZQHA 3D4PA 4XEHA 2Y1FA 3IAHA 1ISMA 4HFNA 5MDHA 1JKJA 1PQUA 4GSLA 2HRBA 4AJJA 4ZRMA 4U8GA 1U28A 3BXXA 1GZ3A 4FS3A 1QMGA 1DJNA 1B26A 1LSSA 3GGGA 2C2YA 3QE3A 3CMCO 1LI4A 5HS6A 1HF3A 3PTZA 1ONOA 3QJ5A 2F1KA 1VJTA 3PWSA 3BHMA 3OETA 4L4RA 4P4LA 3V1TC 1R15A 4DQXA 2X5KO 4J4BA 5JY6A 4NR0A 1EFLA 2ZCUA 3OMLA 1NASA 1UXJA 4CMGA 5HBRA 3ADOA 3GRPA 4YACA 3ZV3A 2Q49A 3Q0EA 2Y0EA 1CDOA 1RPNA 4FFPA 4CM4B 1V8BA 2Y68A 3BTUA 3PP8A 4CL3A 2W2LD 3JV7A 1XWFA 2W8ZA 4Z3DA 1R0SA 3W4IA 5KOIA 3C7DB 3NTQA 4OXYA 2FR0A 4G81A 4XB1A 5T67A 3AUTA 3SXPA 4BKOA 3TOXA 1XKQA 2VUSA 2H63A 1QYWA 2X8LA 2AQIA 4LGVA 4PLTA 4J9UE 3RFTA 3INRA 3ZWNA 4D3FA 4FJ1A 4XIYA 4HV4A 2VYVA 2I67A 4D3SA 1IOLA 4K26A 2PKQO 5CG1A 2VHVA 5A9RA 4Q3NA 3FNHA 3I9NA 5G4KA 4B4UA 1LJ8A 2X5JO 1N7GA 4EUHA 1YJ8A 1O94A 3KSDO 3IJRA 2Y1CA 3DZGA 2J5QA 2X58A 4ZA2A 4XD2A 4AJ4A 5ILOA 1GQYA 4IQ0A 3GF4A 4YT2A 5C3MA 2JL1A 1A4IA 3GPDG 9LDBA 1PZFA 3C7AA 3F6YA 4AJEA 3JQFC 4TRNA 1QYCA 1F0YA 5L95A 4GH5A 2BGMA 3OQBA 3D3WB 4BNUA 1Q7BA 1DJQA 4GSKA 5TX7A 4QSMA 1UXHA 3BTVA 4K1LA 2VWGA 1JQBA 5JY1A 1PL6A 3BZUA 4RVFA 1I01A 1LLCA 3QVOA 3BMOA 4IMRA 2ZQYA 4DA9A 1BVUA 2GSDA 2YV2A 4BMVA 3S2FA 3EVNA 4U0JA 2XAAA 3W1VA 3L77A 3NT5A 5K0ZA 3FNFA 4R1UA 3FTNA 3ZU5A 3PWZA 4OYRA 1QYVA 4CR7A 4D41A 5KIAA 2P9EA 4OAQA 1T1RA 1HYHA 1P44A 2JCVA 3AWDA 5COQA 2IODA 3K2EA 3V2HA 1YKFA 1U2GA 1XCBA 3BMCB 3SLGA 3GNTA 1B15A 1ZZEA 3FCOA 3AY6A 3V1YA 1V6AA 4J1NA 3UUWA 3E18A 4YJFA 1GFSA 5U4QA 3PJDA 2VYVD 3Q2KA 3HB4X 2B83A 1KVUA 4N5NA 4QUKA 1D1SA 2IZ1A 3BMQB 3COSA 1NBOA 3M2PA 5C7IO 1DIAA 3ZCXA 1E3SA 2EW2A 4JK3A 2VQ3A 4NNJA 4BUCA 1T2CA 4EJMA 3KYBA 1LXCA 2ZB8A 5A1TA 1W8DA 1MC5A 3WSVA 4CMBA 1YL5A 3E6AA 3OEYA 1C1XA 3NRCA 2ZJ1A 2YHIB 2VHYA 4B7UA 2VHWA 2BLLA 3QWFA 3NYWA 1H5QA 1I33A 5KJCA 4GVXA 1ZJZA 4W9NC 4F45A 4IINA 1PSDA 3JD4A 3MJCA 1P1IA 1WWKA 2PGJA 3KLMX 5BT9A 2EKQA 5ICMA 4J0EA 5T64A 4DPKA 2D0IA 4Y6RA 2PZKA 1A72A 3GZNA 1MX3A 1OC2A 3Q9UA 4RF3A 4E4YA 2I9PA 3O8QB 1SB8A 4FN4A 5KVCA 1RM4A 1IL0A 5L45A 3K73O 4EUFA 4PG4A 3LT0A 4FW8A 5TC4A 5KVVA 2FOIA 3RU9A 2Y1GA 4FSHA 4UUOA 3VH2A 2UUOA 2X1HA 3Q1LA 4BNJA 4YJHA 4MVJG 1KEVA 2NWQA 3ZN2A 1U3VA 4RZHA 3WYEA 1PWXA 4L0QA 3WB9A 1Q2XA 1T4DA 2X86A 2BH9A 1E5LA 1IPFA 3ABIA 3M6IA 3W8EA 4RJTA 4I1IA 1BW9A 1XQ1A 4DTIA 1KOLA 3VOSA 1IPEA 2EG9A 2FPGA 1I2ZA 4R3WA 1TVEA 3D4OA 3VH1A 1SEVA 3D5QA 3S2EA 4A5OA 1E7WA 2UYYA 3DO5A 4FFLA 1G0OA 3UN1A 3RC1A 3VVBA 4EJ6A 5DZSA 4G5HA 5B4TA 3JQGA 1EQ2A 1DOHA 2I76A 2B36A 1XU9A 1ENPA 4MP6A 4Q3DA 4BNKA 1X0XA 1OBFO 4PZEA 3EVTA 1XR3A 3EC7A 5CG2A 4J7XA 1LEHA 3AK4A 3TSCA 1EK5A 4LK3A 3NAQA 5T8KC 4FOOA 2GN9A 4RLSA 5DBFA 3PDUA 2HJRA 4NJOA 1JDJA 5B4UA 4EEZA 3D3EA 3QIVA 1HYGA 4EDFA 3B20A 2EP5A 1GZ4A 3GG2A 1H94A 4AJIA 4U5QA 4D3DA 1WXDA 2G5CA 3F9IA 1EBFA 4S1VA 1KY5A 1WVGA 4U6SA 3BTSA 1XEAA 3WR5A 1N1GA 2JFHA 3CMMA 3DOJA 2XXJA 1ZUD1 3F3SA 3K96A 5BSHA 3GLQA 5JO0A 4PLHA 4ROSA 4W7IA 1U7TA 3B1FA 1RM5A 1U8XX 2I65A 3U9LA 1HZJA 1CERA 1ZCJA 1QYXA 3ZWXA 1U3UA 4PLPA 3DBLA 4OO3A 3I52A 1H2BA 5DBIA 4FFOA 1WZEA 4YCAA 1Y8RB 1GUZA 3U0BA 3NDJA 3BMOB 4BKUA 4QT0A 1UDCA 3AFNA 4YT5A 1K6XA 1GADO 4Z0TA 5FEUA 3HNPA 4MVJP 3TZCA 2WE8A 2NV6A 1YB1A 4J1QA 1ISIA 3WMXA 1GV1A 4YAGA 3GT0A 2YY7A 3Q6IA 4UEKA 1CJCA 1NPYA 4YDRA 3T7CA 4BMNA 1BSVA 4IJKA 1HLDA 1ISJA 3AOEA 1RYEA 3G1TA 4WUVA 3WXBA 1DB3A 5JXWA 4NBUA 1MV8A 1U7HA 4CMIA 1ENYA 4ZN6A 4R1SA 3ASUA 5JSFA 3H3JA 5F3RA 3L4BA 4RPHA 3EGOA 3L4SO 1QG6A 3NTOA 4D7AA 1CWUA 2A92A 4JP3A 1I5RA 2ZTMA 4MVJH 5ADHA 1KEUA 4MVJM 4K28A 1BMDA 3UHAA 4GBJA 3JYLA 1D1TA 4DIOA 4XGIA 5CAEA 1I10A 1C1XB 1IB6A 1A71A 2Q99A 1LLUA 2PTGA 2AW5A 5G0SA 1VRWA 5I7EA 1RM3A 2VZ8A 1PJCA 3ZNPA 2NU7A 5IXSA 4R16A 5EQFA 4PG7A 4ND1A 5B4VA 2GASA 4JGBA 4PG8A 3FPCA 4ZQFA 3DZKA 1GDHA 1JAYA 3RUEA 4BNHA 4RVHA 3C24A 5CDTA 4AJLA 2HSDA 1MFPA 3AUAA 1NPDA 4I5FA 3ZNOA 2P2SA 3JQ9A 4E30A 5A5FA 1PL7A 1AXGA 2AE1A 4JCOA 1X14A 3S2IA 4XKJA 3G3EA 1EDZA 4FFMA 4YB8A 3JQ8A 3AU9A 3M1AA 1ENOA 4NK4A 4YVFA 5HTOA 3WGOA 3D4NA 4I5EA 3DHNA 1ADGA 1TXGA 5HRUA 3GDGA 4RF2A 4AJOA 3E48A 5KWEA 3WTBA 1ZXBA 4G2NA 2VWQA 2O3SA 3JQEA 3HFSA 1G6KA 4XDYA 2DBZA 4BKPA 1E7MA 3B70A 1IZ0A 1GQQA 2I5PO 5JAIA 3JQAA 1BW9B 3OF2A 2QYTA 2PD6A 3P2YA 4ALMA 1ZSVA 2TMDA 1Z82A 3FNGA 1YOVB 5ENDA 1NHWA 4BL5A 4INAA 1N8KA 3DZJA 3OJLA 3JQGB 4H3VA 4N54A 4I08A 3ZU3A 1DRUA 4XQ9A 4D43A 2P4QA 2PD3A 4UUNA 4WASA 4WLFA 4IDEA 5A06A 1P1FA 4M54A 3O9ZA 2PA3A 4GLLA 1UH5A 1HDYA 4XQCA 3UCEA 1Q7GA 1N5DA 3RFXA 3TWOA 1PWZA 5DCYA 1VKOA 1PZGA 1ZW1A 2D2IA 2BELA 2X0JA 5A03A 1YS4A 3UCXA 5B12A 3WJ7A 3I9LA 4IQ8A 2WD7B 1TB4A 3DZFA 3S8MA 4Z9FA 5TGDA 7MDHA 4Q3BA 3A14A 3KUXA 3SC6A 2X22A 4RPJA 2Z1NA 1UP4A 3AY7A 4XJSA 3GMSA 1DBVO 1DHRA 4QEDA 4R5MA 2NVUB 4CM7A 2VTDA 4DQVA 1B14A 3DBHA 3PJEA 2C0CA 2O7SA 3ROPA 4KWIA 5G2OA 2ZTUA 4FJ2A 2BD0A 5EJ2A 3WS7A 3UVEA 3LC1O 1ISFA 1QP8A 1JW9B 4CLEA 1GYPA 4E6PA 4E5MA 1MGOA 1KBZA 1AN9A 3PQEA 1EE2A 2D4AA 5L7TA 3UCFA 5GZ1A 4K6CA 3RKUA 3OA2A 4XRRA 4PG6A 2Q2WA 4KUEA 2BFMA 4NK5A 4BO5A 4WPGA 3GC6A 2O4CA 1Z75A 4IDDA 4KQWA 1BXGA 1PJTA 3HE3A 1EVIA 1LU9A 3QW2A 1PJLA 2O23A 1Q0LA 1H6DA 2PKRA 2QYSA 4CM1A 3GA0A 4OJNA 3TZHA 5I9NA 3RBZA 1HTBA 3CE6A 1SPXA 3ZHBA 4E32A 4L76A 2O2SA 2RIRA 1O9BA 3KYDA 2PR2A 4J4HA 5JE8A 2LDBA 1XLTA 3MTGA 2Y0CA 2Y93A 4XWYA 1TT5B 3UF0A 1R0LA 4A10A 1HDOA 3NT4A 2X0RA 3Q11A 2EERA 1CIVA 3C8MA 4MVJE 1Z45A 4J2OA 3NV9A 4LCEA 2HMVA 4MOWA 4NG5A 4CMIB 3ASVA 3PFWO 5EIOA 3AI2A 1I32A 4RCVA 2BKAA 3KYCB 2O3TA 4R9RA 3GPIA 2C59A 4WNCA 1JKFA 3VDRA 3GG9A 3PHHA 2Q45A 2FHSA 4NHEA 5A4DA 1ZFNA 3WSWA 4RQUA 4CM3A 4JP2A 3WGZA 3JQFA 3R0IA 3G79A 3W6UA 1F14A 4BO6A 3C1OA 3PVZA 4LSMA 4CMCA 3EZYA 4J7CA 4NJMB 4Z3KA 1JAXA 4ID9A 4CMAA 1BVRA 2FY8A 1PS9A 4JBGA 5CDYA 1WMAA 3HG7A 4FC7A 2Y05A 4HXYA 2HMUA 4HP8A 1C1DA 1E1KA 3JQBC 1UDBA 3N58A 5JFOA 2HAEA 4WCDA 3PK0A 4Q3AA 3RQSA 3LU1A 2HQ1A 4EUEA 4GGOA 1OAAA 1NVTA 5TJHA 1UP7A 1H0KA 4UUPA 4XJTA 4YYZA 2DPHA 5GZ6A 5THKA 3JQ8B 2WDZA 1FDTA 4CMHA 4CUKA 1T1SA 1GQ2A 4H16A 3WNQA 1WP4A 1YBMA 2E4AA 4MO2A 1PJ4A 4J6FA 5IG2A 3E9QA 3PJFA 1AHHA 1NTOA 1YRLA 5L4SA 3WOHA 3BHJA 4BNWA 3JYNA 1QV7A 2WE7A 1QLHA 3CTMA 3GNSA 2AHRA 4YAEA 1FDUA 3DFZA 3H9QA 3JQAB 5IXYA 5I7SA 2AEMA 4NPCA 3K2BA 3PGJA 3L07A 3IOYA 1P1KA 3C85A 4HFJA 4L4XA 4BKQA 1PJ2A 1FDWA 4IIUA 4HNGA 1UJMA 4TKMA 2WM3A 5F5LA 4CM8B 4CLOA 2YZ7A 2H9IA 2X9VA 4RVGA 1VI2A 1UR5A 2HK8A 5I9LA 3WGYA 1JA9A 3T7EA 1LDGA 3RROA 1U5AA 1C3VA 1O95A 2BI8A 3H9JA 2A9FA 3AU8A 3H5AA 1T2DA 4L4SA 3JQ7A 4IDAA 1PR3A 5JAMA 5AXAA 3E5MA 4MP8A 1ORRA 3VH4A 3INGA 1WAMA 4E5YA 3O26A 4QXMA 4XYEA 2FPPA 4QFCA 5IFLA 1JN0A 3DHYA 3K92A 2O50A 3RI3A 3U4CA 1DDOA 1MG5A 3U4DA 3ON5A 3LC7O 4FIZA 1D7OA 4KTVE 1UXGA 4P4GA 3HB5X 1KVTA 1UUFA 1J6UA 4JLWA 3GK3A 4CMEC 4CUZA 2FP4A 4QECA 3E9MA 3VPSA 2VNSA 3HQ4O 4Y67A 1UAGA 1ZMTA 4NBTA 4PLFA 2IEDA 1E77A 4KUHA 3RFVA 1BGVA 1FDSA 1H93A 4R9SA 4BGUA 2C2XA 4ZGWA 3NDRA 2Q1UA 2JD2A 4WECA 2A35A 1LDEA 3DBRB 5CP8A 1NQ5A 2I3AA 2FN7A 3QLJA 4Z0HO 5FWNA 4RO0A 3A1NA 2OP0A 1KY4A 5T8KA 4WCFC 2Z95A 2W90A 1E3LA 2J5KA 1FF9A 3K8ZA 1QR6A 1P3DA 3HN7A 3KEOA 5EERA 2VN8A 5BSFA 4HUJA 3PFFA 4CJXA 1LDNA 5DOZA 4P8RA 1Z6ZA 4YQYA 4J16A 2DTXA 5TT0A 3RVDA 3DZBA 3HDHA 1BHSA 2D5CA 4N7RA 5TF4A 3HJAA 2O3JA 2C54A 1CETA 5FI5A 4PLYA 1IY8A 1DFHA 5L9AA 2BFOA 1HL3A 1Y8QA 1EZ4A 2BF7A 2XPCA 4BNXA 1ZIDA 4YR9A 3I9KA 1DEHA 4JJFA 3DAGA 3U09A 4BO9A 1FJHA 3Q2IA 5K9ZA 2VUTA 4MIEA 1SNYA 2NTVA 1Z74A 1H6BA 3E9NA 2FR1A 4PVDA 3RJ5A 4BB6A 3NDIA 1M66A 1YO6A 1DFGA 4XGNA 3R1IA 1H6AA 1LUAA 1U9JA 3VH3A 1YONA 5BNIA 1UP6A 4GWKA 4BOYA 2WJPA 4C4OA 4YRBA 2WWRA 3ONDA 1R16A 4BS9A 4QO8A 1NFQA 3GN1A 2W2KA 1PZHA 2XOXA 2FPIA 3C1TA 5F1OA 4XYMA 1A9ZA 3UFXA 4EEXA 2B35A 5A5EA 4BQPA 2H5LA 5LDHA 1IE3A 3ZV5A 5A9TA 1BG6A 2C5EA 3DB2A 5J23A 3GGPA 4M87A 4P4NA 5TS3A 3WX0A 4BNTA 1AHIA 4II3A 4BO4A 4EGFA 1J0XO 3SBOA 3ZWMA 4IJWA 4IZIA
chains in the Genus database with same CATH superfamily
4DOMA 1NN1A 1ZNQO 3CJTA 3BK2A 1G8JA 4CT0A 3BEOA 1ADCA 2X0EA 4RM2A 1MB3A 2HCTA 2AX3A 2HZ7A 3DV2A 4UUBA 2YV1A 3D59A 5K3CA 4EYEA 5CFZA 3RTAA 2IF0A 5G0UA 2A0XA 1QG4A 1Q12A 3LXRA 1QOPB 3F6PA 3IUMA 3FDIA 3KETA 1AMNA 1GPBA 5CPBA 5A7FA 1W5TA 4UM9B 3IVRA 4DLTA 3WDMA 1N8TA 4KXMA 3R8XA 1FMFA 3G8CA 4QVGA 4WESA 3PG5A 5F5XA 4GU5A 4MWOA 5F7XA 1KBQA 2Z04A 2CWDA 2IYLD 1HDIA 1YCGA 3DTNA 3EXHC 1GZVA 1JQDA 1D2EA 1UOOA 4BCCA 2JLZA 1EXDA 1NV8A 2WMDA 4MW0A 4UDYX 3ET4A 2C2GA 3PWTA 5JSQA 5BR7A 4NBKA 3IHWA 3BWVA 3GLFE 1Y4SA 3HKDB 5TPWA 3T99A 4DLLA 3VV2A 1TU3A 2JRCA 3O0DA 2XQVA 3U49A 4U2EA 1EXVA 1BWRA 3HJGA 4ZANA 3FPHA 3GVHA 1S8AA 1RMQA 1DKNA 1PHRA 1T9ZA 2NTYC 3GDOA 3HRHA 3NOVA 4URWR 4EKGA 5KOJA 2IUTA 1D0IA 2VPIA 3FCUB 2B9VA 1ZO8A 5IMBA 3P9KA 3EXIB 1NQAO 2VS1A 1GD1O 4ODIA 3R0ZA 3STTA 4DYDA 3GFSA 4OGFA 2P69A 4YJDA 3NU1A 3RBVA 4WHMA 3WLAA 5C4IA 2CDNA 2IUFA 4YJGA 1R10A 3E70C 1FW8A 3K9FC 3AHDA 1KYQA 1MEJA 2V54A 3AEKB 3G0IA 4L4UA 4MGKR 2EEPA 4H7FA 5I5GA 3SICE 2EL9A 3Q7PA 2ES4A 5DTJA 4WKPA 1YUBA 2ZPAA 2H2DA 6GPBA 4LF9B 4HMPA 2R25B 3NVDA 5U9CA 4F91B 3NHKA 1VLLA 5IBQA 3WFIA 3WQQA 1L6IA 1IVSA 2RHGB 2XYQA 3D5EA 3FPGA 4EBBA 4J0KA 3RE1A 4Z5XA 1XQXA 3GUVA 4TMFA 1COWA 1SIOA 3INTA 3STYA 3CR8A 3AR9A 1CT9A 3DEYX 2C4UA 2I8CA 4JLJA 1E0JA 3M3DA 4X64B 4AMYA 4O1MA 1OYWA 4GX1A 1JTVA 4K2HA 3GJZA 3EPRA 5HR5A 1WNTA 2BHSA 1E2PA 3F6BX 1Y81A 1J42A 2RKOA 4Q37A 3GJ7A 3HWX1 4EG7A 1PR4A 4J4TA 5ICGA 2QJFA 4Q9KA 2BPOA 2AL7A 5CJPA 3T95A 2NZ2A 1YRBA 3UW1A 4E21A 1AA6A 3OH8A 4QARA 4P0TA 4R1PA 1RQLA 3D8SA 4C7MA 1A9QA 3I53A 4Q15A 1DAMA 5DM1A 3E4CA 2GF2A 5A04A 5BV7A 2JFVA 3P20A 1IQUA 2DKFA 3ND7A 4Z7NB 2PH5A 3FN4A 1P5JA 2R6DA 3DZCA 1WDLA 1FMCA 1ZI9A 3X1KA 4H1VA 4HVCA 1F17A 2XF8A 2XWQA 3JQDA 4MPDA 4Q24A 1FFGA 4H3KB 2OYCA 5FFNA 1Q1QA 1H2HA 2ZJ5A 3OLVA 1ZD4A 2UZ1A 2QZ4A 3AWIA 4K05A 2ZCJA 5FPHA 1DADA 3EDYA 3BB4A 3TOZA 2V3WA 1Z0UA 2Q4OA 4Y1FA 2EV9A 2W6IA 3T41A 3VC1A 3VHRA 3RSSA 2VPXA 3RPEA 2IE0A 1L4UA 4BQFA 2P27A 2BEKA 1N7JA 1FRVA 4OOFA 5JLAA 4RJLA 5KMGB 3U5TA 4IIJB 1U2ZA 2AQKA 3CZCA 2DUJA 5I4IA 3H8VA 1P0FA 3NGXA 4CKEA 2R4QA 3H65A 2EF0A 4QUEA 2XCSB 4MUEA 1PRYA 3UGQA 4NV0A 2YDYA 4X41A 1COWD 1LSJA 3CZAA 2AMLA 3CRMA 1RZVA 2BFPA 3KCQA 4KKXB 4C89A 4O4IB 1RAEA 1N92A 1H9BA 1H5UA 3MQ2A 4NONA 5D7BA 1JA1A 4C43A 1YAJA 4DNOA 2JA2A 4LS3A 4RTKA 1A69A 5EFZA 1BZYA 1DIGA 4MAFA 1WOMA 1M8KA 1XZAA 2GARA 4FVTA 1IZ8A 2W6JA 1E0KA 5G4KB 1E1LA 4JU8A 3NPAA 2GPTA 4FSDA 1NIPA 2GWHA 1T8TA 2FP3A 1TX4B 4RY0A 4P7GA 1SUCA 4IUBS 2BGKA 4Y2UA 3WYNA 3L1KA 3NM4A 4N39A 5CT8A 4N6OA 2R62A 3A9TA 4XOIA 4EUSA 4O5OA 3HUTA 4P82A 4EVQA 4BP9A 1M6VA 3DFMA 3TRHA 1G3MA 3VAYA 4B5LA 3VZPA 1GTVA 4JBHA 1QG0A 4LOJA 3HBMA 1JEOA 1XIVA 1CY2A 2COKA 3BIJA 3N0WA 2OV2A 1II0A 2QQ0A 2YMMA 3OUUA 2IZZA 3R3JA 4M8IA 1TNDA 2IS6A 1XDWA 2VTEA 1CSEE 4ILKA 4U7PB 4B9EA 1SVNA 4PCLA 2OY0A 2YRWA 3MF4A 3OX2A 4CQNA 3TUZC 1JLSA 3M6VA 1AUQA 1LWOA 5D51S 2QUZA 5EGSA 1Y3BE 3TEMA 4NFSA 4OBXA 3AMVA 3OZVA 1EDOA 4LVCA 3DMTC 5KYVA 4CM9A 4R69A 2R96A 4C0LA 4MUBA 5H68A 3PDJA 4QBKA 2XQGA 3LI2A 1M1YA 2VLIA 3L0BA 3A28A 1GLVA 4HAOA 5DIFA 3V2UA 4QJBA 4BLUA 1RBYA 2W42A 5HQ3A 5AUQA 1OVGA 3U40A 4DQDA 2PV0A 1Y5MA 2ZT5A 3SDBA 3REQA 4TRJA 1NSYA 5BMVA 2J09A 1R4MA 3TW4A 4HWKA 1ZJ4A 3HUUA 4QA9A 5E7IA 3OU7A 4JSRA 4M53A 3SMQA 5ITVA 5IVHA 3NP7A 2ONJA 2YYAA 2VDRB 3CYFA 2GCGA 4L95C 5AK6A 4OJQA 2OA0A 4A2PA 2OXEA 3M33A 4KFRA 4L07A 5AXBA 3I76A 3KV3O 3WZ2A 2NPOA 3LNTA 4G5XA 3H1EA 5F9FA 2YYYA 2PAFA 1YZVA 2XLCA 2YW9A 3CUYA 4ENWA 5L40A 2Z1DA 3KQLA 1TTTA 1ZZGA 1JVNA 3M2TA 3SYNA 1UMBA 3VMFA 2Y1DA 2W6JD 3HA5A 4X6LA 1DQZA 2O8CA 4ESEA 3EC2A 3ONFA 2XZTA 3VXKA 1TUBB 4OH7A 3O92A 4WE3A 5FNVA 1T3LA 1MP0A 1RQ2A 1EP2B 1WXIA 2OV8A 3GWZA 4H7KA 1KTIA 5ICCA 2ZLBA 2VOJA 5BWNA 4WL0A 2JCSA 1TW3A 4DT1A 1PG0A 2JC3A 1XVLA 2VK4A 2QTNA 3QHQA 2J6IA 2W6MA 3DAPA 2FDRA 3EXG1 4GOKA 1USGA 4M0CA 1WMSA 1BHJA 2XADA 4M98A 2IU4A 3TNJA 4QELA 4EI9A 3D0QA 3NVAA 3T3OA 1VGRA 4NJEB 1CW2B 2O2ZA 5LMNB 3FTFA 3L8MA 1LSOA 3WYDA 4JQYA 2JKZA 2L2QA 2CV1A 3U4QA 1JHZA 4NARA 1X13A 2BWJA 3NI2A 4J3JA 4ARIA 4A1FA 1P9NA 5K99A 3CLHA 4Z8XA 2K7FA 2Q4RA 3L0OA 4D6PA 2CZCA 3LTEA 4B1FA 4OL9A 1XROA 4GFDA 1XXHB 4HAWA 4QPNA 1QNLA 1R4AA 2SKCA 4CM9D 3O8RA 4QJIA 1AOXA 1NXTA 1RYHA 3K1YA 1UBTS 3M1LA 4UDNA 3ZE9A 5JJ5A 1DBWA 4XEUA 3UB2A 2CJXA 3HV0A 4MV1A 2XD9A 3PJGA 2APJA 2RBKA 3Q7TA 4XUCA 5AK3A 3V2GA 3M5PA 3BCUA 1CE8B 1IQPA 4KQFA 1MJ5A 2A5LA 2GBPA 1W0CA 4PLGA 1SHKA 3WLPA 3AFIA 4GI2A 3OUZA 3SZRA 4BDTA 1RAAA 3PUXA 5KWVA 3LPMA 2AN3A 2RONA 1W36D 3CRW1 3NXKA 5BXQC 1J1ZA 3QUTA 5CR9A 2GILA 3MS2A 3K09A 3FY4A 4LJAA 4PCVA 5JCOA 3U7FB 1H0RA 3GVXA 4NDZA 5EWLB 3OT1A 5DNDA 1GUAA 1NKSA 2IBMA 5FBQB 5H7XA 4DYVA 2AQHA 4EAQA 1SEPA 4JLSA 1PSWA 2P5YA 3T5AA 1NVXQ 3OPQA 4A92A 3SVTA 5HCUA 1T9HA 5DI9A 1VSVA 4ZO8A 5DISB 1V71A 3PGLA 1UBNA 4HPXB 1JH9A 4JT4A 4KXVA 4L6CA 4OSPA 1PX2A 1Z2AA 2P5UA 3KQQA 2IXAA 4MULA 3SF0A 4A03A 1QHEA 4BNVA 1XMVA 4NS4A 2ENUA 2Q1WA 3G17A 2ID7A 3OKAA 3VR0A 1EHIA 3FOBA 2BFBA 3LFTA 3WLEA 1VL6A 4IH4A 1PTJC 5JNTA 5CLFA 2BJVA 1QAOA 4H2DA 1OFGA 2W6OA 3OWHA 1NHGA 2JAWA 3KB8A 4HDQB 3IAS1 4QUAA 5D86A 3RANA 3WGKA 5AVQA 5TMDA 3DVLA 3TTWA 1QS0A 4H27A 6YASA 2PJRA 2GDZA 5D85A 3RUFA 4N5LA 3E7PA 5LYJF 1WBDA 1Q11A 1ZGCA 1Z4MA 1HURA 4RKWA 5HKLA 3G6WA 4IWXA 4EKNB 1G20B 2DP4E 2PWPA 3MWEB 1DAFA 1RHRA 2OAP1 5KX5A 1SM4A 2E5WA 2M1ZA 5D2CA 2ZSHA 1B8OA 3KYIB 5K1ZA 1I3LA 1QGED 1VKZA 4QM6A 1WY7A 4YRKA 5H0IA 4GL2A 4ICIA 1WW8A 3QVWA 3RADC 1SU4A 4JELA 4CODB 3SVLA 1DC8A 3FVRA 2J0EA 1N6NA 3ITKA 2QTGA 4PRYA 1RI2A 3T7IA 5KCZA 2XMZA 3UUGA 5DN6D 4H08A 3FMVA 5H82A 4X7PA 3TK1A 4Z9XA 3TB4A 1XTSA 4FFVA 2WYUA 3HB7A 2P2CA 2IZ6A 4H0FA 4X3OA 4ZQGA 5IH3A 3TTTA 3V8VA 1K0FA 1U4SA 5DKFA 4CCAA 3QWBA 3M8KA 4NZMA 1J8FA 5AJWA 5LXTB 2Y71A 4WCVA 1L8OA 5GM1A 3IVGA 1NONA 621PA 1MU0A 5HJ7A 2I66A 3I2GA 1E3MA 2OGUA 2PSJA 4J3FA 3VU9B 4XM0A 1M0WA 5MF6A 2R79A 2G08A 2EATA 1E9EA 2RB5A 4TQUS 4DCOA 2Q46A 2XE6A 1PUIA 5T4FA 3DBLB 2CL6X 4EJSB 3R0VA 1U2QA 1VB5A 1Z17A 2GFIA 2B4YA 4KXXA 5CB6A 2XQIA 1QCDA 2P65A 3C6YA 4EQZA 3IT3A 3B6EA 1CF2O 4P3PA 2PSFA 5MN6A 2C20A 4WCFA 2Q1XA 4BRZA 3X1XA 4MW6A 5KYTA 3NPMA 4Y6LA 1AVTA 4YBZA 1F2DA 1X1TA 1YCFA 3T4PA 4POOA 1GCGA 1AO3A 1T0IA 1XZNA 3AHEA 1IUNA 1OIWA 3L6CA 5H9VA 1X94A 1NX6A 4G0OA 2JI6A 2J7PA 4FCVA 1H42A 2ACWA 3DP9A 4IO0A 1PS8A 4YAWA 4QNMA 1PD1A 4I1OA 2ZYAA 3Q12A 2GRAA 4DAOA 4DLZA 5HKKA 1LZLA 4PRZA 1E2QA 2PZMA 1DEAA 4M9ZA 2O48X 1TC2A 1DEXA 1CRLA 1SXJC 2ET6A 3LYLA 1R6UA 2QL5A 4FX2A 8LDHA 5IANA 3GN2A 2RE8A 1L5HA 4R7GA 3E3OA 3A6PC 5HUHA 2Z6QA 2IUYA 4XD7A 3BH0A 3EXG2 1MFZA 2IYNA 3OQ1A 4BIMA 1WRBA 3GLHE 4KV9A 4JJGA 1N2CA 5KQSA 5EE5B 3DVQX 1IC6A 2QG4A 2G6BA 4QUBA 4P31A 4RPKA 3W5IA 1YIAA 3TZKA 4HWRA 1LQ2A 2I6GA 4LYDA 4PO9A 5BT8A 1ZCZA 3G5MA 4BE4A 2Q6VA 4E3WA 4A9AA 1DJOA 2NO5A 3FRJA 4XYLA 3L4JA 2CF5A 2R48A 2R6JA 2ZRDA 1T8RA 2H3EA 1SBCA 4N6NA 2VDWA 3FJ1A 2YWEA 4BMSA 3AUSA 4YFYA 2W8BB 5CEFA 1DKOA 1FYVA 1S3FA 4X94A 4DUGA 3EOZA 3KSUA 1JQAA 5E3HA 1D07A 1GKIA 3KUDA 4AT1A 3AM4A 1LC3A 3GRKA 5K0NA 1U3TA 2N42A 3IT1A 3KT3A 4DV4B 3ZZ0A 3FDJA 4RETA 1MMFB 4R05A 4EELA 3Q3HA 4AUMA 5GJCA 1K5PA 1JQ3A 1ZXLA 2EW1A 1WE2A 2GO1A 2WABA 5TR9A 5L3VA 4UAGA 3TPCA 3ZQ6A 1Q1NA 4AWAA 5B3JC 5EGNA 1ZL0A 2J7PD 2XV1A 4KLCA 2AZXA 3C3AA 2OCKA 1OY1A 3CRNA 3OOHA 1ESDA 5B1EA 2P2YA 3B1VA 3F3YA 3GOHA 3IAUA 4NHOA 5FH9A 3PU6A 4N82A 2Q3EA 4IHQA 5HKKD 4G65A 3JVEA 1V26A 1QSGA 3NCTA 3P2JA 4NU0A 1M2WA 3M4XA 3CIFA 4YIKA 2GTPA 5HE8A 2H57A 4BAZA 4ARCA 3U2QA 4HD8A 1X8KA 1II8B 4PC2A 1F20A 1V3TA 3LX5A 1QM5A 3MUNA 5EQJB 2ASEA 3LXMA 5J59A 2JCYA 3CUKA 3F2VA 1GPNA 4M7WA 4XD7D 1FX1A 2GS9A 3NB0A 3I6QA 1V5GA 5HMLA 3O1HB 4KAAA 1Q0TA 1T4MA 3UJDA 3UH1A 4C0XA 1I5OA 1F51E 1J2RA 5ALRA 2FMHA 3LWZA 1VMEA 3O21A 2PGLA 3OCUA 1EK6A 4ZT4A 4EI2A 1D4FA 4QYWA 1TO1E 2OO3A 2V4ZA 1B6RA 2Y67A 1LPMA 1U0RA 2DKNA 4WZBB 2GN8A 2X8JA 4C3VA 2VJMA 1ISGA 4CMKA 2PS3A 5A7HA 5AM1A 3WIDA 3C16C 1J8MF 3OPNA 4FR2A 1FP1D 5AM4A 2PGXA 2VJLA 3U80A 5JROA 1L8QA 1X1EA 3JRWA 1Z6GA 2HSGA 1NVEA 4ZRDA 3P0JA 4BGIA 2I29A 1Q16A 1P1BA 1CQIA 2O2XA 3N76A 2YMLA 5FTKA 4B2PA 4KR2A 2WMNB 1PFKA 3BBLA 4B71A 3DLIA 4I5DA 4LJ4A 2O3QA 2QP4A 1Z88A 4WV3A 1IHPA 4LRXA 5AW1A 3UOWA 1F48A 1U7UA 2YVUA 2XBMA 2KBEA 1WPQA 2HMYB 4JGIA 3ZCUA 3H11A 5K7SA 4QUDA 1W5SA 1QZZA 3BQ9A 5DDIP 2J41A 1V7CA 3A06A 3RRMA 2RKBA 1GWNA 1NN3A 4BO1A 1LF5A 5IZCA 4E2XA 2LIVA 1V1RA 2AK2A 5ILGA 3ZJYA 4EFKA 1J56A 4GBED 3H13A 2NSDA 2GYVA 2RDMA 4JAVC 4PSAA 4ZU1X 4AUKA 4ZU6X 3AFOA 4RZ3A 2IZ7A 2OO5C 4LHXA 3WK5A 2Q2VA 3FAKA 5D00A 1THGA 2FRDC 1I36A 3RREA 1VE6A 3LOPA 2W2VA 2JD1A 3ISVA 3IULA 3S4YA 1I3NA 3E9YA 4L51A 3TH5A 4B3FX 3RKSA 3BWBA 1TVKA 1YUMA 4UZEA 1DJPA 2BGWA 1T2NA 4R3UC 2PUEA 5DWDA 1N2XA 4KFCA 2NN3C 2ZG6A 3WGHA 1DO2A 3SS9X 3L7MA 1RU3A 3JALB 2XXAB 4B5KA 1JDBC 1FTSA 1IAVA 1T43A 1VJ0A 2A33A 2FF5A 3FSRA 3M4NA 3PX3A 5H8WA 2XKJE 1ZOLA 2R6CA 3IR6A 1AUOA 1GRNA 5T4EA 1KQGA 4QYTA 1UMKA 1Z2DA 4E3ZA 3V4RA 1FS4A 3NVMB 1ZK2A 5ESRA 3EMBA 4IMPA 1XAIA 1YDFA 4B4DA 3HB1A 3AY3A 4C7BA 2JLUA 3NHUA 2C9OA 4RJKA 1SRQA 3F73A 3A9CA 3KXLA 1VI6A 2ZJ0A 3HY3A 4KXYA 3SHOA 1MUUA 2ONZA 2VBFA 3W2EA 4FM9A 5JPCA 1PO7A 2AFHB 2WM8A 3A3KA 3TCXB 4GX0A 4KVZA 2XMCA 4X9XA 2QXUA 5J63A 3T3MB 3FIJA 4DG9A 4RGVA 1K92A 5BVHB 1GA1A 4WOCA 1ULHA 5M29A 2VP5A 2QR2A 5LPNA 1RMYA 1IBLB 2AI1A 2JFWA 2Q5IA 3M7IA 4W5OA 1S7GA 3L18A 2R00C 1N0IA 2DUMA 5JH7B 1KYIA 1A2QA 3C4JA 1VCOA 1PZMA 3IHKA 4KQEA 4HJRA 2Q4DA 2PNFA 3OP1A 2V9ZA 2WTBA 1WCXA 4NSNA 3SKYA 4MRPA 1Y9JA 3X2EA 4OJTA 2QWXA 5AVTA 5JBIA 3LF2A 4R1LA 1BA2A 1SBNE 5BNTA 4TQAA 3QFFA 2P1RA 2VSOA 3TN7A 3H1TA 4NU6A 4UUQA 1JIIA 4UEQA 1JA0A 4AZVA 1GPJA 3RV4A 4BAGA 2IEZA 1GZ6A 3CX3A 4R2IA 1UAYA 5TY0A 1QXSA 2BKXA 1V39A 1XBTA 1K75A 2PZLA 1M9NA 2C2BA 3LA8A 5FBLB 1A1VA 2AYYA 3ZQJA 2ZUVA 3DXZA 3E1GA 3D1LA 4S1NA 4CPDA 2F59A 3CH5A 1JIXA 5TNXA 3B52X 3BWDD 3EF0A 3CUUA 4DC1A 4F0JA 1X1BA 4RAQA 1QVWA 1ZK1A 1Z6PA 2XE4A 2D8AA 3G0OA 1XUOA 4RIGA 2I7XA 4TLDA 4WLUA 2ZYHA 3BB3A 4PVCA 4EJFA 4HXFB 1IULA 1L4BA 3AJRA 3WRWA 3WYGA 2FLWA 1Y42X 3V8RA 4IHAA 4DQUA 2BUBA 3FPFA 4ONEA 3W2TA 1DRWA 3OLQA 4IIJF 5ENZA 3L9WA 5EUBA 2XBUA 3OIFA 3PFHA 4RA9A 4ZZ2A 5C8ZA 2RK6A 1FMJA 2FF7A 3FHJA 4GMDA 4TMZA 2EARA 2R1TA 1BC5A 1RABA 5CJJA 2CWWA 4LZPA 5JS7A 5G1NA 2GCEA 4M37A 2PSDA 3CZPA 2VF7A 5LQCA 3CZRA 1SOVA 1ZVQA 5DLYA 2GJAA 1JVSA 4UTNA 3THXB 3KC2A 3LYHA 4LECA 4Y9RA 1HMYA 5I9MA 3N2LA 2FVXA 3K5WA 1OT5A 4H0NA 4FSXA 4RENA 4XYBA 5I7FA 2HU2A 5CB4F 3CLRD 3TLZA 4O4JB 1WB5A 3GUUA 4PLCA 1E5DA 3L04A 1SWWA 1VSBA 3F97A 3QEJA 3SSOA 4OKSA 4P4TA 5F7ZA 4P0PB 2C9MA 2QAJA 4TS4A 1HDRA 2VYNA 3M6UA 2ZUDA 1CNMA 5JASA 4FI3C 4KK4A 3WRYA 1UDWA 3ZKWA 4MRSA 2ONKA 3MFYA 3VGPA 5EJ8A 2O9JA 1RAHA 2VJAA 2WSBA 5F21A 5HIMA 5IK2A 4J0DA 2GWRA 2NYAA 4FOLA 3JS5A 3SEFA 2PLNA 1PFGA 2YFQA 3LHDA 2JGFA 3LPLA 4S2EA 5HIIA 2QUBA 1DAEA 3SQMA 1DINA 2R7LA 3K3PA 1WM1A 1W87A 3M3HA 1IXRC 3GJTA 4MYDA 1YULA 3F5SA 3FUTA 4NDAA 4A73A 4A8PA 1QH8A 3DT9A 1SBYA 3TQIA 2II6A 1K7EB 1P0QA 5C0OE 1W46A 1Q21A 4HDMB 4JI8B 1BRTA 1CIPA 4EYKA 3ETJA 4XGQA 1GPDG 1P1CA 1P73A 2NUTA 3TRKA 4YRMA 2YQ5A 3T4XA 1ZX1A 2DY0A 3U62A 1P2UA 4ALIA 4OHVA 1KRWA 3TVTA 3CSDA 4WAUA 2OC4A 4X20A 3IAM1 4G97A 4REMA 2Q5JA 1SAYA 5LIRA 3MWGA 1FFDA 1NI4B 1UKYA 2VCHA 3C3WA 5ED0A 2HR1A 2AYZA 4K8RB 3DFIA 4MZDA 4ED9A 4F92B 3JQ7B 1N3BA 2ZRQA 3GLRA 4P3YA 2IITA 4UTZA 1UK7A 1T6BY 1X7XA 1OT3A 1P2FA 3COYA 4RHCA 2QLFA 1RRPA 4II7A 3TW0A 4U63A 1LW7A 3FNEA 3HR8A 3M6WA 2FOXA 4O5AA 5DGHA 2PMFA 3TQFA 3IO5A 2WZDA 3LC2O 4IUYA 4BWYA 4ZO6A 5IM5A 2AJ8A 4ZV4A 5EKUA 5BYBA 1N6RA 1B8NA 5KUTA 3ZS8A 1YQXA 1LRLA 2IYFA 2JD0A 2VYND 4YAIA 1XVUA 2GPWA 4UAVA 1JYFA 1KU6A 4Z4HA 1O5IA 1T9CA 3WK8A 4WKCA 4WXMA 4B43A 3H4VA 2B1RA 3KS9A 3WLIA 4DWJA 2HF9A 1EVQA 1FRZA 1Z5GA 2FP4B 4NCIA 4WK0B 4X3PA 3DMNA 3RODA 5CCEA 5IK2D 4L9RA 4KV7A 1P2TA 1XTVA 1KE2A 2CKDA 1UFVA 2FPMA 3NEAA 2ZWOA 4BNYA 4R0MA 2PANA 1ZM2A 2VSNA 2V0NA 2XNDA 3PUZA 1VKRA 1CUFA 2PS9A 2OHFA 3EBOA 4XPIB 5CW1A 2FPUA 1E0DA 5GPBA 3UA3A 3UMRA 4A8HA 1W0JA 4L08A 3R7LA 4CTKA 1QHYA 2HCFA 1KK1A 2YBDA 2ZATA 4QOSA 3HXKA 4CV0A 3DHVA 3OPXA 4R71A 1OAKA 1OIXA 2J46A 4J49A 1GZHB 1XD2B 2UV8A 1S7CA 1K6JA 3WGGA 3JYOA 3WDSA 4ZYTA 1SJ9A 5LMZA 4Z86A 2V5AA 3USZA 2QJTA 1YZ3A 4KC0A 4TKUA 1KY2A 3WWZA 2C7VA 3C0KA 3LHKA 2QGNA 1FDRA 1GFIA 3OFJA 3EQ6A 2OV3A 3U4HA 4DXAA 1COZA 1R4NB 2YFHA 4WK6A 5IVPA 4RULA 4ISBA 4M0LA 4L0CA 4Y6PA 2FK7A 1J1UA 2X13A 4X5OA 4F11A 1QBGA 3LDFA 3LKDA 1V1MA 4UFNA 2IS1A 3BL5A 4G37A 1KQNA 1J09A 2LCFA 1HMPA 1AGYA 3BK1A 5E2IA 5AJHA 2QK4A 4CFYA 4YPFA 5LQUA 1IRXA 4G9GA 4W5QA 3IOMA 1E6KA 2WD7A 1JB9A 3PGKA 4JC4A 1ADBA 5IX8A 4RPGA 1Y9AA 2KHZA 2O8DA 3B2NA 2JJYA 2QL9A 3IQXA 3W8DA 2D0PB 1SB9A 5BQOA 1NF9A 3DCNA 3V34A 3VKVA 1SWVA 1ULAA 2BONA 2Q0XA 1KAGA 3G2KA 3KIPA 3MJSA 4GG1A 4IIEA 5BPFA 1FNMA 4PV7A 1G1AA 5ALSA 4WK4B 2YW2A 4D99A 3AW8A 2CSXA 1R6DA 4FW9A 3PDWA 4ML3A 2FAXA 2R6R1 3NNNA 5NLLA 2W4QA 4UU1A 1J2TA 4QASA 3O31A 2VDKB 3DR5A 1R0KA 1Z4QA 3TR6A 3ZW8A 1XZKA 4DREA 2AUNA 4MVYA 1VM6A 4NFLA 2CJPA 3EQ9A 1VI5A 1Z3CA 3RYIB 3VC3A 3SHFA 3V2IA 1HXHA 4J75A 1Z36A 3EZFA 1V5WA 2BCGY 2WKSA 1R0RE 4WBXC 4XR9A 5AOAA 3ZU2A 2FZ4A 5KNCA 3NGLA 1E2EA 2IEAA 1O2DA 5GP1A 2WG2A 2R8EA 1FBTA 2OCGA 1W0JD 4J2TA 4R2KA 5DF1A 3SS7X 1T9DA 1P75A 4AJNA 4DDUA 1JHUA 4IZOA 5F3WB 1DPFA 3FLMA 1Y1PA 4J0IA 4J0HA 2X7XA 2A4KA 5SYAA 3WMWA 5ICEA 3DCYA 1IHDA 1Z6YA 3OZAA 4M8NE 4R41A 1U6KA 4NZZA 3R20A 4CVNA 1PDVA 4OQPA 2BRUA 2DWOA 2O1XA 3G5UA 4P2BA 3K70C 2O0LA 4X93A 1K2VN 4UE6A 3V46A 3FMOB 2YINC 4LZWA 4V0MA 1M7GA 1TTQB 4E2FA 4HX9A 1ZH8A 4HXEB 4J43A 4US2R 3LVFO 4BUJA 5E6RA 1JHQA 3UJ3X 1VSQA 1QTNA 3A27A 4YN3A 4LGMA 5DK4A 2P41A 3GUHA 2FFHA 4WESB 1PR9A 3W5AA 3GYBA 2A9KA 1NQOA 5B37A 3VC7A 1ZOIA 2JHAA 3LUKA 1D3AA 2JGDA 2W98A 1XYGA 3QE0A 3FXAA 4KJXA 2PBLA 3FOZA 5LXTF 1I9CA 1KKMA 2FGJA 2WFLB 1YBAA 5TPWB 2IY7A 3TO5A 1QK3A 2OQ2A 2ZUCA 1ORHA 4MKXA 4TRMA 3FKSD 2OPBA 1IZ9A 4W7HA 5BW5A 2ALJA 4FGLA 1L5GB 2DTDA 1SOUA 3SBDA 1A2BA 1VPLA 4TRRA 3VKFA 1OXTA 1G5TA 5KOJB 1LVUA 1Y34E 2J9RA 3A31A 4DV1B 3H19A 3IQEA 3T3GA 3IIIA 1YZGA 4MUAA 3LCCA 5L53A 3QVJA 1KZ9A 3ZCTA 4E88A 1OJLA 1PYOA 3ELUA 3ZTYA 3RYCA 4YQZA 3QUSA 2BJWA 1N2SA 1PKEA 1DIBA 4IHJA 2E4VA 4YJGB 2HCRA 4KFSA 5KNCD 1PQPA 3FE2A 5G1PA 4F9TA 1IIBA 4J76A 2BSXA 3B3AA 4QOEA 1PJBA 2QE7A 1OILA 3KEGA 4DUPA 4EY8A 1LTQA 3E9ZA 1JVBA 2DLDA 4RTNA 4UNNA 1O57A 1RJFA 4PSVA 5SZJA 1MB2A 1GQRA 1K98A 2WYHA 1EUZA 3FSGA 2G63A 2ZI6A 4J90A 3WQSB 1NVWQ 2HMTA 1C9MA 4PAWA 4WGFA 3ZBTA 2PMDA 2FLVA 5BYKA 2CVHA 1L4KA 4EK9A 5K45A 2X5OA 4IF6A 4RLHA 2HCJB 2VYCA 5L51A 4K9QA 4PXAA 4C88A 4AJ1A 4ETNA 4ARZA 5F7OA 5F3DA 4QDKA 2FXVA 5FTJA 4BBPA 2F1JA 3OFKA 2AB0A 3WV4A 3MNFA 1WX1A 1ONBA 4HWTA 1QO0A 1YAHA 3ETDA 2GYWA 3KU4A 1XQ6A 1EVZA 4YA6A 4D97A 4UXJA 5AQEA 3GPCA 1EU1A 1ZD2P 1YRHA 5EG5A 3WIUA 1EI9A 2ZB7A 4XSHA 1EFRA 1UBSB 3BF7A 3SBEA 1V96A 3WBFA 1FTQA 1S2GA 5HPYB 1S89A 3CY6A 4MKGA 5B30A 1GSHA 1WO8A 3IEXA 4W9MC 3KZNA 4DA4A 4KNYA 2CYAA 2QPTA 3PHGA 2V7EA 4UBLA 3VTFA 1A2OA 2UVQA 4C0HA 4OHPA 4CQMB 3W2FA 2FFQA 3VTZA 1O6CA 1Y4ZA 4AJPA 2I4IA 3GEBA 1C30B 1N4AA 4YJ2F 3C5WP 1EJ6A 2K7ZA 1N5IA 1U5BB 2YXDA 2NPIA 2UZ1B 3KQSA 3OE7D 4GVLA 3R8FA 4YGXB 1HETA 4AY3A 5C31A 1YU6A 2VDJA 1M67A 1VMDA 4FHFA 5IDWA 3RRXA 1IJFA 3RWOA 5GY7A 5L3RA 2LV8A 3WGIA 1USVA 4RC9A 2OPHA 3LTNC 2QRVB 2DWQA 2ZM5A 4OHYA 4TWJA 3D2BA 1NN0A 4HBZA 2ECPA 3UA4A 2HLPA 4CKEB 4OX9Y 1N3LA 4RF4A 2VDLB 2C2MA 1ABFA 2YX1A 4BVKA 3IUJA 1EK0A 2PUHA 1VJ1A 3FSGD 3LOUA 4FGWA 1FDVA 1L7PA 3T9CA 4KRFA 2NU8A 2FG5A 4R98A 3WAJA 1NM5A 4CR8A 2IYSA 2NXCA 3HDQA 4BB9A 1E1MA 2QMEA 4UREA 1R37A 2HL6A 2PMWB 4TQGA 3EUAA 3AEXA 3GGOA 1ISPA 3DZHA 1JEJA 4O2RA 1M1XB 4JUBA 5JUWA 3K0SA 1C7EA 3MWJA 5E4JA 2I6QA 5LBTA 1K63A 1HG1A 2J3LA 2EGGA 3KHTA 3MS4A 5CBPA 1G9XA 4AU1A 1ID1A 1QO0D 3ZWOA 1F2UA 3JWGA 3IAXA 2ZVDA 5I7VA 3PV0A 2IT1A 1FQKA 3QUBA 2EGUA 4NYJR 4OFWA 4OBEA 4I9NA 3EDCA 1EUCA 3OEEA 4O2BA 4DEYA 3CG0A 4WJKB 4CEIA 4TKVA 3D7LA 1EFRD 2JEOA 2Z98A 2A5JA 4X8MA 1M6VB 1S6YA 3SE7A 4TUYA 4N3CA 4IBOA 1A98A 4JODA 4NNPA 1ARZA 5DXJA 5DMHA 2XE8A 3V3KA 2GBGA 2RBEA 2YJZA 1DTSA 2FV8A 4ENVA 3HTXA 1LNSA 1A4UA 4X63A 2P75A 5DGCA 2CEKA 2VDVE 4EY7A 3FUCA 3LDUA 4QAQA 4YUWA 5A1JA 4Q9AA 5AVOA 5REQA 3EAFA 2I4MA 1EXMA 4NMHA 5G3YA 3RT9A 4E5SA 1XMOB 3JYQA 2CMDA 1RKUA 1R9JA 2P9JA 2ZSKA 1NUTA 2I1LA 3K9LA 3LL4A 4L8FA 1SZJG 2A0KA 1ZH0A 4OFZA 3S8YA 3SJZA 5P21A 1X7WA 1M1YB 4NLLA 4KBFA 3AM3A 5CHYA 2EP8A 3VTKA 3MILA 5KU7A 1P17A 1X86B 3A2LA 3BRQA 4V39A 5FPQA 2O8FA 1FRNA 5HQ3B 5IWAB 3FTPA 1N7HA 1SCKA 4BCDA 3P2OA 3F5MA 3W1WA 5KSWB 1YS1X 2TSYB 4WQMA 5FOSA 3REQB 4HAYA 5BMVB 2A86A 1R4MB 3DDZX 3RWBA 1E4EA 1C4WA 3EAGA 3LT2A 3MGAA 4WXPA 3WLFA 3OZRA 5K0CA 3GLIE 2JLRA 1U2DA 4F84A 3KQOA 5CX1A 3VU8A 1IOVA 4GO1A 4LDNA 3UWDA 3H75A 1AUVA 1DGQA 1KVQA 1MO6A 2NUPA 3H2HA 4WVFA 4D4KA 2H85A 4G5FA 2Q4TA 5FUVA 5IVDA 4KTTE 3NC1C 2R6HA 4I99A 5ETJA 3IP6A 4LRTB 3LLCA 4BO3A 3PIRA 2ZRLA 4QE3A 1X8LA 4G1FA 2G07A 3FROA 3KBBA 4MRMB 4OSEA 5B6PA 1U9CA 2ILVA 5FOTA 2WJIA 1O4VA 1T0JB 1VSTA 3MERA 1RYYA 3L4BC 2QRGA 4IKEA 4JSTA 3BZBA 4X54A 3T8YA 3TOSA 4ENSA 5JS6A 5JSHA 5IC6A 3ZI0A 4I55F 5IDQA 3AOGA 1HE8B 5HKOA 4L72A 2VWHA 5IKOA 2XUFA 3OEED 2GXAA 4E15A 5HZKA 2O5RA 1GTL1 1G5QA 3E58A 4Q7JB 4Q4AA 2I8AA 3U7IA 3FF4A 3GR6A 3FI9A 1JQLB 1WKVA 4JI4B 3H6GA 1EFVB 4GKAA 4OGLA 4MI6A 3L6RA 2QRJA 4OB7A 3ZCRA 4B2YA 2IHZA 2AN9A 4TLMB 3BWEA 1YMVA 3FKQA 3U4QB 1U02A 3JPYA 3CFYA 5AKXA 2JHPA 2DQ4A 4H0CA 4DIKA 3HSKA 2YYZA 4OYYA 1EBUA 1N0UA 1PS0A 2CZQA 3WB2A 3WWCA 2BSAA 3PXXA 3ZWCA 1C14A 3IPAA 1NLYA 4Q9NA 1TCUA 1DAOA 4IX1A 1OFUX 4OK6A 2DCMA 4XYGA 4GPIB 3DLHA 1MC1A 1GT91 4CG0A 4F71A 1AS2A 3GNQA 4L85A 1LDBA 3DAYA 3NBXX 5K3DA 3CBQA 3S2YA 3ZNNA 3IJPA 4MX8A 3N75A 4YRQA 3PCRB 2OZVA 3JZAA 2O0KA 2OTCA 3OIUA 4UOQA 3UYLA 5HM8A 3RUCA 3FRHA 4HYEA 5KOYA 1DCFA 3OT1B 2ZAIA 1U7DA 3ORFA 4JUIA 2XMGA 3NIDB 2P4EA 1CKEA 3SE0A 3H97A 1JHRA 1M6NA 4GMFA 4HH0A 3D3QA 3S27A 1PYDA 3WGJA 3CO0S 1SIWA 3I5MA 4KUGA 5BOSA 1ZIYA 4Q82A 1DI0A 4UBIA 1KHHA 4PQRA 4AULA 1QTIA 1BHQ1 1VZ3A 2ZVPX 3DOCA 3I04M 2R1VA 4HSGA 3IBSA 2CNBA 1JP7A 3X1YA 2FZWA 3HS3A 2XUGA 3UKOA 1FVXA 1WXEA 2H17A 2FMIA 4WJZA 4BIIA 3TQOA 3D7MA 1PBNA 1Q1BA 4I5IA 1WTAA 1NNUA 1QCYA 3ZK9A 3FBGA 5DHAA 1GL7A 5I7HA 4ESVA 4MIYA 4ZYUA 3DWEX 4D9IA 4LCJA 4AYWA 5L8VA 1G8YA 3DMHA 4MRAA 5FUYA 3C3XA 4RQBA 3C2QA 4P81A 4B4VA 1PK9A 1XVVA 2WU3A 2IJGX 1C4OA 2OFOA 3PYLA 4FOSA 3GJQA 3TLGB 3VZCA 4CTJA 4YRNA 4YPOA 2LR0A 1JIVA 1XTJA 2QI9F 2C95A 2JFZA 2DPXA 2OM2A 2WT8A 2CLLB 2FJ0A 2CL7X 4I2VA 5ER9A 4UD2A 4W9NA 1AXRA 1GZDA 4MTCA 5IC5A 2D1RA 2GA9A 1PQ4A 2AIRA 2P9QA 4TVOA 5KI6A 3KKQA 4URXR 2O54A 1A7AA 2PGAA 4Q0MA 1JTFA 5SYNA 4NFHA 3AHFA 3DZIA 2CLEB 1CP2A 4FPXA 3W3AH 2F3SA 3LLVA 1J1IA 2C4HA 2SNIE 3LA6A 4P35A 3GWGA 3HBNA 3P0FA 1R0BA 4UTRA 1L7NA 2ODTX 3TSZA 4LF6B 1V1JA 2ATVA 2CUTA 1KNXA 3THOA 3JTMA 4BCBA 2QR3A 3QEOA 4MKRA 5D01A 1RMTA 2V97A 1RCFA 1R5JA 2I7TA 2JIQA 2RGAA 4OKIA 5AJTA 2X8BA 1RI3A 3KE8A 1Y82A 4K9LA 1BHO1 3SXJA 3OM9A 3VPBA 1V41E 2NQ2C 2QMHA 3N2KA 4WNYA 3GPLA 5MN4A 1GIAA 2HGZA 3WTCA 1R64A 1W19A 2NIPA 3QFCA 4DDMA 4ZZ3A 3FUWA 1GKUB 4IIBA 5JDCA 4LFAB 2PT7A 2GHIA 3ZR4B 2FDCA 4QUGA 5A3SA 3ESAA 5BOVA 1PQUA 1U0BB 1GGEA 2R84A 1E89A 3PQ6A 3A6GA 4GSLA 4AJJA 3HYRA 4JUCA 4A3SA 3BXXA 1QMGA 2C99A 1RYMA 3QE3A 3VR4H 2B20A 2H18A 1QGOA 3N8NA 4LAFA 4BFVA 3OLCX 3QX7A 2QM7A 3K2QA 3QJ5A 1M5TA 4HDNA 1KZ6A 2JGRA 1QHHA