4B4WA

Crystal structure of acinetobacter baumannii n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) complexed with nadp cofactor and an inhibitor
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
282
structure length
282
Chain Sequence
MALVLDGRALAKQIEENLLVRVEALKAKTGRTPILATILVGDDGASATYVRMKGNACRRVGMDSLKIELPQETTTEQLLAEIEKLNANPDVHGILLQHPVPAQIDERACFDAISLAKDVDGVTCLGFGRMAMGEAAYGSATPAGIMTILKENNIEIAGKHAVVVGRSAILGKPMAMMLLQANATVTICHSRTQNLPELVKQADIIVGAVGKAELIQKDWIKQGAVVVDAGFHPRDGGGVGDIQLQGIEEIASAYTPVPGGVGPMTITTLIRQTVEAAEKALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Acinetobacter Baumannii Fold Ligand Complexes; Potent Inhibitors of Folate Metabolism and a Re-Evaluation of the Ly374571 Structure.
pubmed doi rcsb
source organism Acinetobacter baumannii atcc 19606
molecule tags Oxidoreductase
molecule keywords BIFUNCTIONAL PROTEIN FOLD
total genus 105
structure length 282
sequence length 282
chains with identical sequence B
ec nomenclature ec 1.5.1.5: Methylenetetrahydrofolate dehydrogenase (NADP(+)).
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00763 THF_DHG_CYH Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain
A PF02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4b4wA01
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 4b4wA02
2IXAA 5DP1A 3TSCA 4QT0A 3BIOA 3Q1LA 1GFSA 4IDAA 4RPKA 4YDRA 3AI1A 5CPFA 3B1KA 3JQDA 4RVGA 3HADA 5AXCA 5TIIA 4A7PA 2PGLA 3ROMA 4Y6RA 1N5DA 1LBEA 2GZ2A 4XEHA 5ADHA 4RF3A 4WUVA 3EUWA 1WVGA 3TOXA 2IZ1A 3F6YA 1SB9A 2NLOA 3M1LA 4ZGWA 1JKIA 3DBRA 4KWIA 1NFRA 1F8GA 5THQA 3ULKA 2H1SA 5IZCA 1TXGA 1UXIA 4PLCA 1I24A 3ZHZA 1IZ0A 1U5CA 1XSEA 2HK7A 2B5VA 3PHJA 1LA2A 3H5NA 2FZEA 4CLRA 2BKAA 2NTJA 5AVOA 4PLTA 4E5MA 4AJPA 4J90A 1BW9B 4OM8A 4BL5A 1I32A 2BRUA 2JFFA 3UN1A 4BNLA 5LDGA 2NQ8A 4YBZA 4UAGA 5BT9A 1PJLA 5I9LA 2VNAA 3NT4A 3NX4A 3ANNA 3WWYA 2D5AA 4B7XA 4GBJA 1CIVA 4FR5A 1W4ZA 3DZIA 1NX6A 3P2YA 4J16A 3E9QA 3GVHA 4C4OA 3CIFA 4ND5A 4DL9A 4AICA 1R16A 3I6QA 1T24A 2X9GA 3DHYA 2B4TO 3JQ8A 3PDUA 1C0PA 1E3WB 4YRAA 5BSFA 4ROSA 3V2HA 4EJ0A 1Y5RA 2O7QA 5T5QA 3UW3A 3JQ7A 4Z0HO 4BS9A 4D45A 3EK2A 1K0UA 3OIGA 2UV8A 4PLFA 3WMWA 4D7AA 4OGWA 4YYZA 2Q50A 4XGKA 3MJCA 3LLSA 3SBOA 1ISMA 3GNTA 3BMCB 4YJGB 3MJVA 1EUZA 4L0QA 5TRTA 5U4QA 4W7HA 1B8UA 4E5YA 2HCTA 1HLPA 3MWDB 4YJDA 1UP6A 1HKUA 5TT0A 2GSDA 2Z1NA 3WSWA 3HFSA 5A3JA 4FFOA 1LDEA 5DP2A 1WLYA 1MXFA 1G0OA 4H7PA 5CHEA 4BNVA 5IZ4A 1E7SA 4BO4A 1WW8A 2Y1EA 4FN4A 2E37A 2B4QA 2GN8A 4R54A 4WCFB 3RU9A 1XGKA 3TFOA 5MGBA 3JQBA 4J91A 5HA5A 4WKGA 4GVXA 1R6DA 4J3FA 3ZZNA 4J1QA 1M67A 5TJ9A 2AW5A 3SC4A 1CF2O 4O59O 2Y1FA 2VOJA 3TL3A 3M1AA 4NI5A 1MC5A 4D44A 5DT9A 3VAZA 4JJIA 1ZCJA 2EKQA 4IDDA 4M8SA 5JO0A 2HRZA 4PVCA 4PLYA 1CYDA 3I9LA 4CM3A 3K9QO 3P5SA 4MJLA 2CSUA 4R16A 1HDZA 5TC4A 2JKVA 3QHAA 4HXYA 4II2A 1O89A 4DC0A 1BWSA 2VRCA 2Y1GA 3TDKA 4ILKA 4CM4B 1NHGA 3G1UA 1QYVA 1VKNA 3JQAA 1H2HA 1W0CA 3OF2A 1UDAA 4GH5A 4P38A 4YB8A 3C7CB 3WMXA 2VWQA 1NVGA 1V6AA 2PK3A 2EKLA 2C5EA 1SPXA 1PEDA 2NVUB 3SX2A 4GSLA 5DBGA 4FFLA 3W8FA 4FSHA 3V1UA 1HYEA 1LUAA 2PKQP 1DB3A 1GV0A 1B16A 3GNSA 2VT2A 6ADHA 3WQRA 3UFXA 2DTDA 1BRMA 3L9XA 4FCCA 2EIHA 4W9NC 3QLJA 5F1KA 3VZQA 4ZQEA 4DWVA 4G81A 2YUTA 1NYTA 3GY0A 4BB6A 5IF3A 5JFOA 1HETA 2Y0EA 4XWYA 1M66A 3K73O 3WICA 4CLHA 3WNQA 4OXYA 5JCXA 3JV7A 2ZATA 5L4NA 1YBVA 1KEWA 3IP1A 3ROKA 1ZBQA 4U8GA 4E4YA 5JCJD 2YV2A 5C37A 1TT5A 1UH5A 3QWHA 4LW8A 4ND2A 3JYNA 2G82A 2Y67A 5JDIA 1Z7BA 4GL4A 5DOVA 1XWFA 3IJPA 2EWMA 1PQPA 3GH3A 3K6JA 3PXXA 5DCWA 4AL4A 3NUGA 3ETGA 3GLQA 4TSKA 4YQYA 5KNLA 2Y1DA 4L4SA 1I2CA 3OEYA 3JYPA 2O3TA 2A94A 1EZ4A 1JQBA 3EZLA 4FC6A 4J9UE 3STHA 4YEDA 3U4HA 5BNTA 1M75A 4UUPA 3X2EA 1OI7A 5FEUA 1JVBA 3OBBA 1U2DA 2Q1SA 1V9LA 5AXBA 2CY0A 1QORA 4JROA 4D41A 4BIIA 1PIWA 3PP8A 3FN4A 1YE3A 2AQ8A 1KY4A 4CMCA 4MIOA 4E12A 4E3ZA 1LSUA 1RYDA 2C29D 5JE8A 1H93A 1IZ9A 2RHCA 2UUPA 5DOZA 4IMPA 2JAPA 4XQEA 1GY8A 3D1LA 1EFKA 1VPDA 2GZ3A 1RJWA 1LQUA 3IKVA 2WSBA 3JYLA 1MXHA 2NSDA 1KEVA 1HL3A 3EVNA 3W4JA 3RROA 3PLRA 2FR8A 3WFJA 2P4HX 2VHXA 3DR3A 4FPXA 1I5RA 4IJVA 3K8ZA 3S8MA 1KVQA 3AU8A 1VL0A 2VZ9A 3NYWA 1B7GO 4DBVO 4IDEA 2JCVA 1BMDA 1X0VA 3AJRA 2WYUA 1N9GB 2PWZA 4NH4A 4Y9DA 1B8PA 2PZMA 4FIZA 4L4RA 4NFHA 1YWGO 3KETA 4B3HA 3JD0A 4KDFA 3FCOA 1T2FA 3KUXA 2ZTMA 3JQGB 3IOYA 1O0SA 3PYMA 4RF2A 4FOSA 5L51A 1YJQA 3UH1A 1FDVA 1UDCA 2Y05A 3GFBA 1B14A 2RBEA 4XYGA 1BSVA 3HN2A 1T2CA 3AUAA 4BNXA 3JYQA 3C7AA 2JJYA 3DBHA 1C0KA 4HNGA 4OH1A 4P4NA 4CM6A 3RC9A 4IINA 3DONA 1GV1A 3HSKA 4HKTA 4J0EA 4CUKA 3Q6IA 3TZCA 2J5QA 1BG6A 2A4KA 1VL8A 1H6DA 3GRKA 3L6EA 3VZSA 1QLHA 1GYRA 1GZ6A 3OH8A 1M6WA 3OIFA 4B8ZA 1YL5A 2C5AA 1JAYA 4QFDA 5A06A 5A4DA 1DFHA 2I66A 5IZCC 1ZVMA 4KQXA 3KVOA 1SMKA 3D5QA 2C7GA 2C20A 4OJNA 2XAAA 2BI7A 2AE2A 2WD8A 1BHSA 1JA9A 1GD1O 1KC3A 2FR1A 2D59A 2Q2QA 3LYLA 2EGHA 3HG7A 5FYDA 3D3EA 1BXKA 2VWPA 5C7OO 4ZA2A 1U4OA 4HFMA 1K3TA 4MVJE 4J7XA 3BYZA 4I5FA 1SEVA 3TL2A 4BNKA 2NTVA 4WLVA 4CV3A 3KLPX 5B12A 2D5CA 3I9JA 3DFUA 5ENDA 3ENKA 1AXGA 4GQAA 2QZ9A 1D1TA 1YOVA 4YAGA 2GZ1A 1KVTA 4EI2A 5L7WA 4D3DA 1LC0A 4IJWA 1XQ1A 3WBBA 5H82A 2JHGA 5HWSA 2YY7A 3WTCA 3FBTA 1SNYA 9LDTA 4GAEA 3UCEA 2JD0A 2EP5A 2EV9A 5EERA 1XR3A 2X58A 2TMGA 3NDJA 4DUPA 4MP8A 2C7VA 2PA3A 4FOOA 3E18A 3ANLA 3ITDA 4HADA 2EJVA 4NFYA 3RC7A 1I3KA 1PQWA 4K28A 2Y1OA 2VUUA 1V3VA 4IDBA 3R3SA 4OL9A 5COAA 4DC1A 1Y1PA 3ZDFA 4A73A 2WEKA 1SEPA 3W4IA 3O8QB 3Q2IA 2V7PA 3JD4A 5ICMA 4NPCA 3DBVO 4BKUA 1VLLA 1Y81A 3QVXA 2J6IA 5I7SA 3LC1O 3A14A 4MINA 1PTJA 3RWBA 1Y9AA 4G5HA 3IUSA 4BNHA 1C1DB 3JQEA 5KJEA 3DTTA 4DIOA 2WM3A 5CEEA 4CJXA 2BELA 4ZHSA 1U5AA 4E0BA 1LSSA 1Q1NA 3CXRA 3JCZA 1YJ8A 4BKOA 3EYWA 1P0CA 2BI8A 4XQGA 3B20A 4UVIA 3HJAA 3PK0A 1CDOA 1DFGA 5IFLA 3JD1A 1W6UA 1ZK2A 4JJFA 5ER6A 3UF0A 1RWBA 3WGYA 3DOOA 1L7EA 2G1UA 4II3A 1WMAA 4BO1A 3CSDA 2BGKA 3JQ8B 4IQGA 4YJHB 3LDHA 5DZSA 1Q0LA 2O23A 3H5AA 4F46A 2HUNA 2VCYA 4RPHA 3OJFA 4EW6A 3VZPA 1E0DA 2CVOA 1FK8A 2Q3EA 1P74A 2QG4A 4BUCA 3FHLA 1E7MA 1XCBA 1IHXA 1RM0A 2I76A 3QP9A 3BA1A 3DZHA 3D0OA 2ZTLA 4R9SA 1PSDA 1ENZA 4Q3NA 1GEEA 2VNSA 3CZRA 4LRTB 2P68A 4K6CA 1NP3A 1QYDA 3WG9A 2PGDA 4PZCA 5C7IO 1YL7A 3GPDG 1Z82A 1VE9A 2BFAA 1XG5A 3VPFA 4AJ2A 1Z73A 3GVPA 3KYBA 4XYLA 1PJ3A 4BVAA 1IY8A 1ENYA 1YDEA 3QWFA 5KTKA 1V0JA 4CMAA 4IPTA 3AWDA 3D64A 1E1NA 3RAJA 3DEYX 2CF5A 2RH8A 2NUAA 2G76A 4M55A 1OC4A 4OIMA 1IPEA 1GTMA 2NM0A 1YB1A 2PV7A 1DLIA 1BXZA 4AG3A 4R69A 3OJOA 4P4LA 3FPCA 1ZEJA 3UUWA 5BSGA 4CL8A 1AHIA 2NADA 4RVFA 1PJ2A 1ZSVA 4A5OA 1YRLA 4K9DA 5T67A 1P44A 5EQFA 3GMDA 3DAFA 1MA0A 3RJ9A 1JKFA 4XRGA 1A7KA 5JLAA 4BHTA 1ZXBA 5F3RA 3VKUA 1PJCA 1SOWA 5HM8A 2PKQO 4LMPA 4DMLA 5AOVA 1KIFA 4JBIA 4NHEA 4EEXA 2FPGA 4CR7A 2DTEA 3C8MA 2ZYAA 1K6JA 5JY6A 3MEQA 4DYDA 4BNGA 4J2HA 3RBVA 3ZNOA 5KKCA 3TJRA 2C54A 4QX6A 4OYRA 1CQJA 1UZNA 4MVJG 3ZWWA 4YJFB 2O3RA 4KMSA 5KKAA 1T2AA 4CMBA 3V1TC 1H6BA 3KXDA 3U49A 3DMYA 3KYDA 2PH3A 4J49A 1PGJA 3KEQA 1YB4A 4ID9A 1LDMA 4Z9YA 1XKQA 3BHIA 1NXQA 3D5TA 1JAXA 1LC3A 1N2SA 1E3LA 3QWBA 4WNCA 3VPSA 4JP2A 3GRPA 2OUIA 3QW2A 4WECA 4CR6A 2VRCD 4UVEA 1DAPA 1QKIA 2I3AA 3EY4A 4DLLA 3KM0A 3ZU3A 2YDYA 4ZICA 2DKNA 2DM6A 2CDBA 1CERA 2Y93A 1DOHA 4JNKA 3IIEA 5G0SA 4AJJA 1EEHA 1ONOA 2GLXA 2BD0A 4PGFA 4ZQHA 5KVVA 1GYPA 4MKXA 1Q0QA 4LCJA 3ROQA 1W73A 5I7FA 1LDNA 2Q2VA 5JMPA 3H6KA 1ULUA 1KVRA 2Q4BA 1ADCA 5GZ3A 2HMUA 3F4LA 4U7WA 4BO3A 4O5OA 4D46A 5HBRA 5A04A 4JGBA 5B4UA 3GEGA 4HFNA 3JQBC 3GEDA 1B15A 2C07A 1Y8QA 3EMKA 2FSSA 1IE3A 1ZK4A 2JFGA 2VZ0A 3DHEA 2R6JA 4Q39A 1NWCA 3I83A 4L76A 3UCFA 3R6DA 3C1TA 4ZVVA 4GX1A 5A9SA 3LK7A 4BNZA 4NNJA 4E2WA 8LDHA 4NIMA 2Q1WA 4FFNA 2RCYA 2DUWA 1LSOA 4CR8A 4MVJA 3X2FA 1A71A 1J0XO 1JWBB 1OFGA 4RORA 2OHXA 5L45A 3ASUA 3U4CA 4TWRA 1TT5B 1PL8A 2I6TA 3JD2A 1JN0A 4XYMA 1PGNA 4BNTA 3UKOA 1ADFA 4Z9FA 4RPLA 2VUTA 4WLUA 4EDFA 3UHAA 2PTGA 3WLFA 3W8DA 1I33A 2BH9A 3ZWNA 5JDCA 3NJ4A 4L74A 2HKIA 4U0JA 4MKRA 3P7MA 4FJ0A 1PZEA 1BGVA 3L6OO 4R41A 4E5KA 2ZQYA 2Q99A 3IC5A 4JX8A 1ARZA 3NTQA 1MUUA 1TI7A 4IUYA 4R1UA 3B70A 2GYYA 4E5NA 1X7DA 4WPGA 4CQMD 1FDTA 2ILTA 3M6IA 3BMQA 2GGSA 2O7SA 1E7QA 1YQGA 3ADOA 1V8BA 4HNHA 3AOGA 1YKFA 4YAIA 3GEMA 1VI2A 3L4BC 2QYTA 3WOHA 4MVJM 1NQTA 4R3WA 5TNXA 2WYWA 2VWGA 4UUMA 4CMGA 2H9IA 5L95A 4OKNA 2AA3A 5K0ZA 3QVOA 2X5OA 2Y1CA 3K2EA 1QSGA 4BNMA 3ZWMA 2D2IA 4BNYA 5G0TA 4J1TA 1T1SA 1DIAA 2WWRA 4DTIA 1R4MB 3F46A 3PWSA 1FJHA 2A92A 1LXCA 1UR5A 4NBRA 1KC1A 3H65A 4R1NA 2ZCUA 4DPMA 3LF1A 3UGKA 4B4WA 4XR4A 1E3JA 2HDHA 4IGEA 1KEUA 2X5JO 3TFQA 4YRBA 4YXFA 3DOCA 2W90A 4CODB 1YGYA 1ZSNA 1O6ZA 2IODA 4NBTA 2NNLD 5JCJA 2HLPA 1DIGA 4R5HA 5U9CA 5IJZA 4PRKA 3ZHBA 5G4KB 3ABIA 3RVDA 1EK6A 1GQ2A 4DLAA 1Q7CA 2J3IA 1SC6A 3GVXA 1RM5A 3A06A 3WBFA 3AY3A 1HYGA 1N7HA 4QQRA 1JLLA 1JVSA 3FTPA 2Q1TA 4GVLA 3PFFA 2ZK7A 3RBXA 4PG8A 4RVUA 2GERA 2EF1A 3C7DB 2GASA 1LLQA 3RUDA 3GVIA 4KDEA 2XXBA 3EHEA 4TRNA 3VHRA 1WDKA 5HTOA 1RM3A 2Q49A 2B5WA 4XQCA 2V6GA 4QXMA 2DVMA 2XOXA 3AUTA 4PG6A 3SJ7A 1M76A 3H5RA 3LZ6A 3N74A 5JAMA 3E5MA 2NV6A 1R66A 4WASA 1E3WA 3WWZA 1SBYA 5GMOA 1DFIA 1YBMA 2VQ3A 2G0TA 1DIHA 4J7CA 3NAQA 2EJWA 4ND3A 1EBFA 1VJTA 4L73A 5A05A 2AG5A 3QVSA 4GX5A 2NTNA 5KJ1A 2WDZA 1DRWA 4ZRNA 3I1JA 2FR0A 2ZYDA 4GI2A 4IDCA 4J9VA 4PLPA 4J43A 4KTVE 2CUKA 5JC8A 1DSSG 3L4SO 4K6FA 4ZD6A 4G65A 1HEUA 4HUJA 3IL2A 5A9RA 1H94A 2PZLA 4DMMA 1P77A 4IDGA 3UVEA 1P1FA 1ISHA 1MV8A 2FOIA 1P3DA 4PCVA 4F6CA 3TOZA 1E6EA 1N1EA 4JN6B 2VYVD 3HWRA 4RF5A 3VVCA 5A9TA 2OORA 2GN4A 3BMOA 4ND4A 4J1NA 2B0JA 4QUKA 1NNUA 5MDHA 3DBRB 4XJSA 1GQYA 3DFZA 3WB9A 3KOUA 2IYOA 2VTDA 4RZHA 2QHXA 1Z6ZA 3BTSA 1LDYA 2J3JA 4RQUA 5KJCA 4D3SA 4BV9A 1DC6A 2EW2A 3E9NA 3E82A 3N7UA 1LLCA 3K5PA 2YDXA 4NBUA 4TVBA 4XIYA 3ZV5A 4CQLA 4PG4A 3GPIA 4D3FA 4CV1A 1E7WA 2CMDA 3F5SA 1R12A 1LU9A 2WJPA 1HE4A 1GUYA 3RUCA 3KRTA 1U28A 4P22A 3V2UA 5CDYA 1VL6A 1I30A 1K89A 2EERA 3SLKA 4XYBA 3V8BA 5KVQA 1P1RA 3OMLA 1SCUA 3BTUA 3WGTA 5JNLA 3QVTA 3CPSA 3MCVA 2ZCVA 4I08A 1JKJA 2JAHA 4I5EA 4PG5A 4IJUA 2ZQZA 3WGZA 1ISJA 4YTEA 3KB6A 3M2TA 3KEOA 1LJ8A 1VJ1A 5CEJA 3I4FA 3BMOB 1CRWG 2WYVA 3NGXA 4S3MA 5EL0A 1HE2A 3N58A 1E6UA 3U5TA 3PFWO 4EUEA 3SLGA 3PYLA 4OSPA 3VKVA 5COBA 2PD3A 1YQDA 1DC3A 1EDOA 4BO2A 4WCFA 1CEQA 2D3TA 3Q3CA 4FGSA 5ER9A 1D4FA 3UAGA 4J6FA 1X1EA 4KP7A 5I9NA 1ISGA 5L53A 1UUFA 4XA8A 5DDIP 1E3EA 3MJTA 1SOVA 2DT5A 2E48A 3OQ1A 1K6IA 1NHWA 1LTHR 3KV3O 5TLSA 3INGA 4GX0A 3QRWA 1I10A 2J5KA 3MTJA 4A2CA 4I1IA 1Y5MA 5DBIA 5HS6A 2V65A 5A5EA 1QRRA 3S2GA 1UXGA 4YT8A 3KSZO 5LCXA 5TS3A 3O26A 1PR3A 4U5QA 4IQ0A 4MKZA 2HJSA 2POQX 4GGPA 4W82A 2IE0A 1TB4A 3EZYA 4GPD1 1GU7A 2C0CA 4RPGA 4ALJA 1CWUA 1E3IA 1ULSA 1X13A 2YV1A 4J1SA 3BMNA 1PJQA 5GZ1A 4W4TA 4CQLB 1DRVA 1TEHA 1NAIA 4LCEA 2O3QA 4AJIA 1ZO8A 5G0WA 3DOJA 4GWGA 5FWNA 3D4OA 4N5LA 1S7CA 4Q3BA 1VSUA 4ZU3A 3GFGA 4J0FA 5LDHA 1M6HA 1PL6A 4LK3A 3ZU2A 4ND1A 2GR9A 3QSGA 5KJFA 1U3WA 3A9WA 4I5GA 2EEZA 2FN7A 3RUAA 4NU6A 1WDMA 4N18A 2HJRA 2YYYA 2X23A 1EUDA 3MZ0A 2D4AA 3U3XA 1E5LA 2AMFA 2X5KO 3ENNA 1N7GA 3ZWAA 2FPIA 2P2SA 3I9OA 2O3UA 2AHRA 3G17A 4YJHA 4YT2A 4BNFA 5A02A 2O50A 5IDQA 3HHPA 1DDOA 3DZBA 3VH3A 1P1HA 1C3VA 3DTYA 3RFTA 4A0SA 5C3MA 3H9JA 2HQ1A 1Z75A 2BFPA 3RKRA 4YR9A 1EQUA 2FWMX 4YAKA 1A4UA 1LNQA 3PQEA 5JYEA 3G49A 1C1DA 3H3JA 5TGDA 5JDCC 3GAZA 4MVJD 2OGUA 1AXEA 4UEOA 3KHUA 2D8AA 2AEJA 5BSHA 2YHIB 1KOLA 3H8VA 4IZIA 4I8XA 1R4NA 3PJFA 4RDIA 3VDQA 4MPDA 3ITKA 5G0UA 3AUSA 4BKRA 3PHIA 2V6FA 1PR9A 2OP0A 2IYPA 3JQAB 4WOJA 4YAJA 4H15A 2OZPA 2NQTA 2EXXA 1XYGA 3CTMA 3FBGA 3JQCA 4B4OA 2NU6A 4FBGA 2RH4A 1PGQA 4PLWA 3IAHA 3PJGA 1B26A 3DWFA 2PNFA 3FWZA 3FNGA 5CPBA 3VVBA 1NQAO 3U0BA 5EQDA 1HSOA 1J5PA 4FFMA 4OXKA 2OFPA 3RKUA 3H4VA 4TVOA 4CLEA 2HU2A 3TZKA 1R0SA 4NZ9A 2O48X 3PPIA 1YBAA 4N54A 3IUPA 4TROA 5IN5A 4EJ6A 1FDWA 2DBRA 3WIEA 4DQUA 5JY1A 2GNAA 1N1GA 3I9MA 1P1IA 1EVZA 1RPNA 2DU8A 1CETA 1E7YA 2C2XA 2O4CA 4YT4A 4NJMB 5AXDA 4Z3KA 4CM4A 3LVFO 4AVYA 2H63A 3HDYA 3OJEA 3KO8A 2QZZA 5JAQA 2Y0CA 1XIVA 3W6ZA 4URFA 1SB8A 4U6QA 2GN9A 4Q3AA 1ZJZA 4BNIA 3GUYA 2DBZA 3H9EO 3R0IA 3U4IA 4OMUA 3S2EA 4BMVA 2PGJA 3PQFA 3GG9A 2YHUA 2PFGA 3AW9A 3ZI0A 2ZB4A 4UULA 4LVUA 3VPGA 4WCDA 3ONFA 3PEFA 4YVFA 2X0RA 1DIRA 1NQOA 3DMTA 5KJ6A 3OFSA 1PU2A 5HS4A 3DXFA 1Q2XA 4D0SA 5F1PA 4EBFA 2AXQA 3S2FA 2Q2WA 3PTZA 3AI2A 3A4VA 3Q9UA 4B4UA 3ZWBA 4LVCA 3DO5A 4ZRMA 1N8KA 5TSDA 1HDYA 3IS3A 3ANMA 1LDBA 3ETEA 3QIVA 1HXHA 4LISA 5K9ZA 1FMCA 4LSMA 3EVTA 5BSEA 5JPIA 3RCBA 4CQMA 2JHFA 1YDWA 1GCUA 3PWKA 1GL3A 1DBVO 1UZMA 2IZ0A 4H3VA 1M2WA 3H9QA 2UAGA 4RL6A 3LQFA 5G4LA 2VTEA 2GF2A 4TKMA 2O2YA 4FGWA 4CLOB 1ZZEA 1OC2A 4BMNA 1B0AA 1MFZA 2B83A 1QV7A 4AJ1A 1WWKA 3I9KA 5DULA 2X6TA 4C7JA 5A1TA 1F0YA 1TA4A 2IRWA 5T64A 4IDFA 3PRJA 3CINA 3ZU4A 3JD3A 4CMEC 1X7GA 4OXNA 3WGGA 4BKPA 2FP4A 3DZGA 1Q0HA 1EBUA 3ZN2A 2Y99A 4GKVA 1FDUA 3L0DA 1O5IA 2YHIA 1I0ZA 4YT5A 3PDJA 3LLVA 4QEDA 5GZ6A 2FZWA 4NR0A 4KTTE 2IZZA 4U6SA 1V3TA 5AYVA 3ST7A 4IZHA 4N7RA 4XX0A 4CPDA 5JSFA 2VHZA 3DBHB 4R4JA 4TZTA 4NBWA 1GPJA 3F47A 3PHLA 1ISFA 3ROPA 2DPGA 1G6KA 3FR8A 1XHLA 1KEPA 3F4BA 3VC7A 5BQFA 4Z3DA 3KTDA 4OAQA 4CMHA 5IG2A 1ZFNA 4Q3EA 1HZZA 2DTXA 4W6ZA 4DVJA 3GN2A 4XYEA 4CMIA 1WPQA 1NQ5A 4BO9A 1WMBA 3CZMA 4WEQA 4YACA 3H2ZA 3D4NA 5GY7A 1C1XB 1NPDA 1TVEA 3RC1A 5CDTA 3QV1A 3RUHA 2IXBA 3GZNA 4PVDA 4EUFA 4IM7A 4YJFA 3IP3A 2VHWA 1R4MA 2FMUA 2OP1A 2I99A 1W8DA 3E6AA 3DL2A 1IL0A 3WSVA 2P9GA 2ZJ0A 2JCXA 3B1FA 3TF5A 1P1KA 3I4CA 1ZJYA 3C3XA 5ITWA 3RFVA 1J49A 1DXYA 3GF4A 4M89A 4TRJA 3BZUA 3LT2A 1F8FA 2HMWA 5JYDA 3WGHA 1GAEO 1P9LA 4WOKA 1E6WA 3FTNA 4FC7A 3OM9A 2X8LA 3V2GA 4B7CA 2HMSA 4IIVA 4XDZA 3WXBA 1MLDA 4C7KA 3V1YA 4KUGA 1E5QA 3ZHXA 3MJSA 4AJHA 2DUUA 4FJ2A 4E31A 4E30A 1G0NA 4DQXA 3GZNB 4IJKA 2D1YA 4A03A 6LDHA 1IB6A 1U7TA 3H9GA 3ZU5A 3QVWA 3O4RA 4NK5A 4OHUA 1KY5A 4JBGA 2P91A 3HQ4O 3ZNPA 3PQDA 3GDFA 2BFMA 2BLLA 2QYSA 1C14A 1I3MA 4RLSA 2UYYA 3IJRA 4WGGA 4YCAA 3ZNQA 5I7EA 1V35A 1OAAA 1ONPA 1NVTA 4ZQBA 4BO5A 4XR9A 2WE8A 4QECA 4MVJH 1EQ2A 3QWIA 1SZJG 3IKTA 5K6AC 1LEHA 3E03A 3DB2A 3OQ6A 3HNPA 4MVJF 2EP7A 1FDSA 3WX0A 2PH5A 3WLEA 1GDHA 2PKRA 4WLOA 3NGLA 1VKOA 3E1KA 3OSUA 1KYQA 2DC1A 3GQVA 3ONEA 2GCGA 3ICCA 3U4DA 2VHYA 1G1AA 2G17A 2VZ8A 2DBVO 4RQTA 3GR6A 4MIEA 2VOEA 1QLJA 4XKJA 4Y67A 4DYVA 2HK9A 4GGOA 4I9NA 1ID1A 3WS7A 5TQVA 5DCUA 5JAIA 1EDZA 1EK5A 1ZXLA 3A28A 4PG7A 5G0VA 1EE2A 3H2SA 4FS3A 4KWHA 1QV6A 2OBNA 1E77A 4CUJA 3I9NA 1SO8A 4YWJA 2E4AA 4XJTA 4J2OA 1AN9A 4F45A 1A4IA 4JXKA 5IDWA 2Y0DA 5LC1A 1LQTA 5T8KA 1ZH8A 1NR1A 5L3ZA 3UOGA 3INTA 3GA0A 4CM9D 2HMTA 2I67A 4K26A 1Z74A 2NU9A 5EIOA 2Q45A 5KCZA 2GD1O 2H6EA 3PHGA 4IBOA 5H81A 3U09A 3ZHYA 3AM5A 3R3JA 4OOEA 1ZIDA 1N92A 4NDNE 5IAAA 3RU7A 3B1JA 4X54A 5L7TA 2XPCA 3O8QA 5C7LO 1GPDG 2OMEA 4N5MA 1B8VA 4MDHA 3SJUA 4YQZA 1JU9A 4E2ZA 5FFFA 4BO0A 2OO5A 5JDIC 3W1VA 1B3BA 4A27A 2FSVA 2VYVA 1PZFA 4R1SA 3WDSA 4L4XA 5JXWA 3ICPA 1P33A 4BOYA 2BGLA 1RM4A 2OBYA 4L75A 3WQSB 3BHMA 1PWXA 3HDHA 2DBQA 2UDPA 1ZKMA 5EN4A 1PJ4A 5F5NA 3TZHA 4E6PA 3IQDB 1NVMB 2B37A 1A9YA 3GK3A 3B6ZA 3DZKA 1QMGA 1EVYA 3DQPA 4A26A 4EJMA 4E32A 3VH2A 3CKYA 3F1LA 2HSDA 5L4LA 4RZIA 2JD2A 4WLNA 2DFDA 4WK6A 4ZJUA 5JC1A 2DAPA 4ALKA 2W8ZA 4EUHA 3ZV4A 5ITVA 1BW9A 4Y98A 2G5CA 4PFJA 2O2SA 2D0IA 1U8FO 1XLTA 2X9NA 2UUOA 3RASA 3UXYA 4IGFA 3AK4A 3NV9A 1ZNQO 5EPOA 1P31A 2AQHA 3F9IA 1LRKA 4HP8A 1DO8A 3V5NA 4MVJP 3PWZA 4D0RA 2PR2A 4W99A 2GRAA 3C1AA 3ZWPA 4R01A 3S1LA 2PD6A 1D1SA 4LN1A 1DEHA 3AM3A 3O38A 3VPHA 1Y8RA 5ENVA 4UREA 5T57A 4KOAA 3ZW8A 1UZLA 1T4BA 2X7HA 1R4NB 5U1PA 5EJ2A 4PLGA 2ZTVA 1IULA 1KS9A 5F21A 4XGIA 1C0LA 1PS9A 3DMTC 3FR7A 1HDRA 2P5YA 1QG6A 4CLOA 4XIJA 1QR6A 4QO7A 3EGOA 4DREA 3WIDA 3JQ9C 3G1TA 2X4GA 2E49A 4UEKA 2P9EA 3ONDA 4OSOA 2HO5A 3INRA 3FNFA 2QX7A 1WZIA 3ZV6A 1CQIA 1A72A 4FJ1A 1VSVA 2O3JA 1R15A 4I9HA 4P4GA 2VUSA 3L6DA 1XQ6A 1B3RA 2J8ZA 3I6IA 4R68A 4CMIB 4NBVA 4CMEA 1V3UA 3C85A 1GZ4A 3F1KA 2LDBA 1WDLA 4DIFA 1IOLA 4ESOA 2C2YA 1HDXA 2LDXA 4BO8A 3PJEA 1Y8QB 3AUUA 3JSAA 1HE3A 4AJLA 5THKA 4XZ3A 5B37A 4B8WA 1WNTA 3T4EA 2YFQA 4UVHA 1ZK1A 3BTVA 4UUNA 2YW9A 3CMMA 3OHSX 5A9SB 1H2BA 1EFLA 3DC2A 4Y6SA 1ONNA 2EGGA 4DA9A 1UP7A 2Q46A 5JW6A 3KSDO 3GT0A 3W6UA 4FFPA 4TQGA 5KOIA 3ASVA 3RD5A 3K30A 1J4AA 1HTBA 1PL7A 3R1IA 5EESA 1Q7BA 4KQWA 2CDAA 1I8TA 4O63O 5ILOA 2CF6A 2RIRA 2DFVA 1NPYA 4RVDA 4HX5A 1LDGA 3JQ6A 4LRSB 1YO6A 2B36A 3K96A 3W4KA 3ZGYA 1MX3A 1DC5A 3VTFA 1BVRA 5DN9A 4FQ8A 3G3EA 1A9ZA 4Q3CA 4EITA 2I9PA 3MOIA 4JBHA 1HSZA 1P45A 4FFRA 3BHJA 4E13A 1LX6A 3OQBA 3RIHA 1U8XX 2J3KA 3BXXA 1DHRA 4XRRA 3PGXA 4R3NA 1DIBA 5L9AA 2PLAA 3AOEC 5L4SA 2R00A 1HDGO 4IXWA 5CDUA 1BTOA 1FXSA 5HRUA 2Z1MA 1TLTA 1YH3A 3BMCA 4YJGA 2C82A 1XU9A 4Z0PA 5IXYA 2ZB7A 1DJQA 1L7DA 1QYXA 1D7OA 3FPLA 4XD2A 1WZEA 4E2YA 3WGQA 2YQ4A 5B4VA 1HDCA 3E8XA 1ZMTA 3DZJA 3JQ7B 1PZHA 4Z0TA 3GNQA 1L1FA 4BGEA 5JBIA 3DZFA 1O8CA 3LC2O 3RUEA 4NQZA 4O0LA 1MG0A 4OQYA 3ON5A 5L7YA 5BNIA 3AY7A 2VT3A 4BB5A 4NJOA 4W7IA 4ALMA 2X0IA 2EW8A 1AUPA 2X0NA 3L77A 1NPTO 4FDAA 4RF4A 1YONA 2Q4EA 2X1HA 1F12A 1GCOA 3JQFC 1YOVB 2NVBA 2CVZA 2W2LA 3RC2A 2QRLA 1HT0A 3AFMA 1X7HA 4OKIA 1BDMA 3ADPA 1PS8A 4GWKA 2GO1A 1EVIA 4EGFA 2YZ7A 4EZBA 2NVUA 3WNVA 3OEWA 1LRLA 1NM5A 4BKQA 3E5RA 1KVSA 1E92A 2GDZA 4DGSA 1I3NA 2E82A 3AM4A 2BMAA 1VC2A 1GR0A 2W4QA 1PJSA 4FW8A 3ZWXA 1ZW1A 1T2DA 4PLHA 1VRWA 3OA2A 5AQ1A 3GHHA 5JS6A 5BR7A 3Q11A 2PY6A 3QWAA 1I36A 2HK8A 3FNEA 1XU7A 4LMRA 4ITUA 3ZNNA 4HFRA 2W98A 1X15A 2WMDA 2UVDA 1R37A 2FRDA 3E48A 2EG9A 3PGJA 4R5MA 1EUCA 4HBGA 3OETA 3RFXA 4A10A 1O9BA 1DAOA 3VH4A 4B3JA 4JQCA 1KETA 1UXKA 5G4KA 3S55A 2V6BA 1XA0A 1DRUA 2ZYGA 3FNHA 4RPJA 4XB1A 3TZQA 1DC4A 5T8KC 1I2ZA 3HE3A 2VRBA 4GMGA 5AXAA 5A5FA 2PZKA 3PZBA 3GVCA 2WD7A 1O94A 1MC4A 5DF1A 3WYBA 4BNJA 4BQRA 3IMFA 4RJTA 3RQSA 3M2PA 3S2IA 1ZEMA 4MO2A 2JFHA 4JJGA 5I8ZA 4UUOA 3GHYA 3FRJA 4AFNA 1H0KA 1JW9B 1QYWA 1YVEI 2O4UX 5B1YA 1AGNA 2FY8A 4Y6PA 3T7CA 4CUZA 4IS3A 4PZEA 4D43A 2P4QA 4ALLA 3GZ4A 4JCOA 4K1LA 1HF3A 2WE7A 3DBLA 3QA9A 3AFNA 1E3SA 1Q7GA 5FI5A 2V6MA 3FSRA 2QRKA 1WXDA 3NEPX 2I5PO 4BQPA 2EHDA 1LLDA 4BGUA 1DLJA 5CDGA 4RLHA 1GEGA 3OIDA 2TMDA 4O6VA 1IPFA 2VYND 2ZKLA 3RBZA 1U3TA 3SEFA 4B3IA 4Z9XA 2Y68A 1J6UA 4CM8A 2IEDA 1VM6A 1X14A 1E7RA 1NASA 4BMSA 1H9AA 4LGVA 5BNFA 4AJ4A 1DHTA 3Q0EA 3DDNA 4NJMA 2JL1A 3GC6A 4BNWA 3PJDA 4ZQGA 3W8EA 1EE9A 3GGOA 1BXGA 3RI3A 1HRDA 1I01A 1Z45A 1JTVA 4CQMB 4IIUA 3EAGA 5DBFA 2NWQA 1NAHA 2X9VA 1PS0A 1ZK0A 5I9MA 1O95A 1AHHA 1X1TA 2CFCA 3LT1A 3WR5A 4FD3A 3VTZA 3NDIA 4CLRB 2I65A 2AEMA 5TF4A 5JAZA 1TT7A 2H5LA 1DJNA 4P8RA 5ICSA 2B35A 4TZKA 3LT4A 5EINA 3L07A 4TKLA 2I3GA 1HE5A 1X0XA 4AJOA 1MGOA 3HFGA 4GSKA 1DPGA 1LI4A 1R0LA 4WEOA 1GZ3A 1T4DA 3HN7A 5I8WA 4TRMA 3HDJA 3NDRA 4JP3A 4CM5A 1PGPA 2CD9A 4D79A 4CM1A 3H9UA 4KZPA 4CM9A 1XDWA 4NFSA 4R1TA 2YV3A 4PIVA 5K6AA 2IDZA 3P2OA 4DRYA 2QW8A 4CLDA 3LSYA 1Y6JA 1JWAB 4L8VA 4NMHA 2NU8A 3VZRA 2YFHA 1UXHA 1U3UA 2GPTA 3RUFA 2VHVA 4B4VA 4E33A 2W2KA 1U4SA 4N5NA 1R0KA 4PZDA 5A3VA 1GADO 4UVDA 1MG5A 5TT1A 3OJ0A 2ET6A 4AJEA 4H16A 5CAEA 2HAEA 3VPXA 4CLXA 2W2KB 4F3YA 1EVJA 1H9BA 1MP0A 2AG8A 4RDHA 4BNNA 1ZMOA 3BAZA 4OQZA 4E2XA 4HFJA 2ZB8A 5TX7A 2VN8A 5G2OA 4XB2A 3OICA 1F06A 4BO6A 3I3OA 4FB5A 4XDYA 2R2GA 1ADGA 2X0JA 1QP8A 4S1VA 1E1MA 5CG1A 4I9UA 3WTBA 3MOGA 3E9MA 2ZIZA 5F1OA 4WLEA 1ML3A 2Z95A 1OBFO 3PLNA 3ZWOA 1IUKA 3HUDA 1NFQA 3K31A 4RVHA 1QXSA 2BFOA 2QRJA 4QO8A 2Z5LA 3I52A 4RVSA 1D8AA 3ZWYA 4LSWA 3TRIA 1PX0A 1U2GA 7ADHA 1NR7A 3PI7A 4W9NA 2AEFA 1KBZA 1F14A 3K92A 2ZB3A 2B4RO 3L4BA 3RUIA 3VOSA 3GG2A 1A7AA 1GUFA 3WFIA 3ORFA 1Y9EA 4RV9A 4TRRA 2O3SA 5KVCA 3H7AA 3T4XA 3C1OA 4IMRA 4RCVA 2XF8A 1NWHA 2J3HA 3NJ8A 4WE3A 1ORRA 3AOEA 5KIAA 1C0IA 3MJ4A 2R00C 3GUCA 3KLMX 1UJMA 2CZCA 4BGVA 3HZZA 2X86A 5JMWA 1K6XA 4XGNA 1AE1A 4HY3A 4CMKA 3D7LA 5B4TA 2BF7A 3HDQA 1NTOA 4INAA 5KWEA 2AQKA 4OOFA 5ILGA 1UP4A 1HWYA 1PQUA 4Q3DA 3G0OA 1BVUA 1YB5A 2WD7B 1A27A 5COQA 4UVGA 4M87A 7MDHA 4MOWA 4GX2A 4EYEA 4JLWA 3SVTA 1YQXA 1CJCA 1LSJA 1N9GA 4I5DA 3WQQA 3F3SA 3TZ6A 5A03A 3KYDB 2GN6A 4MP3A 3ZWVA 3GMSA 3T7EA 3CUKA 3ZW9A 3NTOA 4YPOA 4J4BA 3Q9NA 3KYCB 3GN1A 3BMNB 2DQ4A 3PZRA 4ZQFA 3SXPA 4XCVA 3U62A 1GUZA 3CH6A 4BNUA 2RAFA 1GQQA 3FD8A 2DPHA 4B79A 5ES3A 1MFPA 4WCFC 4IQ8A 4DXHA 3A1NA 1LRJA 2A35A 2JCYA 4WNIA 2B69A 5H83A 2P9CA 2Y66A 1HZJA 3HB5X 2GUGA 2J5RA 4PLVA 3MJEA 1RKXA 4GLLA 5J23A 9LDBA 2RHRA 3PYXA 1KVUA 1VJ0A 4KUEA 4CL3A 2SCUA 3KZVA 2XXJA 5IXSA 3FI9A 3GDOA 3NT2A 4RO0A 2A9FA 3JQAD 1P0FA 1UAGA 1ZK3A 3COSA 1YL6A 3O9ZA 4Y8VA 3JQFA 3TPCA 3QY9A 4GLOA 4GKBA 3D3WB 4QFCA 1MB4A 1E1LA 2P5UA 2Q1UA 5JO9A 3JQ9A 5CFZA 1E1KA 3GGGA 4YA6A 1ZSYA 4DPLA 3GOHA 3SC6A 4J4TA 2EKPA 5T6BA 1B2LA 1XEAA 4E21A 4HV4A 5CDSA 1UXJA 4Z6KA 3WYCA 2F1KA 1IHYA 3AU9A 3NRCA 2FHSA 3NKLA 1ENPA 1NBOA 3QJ5A 3EC7A 1YS4A 3LC7O 5CG2A 1Y7TA 3MTGA 1JDJA 3KYCA 2DLDA 3MWEB 3OJLA 2OXIA 2OL4A 4CV2A 4CV0A 4ONEA 3K2BA 4WLFA 3ZCXA 1GYQA 1ADBA 4DPKA 5DNAA 4NU5A 3JYOA 4NG5A 3LU1A 4CM7A 3D4PA 4M49A 3EDMA 4BGIA 3LT0A 3NT5A 3D3WA 2HMVA 2BGMA 3CMCO 1K5HA 2HRBA 2E6UX 3TWOA 4YRDA 5FF9A 4M86A 4AJKA 3JQGA 2AE1A 2QIOA 3OECA 3ZWCA 1D3AA 1C1XA 3QE3A 3DAGA 3ZV3A 3QQPA 2VWHA 2WTBA 4PRLA 4MIYA 3UCXA 5DCYA 3GAFA 1PGOA 3I5MA 1LLUA 3C24A 1BDBA 3FF4A 5IDYA 1PWZA 5TJHA 5CP8A 1K2WA 4JIGA 4Q9NA 2X22A 2PZJA 3CEAA 4MVJI 1F17A 1OOEA 1PJTA 3CE6A 3TNLA 1ENOA 4AJNA 2ZTUA 4IXTA 3OA0A 3BMQB 1BXGB 4GMFA 1H6AA 3KSUA 4XQ9A 2W2LD 3IDSA 2JD1A 3PVZA 1Y8RB 1FF9A 4DQVA 3F5QA 1P1JA 3FWNA 1U9JA 3H3FA 3WYEA 4BV8A 3AY6A 1WP4A 1QYCA 4TMFA 1PJBA 3O03A 2IEBA 2NU7A 5KVSA 3P19A 3Q2KA 4BO7A 8ADHA 2YJZA 4OO3A 1UAYA 2F00A 3NTRA 1S6YA 4J4HA 1T1RA 4WJZA 1Z7EA 3HB4X 2PD4A 4HWKA 3EW7A 3RJ5A 1HYHA 2CNBA 4ALIA 3ETDA 2CVQA 4JK3A 1T2EA 1I2BA 4IY1A 1T25A 2OOSA 3OP4A 3WJAA 1OZAA 4O1MA 4UEJA 1OMOA 2FPPA 3G79A 5F5LA 1KERA 4QSMA 1U1IA 3VDRA 3DBLB 4NK4A 4B7UA 5IDXA 3RSHA 2YQ5A 4CMJA 1U7HA 4DIBA 2BHLA 3AI3A 4IS2A 4M1QA 3KBOA 2QQ5A 1IYZA 4RGBA 5FI3A 4U0KA 4D42A 3PHHA 4J7UA 4CM8B 1NFFA 1RYEA 4M54A 4QTZA 1U3VA 4EEZA 4PLZA 5CEFA 1ZUD1 3GDGA 5C5IA 4YAEA 3DHNA 1YXMA 2NVWA 3PIIA 2ZJ1A 3WGOA 4DBZA 5EMHA 4L9RA 5L40A 4KUHA 1HDOA 1PZGA 1H5QA 2NACA 1ISIA 2AQIA 3U9LA 4MP6A 1UDBA 1WAMA 3WJ7A 3TQHA 4R9RA 1I3LA 3VH1A 1T26A 1H6CA 5I7VA 2CDCA 4ZN6A 3JTMA 1A5ZA 1XELA 3LF2A 3I23A 3PIDA 3WGIA 3TN7A 4ALNA 1EMDA 1SAYA 3ZH2A 4F6LA 5IN4A 1HLDA 2C59A 3L9WA 4PN3A 4G2NA 4DLBA 3DAPA 3GGPA 2VYNA 4E5PA 3UICA 4R51A 3BTOA
chains in the Genus database with same CATH superfamily
2AWOA 4X61A 2B1JA 2OFFA 4G4GA 2P2NA 1M10A 5DP1A 2FZCA 3ER9A 2B1QA 2OENG 3CKKA 2PMDA 1DO0A 2J0SA 1Z4PX 1NF3A 3HLYA 5KNBD 2EQBA 3AI1A 3GCZA 4KSBA 1FFHA 1LFDB 1FFDA 5I3CA 5AXCA 2V7QD 2P75A 3IT0A 5FAXA 5FOXA 4MV0A 1XTJA 1RPZA 3ROMA 1UQRA 2RGGA 3T5TA 1KTVA 2O2EA 3D6JA 1KXJA 2PX2A 4KFSA 4P7JA 4D92A 4G5RA 4RF3A 3WIUA 3D7MA 3EUWA 2C7PA 5C81A 2ATIA 4QM7A 4D96A 1GFWA 2VC2B 1SB9A 2EFDB 2NLOA 3DLIA 3M7IA 2QLTA 4ZZIA 1JKIA 5EYPB 3SN6A 3U1TA 1TO6A 1L5OA 1SHJA 2WG1A 2WKRA 4OF4A 3U9SA 4ZCPA 5IZCA 1UXIA 5KI6A 1P7WA 4PLCA 4UHDA 5IMSA 4C4SA 1G6HA 5I7AA 3ZVMA 3KXLA 3MXTA 1QHHB 5T3YA 5J2UF 4QYTA 4CLRA 2BKAA 2NTJA 3C6BA 1QS0A 4V0LA 1T8YA 5E1MA 5AVOA 4ADSG 4PQYA 2WW8A 4XSVA 3RT7A 4E5MA 1X1CA 3THWA 1LGYA 1E9VA 3NHLA 4OM8A 3PNQA 3IHTA 3FAKA 4L8WB 3CRZA 2QKYA 4BNLA 3LBHA 1UMBA 2GJKA 5LDGA 2KW5A 1AUQA 4Z5XA 2NQ8A 2NO5A 5BT9A 4B82A 5I9LA 4S35A 5J4YA 4JT8A 1QGUA 3NT4A 3DV2A 3UT6A 4QM6A 2NIPA 5LQUA 4KC0A 3OCWA 4RZ3A 3RPEA 1W4ZA 2NUTB 2PSEA 3E5HA 4OFXA 3BL6A 5LP6B 3E9QA 1B76A 1ZN9A 2YVQA 1USWA 4DL9A 2YINC 3HYCA 5LIRA 2I2FA 4LK2A 3BK2A 1R16A 2BM1A 2X9GA 3DHYA 4CN9A 1D09A 1XLWA 1QTIA 1E3WB 1SXJE 2VF4X 2FSUA 2JARA 1XN4A 3LFTA 4HEHA 4M83A 4YDHB 5H5JA 2O7QA 5CLJA 3UW3A 1CY4A 3JQ7A 3UEOA 3J7AC 4Z0HO 3D7KA 5LQSA 4D45A 3R2JA 4AX4A 1FNCA 2ZIEA 4YYZA 2Q50A 3ZZ1A 3TE6A 3ZY4A 13PKA 1QDEA 4M76B 3LLSA 1RHJA 1UFOA 3R20A 2FHPA 3RHFA 3SBOA 1ISMA 3GNTA 2ZP1A 4INZA 4UMFA 4LGCA 4EGQA 3RRYA 3UY4A 5JNSA 2NSJA 1EUZA 2GHRA 3R0VA 3FVTA 1WG8A 2HIAA 3EG9A 3ZPXA 4H27A 2C4NA 3LYHA 1QZ3A 1BCSB 1VHWA 4E5YA 1N77A 3F97A 4OHCA 1HBJA 4YMVA 4Z54A 2GI4A 2WJWA 3EIFA 1N8TA 2MMCA 3AEKB 4FZ5A 4M36A 4YJDA 3TQFA 1UP6A 3W9YA 1GTSA 1FYEA 3PDIB 3HFSA 2O2IA 3RKSA 4FFOA 6GPBA 2OK7A 2C9ZA 3PKJA 5K8UA 1DT3A 2I3BA 4GHWA 2BP7A 2IPXA 3CH7A 1KARA 1S9HA 2V96A 2XUOA 4FN4A 3TIIA 4ZYYA 2E37A 3UGJA 3RU9A 2O8EB 4IZOA 3TFOA 5MGBA 1FQWA 3JQBA 4J91A 3IQIX 1Z0DA 1CUCA 3NC1C 1GSIA 2F6RA 5HA5A 2QB5A 5GJBA 1AGYA 5FTJA 5E38A 5IT9A 3DDWA 1V6CA 2VLIA 4AG5A 2J9GA 3MPUA 2PL9A 3HCDA 3ELYA 2GVZC 2FPIB 2AW5A 1E1QA 3GJRA 2MINA 3FE2A 3EVFA 1JQAA 2AJBA 1XRPA 2VP2A 1PEYA 3M1AA 4EFLA 4U7HA 3D8TA 1ATIA 2FOXA 2WRZA 4LDRA 3M6WA 4CEHB 2EKQA 4RTQA 3RIMA 3UHOA 4PLYA 1CYDA 1YUMA 4CM3A 4GYJA 1ZYUA 3B6EA 4MJLA 4B34A 1HDZA 2XSZD 3QHAA 1BS1A 2WT8A 2B4AA 4DC0A 3IQZA 4OEHA 1A3CA 1BWSA 5FWAA 1YJCA 4CM4B 2IV7A 1MNAA 4EMBA 1QYVA 3H04A 4Q7MB 1VKNA 4X97A 3TAHA 4DQDA 3RVSA 4CL0A 2RHMA 4Y9UA 1SQSA 3P0JA 4LCBA 2VWQA 3WMXA 1C9MA 1NVGA 3TTSA 3W2FA 3EXFB 2Y76A 1ZIYA 1WUYA 2EKLA 4LI0A 2DUJA 4OQ4A 1U80A 3W2HA 1Q0SA 3U6BA 3OKAA 1OVGA 1M34A 2NVUB 2AJCA 4GOKA 4YRIA 2Y0PA 1M0WA 1Z4OA 3LBFA 2BGUA 3NVMB 4FFLA 4L8GA 3W8FA 1X9HA 2O1SA 4FMPA 4R7ZA 4WESB 4WJKB 1L2TA 3T7IA 2B20A 4P4TA 4MUJA 1P3JA 4EHLA 1NBWB 2VT2A 4YJ2A 2V98A 1BGXT 1FP1D 1UPBA 3M1IA 5A6SA 3NEJA 1ZWKA 5B3JC 2AOVA 2AN4A 5D8DA 1F0PA 3GDHA 3PKIA 1UJBA 4PGHA 4Q15A 4NU8X 3TW0A 1NYTA 4BFVA 2QUKA 5IF3A 1GNQA 1RQXA 2B8NA 4ZHQB 5HYVA 1K5DA 2XDWA 3V97A 4CLHA 3WNQA 4OXYA 5AVYA 5I7HA 1FMFA 1GJRA 2AFHE 2ZATA 3A6LA 3UENA 4UHHA 1N5MA 4F04A 2UYCA 1ZBQA 1BEUB 5JCJD 3NZEA 3HP7A 8GPBA 1GNLA 3BFPA 1T3SA 4XTCS 2K5UA 1KO8A 1BS2A 1ZGBA 2BONA 1WB4A 4GL4A 2H4ZA 5CLFA 5DOVA 3O4IA 4AP9A 1I1HA 2JGRA 1P0IA 5LWHA 2ZREA 1CNEA 3GL9A 5DCWA 4A2PA 3ETGA 4TSKA 4IMJB 1B74A 4UFNA 5JTTA 5KNLA 2J59A 4IQ4A 4BLSA 3CW9A 1NSTA 2XVAA 3OEYA 4QAQA 2QS9A 4FC6A 5J3JA 3GLHA 3KL2A 3STHA 1GRCA 2CHVA 3PC8A 5BNTA 2O2DA 5HE9A 1NRIA 5GINE 3ZLTA 5ITSA 3WMFA 5FEUA 3WB2A 3EFEA 4ZEOA 3OBBA 2I4OA 1XVVA 2PZAA 3ECAA 3I28A 3HXKA 4ZQCB 3SD7A 4AT1A 2UYHA 2GPYA 4WSOA 3QUSA 2R6DA 5FR2A 5HZGA 1LI5A 1D1QA 2RH9B 5CB4F 2WJIA 4DJAA 4IH4A 1SQGA 3EXHA 4RKRA 1HGXA 3RO7A 1RZRD 3FN4A 1X70A 5JHHB 1YE3A 2AQ8A 2YNMD 5DGCA 1MQAA 2DPMA 2IYLD 1KI6B 2NZVG 4E3ZA 1LSUA 3FB1A 1FZTA 1QPBA 4GYYA 3F90A 1H93A 1WNFA 1RHRA 1XLTC 2UUPA 4IMPA 5DOZA 3RYFA 4MK4A 1HFJA 2GT1A 4DDMA 5A4MS 3GUZA 1B4DA 2VL7A 3D1LA 1L5HA 5JIBA 3IA2A 1ULAA 1CHNA 3T4PA 3CIOA 5I9BA 1BQ3A 2ZYWX 3OM8A 3LQKA 1G8MA 1LQUA 4JC0A 1N6PA 1XMPA 2PT6A 3H6HA 2WNSA 3KKEA 4PZ0A 2QTAA 1AQUA 1MXHA 4PPFA 5KHAA 4A1FA 1JDZA 3LW8A 1ZY2A 2IOQA 4TSFD 4UMEA 5LLSA 3RROA 2PL1A 3W4JA 1YBFA 5C34B 3W2TA 2YBDA 3HP4A 2VHXA 3OZCA 3EC2A 1I5RA 3I32A 1A8PA 4K9NA 3TOCA 3IEMA 1LK7A 2VZ9A 2R7MA 1B7GO 3RNLA 1MA3A 3U7QA 1Z4LA 4IDEA 5FTNA 1QFXA 2JCVA 3M1YA 4MEBA 3PLAE 1BMDA 4A0RA 1KRWA 4QYMA 1M54A 2VT7A 2AOTB 2JIZA 1SC9A 2PWZA 4N3CA 2KBEA 5KQLA 4NH4A 3U81A 2VAXA 5EE1A 3T9EA 2QTBA 3ENVA 2PUAA 4ZODA 2ZS8A 1TO2E 5HF5A 2GOYA 5FOSA 4IH9A 5B3KA 1JIKA 4WK4B 1S8AA 2AKYA 3RVRA 5ECYA 3PI6A 4ITVA 2HQSA 2YY6A 3AUYA 1GZVA 4YRLA 4L6CA 3EIWA 2A1UB 1DCFA 3PYMA 1NE7A 1J7JA 4JODA 4A82A 1J0BA 1UDCA 2G0NA 3UMRA 2VI5A 2ZSDA 4H7JA 3HGQA 4XYGA 1X9GA 4OGFA 5JMOA 4BVKA 1STOA 3HN2A 1RXWA 3N05A 3VR3D 1T2CA 1JQDA 3AF0A 4TXNA 2IOFA 5C32A 1MT3A 5TEVA 1MHPA 3HSKA 4JELA 3O83A 4X1OA 3K0FA 3TZCA 2DKOA 1C4XA 2A58A 4GZMA 3GRKA 3LCCA 4N4AA 1XFDA 3VZSA 1GYRA 4D8WA 1GG2A 4B8ZA 2C5AA 1MJGA 2D1TA 1LK0A 1DFHA 2I66A 3FKQA 5F3DA 1L6RA 2FQXA 2CLMB 5ADWA 5LSAA 1OV6A 1SMKA 3UFXB 2C7GA 1JIQA 4YV0A 3LKVA 1RZUA 3GT4A 1OFUA 2YWFA 1XPRA 2D1QA 1YOBA 1KO7A 2C1EA 2EATA 4EH1A 1JA9A 2CKDA 2Q2QA 3LYLA 2EGHA 3HG7A 1U2PA 2OO5C 4HYYA 1BXKA 1LB1B 4KBYA 5DTEA 3Q3IA 3TRDA 3CG0A 3EODA 3FRIA 5NLLA 3T7KA 1UL1X 3KJQA 4ZA2A 5C7OO 1QTNA 1M8GA 1Z0ZA 3KJXA 4NXNB 4ZZ3A 1CZHA 2NTVA 3JARB 3V3KA 4BNKA 2X7XA 3LOQA 4RZXA 3VGPA 5HTKA 2ORED 2XH8A 1J9ZA 3HZOA 1E8MA 3LP8A 1J97A 1S4QA 2CLFB 2JBWA 3MINA 4GQAA 4YXWD 1KFJB 4V39A 1CZUA 1YTUA 4YAGA 3OQHA 1KVTA 2B3DA 3D0QA 3B36A 5L7WA 3OI7A 4D3DA 1LC0A 2Y0BA 3RIGA 1N2BA 4IJWA 2A1TS 4M9RA 2NUAB 2ILVA 2ZBUA 3VO8A 3UMMA 3S40A 1HQKA 2JHGA 3C8DA 5HWSA 2YY7A 5E1BA 5IKOA 3OQOA 2J7PA 3FHOA 1ZD4A 1FQKA 3QVUA 3UCEA 4OHYA 4S24A 1J00A 1HEYA 2EV9A 5D3QA 2WOJA 3LY5A 4DUPA 2N1BA 2O1WA 1D6JA 4UJ3A 3AONB 3KQOA 4EY5A 1NI3A 4D2IA 1I3KA 1PQWA 3D6NB 1EFTA 3OZTA 3RSZA 2YMQA 4K28A 4LXGA 2Y1OA 4RENA 1OI3A 1AM4D 1XZEA 4OL9A 4JMLA 3SMQA 2VJLA 2L82A 1QHFA 1LW7A 4A73A 2AI2A 1QH1A 2PX0A 3G5UA 1SEPA 3KOXA 3Q2IA 2V7PA 4WK2B 4BBZA 4NPCA 2XTMA 3DCNA 5ADVA 4R8SA 2HPAA 1ZLXA 4BKUA 2GWHA 5I7SA 4MINA 3A14A 3MYYA 2ZPAA 3G8AA 4C87A 2I03A 4V02A 2IXTA 4LOLA 1MNQA 3S29A 3JVDA 3ETJA 3UK7A 2BZSA 2P3LA 5KJEA 2P9TA 3FPFA 2WM3A 3B9PA 2RMKA 3B1VA 3GYBA 2WU0A 2CXRA 1YJ8A 621PA 1C7FA 3EYWA 4TTIA 2BI8A 3VX3A 2JJ1A 3B20A 3H8WA 4UVIA 2C7OA 1CDOA 3UB3A 3UMFA 5JARA 3KR9A 4GEKA 3DAYA 5EQTA 2OM2A 1ULHA 5E95A 1W6UA 2YWBA 2IKSA 1Y7PA 3MTQA 1RWBA 3LBNA 3DL0A 4FZJA 1L7EA 4II3A 3UT0A 4MPJA 5CCDA 4BXOA 3CSDA 2BGKA 3K8OE 4H35A 4I2NA 4TPKA 2C9MA 2JLBA 2C04A 4ZOLA 2RGWA 1LPOA 1U6IA 1Q19A 1HT2E 4Q1VA 1SUIA 2X2OA 1T34A 3PRKE 4I9FA 2O23A 1GPNA 3H5AA 4F46A 1E2MA 1USVA 3TLGA 2ERXA 2Y6UA 3QYAA 4C0KA 3FSGD 5JT1A 4LUCA 5AKEA 3KUDA 3VZPA 5KTSA 2CVOA 3DLAA 3RM3A 1OH5A 2PMWB 4UHBA 1VCIA 2CBGA 3DFFA 4P2BA 4BUCA 5JSZB 1CXZA 1XCBA 1AZWA 1IHXA 3FHLA 1E5TA 3LYUA 5D1HA 3W90A 2OAGA 3ETHA 2IP1A 2UZ0A 3IOCA 421PA 4NCHA 2ZULA 4O4JF 3UUGA 3G2MA 4HX9A 3RFUA 5CCEA 1WZUA 2ZG6A 2CYBA 3WG9A 1MZPA 2LNDA 2PGDA 3PT5A 3R0QA 1M6VB 3PQ6A 1GKKA 2ZJ4A 3MAGA 5DEIA 5A71A 5HX7A 1BRTA 2IOFK 2YFKA 4XYLA 4PR3A 1IY9A 1YDEA 4OY3A 1Y6GA 1F4VA 4YRJA 1R2QA 3V7YA 1FMLA 3CBGA 1YULA 2O0KA 5DHAA 3MAJA 2JLAA 5FUXA 2AMVA 4MMXB 4W5WA 2FWIA 5H4GA 2OV3A 2IU3A 1Y7HA 2BFDB 4DEYA 4EUSA 1VLMA 5IYZA 5F9HA 4F2WA 4BVFA 2REXB 1CR0A 3DW3X 4Y1RA 4DG9A 3SSOA 2ZJOA 1BXZA 1U98A 2BBOA 3ZIDA 2Y1KA 2YMLA 3OJOA 5CNIA 4B3CA 5HNKA 4P4LA 1QNFA 1ZEJA 3FPCA 3T3IA 3QKRB 4HATA 1DKOA 4PS1A 3WK8A 5WRFA 5KWVA 3QKSA 4TWIA 5A4JA 1ESNA 3K0CA 1ZSVA 4QFBA 4RVFA 3TRJA 1VPVA 2QZ4A 4KQ2A 1P44A 3O7WA 3HWSA 3KT8A 4OYYA 5T67A 3ZDXB 4AY2A 5EQFA 3TPZA 1MA0A 2UZAA 2PLWA 3QJYA 1IRXA 2H1WA 2IIPA 1IOWA 4BHTA 4IKOA 5F3RA 4RGVA 1N2ZA 1UKBA 1BEZA 4RSRA 4WMLA 3PRHA 1W88B 2PKQO 4DMLA 5EXTA 5AOVA 5BYAA 3FDZA 4ZO6A 4EEXA 5AFSA 1K6EA 2ZSKA 1Z7YA 1L3CA 1YRHA 2PRKA 2DTEA 2DWQA 2ZYAA 3C8MA 3PC8C 3MEQA 4DYDA 2I8LA 3P9QA 4BNGA 1AGXA 2HA5A 4LOJA 3ZNOA 1A2BA 1IN5A 2ZS9A 3O93A 2C54A 4A4DA 5KKCA 1G3IA 1OWOA 4MVJG 4FDMA 1R8JA 4J0CA 2D1SA 2KLBA 4Y0AA 4X91A 1T2AA 5KKAA 4A16A 4UU7A 1W2GA 3HCFA 5C0OE 3E35A 1FP6A 1HTTA 4CMBA 4G4JA 3V1TC 1H6BA 3RYIA 3HXQA 3MWLA 4TV8F 8ABPA 4J49A 5MFPA 4JI2B 3AINA 3GA5A 4C88A 2V8OA 2XTZA 4ID9A 4Q21A 5DM4A 3WRXC 4EAAA 2IA5A 3DVAB 2I4LA 4NE9A 5HQJA 3KJFA 4WNCA 3MB8A 5AJHA 2YVUA 4JP2A 3HKCA 4K7JA 2G8NA 2OUIA 1AK9A 1U2DC 2GEFA 1YRWA 3QW2A 3SIRA 4E5UA 3K35A 2VRCD 4LC1A 4UVEA 2OA0A 2I3AA 4D8YA 3EY4A 4DLLA 4LF6B 3KM0A 1YQUA 4C7MA 2OM6A 1NZFA 1AQNA 2IHTA 4UOQA 4ZICA 1U02A 5D3ZA 4JYAB 2Y93A 3G8CA 4JNKA 4JENA 5G0SA 4TTTS 4AJJA 2I55A 3IBYA 4PGFA 2VQFB 2X40A 4ZQHA 1Z4NA 1GYPA 1TMGE 3FB4A 1X19A 3P20A 3PXAA 4G5XA 4JQZA 2Q2OA 3MBKA 5JMPA 4RK5A 1ZCFA 4GI7A 1VMEA 1LF5A 4AKSA 2Y8EA 3MMNA 1GTZA 4MKGA 4MR9B 4X7MA 4NL4H 4O5OA 3DTVB 1NM5C 3WLKX 4FX5A 1GXSA 1ODSA 3GEGA 5EUMA 3JQBC 4S2EA 2O8FB 2FMIA 3QXJA 2VEOA 1SOAA 2C3UA 5H3CA 1JR2A 4ZAVA 1FLDA 5AVJA 3N2KB 2FGKA 3Q7QA 2R6JA 2BDUA 2HWUA 1ODCA 4GM1A 1H4QA 1UDRA 5FCDA 5FEMA 4ZMSA 2H4HA 4L76A 1TW3A 3L6RA 3OQVA 4W6QA 2HA3A 3C1TA 4L6AA 4ZI7A 3K94A 1VIDA 2CXTA 4ZEXA 4BFCA 5IT4A 4Z9AA 3TUJC 3AL0C 1E1RD 2BFBB 1XLUA 4MQ4A 4E2WA 5KTOA 8LDHA 4I3GA 2Q1WA 4WKNA 2XDYA 3BXPA 1X2EA 4HH1A 2XGMA 2DUWA 2FP4B 3OE7D 1IXRC 3RVOA 4CU5A 5FOQA 1FUIA 3FDZB 3LQ2A 3HVKA 1QGOA 2GM5A 4MKHA 4MLCA 5AM3A 2JGDB 4XGQA 4QU5A 4ZT2A 3SFZA 4HDMA 3ASUA 1Z15A 1IN7A 4XCXA 2YN0A 1TT5B 1RQLA 1PL8A 2J32A 4FFSA 5IW8A 4KPEC 3MINB 2ZRLA 1FLNA 4QODA 3WV4A 1XQXA 4ESEA 1UBFA 2ZRPA 4QJ5A 2FSPA 4HN2A 3T52A 1TK2A 5LQMA 1KMCA 2QPAA 3UKOA 2OSVA 2GVDC 3HPRA 2G67A 3ZS9A 4G1EB 5EJ9A 1IEVA 5KX5A 1Q1AA 4PXAA 2NUTA 4JBXA 2OCAA 2BH9A 3LBIA 3MGGA 4J8PA 2ZGVA 3IBGA 2HKIA 2NTEA 4WXRA 3AQ4A 1DQZA 1M34E 3FPEA 1KY2A 2QI9F 3O73A 5B2FA 4FJ0A 1OB5A 2BEVA 2NYAA 3AUJB 1T36A 5AKYA 4JXJA 3UANA 3VU1A 1AKUA 1JIUA 3F9CA 1NVVQ 3QW4B 4INOA 2Q99A 3ZU6A 2C4VA 3QELB 4WK0B 1TI7A 1JHOA 3PDWA 1G20A 2WF6A 3MMPA 3B78A 4RK0A 2GYYA 4LOHA 4KZKA 1Y33E 1X7DA 4WPGA 1DARA 4E5NA 2ILTA 3EZGA 2RKOA 1O8BA 4UNSA 1VZ3A 4RD1A 2H4FA 5B7PA 4AW9A 2PSSA 4GBMA 4XVRA 1YQGA 3ADOA 2G83A 2IIVA 3L7JA 1YKFA 4HNHA 3WYNA 3CPHA 3L0PA 3PE4A 4BEBA 2Q6OA 3ZJTA 1X80B 5TNXA 3MFQA 3G0DA 2VWGA 4UUMA 1GNRA 1ETUA 5IK2D 2OZEA 3GO4A 3I6MA 1QSGA 4AJ2A 1DINA 5ECDA 5FTMA 3UG6A 4BN0A 4BNYA 2IX3A 1RLUA 4OIFA 2I1WA 3QFRA 3CNEA 4DTIA 2PH1A 2FLVA 4EKNB 1XL1A 3PRYA 3PWSA 2IYEA 2I4TA 3BAFA 3AEUA 3CUYA 3K1ZA 5CIWA 1QQ5A 3RV3A 1WZCA 5JAPA 3RAFC 2HA0A 4DFDA 1KC1A 1I4OA 3FPJA 4DPMA 5AKIA 1CY0A 3FVRA 3B5IA 3LF1A 3DTVD 2HDHA 4XR4A 2ZVPX 5KAMA 2X5JO 3A1WA 3TFQA 4FB4A 3DOCA 3X0DA 3O8CA 4EFDA 2C2MA 4CODB 3MB5A 1C7QA 1R0XA 3UW1A 4BFLA 5DYGA 4RA6A 3W2GA 1RBQA 1O6ZA 2P8JA 2IODA 1XVAA 4PYRA 5JCJA 1IBCA 3WZLA 4D02A 3LY8A 2A57A 4EIWA 3HJUA 5LNK6 4PQGA 3KR2A 3DLPX 1KJ8A 3R7BA 4DLUA 3RVDA 3GI1A 2P6PA 1EK6A 5AVTA 1KZ1A 4DLAA 5ALDA 1V16B 1P19A 1BOFA 2J3IA 4Y6GB 4J07A 2BUBA 1Q6YA 3L0CA 2PT5A 4N3AA 4OGGA 4D3ZA 3PC3A 1JLSA 2AWNA 3W04A 3PFFA 1NL3A 2ZK7A 3IVAA 4LMBA 4LF9B 1YR9A 1O03A 2OQ2A 2GASA 1LLQA 3JWHA 4G1CA 3O8NA 4W8HA 1PTJC 5I9SA 3ZBPA 1OR8A 1WDKA 5HTOA 1RM3A 5EHGA 1Z7WA 3AETB 2DVMA 2XOXA 4PG6A 1TQ2A 2AC4A 5C8YA 3P9PA 1WZNA 1PYDA 3HM2A 3ICVA 3KYIB 2XT0A 2PUBA 1R66A 1KJNA 4AF8A 3WWZA 5GMOA 5AI5A 2ES4A 2OV1A 1DTWA 2VQ3A 3BJEA 4M9XA 2J3LA 1M73E 3QX3A 1WD7A 5F76A 3SZUA 2G0TA 2EWWA 3UYLA 1C3LA 3NAQA 2EJWA 2W5UA 4B6OA 1RCUA 4F4JA 2IHUA 2DETA 1EBFA 1JQKA 1VJTA 4KGVA 4WACA 3M4ZA 3QVSA 5A05A 5KMGB 2PVSA 3QMVA 1K5PA 4QE3A 2ZUBA 4JUCA 1CCWA 1DRWA 4DMGA 1E3TA 4XWWA 2IYQA 1FTGA 3T1HB 4NCAA 3G7NA 2BIFA 4IDNA 5K8CA 1CT9A 1QJ4A 2FNAA 2HSZA 3KC2A 4RV4A 2CV0A 3FUCA 1OHHA 3E9ZA 4PLPA 4RHCA 3BSWA 5DYNA 2QD2A 3JS5A 1TIKA 5KYXB 2FW0A 4D4KA 1JXAA 2MTBA 5B1SA 2DT8A 1RC8A 2FB9A 3L92A 4HUJA 4D97A 3CNQS 1ID8A 1ZHOA 3GB9A 3D6AA 1P77A 2ZEJA 3WB0A 1N33B 1BQEA 3VOTA 2FOIA 2IZ5A 1IBRA 2B8TA 4JJAA 3RSQA 2R8RA 2VYVD 3GRFA 3GRCA 4F2DA 3EGDA 3HWRA 3VVCA 5A9TA 1E0KA 2GN4A 2OORA 4BJ3A 4RMJA 4OXXA 2IW1A 4J1NA 1P5HA 1RXYA 3UWSA 2P6UA 2WJVA 5J2TA 5A5VA 5IJ9B 4XJSA 4F9EA 3DJFA 1Z2OX 4ZANA 4BLVA 2F9MA 1H0SA 2IYOA 3KOUA 3WB9A 3OC6A 1I5EA 1Z6ZA 4RQUA 5G3YA 4PTLA 4PNPA 1LPNA 5KJCA 2Q62A 1M2KA 3NOXA 3SC3A 3NOVA 4D3SA 4RCZA 1J1UA 1V5GA 1LQ2A 4ENTA 1Z26A 4NBUA 3H9BA 1Y8AA 1R10A 3ZV5A 1QNLA 4MR8A 4L4ZA 2J45A 5LZ5A 3CCBA 4D3FA 4CV1A 1E7WA 2CMDA 3F5SA 1Q7TA 1W85A 2A86A 3O9VA 4UTNA 4BBPA 4PCAA 1GUYA 2XIQA 4LC9A 3HFJA 2DHDA 4TLAA 4FW9A 3NHPA 4JBLA 3IE0A 3V2UA 2HIHA 3DT8A 3GIDA 2GTIA 3W5UA 4G63A 2GM9A 4O2BB 1K89A 4YCSA 1S1MA 5DTMA 1X42A 2HJWA 5CAEB 4P08A 2Z2IA 3KQNA 2O2GA 1EP9A 5CR9A 3MCVA 2OGWA 2Q7OE 4G5YA 3VJRA 1YR1A 5BRNA 1T8PA 5IF9A 2JAHA 3OIYA 4IJUA 2ZJBA 3WGZA 1DKUA 1LPBB 3OZSA 1ISJA 3KB6A 3M2TA 4F4HA 3WJ1A 3D6TB 1KFEB 3I4FA 3K8YA 1J33A 2PVPA 4WFQA 5B64A 5CEJA 5BR8B 2RGEA 3L0ZA 1FRVA 3NGXA 4LTNA 4RL4A 1T2NA 4WVFA 4MDYA 3ZQUA 3TK1A 2MHCA 2B2CA 1JP7A 2Q4TA 1ST2A 2DQKA 3MELA 4U9IS 5TF0A 4AMYA 1CF4A 4KRXA 3SIXA 1ISPA 1E0SA 2XCQA 2O14A 4NVRA 5COBA 3ND6A 5K3EA 1DC3A 4TKVA 1TAHA 2LCQA 3I58A 4RH1A 4BO2A 1K8RA 3GXOA 4WCFA 1CEQA 3QEOA 4CGZA 3Q3CA 4MWTA 5DTJA 4Z1MD 1KH2A 1TJ5A 4FGSA 2CZGA 2IUSA 5ER9A 7REQB 3GLIA 2YJNA 3I04A 2AVNA 3L7OA 1WSBA 3ET5A 1JR3D 2OV4A 2DT5A 1K6IA 1FOEB 1LTHR 3KV3O 2W7TA 1RI5A 2PH7A 4GX0A 1EG2A 4CG2A 4RGQA 1P7CA 1E2UA 5EIBC 2JBHA 5DBIA 5HS6A 2V65A 4QAJA 1DBIA 4YS6A 4DHWA 4HOYA 3RS3A 7GPBA 3W5CA 3KSZO 5LCXA 1E79A 2X42A 3IVXA 3O26A 4AN1A 3UTDA 2RD2A 3K53A 1IZ7A 1ORTA 1T5LA 3N07A 1J06A 4IIXA 1F2VA 4IQ0A 4MKZA 4E4RA 1AHNA 2ZDHA 4W82A 3HI4A 1TB4A 1NN3A 3F8SA 1CWUA 2C9OA 2FEAA 3TBHA 2FEWB 2GA8A 2YV1A 4U2DA 5C1OA 2BGWA 4PO8A 3HL4A 1CW2B 1PQYA 4KMMA 3C45A 4LF7B 4CQLB 1BCRB 1ITZA 2GNPA 2YXEA 4JOQA 4DCUA 4YCCA 1AUXA 3O1HB 3SR0A 1QOPB 1UPTA 4DDKA 1SVIA 5FWNA 3FF1A 4N5LA 4Q3BA 2XCTB 4TLDA 1AOXA 4IIYA 5U4XA 1PNVA 1T5SA 3A6HA 3MRSA 2JGNA 2HGSA 4J0FA 1OZGA 1JB1A 4OK6A 1YZNA 4BU1A 3CLSD 2R3SA 2VP5A 1FTYA 5EVCA 3QSGA 3SJAA 3TNJA 5JAHA 2BE7A 3ME5A 3L7CA 4AWBA 1T9BA 2Q4RA 2VXYA 2EL7A 4MWSA 4MMYB 4LHYA 4N18A 4LZOA 1EUDA 3AL3A 3IGFA 1MO6A 5JMTA 2AMFA 4FFBA 4AU1A 4P1ZA 3L43A 1N7GA 3ITEA 4ZVKA 3ZWAA 2JA1A 4C6SA 1PTKA 1CJKC 3I9OA 2O3UA 3G17A 1YD7A 3AP1A 1WUHS 2AV6A 2D62A 3P5BA 3IUNA 2O50A 4KQEA 1E1YA 4E1BA 1CC1S 2PIAA 4BE9A 3DZBA 1VA4A 3F4KA 1RWNA 4M6WA 1VIAA 2W6JD 4TUYB 2REBA 4JI5B 4X64B 1UBNA 5K20A 1JYSA 4OYHA 1Z75A 4QVGA 1AMUA 5EOVA 4R9VA 4BV2A 1E1RA 5J4LA 3MBIA 5CA0F 2NU7B 1N0IA 3FSGA 1I6KA 4FUQA 3G49A 1C1DA 1UKCA 1VLVA 2ZSUA 5TGDA 1VBMA 4HVLA 4PQRA 1P3Y1 5H3LA 1AXEA 2D8MA 3Q88A 4NAUA 4UEOA 2HF9A 3KAPA 3B6MA 3LY7A 2YWHA 1Y8ZA 3SVLA 1FRZA 1KOLA 3I05A 1R6VA 1KH1A 3H8VA 1M1YA 1JVNA 1R4NA 5ES4B 3VC3A 3C3CA 4N82A 3HMQA 4ER3A 4YV2A 3PJFA 3BZBA 5G0UA 3AUSA 4BKRA 2OC4A 1AKNA 5BVHA 1PR9A 1TM3E 2P4EA 3KZ1E 1DBPA 3H1FA 1AHPA 1OWLA 1RC1A 2ZJ2A 3BXEA 3CTMA 1XYGA 3PC4A 3FBGA 3R7WA 4B4OA 1V39A 4DM4A 2ZUSA 3VU9A 3DQZA 1T36B 3W9SA 4LYYA 1SXGA 3IAHA 2PMFA 5KC9A 2F48A 5JAOA 2AL7A 3CZAA 1H2WA 5CPBA 4AQYB 3CLRC 2VP9A 4TSRA 2B7CA 3DE4X 5LLDA 2E6KA 1S2OA 3N2ZB 1K2VN 5SYNA 4OXKA 2OFPA 3ZLUA 1FQJA 1SG9A 4TVOA 3CURA 4GI5A 3TZKA 2C03A 4BMOB 4R9UC 2O48X 5JU6A 3V4LA 5JJKA 2YZMA 4DGQA 2C9YA 4N54A 4RJJA 2ID7A 3RB8A 1E9SA 3K0AB 3PFNA 2DBRA 3SJBA 4XWTA 2QTVA 2QTGA 4LJ6A 3IUJA 4DJDC 2X15A 3ACCA 3IJEB 2O4CA 3A05A 3H2JA 4Z3KA 5BMVF 4QZVA 3LVFO 2XV1A 2CCJA 3X1XA 4AVYA 2H63A 4TSFA 5E6RB 2R62A 2Y0CA 1JMYA 3FYUC 2ZVDA 4BNIA 3DQQA 4UBMA 3HYRA 4OMUA 2A84A 2R7LA 1M0EA 3IESA 4BMVA 2GJAA 3T3MB 1CUYA 2YHUA 5DV9A 5BURA 5A62A 4EPVA 4UULA 4EATA 4LVUA 1QH1B 2A5GA 2XYPA 1QP7A 1IC6A 5HIMA 4D9HA 3GP3A 4CQJA 5LQRA 2QUZA 3PEFA 3FUXA 4YVFA 1W6RA 3KTAB 1XVIA 2X0RA 1NQOA 3LP6A 2R11A 3NKFA 3E3LA 3OFSA 5AI6A 5H0IA 2DWCA 4D0SA 1TPZA 3SQXA 1IB0A 1M1YB 2Q2WA 1F38A 4KE6A 3AI2A 4Q18A 5ELMA 1WUTA 3TKYA 3Q9UA 2F17A 2JFUA 2YJ4A 3VI3B 3DO5A 4PICA 5ESRA 2WG2A 4O0MA 4TMVA 2FJ0A 2J6BA 1EK0A 3HUUA 3ANMA 3QIVA 4Y9SA 2FEXA 1FMCA 5FUMA 1N7IA 1REQA 5BSEA 4MWGA 3E27A 5JPIA 4BY9E 1NMYA 3HXMA 1CQIB 1GCUA 1DBVO 5HVNA 4TTSA 2H1FA 2H8GA 3O2NA 5DNCA 4H3VA 3TRKA 5K03A 4MHTA 4FI3F 2ASEA 5JHGB 5G4LA 1PEAA 2WF5A 2O0LA 4QTYA 1W1WA 3FKSD 3K70C 4C3VA 2F3PA 1IXKA 1DL5A 3ZY2A 3FPKA 5DLYA 1QJCA 2YIMA 4OAPA 1WWKA 1N6NA 5A1TA 5BNWA 4DA6A 1TA4A 2RJ3A 4F2HA 1GA4A 2BGTA 3DLCA 4Q24A 1N32B 4WV3A 1OILA 5GJWC 1ZU4A 3KLOA 4XH9B 5BVHB 3FPGA 4MRNA 1JKXA 2YIDA 1R64A 1MAUA 4OXNA 2NYVA 3ZOZA 2EG5A 1TUIA 1AA9A 4DAOA 3G23A 2FPWA 3DZGA 3C98A 4BFUA 1EBUA 1TCBA 2J09A 5D7BA 3ZN2A 1RRMA 3LZCA 2XODA 3D43A 3NYIA 2YHIA 5L3SA 3AEXA 1FS4A 2HU8A 5BYJA 4AZ3A 8OHMA 2DB3A 3C8UA 5EP1A 3U3RA 2FZWA 2JLQA 2WSSD 4KTTE 3E9RA 1V3TA 1Y4SA 3VI4B 1XP5A 4X84A 4XX0A 5CRIA 4DDTA 2VHZA 4R4JA 3WC4A 3WVNA 3QFHA 3KE9A 3LPCA 3E22B 4TZTA 2DY0A 3IKJA 2FPOA 1L4UA 1ISFA 2AHOA 4B09A 3TMAA 1BEEA 1XHLA 3FR8A 5BQFA 5ALHA 1N4AA 2NP6A 4Z3DA 4YQFA 1J5EB 2VP3A 1G41A 1ZFNA 4BAZA 1HZZA 4DVJA 2ZXFA 5IG2A 3AT1A 3CGGA 4NOMA 3GN2A 1GCAA 5LA6A 4HWTA 4BQIA 3KTAA 4OJQA 2EDCA 2J85A 1NQ5A 3I6BA 2GCOA 1WMBA 3L84A 2BDTA 2J0QA 1PFQA 3DV9A 1IN4A 3H2ZA 5AJYA 1C1XB 1NPDA 1UC4B 2PGOA 3UV6A 1WEHA 1T0UA 1GU1A 2ZAYA 4QJBA 3GZNA 2CBZA 4EUFA 2OLKA 4N12A 4IM7A 3A6EA 3IP3A 2VHWA 2RHTA 2OP1A 3MT7A 4HLNA 3IKMB 5LJIA 3A9RA 1A9XA 4ZIRB 3KKNA 1WXQA 2P9GA 4QICA 5FXMA 4C03A 2QRHA 1P1KA 4MGHA 5F4BA 4O5AA 4UE3S 3HM9A 2QNIA 5D2CA 1P9WA 3AB7A 5IEJA 1CY7A 4M89A 4EHFA 1OLOA 4TRJA 3NFYA 3R8CA 2ZRIA 1PI3A 1SKYE 5CYGA 3S1AB 2HMWA 1GGNA 3HCAA 4CWAA 4B1FA 1E2EA 2QJRA 4R81A 1ND5A 2EU8A 2Q5FA 3DHVA 5E1OA 2Q3JA 3IA7A 4WOKA 1E6WA 2HCRA 4ZOAA 4BX2A 2WWYA 1TO1E 3E70C 1L8AA 3K0SA 1X7WA 2H2HA 2HMSA 5FDFA 2QMZA 2NV0A 3KFXA 1L7MA 1BWPA 4IIVA 5F98A 5AHKA 2HA7A 3V1YA 3ELBA 5DU2A 2X77A 4J2TA 2D5LA 1J7KA 3ZGOA 5FWYA 5HKKA 3GZNB 1CY1A 1PF7E 2IYUA 5HK9A 5I4BA 2ZWIA 2HWYA 2D1YA 3Q72A 4Y7CA 1PX2A 3FMFA 6LDHA 5JNVA 2KM1A 2Z5GA 2DERA 2OHHA 2JKZA 3QVWA 4ISBA 1ESDA 4DWJA 2DCUA 5J1SB 3O0TA 4NK5A 1GRQA 4OHUA 4D56A 3F7TA 2GAFA 4JBGA 4QUJA 1T9ZA 3HQ4O 4RZSA 2IS6A 2BFWA 3FTFA 2QYSA 4TWAA 3BFJA 3PV0A 4HGYA 3VZBA 3GLGE 1I3MA 4O4LA 3HGMA 1PT8A 2HIMA 1NVWQ 3EG5A 4RHXA 5DNVA 4G89A 4LDQA 3SMVA 3FM9A 3J7TA 5IP5A 1O96A 4G0XA 4XX0B 1E2NA 4PTZA 5ALIA 1QQBA 5HEKA 3W3AD 2R47A 2QEQA 2J6CA 2YWCA 2A1IA 2IITA 4CIWA 3TG2A 1SZJG 1ZJ6A 4MLZA 1JDTA 4RXTA 1KK0A 4UHCA 3REOA 1ORDA 4NZPA 1LBSA 5K6AC 4NMLA 1GPUA 5C46F 2AOUB 1Q3HA 3WX0A 1GDHA 5JUWA 1MX1A 3E1KA 5EWJB 3TQRA 3NH9A 3ONEA 1XPUA 2A5YB 3U4DA 2QX9A 4POOA 3DV0B 2HXYA 1XTUA 1G19A 2JIOA 4HX2A 4J0IA 4KQMA 4RQTA 3AHIA 3SICE 4ABTA 4XKJA 5EG5A 2NU8B 4DYVA 5HOEA 3BA6A 1X8JA 2XMCA 4GGOA 3T5BA 1V4VA 4M6WB 4KRGA 3EDOA 4Z49A 5J47A 1YQEA 4GM4A 4M1EA 5B6IA 3A28A 3VNSA 3DTNA 3G0GA 2XJ9A 1YVRA 1TLFA 1ZOLA 2YWEA 3P0FA 4MVXA 1GG8A 3LUJA 4DCJA 3O2SB 5IUKC 5E7MA 1G9SA 2E4AA 3I0NA 4XJTA 3SQMA 3RSCA 5M7EA 2UUAB 3T3OA 2R751 4EM6A 1A4IA 3WHKA 4JXKA 4AZVA 3UJ8A 3GEIA 2Z0MA 2MCFA 4URXR 3ZDAA 2J46A 5MHTA 1ZH8A 3NEAA 2UUCB 4CG1A 5L3ZA 3WLSA 1DRKA 2CNDA 2Q21A 1VPEA 2A3RA 3CLKA 3IMCA 3OU7A 5DNEA 5FBHA 4ACAA 2I67A 2IVFA 2ZDGA 5EIOA 1XL0A 2NU9A 2PQ2A 3DNMA 3FROA 5KCZA 2AX3A 5BUQA 3N59A 4YJ3A 3KQPA 3DM9B 3PHGA 1MVOA 4ZFNA 4IBOA 2ETXA 3RG2A 4RM3A 4MRVA 1PR6A 1RWQA 3R3JA 4EB3A 3O82A 4JYCA 4NMXB 5F2NA 1XVUA 3CA8A 5IAAA 4C2BA 4KCGA 3TEJA 3LKDA 3JR7A 2XPCA 1N2CB