4B50A

Crystal structure of the hiv-1 gp41 mper-specific llama vhh 2h10
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
122
structure length
122
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGSISSVDVMSWYRQAPGKQRELVAFITDRGRTNYKVSVKGRFTISRDNSKNMVYLQMNSLKPEDTADYLCRAESRTSWSSPSPLDVWGRGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2H10 LLAMA VHH
molecule tags Immune system
source organism Lama glama
publication title A Gp41 Mper-Specific Llama Vhh Requires a Hydrophobic Cdr3 for Neutralization But not for Antigen Recognition.
pubmed doi rcsb
total genus 27
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2012-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4b50A00
4KKLD 1Y18B 5T3ZD 3HC4H 2NPLX 3WIHA 1VKXB 1H3TA 4O4YL 5JOFB 4NIKB 5E08H 1U58A 1I8KA 3MRFA 5DRZB 4G43B 3RVXD 5E00B 4QHKJ 3U46B 3OAZK 4HJ0D 1U8NA 1AGCB 2WM0A 2Q86B 4R9HA 3STZA 2OXHA 3TF7C 4RWYH 5DJ8A 4X4MA 3S3JA 3QBTB 4BFBD 5E2TL 1R5WA 4XAKE 3LVEA 5F1KC 3AU1A 2D9QB 4LVHB 1NUFA 1QFWH 5F7KC 3TVMB 4WFFE 2WIIA 5TE6L 1X9QA 3D85B 1ES0B 1ZSDA 2ADFL 1Q9LA 4OD3L 4YHNA 3MJ7A 3SE9L 5I1IL 1EERB 1KUMA 1PG7L 2EECA 4PGZA 1XFPA 4RFEA 4Y4FB 5D71L 3BZEB 2Q7NA 3GZKA 3J8F7 1KNOB 4HBCL 1BQUA 1CGSH 1AR1D 3TBWB 1DQMH 4ZTPL 3BRGC 5KS9E 1ED3A 3MCLL 4HUKB 5EO1A 3GJFA 3T2NL 1XGRB 2NNAA 4G8EA 5A2IH 1OTTC 4HHAB 3THML 3SKJH 1PFCA 3MV8D 2CKNA 5HJ3A 5HGBA 5C0CE 2VZVA 4PLKD 4JG0H 2X10A 1FBIL 2XXCB 5C0CA 1CLZL 3BI9X 2NY7L 2VN7A 1RIUL 5D72H 5ITBL 1KELH 2J2ZA 5D2NE 2X70A 4K3DL 4C54A 5KSVA 2R2BA 4X6DB 4LDOB 3RKDD 2R1YB 2A0LC 4PRID 3HTLX 5BOZG 3PGFH 4TSAL 1CS6A 3IXAA 4OGAD 3D2UD 1XGTB 4UAOB 5FK9B 1GH7A 3H7LA 4HS8H 4BFEA 5SWZB 4KQ3H 5AYUL 3HG1A 4GW5A 3O3BA 2GSIB 2BVQA 5BJTB 5INCA 3GO1H 2VDRL 4JFED 3BD5A 4X7TA 3O6MH 4UNTA 5FA3B 4XX1G 5FO7B 3MRQB 3SKMA 3MOQA 2XZAH 1CFTB 2YWZA 3BZFB 1ZS8B 2CO6B 4P3CH 3L7FB 4IRJA 2BXZA 2W38A 4OZGB 2XWJB 3U1SH 3F58H 2VDNL 3MLTA 3RVWD 1A7OL 3KWWA 1MFDH 3F58L 1N59B 4U1LA 1YEJH 1MCOL 3OJVC 2DL2A 1NBYB 1RJLB 2P8MB 1U41A 3HAEB 2ITCB 1K8IB 5MP6H 4HDIA 4WI5A 1DBMH 4LDEB 3MCKA 1MCCA 2IPUK 4OJFL 3VMNA 1R3LA 3I6LD 1JGEB 3NCEB 1R3JA 2RAMA 4OUUB 5C07A 5FKPA 1MEXL 4YXHL 1T03H 1EAPA 4RWHA 2YXFA 4LVOB 3QDGD 4QRRA 2O5XH 3WFDL 2CUIA 3PXHA 3BXNB 1E6JL 3LS4L 5CP7B 1F11A 3C2SA 1CLYH 4YGAB 1MHHA 2VZUA 1GC1H 4N0FA 3MLRH 2DQCH 5T1KD 1DVFB 2NX5D 1LNUB 3DX6A 3WBDA 1CLYL 1JNNL 4WFED 4LK4A 4ZAKA 4KK6D 1MRFH 1NBVH 3JXAA 4IMKC 4P9ML 2IALB 4I2XE 5L2KE 3GJEA 4Z7NE 4TVPL 1X5KA 4KC3B 3VXMA 1XR9B 5DJ0A 3H3KA 5FGCE 4YFEA 2OK0L 1XGPA 4YHLH 3QUYC 2NR6C 5E99L 1FL5A 2QHRL 5DD1L 3EO9H 4CN6A 3IKCA 3ULVD 4JKPL 2LU4A 1BZ7A 5DHVB 2O5ZH 1UB5A 1INDL 2OMBA 4M6AA 1WT5A 2FEEI 3I6KA 4JY5L 3U2SB 3AS2A 5I18H 5I1GL 1JCKA 4F15B 1AI1L 1JFQH 1T66D 5ACZA 5BV7C 3IRZA 4CUCA 2GJ6E 3BVNA 4MJ4A 4WUKH 1A2YA 4MAYB 4ZFOB 5ESAB 2EKSB 4P4RA 5KJRH 5EH1A 2NY4B 3CVIH 5T1LB 1T21A 3WFEL 2WP3O 3L9RA 3MYJB 5D6CB 1NCTA 5AWNH 3CVIL 3JWNC 2XTLA 3VWKC 3NFPB 1N64L 4DN3H 3ZDXE 3TH3T 4JE4B 3RTQD 1T2QL 4I5BA 3AXLB 4O58L 3K8KA 3FQXA 4GAJH 3KR3H 3DVFA 4G9FD 3WLWC 4GBXA 5EBMA 5I15H 5IMMA 2O93L 3QAZB 5IG7A 3WFBL 1BLNB 3SO5A 4X6BB 1JGLH 3RGVB 3MOBH 4P2CG 3TC9A 1J1XH 1KACB 1ROWA 1RZJH 1JJUA 3L3IA 1Z9LA 3DROA 3Q2CA 1QG3A 3UPAA 3KPOB 3K7UA 4GW1B 1VEPA 1UXWB 5HHOA 3T3ME 5ADPL 1MUJA 3VRLF 2DQDH 2V5TA 4KXZI 4PREB 5HI4D 2OR7A 4YZFE 3IGAB 1N6QH 5TE7L 3P30H 1AGDA 4TUJA 3FO1B 4NKDB 5HGHA 4KY1L 5SWSD 1U8MA 4ODBD 1CXHA 3TBVB 2G5BA 4GKSA 5T1DH 3GM8A 1FZJA 2LVCA 1Q38A 4Z7VA 5DSCB 1RZ7H 3DNKA 1MVUA 1J7VR 2HT4D 2ZG1A 1RJYB 4XPFH 3FCTB 3GI9L 1V7ML 4KTEL 4L4VA 5E8EB 2GFBB 3DGGB 3RHWK 1WIPA 5DJZA 4R4BB 2DQFA 4ISVA 4XPFL 1AGEA 4H25B 3MSPA 4M5ZH 5A2KH 4LASH 3SDCA 4FABL 3BWAA 1ITBB 4Y2DD 2DMCA 3LKPB 4NM4H 4U1KB 4OGAC 1D9KD 5D5MF 4P59H 2DIBA 4XP6H 4Z95L 3PV6A 4FG6D 2ZSWB 1MOEA 1OT1A 4X9IA 3KYKH 2BXYA 4HKJA 2C4FU 5I8CA 3G6JF 1LE9A 4NWTH 3SE3A 4YK4C 1PSKL 3PWNB 5EC1A 4AL8H 2OZ4A 1JPSH 4C4KO 5IMKA 5TQ0H 3KPQA 4N8VG 4JO2H 5B39B 4Y5VC 4JN1L 3RL1A 5C0CB 4XP9H 1KCRH 4NWTL 5D1ZC 4V2CB 4Z8FH 1TPXC 3IFNH 2DLGA 4WNQA 1A8JH 5C0NC 4XCNA 3IJYB 1AO7E 1IGIH 2J4WL 4MS8C 2PKDA 1ZT4B 3MREA 4XAWH 3W0WD 3KPNB 4XWGL 2R23B 4L29A 5IB1B 2R4SH 3ZKQD 4Z6AT 4OLZH 2EICA 4PRPE 5DHXB 4M3JA 2NX5E 2R9HC 3G5VB 2NY0B 1BD2D 3SKMB 3SDAD 4WCYL 1NEZG 2VR5A 2CR6A 3SPVA 3GNML 3QXAB 3BGFB 1EGJL 4HWEL 1CI5A 3BMWA 2FX7H 1MHPH 5TE4H 1O7SA 3MGOA 1HINH 3AM8A 3BD4A 4NM8H 4PG2C 2FL5A 3EOAB 3GSNB 3TA3B 3TVMC 5JIPA 2EC9U 4CMMB 3OKLA 3QQ3B 2J8UE 4H8WC 5BW7A 2QHLA 5F93C 1CTOA 1I9RL 4AEIH 5L0QC 1HIML 3O0RH 2BY1A 1BX2B 2DWDA 3VXSA 3MRKA 1UWEH 2NY5H 3I6GA 4PGBA 3GIVA 3QNZA 2CR3A 3R1GH 4YEFA 2P8PB 2XN9D 1F58H 4PJ7F 4OZFA 4OKDA 2X1QA 1LP9F 5CLWA 2PYEA 3K4AA 5TF0A 4MJ6A 5E7FA 4P4RB 3LEVL 4Y19E 1KB5H 1TMCB 3D2UB 4DZ8B 4AG4L 1FO0H 1P4LB 3NFPA 4XBPB 1CE1L 3E6FB 5E2WL 5I1HH 2QQLL 2E6JA 2QQKH 4D8PB 3GSVA 3IJHB 2ZPKH 3SO3C 2B20A 2V2WA 1FNSH 1WJ3A 2WLZA 2M1KA 1G9NL 1I7RB 4UDTB 4HIXH 2UWEB 1F13A 5DD0H 5F9AC 1MJ7H 2EYRA 4YXLH 2Z31D 3CX5K 4ODSL 4RMVA 4KV5E 1V05A 4X7TB 1K85A 4P57A 5HYSG 4NT6B 4DGVH 2XKNB 4ODSH 3CC5A 1NGPH 3G5XB 1KTRL 2DQJH 3DETD 3EYSL 4DK6A 1QFPA 3MLTB 2GW5A 4NPYA 1I9IL 2YD1A 5F9WB 2C3GA 4OAWB 4GKZA 5CJXA 3B5GA 3BIKB 4FRWA 4BKLA 4PBWD 3U9PL 9CGTA 3UO1H 1RZGA 1V3JA 3D18B 5D5MB 3CSGA 4PJFE 3UXFA 4R97B 2VWEE 4YX2H 4U1SB 1UJ3B 3HG1E 1VPOH 4LRNH 2J8UB 4X7CC 5DRWA 4EUPB 5I8OH 1ZKAA 1AGEB 5D2LF 4NO0A 5HHVH 5EC2B 3TH2T 4ONGL 2VAAA 4GAYB 3GI8L 5LGKA 1JRHH 5HHVL 1F3RB 3QQ9C 5ERWA 3N1FC 3U36A 4LRIA 4PV9A 2ZCKH 1YNKL 2ARJB 5DHVH 2DD8L 1TJGH 3LY6A 5TF1L 4KQ4H 1FG9C 3RHWF 3RGVA 1J1OL 1EV2E 2A0LD 1N4XH 1KJ3L 5C08B 3HE6A 5HHME 1IT9H 4TNVK 4XVTH 1OGTB 1SY6A 2NCMA 2YA2A 3OKKB 4GW1A 3V6OC 2V17L 5DTFA 1J8KA 3MJ9A 1FVCB 4NC2B 4OZIE 1RJCA 3BE1H 4WI4A 3QZWG 1F6LL 4P5TC 1KGCE 2P42B 2LFGA 1ZLWK 5C9JA 4DN4L 2O61A 5L2KB 4TUJB 1FZOB 2ATPB 5D1ZA 3TZVB 2HFGL 1MF2L 1UH4A 4MDIB 5HHQA 5JW4R 1FNFA 3QFJE 5F88A 1BQHG 5J9PA 3GB7A 1GOHA 3QHZH 1YN6A 3FZUD 2J88L 5L6YL 4WWKD 4BSJA 4OZ4B 4TTDC 1RJYA 1Q8MA 3QQ4A 3QHZL 1WBXB 1M7XA 4NHCL 5E0QA 2XNAA 4UT7L 1AGBB 4LVOC 1BQLL 1MAJA 1U9KA 4CMMA 4PB9H 1T83A 4HJGA 4J3XA 3LH2H 4AIZA 5A1AA 2QJDA 5HI3C 4PGCA 4IMLA 1NMAL 2CKBL 3WIFA 4NZRH 4ZNEE 4IIQC 1JGVH 2H3NB 4WHYG 4M03A 5KG9B 4UT6H 4HJ0C 1N5YL 4ORZC 3Q6GL 1ORSB 2QSCH 3EYUL 3HHRB 3DX7B 4PB0L 4UT6L 3IU4L 4ZUVA 1JVKA 3N9GL 1LEGB 1MCWM 2WBKA 4NRXB 3LRGA 2IC2A 2MNUA 3FQXB 4PB0H 5ETUB 3CLEH 3BKML 3HKFA 2ZJSL 3T2OA 5EBGA 3O9WD 4O4YH 4DVBB 4U31A 2QKIB 1BFTA 3G5ZB 3WHXA 1K6QL 4MNGB 4G8IB 2X4RB 1K5NB 2BNRE 4N68A 5IB1A 3Q3GA 5DD5L 2QTEA 2FCBA 1QBLL 4OB5H 1HDMB 4UT9L 4XMKH 3LS4H 2DOCA 3ARDC 4DGYH 3MPCA 2EDDA 3TCLB 2CKBB 1S8DB 3SCMD 5ICXB 3BQUC 1MCBA 1G7PA 5CEYB 3W0WB 4GMSL 4OM1H 3FO1A 1MJJA 2EYRB 4UV7H 1MCJA 1XEDA 3VXRB 3FT2B 2IADB 1T7VA 4P46D 5F97E 4DGIH 2VDLL 2F74A 5CUSL 1UZ6F 1UA6H 3KXFB 4YDIL 2JJVA 3EYQC 5TH2A 2A38A 5DJDB 1D5ZB 1QLFA 1Q0XL 5F6HI 4NP4H 4PJHA 3EGSB 4P2RA 4N90D 4QT5A 3I2CH 4M1DH 4G8FB 5DEGA 5DJZB 3H8NA 2NY5C 2R0ZH 4OAWA 1DQML 4KJPD 4H25A 1NGYB 1AE6L 2Z35A 3PNWB 3WLBA 3BIBX 4RBPK 4K7FB 3MV01 3T0BA 3MOAH 3O3DA 1BIIB 1A6VL 2D0FA 1NCAH 3QDGB 4LGSB 5A43C 1D9KA 1XH3A 5HHXL 3LV3A 4U0QB 5D9SA 3JTTA 4IOIB 4MJ2A 5DUPL 4DZ8A 3HUJE 1GGCL 2Z4QB 4HUVB 4JO4L 4POZC 4CU7A 3QHFH 1CD1A 3OQ3B 4NRYA 4S1DD 5CEXB 4NO2B 3MUHL 4WWKC 4U1NB 3O3UN 5LCVH 1GOGA 3MV7D 2EDFA 5F7EH 4EIZC 1A02N 2PNDA 2JB6B 3S98A 1M05B 5D1XD 3QUZD 4O9HH 4ZOBA 4O58H 4WI2A 2YN5A 5JQ6L 3FQNA 5J11C 1HSAA 4W81A 4NSKB 5C71A 4NQSA 3QXTA 1MELA 3ULSB 5T3ZL 3HC3H 4NN5B 5GPRA 3KPSE 1IGFL 3LQZB 2JELH 1S7RA 3D85A 5D7SH 2VLME 5DJXA 1FAIL 5L0QB 1J10A 2R1WA 3MLWL 1A6ZA 4X80L 5I1CL 2Z8VC 5MENE 1XF5A 4NNPL 3MLVH 4FOMA 3GB7B 3ARGA 2P48B 2LAAA 3TNMA 3QDJE 4BA8A 1KIQB 3FN9A 1NAKH 4KJWC 3L3JB 4Y5VB 4R26H 2I60H 5K9KB 5D1QA 5LGHH 3VFUB 1JGDB 1PGRB 1A7NL 1U42A 1OAUL 4N0YL 3OJDB 4XI5C 5D6DC 3N50A 4MA8H 4BUGA 1I7UA 3D87B 4HUWB 1A7RL 4UQ2A 3TBWA 2I07B 2WV3A 2ESVD 3QUXB 4Z7VE 2H3NA 2X4SA 3V4PH 4JY6B 2YD2A 4MXVE 5DI8B 1HHJA 3RIAF 5KAQG 1LGVA 4H0GA 5FOBB 4XBPA 5J6HB 2P7TA 3MRDA 1FCCA 3GBNH 3QO0A 1U8JA 3VGGA 1CVRA 3RIFK 2NY2D 1IEBB 4G42B 2ZKHH 4GKNA 3QIUD 2WBWB 4JFFA 1S9KC 5IJVB 2DLFL 5F1IB 5EZOL 2NXZD 4MD5A 1WEJH 5KVEH 5KN5B 2CLRA 5ILTH 3B6SA 4EN3A 2DI7A 3M1BA 3H3PL 4LSPH 2IGFL 5L9DH 4LNRB 2JJSC 3NOIA 1T1ZB 5J9PB 4ZS6D 4G8GB 1BJ1H 1MQ8A 1DQDH 2VXVH 5CJOH 5DYOA 1I1FA 4OLZL 4JFYB 2EE3A 1E4JA 1FH5L 1MJ8H 1FN4B 3V2AR 3CUPB 1JHTB 4WCYH 5F3HB 3VFPB 1NCCH 3FQWB 1NBYA 4PJHB 4LFHD 3UAJD 2V7HB 1A3QA 5IW1A 1A1MB 2H6PB 1JZ2A 4YHML 3M17A 2C7UB 1DUZA 2EDOA 1QRNA 1NGYA 5I75C 4FQIL 3QXDA 1P5VA 3MROB 1I9RH 5C0BD 3DUUA 1ED3B 1ZMYA 3KPTA 4U1JB 1YQVL 4X8XA 5ERWB 4PJDB 4Y4FC 4HW6A 1F02I 3LSOA 5BRZB 3RDTC 3V95A 3R1GL 5DJ0B 3LKRA 1XT5A 2M26A 1FNAA 1YA5A 2JIXD 3LOWA 4KPHH 5ID0B 4L8BB 1DVFA 3DX6B 1JYNA 1FL5B 3MA7B 3MBED 4X99A 4JGJA 2R2BB 2EE6A 3OR6B 4F58H 1DZBA 5F9WC 4MDJB 2AEWA 1NFIB 4CJ1A 2WWKT 2DQTH 3BP5A 1MJJB 4YR6B 5IVXB 1ZLWH 3RVUD 4XVJH 2Q76B 4NJAL 2H2PC 1A6TA 1NLDL 25C8H 3FT3B 4QXUL 4R2GC 5D93B 3ULUE 2NW3B 1T0PB 3B2UC 5ESAA 3RL2A 4MSWB 5FO9B 4I18A 5KVMC 1KCSH 4WJ5B 4KROD 1A64A 2YMXH 5FYLH 3FO0L 3HZMA 1QO3B 1YYMH 5IW6A 4KJYB 4X6EB 4YHZL 2W9EH 3RWFB 5HHNB 1EO7A 5K33A 5C08E 5FF6B 5TFSL 5KSAD 2QSQA 1XF2A 4FA8A 4NM4L 1VSCA 1BF8A 5JR1H 2DQJL 4FFYL 4K55A 5IHZA 5FHBL 4LQFH 1IARB 3OSKA 4P2RD 2NY0D 1QFWI 3SE3C 3HE7B 1CICB 4ZFGH 5CZXD 4Y5VA 2FZ3B 2XQBL 5IR1A 5B38A 1LO5A 1JGEA 4PP2B 3L3IB 4EDXB 1I1CA 2AJSH 3IFNL 2CDEB 2EEAA 4XBGA 5FCSH 3DO3A 5HD8C 1IVLA 1B4RA 2IFFH 4D9QE 1BOGB 1QACA 4P0DA 3WMSA 4K9EL 4ZNEA 1KJ2A 4UIMA 4KWUA 4AMKH 4GLRH 2ORBH 1MFEH 2AJVL 3QXWA 3IDYB 5J1SC 5GGVY 2E6PA 1T2JA 3KLAB 3I3DA 1C5CH 3MV7A 3S96B 3CFDB 3O41B 5HI4C 1RULL 1HOCA 4Z7VB 4QEGA 1F8TL 3QDJA 1G7LA 5ICXA 2P44B 1A4JB 4O2FB 4NZTL 5AG8A 5JOPD 2DWEB 4LPTA 4CVZA 5DMYA 1H3VA 1MJUH 5ALCH 1IT9L 4ZO8A 2X4OA 3NCYS 3SKUD 1IKFH 2CLRB 3WIHH 5GSVB 2OTWA 3VWJD 1F3JA 2YKLH 3QIWA 2P8LB 3CXHJ 4IJ3B 3KNBA 4ZS7L 1AQDB 1CE6B 4JVWA 3UTSB 1GAFL 5CBEB 4HIHB 4YHLL 4Y16D 2DJSA 1FZJB 1WZKA 3WN5A 1NSNH 3TBSB 1EJOH 5IOPB 2X9XA 2PCPA 2DQIH 3U2SA 1F58L 1H5BC 3QJFB 4Z7UA 3CZFA 5EU6D 1OP3H 5B39A 3LEVH 5C6WH 5D1QC 3SDCB 4Y1AE 4PJDF 4M7LL 1JFQL 5FDWB 5HYFA 5DK2A 2E7HA 2F9BT 5J0BA 5JHDB 4JM2A 2BDNL 3E6HA 2ATKB 1ZT4A 3MREB 4RMTA 4MAYC 2ZP0T 4BFGA 4UINL 4D0CA 1HHJB 1UACH 2FEEL 3B5TA 3KHOA 3QHTC 5I1HL 3O6FC 1U8HA 4LBEA 2ZSWA 4CADA 3VI4E 1G84A 4L1HA 2HKHH 5I1DA 1UENA 2GUOB 4F7CB 1WTGT 2ZPKL 4BQ8A 3EDDA 4NFCA 1X5HA 4NJ9L 4LVNB 1IEBA 5IMMB 2FO1A 4J6RL 2VDKL 1IM3B 3MA9H 5EU7E 1A9BB 4FZEH 4P3WA 5I16A 3GKZA 3S97C 3SE8L 2ILLA 1JI2A 4HULB 4R4FH 2ZNXA 2D4DA 1HHIA 4PLJD 3RGVC 43CAB 2VLJA 2ZJSH 5CGMA 3QIUA 3K46A 4L4TA 4LP4A 4HXBL 4KZDH 1NFIA 4JFXA 5C7XL 3OF6A 2E9WA 3WIIH 1FLRL 2VXUL 2XG5A 5IVXA 1QFWM 4WI7A 4KFZC 4M62H 2FECI 2YPLA 4JFPB 1JBJA 3EAKA 1RK1A 3C8KB 2ZUSA 4NO3B 3F65A 1FFNB 3ARUA 4NGHH 1OQOA 4PJ8B 1TVHA 1IEAA 2BMKA 3JV6B 1Q9KB 4MX7A 3UTTE 4YWGL 4AT6A 2V7HA 5T3XE 3O4OC 4NGHL 3ES6A 3U0TB 2BHUA 2HT2C 3QO1A 2C3HA 3ZDYF 4E0RB 4U7KA 1WWCA 1J05A 3UDWA 3QISA 1MHEB 5DRNA 4M4RA 1HKLH 4XNXL 1T22B 4MJ5A 3CMOH 3VFMA 4KAQL 4X4XB 4H20L 4LASL 4OCXH 1HQRA 3EYVA 2UVEA 5IB4A 3VWKB 1CDCA 4HD9A 2NZIA 5D71H 1KJ2H 1OVZA 4IIQA 4Z76A 4YJZL 1CFVL 3GK8L 2X4TA 5ENWA 5EUOE 1SYVB 3S5LA 3ALXA 3BQUA 4JM2F 3CC5B 1NGQH 2BY0A 4YK4B 2D7QA 2MCG1 4M8VA 1GGCH 4JO2L 3EO0A 4M9PA 2OTPA 3GSVB 4KU1A 5GISL 1HH9A 3UTSD 1TPXB 3DGCR 3INUH 5DJ2A 4B53A 2ID5A 2OJZH 1V3KA 4R3SA 2K1MA 1WVZA 5C0BE 5D7LD 1CLOL 3UX9B 2P5EA 5ISZD 3NCYP 4PRHB 2IJ0C 4QRUB 1YMME 3NCMA 3ZL4L 1YECH 1FLTX 2B4CL 1UZ8B 4G8GA 4Y2DB 4MSWA 3OHXB 4M43L 4PJ7B 3QRGH 4KK5D 3QH3B 4RAHA 1OL0A 1P84J 2X4OB 4I18C 4HK0B 2BFVH 4Y4KC 5IMLA 5C0FB 3WUWA 3NIGE 5C0IA 2AQ2A 5HHNA 2P1YA 4HSQA 1JRHI 2YRZA 3QWRD 3BGMB 4OFIA 5EOCJ 2BFVL 3OBAA 3FRUB 4NCC2 4LOUD 1F2XK 1T7XA 5D96C 4EIGB 4Z0BL 3P4NB 3WNOA 4GAGH 5IV2B 3F7PC 1YMMB 1OY3B 1ZT1B 3DPBA 2VITB 5DD3H 1YN7A 3HS0B 2AGJH 2NXYB 1F6AB 4HC1H 3OPZH 4R7NA 1J8HE 4P4KB 2R39A 3QNXB 2I5YL 4C56B 1J88A 4MNQB 3RVVD 5IHLB 1NGZB 4JM2B 2APWA 4HC1L 4JQXA 5JIKA 3ZHLA 3E6HB 5BS0E 3ZKNC 2X9YA 1FGVL 3I9GH 5IIEB 1B0WA 3BMVA 3CJJA 2VYRE 3RWDA 4YHIB 5HHQB 1E27B 3QUMH 3EUUA 2HH0H 2BOCA 1P53A 2WMPA 1KPRA 3TBTB 3S5LG 3V4PL 1DTUA 3SJVB 2BVYA 1QQDB 4AH2B 1ZA3B 1MREH 1YEKH 2HT3C 2VXSH 4W70A 4XMLH 5HGDA 2XWJA 5J1AA 3NBNA 1MI5E 4MNQE 2H32A 3DRTA 3SDDC 5C0CD 4ZYKB 3TO4C 1CT8A 5E6IA 3CPLB 4K9EC 1E0OB 1NUGA 2VISB 2OTWB 4JKWA 1OF2B 3WO4C 4HS6B 5FXCH 3SGKC 3AUVA 3VD5A 1NC2B 1LQSR 4NBXB 4I2XB 2ARWA 4WEUD 1T7YA 3O4LD 3TBSA 2BOBA 3LPGA 4QTHA 1HN1A 3SGKA 2JJUA 1C5BH 3RVVC 4RDQG 4Y7MA 1MIMH 5HHXH 4D94A 2CSPA 1CFNB 1MAML 4HV8A 3JTSA 3BSZH 4ELMF 5BRZE 3ZT7A 1VENA 4JHWH 1N2RB 3D9AL 3H7BB 2W0LA 4FQ1L 1SJHA 4Y16C 5IR1B 2Y1VA 4PRHE 2FSEB 4DEPC 4LDLB 1VKXA 1HWGB 5D7JA 5M95B 4J3OC 2CDEA 5EC2A 3PWVA 1IGJB 3S36L 2CIKA 1R0AL 4LOUC 2NY3D 1EZVX 2GEEA 3EOTH 4JM2D 5CEZD 4PJXA 1KT2B 1V8HA 1G7PB 5CEYA 3O2VL 1IAIM 2VL5B 3I3BA 1GGUA 3NIFE 5FM8A 4JZNB 1TFHA 5D93C 4DVBA 4JFZH 5FUCC 5B3JF 4M6OL 4PJ9B 4H8WL 1YQVH 5F1SA 1W8OA 3Q3GB 4J3SA 5I1IH 3QSKB 4AEEA 1B4JL 4Z7WB 1EO8H 4FFVC 2VLLB 1JGLL 1AXTH 4GRLD 3PL6A 4NWUL 1FAIH 1RZJL 3HNSH 1WLHA 1D6EA 4Z18A 1JV5A 3MBEA 1CZ8L 3WEXA 2B4CC 5TJWK 5E7BA 1RK1B 3C8KA 1S7SB 1CICC 3CK0H 3DJ9A 1AFVL 5EOQL 2ZUWA 4K3EH 1CK0H 3EDFA 4OIIL 2V9RA 5CJXC 6FABH 4Y16A 4LARH 2I60L 1NMCC 3PABA 4OTXH 1QFOA 2B7DT 1RFDL 4JPKH 6FABL 4HXAL 3OKOA 4HHAA 2MKLC 4PRIA 2HN7B 3AY4A 3D0LB 4JQXC 5HJ3B 5HGBB 4EZMA 1U3HA 5I1LA 1WT5C 1MHEA 5I6XB 5HYJB 3MJGX 1S7WA 2ED7A 3O6FB 1YYML 5CCKH 4MCZB 2PXYB 3GO1L 1IJ9A 4BK5A 4DVRH 1I1RA 2ESVB 1J0ZA 4PRPB 1OAQL 3QWQB 3VU2A 4LAQH 3ARSA 5I1KL 1DQQB 4IIQB 1F5WA 4MCYA 4YHKH 1HSBA 2Y06H 4R7NB 1EFXA 1Z5LB 1OLLA 1RURH 3AM8C 3O2WH 4NO2A 1ZGLP 5IB5A 4JPIB 1UWGL 4JB9L 5F9JB 1XGQA 4FP8H 2EYSA 2R8SH 2QR0B 2FHBA 5L8LB 3RVTD 5GS2D 4NKQB 1KLFA 5KZCD 1AGDB 3T8XB 4FP8L 4DCQB 2R8SL 3EOBB 4OF0A 2IQAA 1QFHA 2CRZA 4Y5YC 4WW1A 5FUOL 3OJMB 1HI6A 2B2XH 5TE6H 4FFZH 4WGWB 2FB4H 1G1CA 4XPAL 4E5XA 2VXVL 3K8MA 5E24E 3V6ZA 5FA3A 1KIRB 1J86A 1ZHNB 4L4TD 4PGEB 5GS1C 5J6GB 4OB5L 4UT9H 4PY8J 4AQ1B 1S7XB 2LU7A 3ARDD 4OZGA 2JF1A 5K9KA 4R4BA 1OTUD 4U1GB 5D1QB 3VXRA 3CPLA 2BNQA 4PP1C 2J5LC 2A6KA 4JHZA 3TBYB 4UTAH 1MLBB 1F8TH 4WTZG 1E4KA 5GRXG 2XIDA 5D7IB 4WEBH 1EK3A 1FG2A 2DQCL 1LEIB 3RAJH 4EUPH 2DIAA 5DJDA 1M7DA 2W65B 1LO0H 3QUXA 1QLFB 4MX7B 4ZAKD 1OGAE 3S36X 1ONQA 3L5WB 1JYVA 5CJBA 1VERA 4PRDA 4HFUL 4BFIB 2P7TB 3MXWH 5H2BB 4UV4H 2GHWB 1H9VA 4LKCB 4PJ8D 1Q72L 4HKXB 2HLFD 3Q5OA 4ONFH 4URTB 3L3OA 3OXRA 5BZWA 1AE6H 1LP9B 4K3JL 1GSMA 1NGZA 1MCIA 4OM0H 5B38G 1BREA 2CGRL 5E4IA 1AP2A 1RUKL 2UUDK 5IJVA 4JFQB 1HQ4B 4Z7UE 4HAGA 2PXYD 3CFBA 4U1NA 3V0VB 3T04D 4F58L 3G5VA 4OD2A 4F7PA 5I18L 5KSUA 3W39A 4HWZB 5SWZE 3H42H 5LWYH 4OV5B 4F9PC 4HK3N 2YS4A 1BVZA 2HYMA 3PHOB 1JNHB 1QQDA 1GGBL 4WWKB 4GQPH 2JK5A 2CK0H 3QWOB 1M05A 4HAFA 4JFYA 3DRTB 1I7ZA 2BRRL 4QXGL 1MWAB 4M61A 4TQEH 3UJIL 4NQUA 1CTNA 2XZQH 4OLEA 3C2AL 4M48H 1NAMB 1SY6H 5FKAA 4KHTL 4LLDB 3M1BB 3FOMB 1MCNA 4ESKA 4PJ7A 5EO0A 2MJWA 4YXHH 1ADQH 3CU1A 2Q7YB 3ZTJG 1TTFA 5H35B 3WFCL 5DMKB 4M1CC 4EXKA 5IESL 4CBPA 3I6KB 3RWGB 1RIHH 4EJ1C 2JE8A 1E4XL 1SBSH 4HPYH 1RAMA 3QUZB 3S3SA 1A7OH 3ARGB 3MLWH 1E4XH 1BWMA 1A2YB 4OLUH 5IG7B 2AEPH 5I30H 5T1LA 3V5KB 2BVEA 3MV9B 1I1AD 4U6XB 1I8LC 5FYLE 3VFGH 1LK3L 3H6JA 1D5IL 1L7TL 3V4UH 1MVFA 4PBXA 1B2WH 4X5LA 4PGJA 5C2BH 1Q9OA 1K4DB 3JWDH 1V3MA 4M00A 3TJHC 4TUOB 5GGVL 1B2WL 1MFBL 2C1OA 5HY9A 5FOBA 5GGVH 1A1OA 1IC1A 3TV3L 5C09A 2Q76A 1AD9A 5EIVA 3H2WA 4OCXL 4DFHA 1H15A 1J12A 4K71B 3MA7A 3FO9A 2AAVA 4I18B 1EBAA 3ARBA 1UVQB 2APBA 2ENSA 1WF5A 3OAUL 2WUCL 3HI5H 2H32B 2FGWH 3SEPA 1A9EA 4XGZB 2IQAB 1A0QL 5FGBA 1JV5B 4PJEF 3U6RA 5I71C 2KH2B 3QEGH 4KTDH 3BP5B 1XF2B 2H9GA 4JDTL 3VDAA 5CMAB 3PJSB 4OGYL 3MRHB 4JRXE 1P9MA 1NSNL 4V2BA 1FE8L 3TWCH 5D2LA 5F3BB 4QXTB 5SV4A 4BM7A 4R4ND 2DJUA 3QXVA 2YC1B 1I1FB 5JW4N 2NXYC 1YEDA 1ZHBA 4ZO6A 4AEFA 3VFWA 1W0YT 5DR5H 3B8YA 3RQ3A 1FG2B 3VGFA 3U0WL 3ARTA 4F3FA 4OQ1A 2IANE 4AZ8A 1CU4L 4K8RD 2V7NA 4R96A 1QBAA 1A1MA 2DQEL 3CVHB 1JZ4A 4RMUA 1B0RA 4HBQA 3KPNA 4ETQB 1VFMA 2E8YA 3LEYH 1G7IA 1H0DA 5IGXH 3KJ6L 3PDDA 5I8CB 3Q48A 4P3DA 4C83A 3L3OB 1NLBL 3KPQB 2DDQL 3RL1B 4PJXB 1HEZB 5JW5A 2VZOA 5BRZA 1NJ9A 2O5YL 5DWUL 2PTUA 1FNGB 2ADIB 3N1MC 4NYLB 2XWBB 3P3YA 3UJJL 3N9GH 4L8BA 2B1HH 4GO6B 3FONB 1MPAH 2NY6C 4F7EA 1PG7X 3GMLB 3N85L 4LSVL 4Y5XA 1WAAE 3PDOB 1UXSB 4XZUB 4RA0C 4Y89A 2VXUH 4OF7A 4I0KA 4YDVB 5J8OA 1A4KB 2XY1A 3MRKB 3BP6B 5DD5H 3SDDD 1UKSA 4C56D 4CVZB 4O51B 4OCWL 1K2DB 2K3TA 5HYJE 3PQYA 4DUWA 3Q5TA 4YIQB 3RY5A 1CCZA 1U3YA 3MGOB 4HJGB 2P5ED 2P8PA 4XP1L 1ACYH 1FGNH 3P73B 1FVEB 4YPJA 4MLIA 3Q6FB 2N56A 2VXTH 4G8GD 1HYSD 5DK2B 5JXAL 1DJSA 2L7JA 4EOWL 1NLDH 25C8L 4QXUH 4ZG1A 4TNWF 1QBMH 4YHYC 4QOKB 4N0UB 4X6CF 1RVFL 1M1SA 5F96H 4GXUM 4RIRB 3O6LL 3P0GB 1TETH 4I9WD 5J1TC 4NUGH 5DEFA 4I4WB 2DI9A 3LKSB 4G6ML 3K3QA 1KN2H 4D8PA 4NQEE 4G9FE 1KFAH 2R2EA 5JR1L 2SEBA 3FB5B 4FABH 5I75B 4XNQB 1IKNA 5EU3B 5K9QG 4ODTL 4WW2F 3CXDH 3PWPE 2ATKA 3DUSB 4BH7A 4MD4B 1NFDB 2AV1A 3A6CL 2OX5A 1CDYA 1EGJH 2GJ6A 3RX5A 5ALBL 1S9WA 1EFXB 3E6FA 3LCYA 3ZYOA 4S0TD 4P57B 3RI5K 5IHUH 3JZ7A 4L4TB 2EYSB 4HWZA 2F15A 4XVUD 2YWYA 1CFTA 3BZFA 3MCG1 3R06A 3U9PH 2NXZB 4JFXB 5A3ID 3X11A 2C1OB 5HY9B 4HIJA 2WANA 3KLAA 4WGVB 1DQLL 2Z8SA 5DJ8B 3CDCA 4WW2C 4DZBB 3FTGA 3IDYC 2YPKB 1U3HC 1JHKL 1D5ZA 2OL3B 3CFEB 2WIIB 1BFSA 4P2RB 4XT1C 1UH3A 2R0KH 7CGTA 2A83B 4GRWF 2F54D 4ALAH 2Y7QB 1PEZA 4U6VL 4YO0A 5CP3H 1H3PH 4RCAA 1YEGL 15C8H 1DCLA 2L4OA 3VFMB 4FQHB 3O3DB 3TO2A 4HZAA 3RUGF 5AG9A 1IZKA 3ECBB 32C2B 5DVLA 2MKWA 5IFJB 1UG9A 4ZO9A 1ZGLM 5KBNC 4F2MA 3VFWB 1JZ8A 1G7JB 3RTQC 4U1SA 4JR9L 3PWUA 1CL7L 2C3VB 5ID1B 4JO3H 3MX0A 1H3UA 3U7YL 2X4QB 3MRCB 5CIPB 1J05B 1SYVA 5CZVL 1OARL 5IF0B 5I2IA 5DQ9A 4OTXL 4F3FB 4ZAKB 1AXSB 4ZXBB 1EEQA 1DEEA 4I77L 4WDIA 5D2NC 5I76A 1AP2B 4KKNA 1A7NH 5FAAA 2HT2D 3LN5B 2WWKO 5IMOB 4J3TA 5JW4Q 2BHZA 1NUNB 3CFBB 3F6IA 1G7HB 3TYGH 2J12B 3NIDF 2YD5A 3MFFA 1G9EA 2HRPH 1H15B 3A0OA 5EU7C 3UZEA 4NN7C 4KTYA 3P4OB 1F6FB 1A9BA 2L7UA 3GKWH 2D3VA 5AZEL 1URLA 1PQZB 3P0VL 5D1XB 1I85A 3JUYA 3GBNL 2BVOB 4HWBH 2YZ1A 3MA9L 1II4E 2FX8L 3B43A 4R3SB 2P5WD 3TZVA 5TPWL 4PGCB 5I74C 3GSQB 3ZMRA 1F90H 3QFDA 3QUMA 3N06B 4MAYA 1TVDA 5J4MA 2FATH 1K8IA 2Q7YA 5H35A 4KK6C 4IJ3C 1P2CB 3BZ4B 4E9LA 1ETZB 1WBZA 4FQXD 3RZCC 2HFEB 4W6YB 1FVEA 3UTQB 1A3RH 4X5WB 2Q6WB 2VO5A 1K9TA 1KEGL 2I07A 3F5WB 3D25B 4CVUA 1PX4A 1GIGL 3D5OF 4LSDA 3BP4A 2HLFC 3X3GH 3B2VL 3G5ZA 4F9PA 4GS7B 2F8XC 3SCMA 1TJHH 1K5NA 2VC2H 5J6HA 1H0DB 1QZ1A 1U8OA 3X3GL 4Z0XA 5ADOH 2IG2L 3ULUD 3G08B 3W82A 3ZTJH 3IYLW 1X4YA 4U2ZA 5B4MC 5HGDB 1BIHA 1V7NL 4PJXE 3VRJB 1CXLA 3KPRA 4M6OH 2NY7H 5JLZA 4JFHD 3L7EB 4NYLA 5EPMA 4G6KH 5HGAA 3P9MB 1JF5A 1RUAH 4OZGF 4YHIA 4YGVA 3FFCD 2EDHA 1OCWH 4K7PH 3PWLA 4Z77A 5C0RL 1ULVA 1RZFL 4XZUA 3EO0B 3TNNB 3ZSSA 3MBXL 1CGSL 4POUB 5E5UB 3DURA 4JHAH 5F6HJ 4JFEB 2FBOJ 2EIZA 2F8OA 4M9OA 4P5TD 5DVKA 3SGDH 1AFVH 5EOQH 2H9GB 1CG9A 3DGGA 3MRIB 3DO7B 4DZBA 4LARL 1OGAD 1G6VK 1GHFL 5F8RC 3S9DB 4ZFOA 1MF2H 4N1HB 4K07A 3RWIB 4B5EA 1QHOA 5DDHB 1CLZH 1SJHB 5FM5O 1X5JA 2PYFA 3SQOH 4Y2DC 5C0IB 3AS0A 2ERJC 3HZVA 3WUWB 3C87A 1MLCB 4YDJB 4PGDB 1DBML 3OZ9H 2YXMA 5DEFB 3QG7L 2JJWA 3FO0H 4I5BB 3O4OB 5I1AB 2VH5L 1OAQH 2V7NB 4R96B 1BIIA 5DMIH 4HF5L 4WNQB 1QBLH 4XNQA 1KXQE 2W0FB 1U93A 1WIUA 3BKJH 5D96B 5EU3A 3W9EB 3MNVA 5T3ZH 1JGUH 5HYJD 5INDA 3RA7H 3D85D 3MO1A 1CD1B 2UVFA 7FABH 2ITDB 1ZVSA 1DANU 1FYTB 1Q0YL 1T5XB 5HHOB 5IEHA 1BJ1J 2FJHA 1N0XL 4IOFD 4TULH 2XZCL 4HK3J 5KSAC 5D7IF 2BZDA 4DGIL 2VDLH 5CUSH 3MLPA 3E8UL 5IIEA 1KT2A 3PP3K 2ADGB 1I1AA 4XNYH 1UKQA 1S9VA 5JPMB 4PJAF 4Q9RL 1WBYA 4BK4A 1J0HA 3UPCA 2PW2A 2YSSB 1YMHB 5FYJE 3E1F1 2M2DA 1D5MB 3S35L 3VGDA 1FPTL 1CLCA 4H1LH 3IDGB 4QKXB 2MPAL 1KC5L 3DI2B 1GRWA 2VE6A 3U30C 2V5SA 1UYWL 4U4BA 2AJYL 5FF6A 1C7SA 2H2SC 1JPGB 4PJGB 2DIJA 4MNGE 3O6FA 4N5ED 3LHPH 3VRIB 2AV7B 4F57H 4YEEA 4QRRD 1KB5B 1X5FA 5HYEA 3QEQB 2E7LA 1MRFL 1NBVL 5T33H 3BHBB 1NKRA 4P9MH 4PP2A 3DRQB 1CDGA 3H9SA 4DKFL 3VA2C 1INEL 4XBEH 2Z8RA 4XBGB 4P46B 3F12A 4DJMA 5IMKB 5CINL 1F4XH 4X5WA 2Q6WA 3ULUF 1INEH 5I2IB 5IF0A 4HH9B 1D7FA 2DM4A 1A22B 2HFTA 4XCNB 4YBQD 1SVCP 2F53A 3NFSH 4LSPL 5IBLC 5L9DL 1NQBA 5DD1H 3RZCA 4TVSa 4TYUA 5E6IC 2VXQL 5DUML 1Z3GH 3BDYL 5H94A 3DMMB 5FYJU 1DQQA 3ZLQC 2NR6D 5K9JL 3BDYH 4OFDA 1P6FA 1KJMB 4DEPB 3RWEA 4OF5A 4G5ZH 4WI3A 1JTPA 1IKNC 2GKIA 5F6IB 4J12A 2XKNA 2D7OA 3MV11 5I8EA 3CFCH 5T5NF 3MLVL 3EOTL 2QADC 1OP9A 4HIJB 4M6ML 4X6DE 4LHQB 5C09D 1X6NA 1JPFB 3T77A 1ZHLB 2WQ8A 3DXAA 5KN5A 3PWPA 5HBBA 1L0YA 3BESR 3DIFA 4ZDHA 3REVA 3FQWA 1KXTB 3HMWL 4RGND 1LD9B 2HTKC 5B8CC 2OL3A 3T09A 5DJAA 4PJFF 5E2UL 3PG2A 4OD1L 4LCIH 2O26U 3VJ6B 4DFIA 4BFIA 2VDPL 3QJFA 3QPXH 4Z7UB 2JCCB 1NL0H 3QIUC 4Q58C 2P5WA 5E5MB 1XMWA 1TQBC 4GLRI 1TCRB 4ZUTB 3MOBL 4IRSB 4K94L 1AC6A 1CYGA 3QPXL 5GS0C 1S9YB 2BSSA 4K23H 5F3HA 3VFPA 5FDWA 4HUUB 4PJDA 4UU9A 3VXUE 1LEIA 3BPLC 3KYAA 4OCSL 4J4PD 1JWUB 4NNPH 4HJJL 1CK0L 4F2MB 5CBAA 1FSKC 3JSSA 4X83A 5I1DB 3L5IA 3V4VH 1QYGH 5CIPA 5JIIA 4OD2B 1HNFA 1UCTA 2KQNA 1FC1A 1P7KB 3B9VA 1EBPA 2DQHH 3ILPA 1FL3A 4L9LA 4YWGH 1JN6B 3B9EA 4UQ3B 4HKXA 3TPUB 1T5WA 1JPSL 2VDQL 5BZWB 3CSYA 1I9EA 4Z8FL 4ODHL 1PKQE 1NFDF 1JUFB 4DQOL 2BNUA 5I1JH 5GRZA 2ITDA 1NAMA 5IQ7H 1WFTA 5C08D 3C09C 5BS0D 4NT6A 3SE4C 4RX4D 4KK5C 4WUUB 2GI7A 5GRVL 5EG6C 2CDFB 3OR6A 3REWB 3MACH 4FFYH 2JK5B 1WAAA 2GJ6D 1CF8H 4J8RA 2BVOA 3BJ91 4AY0A 1D5XB 3DV6B 4GKZB 4XNMB 4Z95H 3SDYH 4X6CA 4S2SA 2DLFH 4KROC 3GRWA 1IEAB 2MCPL 2B2XL 1KN4H 3V8OA 2DMKA 4GFTB 3HE7A 1X5AA 4S1SH 3FOMA 5KVGL 5A40E 1A14H 1ORQA 2EDBA 4I9WE 1VHPA 4LCWB 4OKVA 5SX4I 3BPNC 4UUJA 3IF1A 3ROLB 5AUMA 3UDWC 3WXVH 4YHNB 1QSEE 2NY1D 4X6EA 5KVGH 5KS9F 1SMAA 1MLCA 1YECL 4QRTA 4RAUA 5IFAL 1A7QH 1FRGH 1U8PA 4GAYA 1YNTB 4Y4HA 5DVNA 2J5LB 1CGXA 1OWWA 5E03A 3SDXF 5JXEA 1LEGA 1RQ5A 3LEYL 4TUOA 4HGWA 4KK9D 4AENA 2A6JB 4YNYB 1YEGH 4G8EB 1OP5H 2GK0A 1MQKH 5D7KD 3IDNB 2X4RA 4PJ5D 3CFDA 4LKCA 3BQUB 2BK8A 3GIZH 3RDTD 3OKNB 1Z9OA 5E6YA 5C6TH 2OI9C 2X70B 4G7YL 1S8DA 4JZJB 1HH9B 3U7YH 4IS6A 3VXPA 5ITFA 3R8BB 3EZ8A 2DBJA 4FQQA 2R2HA 1FZOA 2ATPA 2AXGB 5FYLL 3MZGB 5C6PB 3CFJB 1LDPL 2HKFH 1DLFH 3FT2A 2IADA 3EDEA 2X1XR 2VJXA 3I9GL 3PHOA 1JNHA 1VFAA 2VLRD 3ULVF 4OCWH 3IU3A 4ZOEA 1YY8A 2BNQE 1G6RB 2VE6B 4PLJC 5C0FA 4XC1L 1Q9LB 4G8FA 3FKUS 4ZFGL 1IZJA 5K59E 4LCWE 5TQ2H 1IAOA 4M4PA 5DO2D 4HCRL 1C1EH 3BOVA 5F3BA 3UTSA 3TN0B 5JHDA 1OM3H 5TQ0L 4HWBL 2EDYA 3UTSE 2X4UA 3QDGA 2FX8H 1B0RB 1ZT7A 1IQDA 4QCIA 4XNZB 5MP6L 2EC8A 4LLQB 4ONHA 3UO1L 4JN2B 4ZPVA 4M7KL 2EH7H 2YMXL 2OBGA 3QYCA 3DRQA 4JJ5B 2OMNA 4Y88A 4C83B 3UZQA 2AK4D 2VLKD 5FKPB 2NTFA 4HIXL 4MAYD 2FWOB 5J57B 4OCRL 3ARZA 4QRRB 5LAXA 3LB6D 5I16B 2YEZA 2CK2A 1X5LA 1IGYA 4P5MB 4OLUL 3VFTB 5KSAB 1KOAA 1F3DH 1UFUA 3DMMA 3O4LA 3SY0A 1U8HB 1TJGL 3VXMD 2GTZA 1P7KA 2GSIA 2OCFD 1ZVSB 5BJTA 1MCSA 4JFDE 1SM3H 3SJVA 1VGEL 3C60C 2C5DC 1T04B 1REIA 3TIEB 1A4KA 1DQLH 3RVWC 3WKMH 4IRJB 2D03H 4GSDL 4ELKA 3HB3D 4MHHI 3PP3H 1CT8B 3WNPA 1CDJA 2YPLB 2OJEB 1DN0B 1QSFD 1P7QD 4LGPB 4X0KB 3FONA 1IL1A 1RUPL 1XF3A 2EH8H 4UOJA 5A16A 3EO9L 4BELD 5D7JD 3SKOB 1UXSA 1RJLA 1GGIL 4U6VH 2K9UA 1D5BB 4JKMA 1LE5A 3ES6B 1EEYB 4PJHF 4N0UA 2P49B 4JY5H 2ZUYA 3C8HA 1YPZF 2YD3A 4K7FA 1KYOK 1OPGL 1JGDA 4HIEA 1MY7A 1X6LA 4LSRL 2OR9L 3MGTA 2MQ0A 1S3KH 1X5GA 4X9HA 5A3IC 2OR9H 3M07A 4IOIA 5AUMB 3MYJA 5F1NB 1NMAH 2CKBH 5AWNL 4QNPE 5IT2L 1VESA 3TT1H 3LRSA 4M5YH 3VI3F 1S9XA 3QQ9D 3VXNB 1U92A 3S34L 2YN3A 4DN3L 3DMMC 2VL4A 4QYOB 4RRPA 12E8L 3KDMA 3IAPA 4ETYA 2R2CA 5BVPH 4ETQA 4IBLT 4XWOC 3FFCE 1M71B 4BZYA 3CLEL 4U7SA 2J88H 1NCNA 4WU7A 3HNVH 1N7ML 2GY5A 1BPVA 1RUQL 2XKSA 1BAFL 3VXOB 4DK3A 4XX1E 3ULSA 1UZ8A 5AZEH 2EKJA 1MUJB 1UGNA 4TN9A 1N7MH 3SDAA 3IKCB 4ELME 4L3EA 4U2YA 5C8JB 3B2UD 5EO9A 2PTTA 4IHOA 2AVGA 4NQVA 2H2PD 5FM4A 1QSEA 4FXGB 4HGKC 4TRPL 4HQQH 2E9BA 3WFZA 1HCFX 5DWUH 5FYKE 4OQTL 3WEXB 4YPGB 4LF3A 3FRUA 4TTGA 3Q6GH 4ZQKA 5CD5D 1OGAB 3MRLB 3OB0K 1A6AB 2XOTA 4OFYA 4D0DA 4G6AC 4F37F 1A7BA 2NY6B 3O6KH 2V2XA 4NO5B 1WCQA 4ONGH 4Y2DA 4P46C 1ORQB 3VJ6A 2CLZB 1RZKL 3BDXA 4V1DA 3MUZ1 4LLMB 2AJXH 1MSPA 3NCCB 1NGWA 4FQJL 4MXWH 3MLXL 4MCZA 5GGTL 4MA3A 1H8NA 5ECJE 3SCMC 3FQTA 2DTSA 2XFXA 4PJBB 3LKPA 3JVGA 3GK8H 3OKMB 32C2A 4NHUB 4RIRA 2PO6D 1BVLB 2GJJA 4CVXB 4AEHH 5ID0A 2RJMA 3GHBL 4WTWA 3OGCA 3ARDA 5JORA 3O2DL 1QBBA 2EDQA 2W9DH 3JV5A 3V0WL 3S37X 4AEHL 1T20A 1A3LL 1YUHB 1FBIH 2EXWC 3IXTB 3SOBL 5DK0B 4KI5E 5T1KB 1G9ML 4GXVH 4K7PL 5IMOA 2X42A 2R4SL 1TITA 2DYPD 5GXBB 3PGDA 2X09A 1S9WB 4XP5H 5HHMB 4YR6A 3S88H 5B8CB 4PJIB 1ZLUK 3VFNB 3SO3B 4KRNA 4HS8L 1J87A 5GGRB 4OLYL 4PJBE 3KJ4B 2AJ3B 1FNEB 3VG9B 4OZHE 4FQXB 4KROB 1FIEA 1NGQL 4L8CB 3KYMB 4ZUSB 4JPVH 3CIQA 2FX7L 3ROOA 1QLEL 2E7MA 5FOJA 1IL1B 4ZYKA 3VW3L 3OKLB 3QQ3A 4DAGL 3FZUC 3VDCA 3F5WA 4DAGH 4U1KA 2JTDA 4P2QE 1PW3A 5DFWH 5LCVL 2VQTA 2C7UA 2CRYA 2AQ1A 1P7HL 5CSGA 1NCDH 1BQHA 2F5AL 3QDMA 1E4KC 3LN4A 3WFHA 1MFAH 2EE2A 2R0KL 1FGVH 3PWNA 1YNTA 1NEZA 2E7BA 4R26L 1ADQL 4EXPX 4Y4HD 3SJVE 4YHYB 2Y36L 3AMLA 4XPHL 4RGMB 1EXUB 4WO4A 4XI5D 2BNQD 2YEZB 3NACH 3RIFF 3GSXA 2AK1L 3TYFB 1JNLH 1K3IA 4NWUH 2QV2A 1OB1A 1NCWL 4LCCA 2R23A 1S9XB 3S3PA 2FLBT 4CL7A 1FFRA 4XXCA 3LIZH 4ERSH 2F54B 1I3RA 3RTQB 1KB9K 1JNLL 5E2WH 4KJWD 1FDLL 4JO3L 4HPOL 3G08A 2AGJL 4RFNC 5I1CH 1H8OA 5T1MB 2CJUH 3V5HB 4OT1H 5EIIB 3ZKXC 3RWHA 4OF8A 1ZE3C 4RZCA 4CDHA 1S7UB 1AO7D 4JRXB 3OR7B 4ELKB 1OSPL 3OG4B 5H37H 4PJEB 1JWMB 1R3KB 5E8NA 1D5IH 4I77H 4KGJA 4TOYH 3GMNB 4XB7A 3U83A 1FYHB 4XCYA 1LO2H 1WFOA 1ZWIB 5DXWA 1H5BA 2LV4A 4P5TB 4PR5B 3RWIA 4HIHA 5FECA 4PJGE 3RUGB 4GQ9H 5DMKA 3EYSH 3KVQA 2VXSL 1SVZA 3C08L 4JFFE 4LHUA 4J4PC 5JDSB 5D1XC 4BKLB 3RPKA 3VGEA 1E28A 5EZJA 2V9TA 4PJDE 3QA3A 1NANI 3NTCL 4R90H 2FX9H 1VGKA 2XTJB 3V6OE 4BZ1L 3PABB 4ONHB 1P2CA 3BZ4A 3SDYL 3TFKC 4S1DC 3FRPG 1L6ZA 4OGYH 4MA1B 5FO8B 3PIQA 2AK4A 2R0LL 5EN2B 1OT2A 4IM8A 2GUOA 5EFIB 3UTTD 5F72S 3UTZA 4OZIB 4FQIH 4JREC 1KJ2B 4UIMB 1YEEH 2EDRA 5DO2C 3RX8A 4ZMAT 3HI6L 5C0JB 1T6VN 2D7TL 3ZDZE 2A73A 2K7QA 3HPJA 1B0GB 3P9LB 2D2OA 1A7QL 1FRGL 3ARWA 1U93B 3O3EA 5BW7C 3HI6H 4KKCD 2UWEA 4WW1B 5CJOL 2JELL 4UMGA 3K1KC 3ZKMC 3MJ8A 4F9LC 3MO1B 4JM4H 1BHGA 2ZG2A 2VLMD 1MJ8L 4HMCA 4JRWA 3T0AA 1Z5LA 5BS0B 2YK1L 3Q1SH 3MODL 4LLUA 3KPRB 3EYQD 2QR0A 4K2UL 1JTTA 1OD9A 3TPKA 2PW1A 1QTYT 3ZHDA 4I1NB 2DQDL 4X5XA 2R1XB 2FDBP 5CMAA 2PO6C 1DN0A 3ARXA 4X0KA 4PRBB 4YFDB 3UC0H 3ULVC 1DQJA 4FQ2H 3LMJL 5D7IA 5D2LB 4HWNA 5KS9A 3BIKA 4W4OC 1OQXA 4XNZC 4QLRA 1N5AB 3T0VA 3WN5B 4PJ8A 5M94B 3ULVL 1DQTA 5ACLA 4OZ4A 1EO8L 1S5HA 3PGFL 1K8DA 4JFDA 4ZUSA 4AT6B 1CBVH 3H9SB 1RZ7L 3ALWA 1MCRA 1AGBA 4GRMB 3GMMB 4LLAA 1CGUA 4JHAL 5JDJA 1JPGA 3HLAB 1G1YA 3KYNA 3O9WB 3ALPA 1CXKA 1T22A 1LP9A 4WEMB 3I75A 4JKKA 2H2SD 2X1PA 4NZRL 1M7DB 5SWZD 3RVTC 3ZE1E 3OWEA 4D0CB 3C6LC 3OGOE 4LPWA 4NHUA 4YDJA 4Q2ZB 5A2FA 2VXTL 4F7CA 1F97A 1GZPA 4X6FB 2VTFA 1FNHA 2Q20A 5JA8B 4HLZH 5C0ND 1T1YB 4WI9A 3FFDA 4IRJC 4XCCH 1YNLH 5CKGA 2C9AA 3ZTNL 3WNNA 1I4FA 3GHEH 3U4BL 1B6UA 2XRAH 2VDOH 2VH5H 3MNVB 5JZ7D 5FYKL 5IQ7L 4LSTL 1KCSL 2RFXB 2XRAL 5ACMA 1PKQA 1WGOA 3MRNA 4DVRL 3T1WA 5JO5B 1J8HD 4FG6C 4F7EB 3H3BC 2VLRE 3IDIA 3PGDB 4KUCF 5HHMD 4YHZH 5I1KH 1TTUA 4TTDD 2ED8A 1RZIA 4HS3A 1AKJD 3DYPA 5CIPH 5EIIA 4QHNB 4HPYL 2BC4B 3VGBA 3L6FA 2ENYA 2PTTB 3DMMD 4IHOB 5HPMA 3OHXA 2QEJA 3QWOA 1B9ZA 3BISA 1UH2A 3GNMH 1QLRA 3LQAC 5D6DA 3BZDA 2X4NA 3AC0A 4LNVA 4N0CC 1BECA 1QRND 3L3DB 2AEQL 4AIZB 1CFBA 5I66B 5FKAB 1UM5L 3WXVL 4Z7NF 4IMLB 1RU9H 4OFYD 2OQJB 1WCBB 2UUDH 1YMMA 1KC5H 4NKMB 5F7DB 1I7TB 5FYKU 4KI5D 3BH8A 3SE9H 3GM0A 5JOEA 3WFHB 1NGWB 4F8TA 4Y4FA 3BZEA 1UYWH 4MJ5B 1F6AA 1AKJB 2XWTA 2NZ9C 1KNOA 1NEZB 3LS5H 3WNKA 3QNXA 3M8OL 4C56A 2ERJB 1DVFD 2NX5B 1U3ZA 3OB0H 5KANI 5IKCB 3GSWB 3LS5L 3GJFB 1YEFH 2ZOLB 5EA0H 5BZDA 1H3PL 1W8NA 3JV0A 3GIZL 3OAUH 2R1YA 2NY3C 3WHXB 4G8IA 3D3VD 1PZUB 4GOSA 1AI1H 2DF3A 1JHLH 4QRPA 3VMPA 3W5MA 3FO9B 3WXWL 1AHWA 5CINH 5B21A 4UV4L 5INCB 1WIOA 3N1QC 5FM5M 1A6PA 43C9B 4AH2A 4LMQE 2DTMH 5CJ8A 5FO7A 3OR7A 5C0DB 3BW9B 2VDKH 3O3BB 1XCTA 5B4MD 1RUKH 3GMNA 2P5EB 2DN7A 3PJSA 5E6IB 3FQNB 2VDRH 4XCYB 2VISA 2Z93B 4R4FL 5GGRA 2AI0L 3MLUH 3ARYA 3OX8A 1W72L 3DETC 5TFSH 3GSNL 4G9DB 4X98B 3ULUH 3NCFB 1ND0A 5GHWH 1WFNA 3EGSA 1T4KB 4WI8A 4YO0B 1U95A 2RIKA 4OLWL 2R1WB 1BAFH 4KJQC 1N3NB 3DXAB 4GRLB 1RSFA 4RDQF 5C7XH 5GHWL 4WO4C 1FLRH 1OM3L 5GZOD 4ZTOH 4YBQC 3UJIH 2DQUH 2B8OT 1LD9A 5IFJA 2MMXA 4J7RA 4QXTA 5GS2H 1YEDB 4J6RH 1KTLA 2H8PA 2EE9A 2FSEA 4RGMC 2ICWJ 4QHLA 2XTJE 3KPMB 1KF9B 3HLAA 3KYNB 3SE8H 3OKEB 1OAUH 5HDBF 5DRXB 4QHUA 4C57C 2ICEA 3ISWA 1LWRA 1AXSA 3W11D 2EXYD 2HVKB 4LGRB 5T1DL 4BQ6A 1KULA 5BVJB 1TQBB 1TJIL 3JWOL 4TUKL 3LQAL 2X4SB 3LN5A 4KAQH 4JQVC 1JRHL 2XV6B 3DV4A 4OGXH 3F7QA 1A7PH 3BPLB 3DOSA 4H0HB 4JFFD 5GZOC 3IDNA 3RTQA 1QR4A 3WIIL 4R8WL 5ALCL 1T1YA 5DS8B 4Y5XB 3C9NA 1FSKB 1A0QH 3FFDB 4P3DB 2BVTA 4G9FA 3OKNA 1I3UA 3S7GA 2VLLA 1W72B 3E3QE 3NGBB 3NCJH 5KW9L 1DANT 1G6RA 2RFXA 1VA9A 1KEMH 3CDGB 3CSPA 3ARQA 3MZTA 4ZODA 4MJIA 1QBML 4M7LT 2DQIL 1A3LH 1NMCB 3CFJA 1YC7A 1HZHL 4LNRA 1EVUA 1S7SA 4QHNA 5LKNA 4WFFD 1OW0C 4GXVL 1T1XA 4BYHA 1HZHH 2XN9E 4H88H 1T0MB 4D0BB 4YBHA 1FNLA 1JYXA 1RUAL 4ZPVB 2X1OA 1YY8B 3LKOB 4JAMA 1I9JL 1DLHA 4R2GB 4O51A 4JGMA 4WFGE 4XC3H 4YAQB 4YHPB 4MA7L 2MOVA 5HI5D 5DFVD 5ACZB 1ZGLB 5MEPB 2MHAB 3CH8A 4XC3L 1JWSB 5GS0H 3L5XH 1MI5D 3QPQC 1HNGA 3BPCA 5IB3A 1N6UA 1IBGL 5F7LB 1DVFC 5BO1H 8FABA 1DUZB 1W0VB 2AKRB 4XXDB 5DI8A 4FQPA 2NYYC 4QOKE 4RBPH 5SWSE 5HI5C 3G04A 2VWEC 3HRZA 4MWFB 1R3HA 1YY9D 4XCFH 1D9KC 4QWWC 4YFLI 3VRJA 3LSOB 1X5ZA 3T0DA 2YUZA 1QVOA 3PHSA 5DC4B 4B50A 1KCLA 3E3QC 4S10A 3W2DH 1TNNA 4PUBL 4QO1A 4JFEE 4RISL 4M43H 2G5RA 3V6OA 4QRPB 1KLGA 1PKOA 2H26B 2A2QT 5D7KE 5A16B 4U1HB 3KJ6H 1JP5A 3GFUA 4PREA 2Y6SD 4DGYL 5MHSE 2R2HB 2Y7QA 5DYOB 3HUJF 4GAGL 4X5XB 2BCKB 1XCTB 5L8JB 3QIBD 4AQOA 3VD3A 3FRPA 3NZ8A 4JHBA 3VWJA 4OM1L 3HR6A 3HMXA 4XVJL 2XTJC 4XH2B 3T1FA 3FTGB 3KPRD 3B3IA 2QQKL 2B1HL 4LPCA 2DQFB 4U05A 5FUCE 2VIRA 2FR4A 5C09E 1K8DB 4JFDB 1EAJA 1OW0A 2VR9A 4H20H 2GFBA 3L5WA 1I7TA 1N3NA 1YZZA 4PIRF 1HK6A 5KOMC 1G7QB 1TCMA 3UYRL 3IDXH 1VADB 2IPKA 4S0SD 1TIUA 3NFNB 2FO4A 4NZDA 4ZD3L 1NC4D 3OXRB 5FHBH 35C8H 4WDIB 5TQ2L 5I76B 5CWSB 3BP7B 4LLQA 3F62A 1PYWB 1OAKL 1MRDH 4AIOA 1LO5B 4EOWH 1X4ZA 3K2UH 3ARFB 1HQ4A 2ZUVA 4I0PA 3P0VH 2X4QA 1E4XI 1KENL 1U58B 4F57L 3MFFB 1RVFH 1QRNE 3FT4B 4OFPA 1I75A 5DRZA 3ZZ1A 3T3MF 4AYFA 1CFQB 1AHWB 3GBLA 5ESQA 5ISZA 3MRRB 4RMRA 5AAWA 3RJQB 1VB9A 4QHKI 1VPOL 1KCVH 5JO5A 1HI6B 1Q94A 3HZYB 2GAZB 2NTSP 1D5MA 3NFSL 3DUHA 4KVNL 3KGRA 5HHPA 4JFZL 1BF2A 1D6VL 4O9HL 2DM3A 4XXCC 3EJYD 2VSCA 4XPTL 5ALBH 5JQ6H 4Z7VF 2PYEE 2Q8AL 2OP4L 2DWEA 1D6VH 4XHQA 4WHTA 3D39A 3K80A 5L88H 1S7TB 1IQWH 3H9SE 4KJYA 4KKBD 4Q6YA 1ETZA 4JHWL 2HFEA 4LLMA 1I3GL 2JJTA 4IDJL 4KVCH 3TA3A 1QLRB 2YK1H 3D3VE 2UWEE 2X4NB 3T2QA 1EHXA 3ZKMD 3QB7C 1R5VA 4OZHA 3U7WL 3KNBB 1F45A 2YKLL 1J0KA 3FQTB 2X9WA 3VRIA 4PJBA 1L9NA 2MSPA 1T1XB 2X7LA 1PDKA 3C6LB 3O8XB 3GSQA 5TDOB 1EEYA 4HLJA 1WZLA 1U6AH 1PX3A 3LD8B 4QHMB 3VGHA 4E41B 2AXFB 3BAEH 3T0WA 3F12B 4ZSOB 2ZUTA 4X8JA 5E1HB 1EGJA 1AR2A 3BN9D 1HH6B 4EQ2A 3GRWH 4TPRL 3TIDA 1M7IB 4LCIL 5J12C 3GMOB 5F89B 2B0SH 4J23A 4BSWA 5BVJA 3UBXB 5EZLA 3HFML 2ZOLA 1JI1A 2RBLA 1ZK9A 4M7ZB 2FIKA 5EOTA 4K23L 4K71C 2GTWA 3GBMH 2XA8L 1BVLA 3UTTA 4OT1L 5C09B 1QFUH 4NC1E 1MCQA 1U2CA 5AAMA 5EU6B 4IRZL 1PG7W 3VXQA 1G7LB 2V2WB 3QDJB 2JJTC 3MNZB 1YUHA 3TA3C 2FJFB 2V6HA 1W0WB 1HXMB 1M71A 4OIIH 5C0DA 1T3FB 5JTWA 1IC4L 2DQHL 5C3TA 4XCCL 4KK8C 5CP3A 3CGTA 2Z91A 2EEDA 3MJ6A 3MRMB 4FXKB 5D7LA 4EI5B 5HVWA 3WS3B 3SBWA 3IU4H 3MRHA 3HNVL 2AXJA 3KPPB 4X98A 5H8DA 2P8MA 1NGPL 3QG7H 5DDHA 1QUNA 3UJTL 1DSFH 4NQVB 3RU8H 3TM6A 3LDBB 4N9GB 3DURB 1K6QH 3MUY1 4R2GD 2R4RL 5I8KL 4JVUA 4DOHE 4ZQKB 1TJHL 1IM9D 4PJ7E 4OQTH 4NNYA 4BZ1H 3C6LD 1LP9E 3UMTA 3WSQL 4DTGL 2Q8BH 2NY3B 3QFJB 3FHQA 1LEKA 4I3GA 5HDQL 4MMXC 4OUOA 2DQGH 4RNRB 2XZCH 3HRPA 3BRDA 2XPGA 3TLRA 1SEQL 3TGXA 3DHJA 5DRXA 3VFOB 4OD3H 5IEHB 4YXKL 4QTIH 4MQSB 3CMOL 2IALA 3GI8H 3ZE2E 2VERN 4XNUL 4JRYA 1S7UA 3DV4B 4Y4FD 5EUOF 1FIGH 2W0FA 4CVXA 1BM3L 4MB3A 1J1OH 3ETBF 4Z76B 2AJUL 2ZCLL 1PG7H 1OGTA 1I3RB 4K2UH 4UTAL 3RIAK 5ADOL 2V2TA 3WJLA 2AEIT 1UQSB 2R15A 2NY6D 5GGUA 5ITBH 1NDMB 3VH8B 5EORL 5C9JB 1S9VB 5IBUB 2BCKA 2GAZA 1EZVY 1WBYB 1GZQB 1YN6B 5JDSA 3T08A 4QOKD 3SOBH 1X7QB 1RFDH 4YIQA 3ZT6A 3RWJB 2IFGA 3STLB 3MRJA 4ENEC 4QXGH 5DEZA 4R97C 3T1FB 2DTML 4XP5L 3S88L 4PR5A 4GRWH 3DYMA 2A9NH 1U91A 3QUXD 3BHBA 3MRPA 3JV6A 5FECB 5DC0A 4HK0A 2F53D 3B9KA 2CMRL 3UZVB 4KDTC 3WO4B 3AGVA 4P46A 4FQXC 3RZCD 4PV8A 2A9MH 4K7PY 1U8PB 3QJHA 1T7ZA 4PG9A 4NQED 2VXQH 4PB9L 2W9EL 3EIFA 1F4AA 1B90A 5CD3B 4JDZA 3CDFA 1QLEH 4Z7WE 1MHCA 5TDOA 3V7MA 2DM2A 4WY7L 4F33B 1IAKB 2E27H 5KG9A 3FB5A 1BQHB 3QDMB 4MNQD 1BZQK 2AXFA 2Z31B 3DECA 1G7IB 3ARRA 3GGWB 3OB8A 1MFDL 2DLHA 1C08A 3QZWA 2XN9A 1ZLVK 4I0PB 2AJZB 5I30L 5J3HC 2BRRH 4JRYE 1MY5A 2KKQA 4WU5A 1R3HB 1QHPA 5EFIA 2IPUG 3N1PC 2A1WH 3VFGL 3C2AH 4M48L 1QVOB 1EEZB 3S35H 3WUWG 2ADIA 2Z0BA 4XPAH 3ARPA 3SBWC 5EUOB 4WW2B 2GYSA 2QBWA 3GSOA 3NN8A 5MEQB 3P9LA 3PQYE 4OCMC 2CKBA 5H94B 4CN4A 3WFCH 1RV6X 2GJZA 1DBJL 3PWPB 3LEXB 1TZHB 4HUXA 3LQAH 4F7MB 3DI3B 5HHPB 4QRUA 2YPKA 4K94H 4RA3A 5DT1L 2VLKA 3BP6A 5C1MB 4DKDC 1RULH 4PJAA 5I8EB 4L4VB 3OAZH 4JY4B 3PQYB 1GC1L 5C70A 4XVSH 4PLNC 4FS0A 5DURD 1BVKB 1OHQA 5D7LB 4EI5A 3R0NA 4D9RE 3WS3A 1JE6A 3VG9C 3BGMA 5DQDL 1GJIA 3KPPA 1SJVA 1QYGL 3HI1A 4YDIH 1LK3H 4QRQB 2I9LB 3HE6C 3P4NA 2BOBB 4P5KB 4WI6A 2VDQH 1S5HB 3G6JE 1Z9MA 4E41A 3ESUF 2VB5A 5D2NA 1AGFB 1MWAL 1ERNA 4ZSOA 1YEHH 1EMTL 2C3VA 4ZXBC 2YD7A 3LKSA 4GRMA 4PJCF 3WYRA 2E7LC 3OKDB 1TCRA 4ZUTA 4BUHA 4O02H 4YQXL 5DR5L 3NFNA 2Z4QA 4PPTA 3ARFC 4M3KB 5GRVK 3TV3H 2R2EB 1E6OH 1NC4A 3SDXB 1DR9A 1I9JH 3IJYA 2EC9T 4GG8B 2XI9A 4R0LC 4OFVA 1RHHA 2AK4B 5EN2A 1IGJA 3UPRB 3C60A 2HLAA 4LCCC 1FZKB 3N1GC 5IROC 1DEDA 4MA1C 1PZ5A 4WUKL 4PD4J 2XZQL 3V0AC 4MD0B 4OZFH 2PN5A 4LIQL 2XXMB 3LZFH 4NSKA 4JREB 3PL6D 4WHDA 5D1XA 1D5XA 2OXGA 3MV9E 3QFJD 4W4NA 4KUZH 2X4PA 4OD1H 2IQ9H 5J06A 12E8H 1S7RB 3VG0H 3ULUL 3ZKXB 5C0EB 3QIBB 5BVPL 4HCRA 4N5UA 3W2DL 1RIHL 1BEYH 1MPAL 5GGSB 3HC3L 4HEME 5JHLL 5K93A 4BQBA 4U0RC 3VH8A 2PR4H 3IF1B 3REWA 3ROLA 4EDWH 1HILB 3BFOA 4GG6E 1NPUA 2R1XA 2XYCA 2C4FT 5EUKA 5JHLH 4EN3D 1X7QA 3CFCL 3LKNA 3LD8C 4HIEB 2DBLH 4Y4HB 3ECBA 5TDPA 4NNYB 4KY1H 2EYTA 4U1GC 3VE0B 1CD9B 4NDMA 1G7MB 1WCBA 4QHMA 1F3DJ 3H7BA 1N6QL 4GMTH 5IBTL 3NZHH 4LCWA 5I1EL 5ID1A 3AROA 2QQNL 2CIIA 1NUDA 4M7ZC 5EOCH 4O00A 1UM6L 2EZ0C 2CIKB 2XWTB 4L1DA 5GRWA 1KPVA 4JPWL 1DLFL 1A7RH 3TO4D 3O9WC 4PJXF 2ESVA 1NDGB 2EZ0D 4JPWH 1A1NA 3VDBA 4KMTL 4PP1D 3BW9A 5J11B 4MXWL 5EPMB 5FGSA 2ZCHH 3GUTB 4U33A 3RY6C 5IBUG 1L7IL 4JRYD 3O81A 2EEBA 4G9DA 5EBLB 1ACYL 2ICWA 3KS0H 4RAVB 1KJVB 4HIIA 3MNZA 1PQZA 4DCQA 5JXAH 2Y07H 5M7QA 1D6EB 1M4KA 1CXFA 3IDIB 5JXED 5DHVA 5GRUL 3PQYD 4GUPB 2QSTA 3HPLB 5AEAA 5E1AB 2IGFH 1S78D 1FYTE 3V6ZB 4Q6IB 3ZYIA 4J3UA 5DGRA 4APQC 2NLJA 3BEVA 2V2XB 4K8RC 4NO5A 1AH1A 3IDUA 2Y72A 2DLEA 4MZ3A 2J8UA 4JJ5A 4APQA 2EKSA 1IAII 2BNQB 1LO4L 2LU3A 1G6RH 1RUMH 1SYSA 1A6UL 1C5CL 3CCHB 3QJHB 3IDJB 4BQCA 2HVKA 3JBG7 1NFKA 1DBAH 1RZJC 4K8RH 4ZOCA 3FO2A 4R4NC 2VOTA 3ARVA 3UTPD 2WWMC 4GW4A 3M17B 2WBJC 4XP4H 5FYKD 3EHBD 1RU9L 3V8CA 1IQDB 4QCIB 3VFTA 3H9HA 5KSAA 4ODVH 4YDLC 3QUYA 3OGCB 1FFPB 2CDGA 2GTZB 2N4IA 2JJSA 5KZCB 3OKEA 5E94A 1FYTA 5IFAH 1GAFH 1OP3K 3CH1A 5IB5B 2NYYD 2DS4A 1EVTC 2OM5A 1G0XA 5JLZB 3DSFH 5DK0A 5D7JC 3M8OH 3U7AA 4MMZC 4MJIB 5D1ZB 1P4BH 4PJIA 3VFNA 3L1OH 1J5OH 1I8MA 4YGVB 1N0LA 1FZMA 4ZFZA 2HTLC 4G9FB 2VQ1A 1OTSC 4EI6B 3AAZB 1GGBH 1T0MA 4X9FA 4R0LA 4PGEA 4GKSB 5C6TL 3ARBC 4JQIL 3M45A 2DLTA 4E41E 3TT3L 3RI5F 4JY4A 1B6DA 1FNSL 4HGMA 3OXSB 5I19L 2OJEA 5FYJD 1KB9J 4LLVB 4UBDC 1RK0A 1MFCH 3UTOA 5FO9A 3WIFB 3MUGB 5EO0B 3QNYA 4G6MH 1T0NB 3MLUL 1BQSA 2BNRD 4FZEL 2GSGB 4P5KA 3RNQA 4MQTB 4P99A 3UYRH 2FEDC 2XQYG 1EJ6A 3EJZC 3AMKA 2G60H 2R56L 3LKOA 4JAMB 3A6OA 2Z31C 2YZ8A 5H2BA 1Q9WB 4N90E 4OLWH 4HKJB 1OAKH 4WO4B 3K1DA 3P9WB 4HXBH 1AIFB 4KZDL 5HTSA 1WFUA 2FIRT 3MV9A 5DJCB 3LRHA 4JO1H 4N8VB 2AJZA 5B39G 1NCBL 5GGSY 1T5XA 4M7KH 2G9HA 4JVPA 4PRHD 4FTVA 3WHE0 1K4CA 5KSUB 2RHEA 2ZNWA 5FGBC 1P7QB 4FZ8L 4TSCH 1PZ5B 4W6WB 1NDGA 3X13A 4UAOC 2PTVA 3KXFD 4RZCB 5T5NG 4WW2A 4AMKL 4HG4J 1GVIA 1T89A 5F9OL 1KTDB 1Q1JL 3FB6B 4UDUB 2VZTA 4WU7B 1BFOA 2C3XA 2HT3D 1ES0A 1ZSDB 2OP4H 3BYYA 1EHNA 3MFGB 4WO4D 4D0DB 3VA6A 1WICA 3MRBB 4XVTL 4HBCH 1ZVYA 4X9GA 2WUCH 3HI5L 4OSUH 1RZKC 1AQDA 3WS6A 4IRSC 4V1DB 3ZKSD 3CFIC 1QSEB 3WD5H 3I3EA 5GSVA 4OSUL 3WLBB 1VADA 1TZIA 4KKAD 1XGRA 2NNAB 4MVBC 5IWLA 3CVHH 2Y4SA 4NKIL 3SKJL 1E4WH 1XIWD 2J7LA 3TT1L 5DJ6B 1OSZA 2DI8A 3K81A 1XH3B 2Y5EA 4NN6B 5IBLD 1GHFH 5E5RB 3VCLB 3JTTB 4NCDA 3DTXA 1DLHB 4FQ2L 5HHOD 3WCYA 3NCBB 3BRFA 3PIQB 3CU7A 3SGJC 1HKFA 1R3IH 3D2UA 2QL1A 1XGTA 3HFMH 2AW2A 3GDBA 3ILPB 4L9LB 1JN6A 4UQ3A 2B4CH 3B9KD 4LEXL 5E6ZA 1QSVA 4U6YA 4OFKA 5F71A 2HRPL 2A9ML 3BKCL 3FB7A 1S3KL 2DKSA 5CSBA 1A1NB 1YJDL 4D9LL 1Q94B 1Z2KA 3HZYA 4N5EC 1JGVL 4ODWA 2APXA 2HWZH 5LQBH 4JFDD 1I7RA 2HLAB 1FZKA 1HEZA 4M5YL 5JW5B 1RZ8A 1BBDL 3VW3H 7FABL 2Y06L 1L6XA 1KJVA 4HIIB 2HJKB 1TQCC 3DBXB 4PJ5E 4Y4KA 3QIBC 5DD3L 5GGRY 1P1ZA 5F7WC 4LEOA 1JPFA 3T77B 3KWWB 4PRNA 2ZUXA 2HVJB 1MH5A 4LKXB 5DZNA 1AQKH 3U4EB 4OJFH 3NGBC 4I48A 3N85H 4Q9BA 3REVB 1N5AA 2ZG3A 5HD8D 1BWWA 4N8CL 5MEOA 4O2EA 1YYLH 3MQIA 3MLXH 4ZFFA 1EO5A 1KIPA 5CZXC 2EO1A 4HF5H 1S7TA 4X8JB 4DKEH 2BMKB 4ZO7A 3BXNA 4IRSA 3OXSA 4Z7UF 3P73A 1S5IL 1UJ3A 1BD2B 4H26A 4XH2A 5DT1H 4NO3A 4HQQL 1M7IA 4NQCE 4XMKL 2NY4C 4N0FB 3EFDL 1FVDA 5GIRB 2HJFA 3L5HA 1QNZH 1X5YA 2LABA 4NO0B 5E8DH 1G7MA 1MREL 1YEKL 4XMLL 3W5NA 5F1OB 5CP7A 4CRPA 4MQXC 2CJUL 3STBA 5EOTB 3BN3B 5D8JL 4LCWD 1V7NH 3GMRA 4UV7L 3LN4B 3EYVB 5SX5K 3UTTB 1OSPH 4IRJD 4U6HB 4DWHA 3EKCA 4NN5C 1EEUA 1KPVB 2APFA 3D3VB 3VXQB 4FQJH 1HQRB 3FFCA 1KBGL 2QHRH 2AJUH 4JFFB 5ENWB 3S5LB 1HXMA 5EZLB 3WLWD 3CMGA 4YDKL 1NCAL 5ITFB 3VXMB 5DTFB 1FHGA 3VXPB 5C0AD 1P4IL 4Y5YA 5DFTA 4UNVA 3C6SB 2W92A 3IFPB 1SJEB 3QCVH 4HZLA 3T2NH 1B88A 3FT4A 4P5TA 4HS3B 5AZ2L 4U0RB 1CFQA 1VDGA 3J7HA 3L6FB 3BYTA 4C56E 5AZ2H 1YDPB 3LHPL 2WUBL 5C07D 4N9GA 4UDUA 4PJEA 4WHYH 2QQQA 5E8NB 3A67L 3C5JB 4NUJB 1T66C 1NCDL 2F5AH 5E1AA 4LP5A 3K4ZA 5IW1B 4KHTH 2HG5A 4ODUA 3H9ZA 3L9RB 1UWXH 5FB8B 1ZHKB 3UAJC 5FO8A 3MC0A 1OOAA 4OZHB 1AKJA 5GJTH 3IDJA 1BLNA 1XAUA 3EFFA 3QWRA 1VEOA 4PJCA 1U8QB 1TVBA 3TO2B 1WZ1H 3RBGA 3V5DA 4Z5RB 3QI9B 3AXLA 5EZJB 2VLRB 4X80H 3OJ2C 3T3PE 3ZO0A 1Y0LA 4NCC1 4WFHE 4KKCC 4JM4L 1MCOH 1Q0YH 2VITA 5DA0B 4XCEA 1IGFH 4GXUN 1AIFA 1N0XH 4M8QA 1NAMH 3ZE0F 3O8XC 5CILH 1KTKE 5KSBA 2XPGB 4Y0GA 4N8VA 3EYFA 1UM4L 1PLGL 5CILL 1OARH 1DBBL 1DUYB 3DARA 4KMLB 3UTZB 4ZXBA 5B3NA 3RJDA 2VKXA 2BOCB 4TPRH 1M6OB 1SQ2N 1FPTH 3VWJC 4KJQD 2RQ8A 1X5IA 3HUJB 2BY3A 5E8OA 2GTWB 4NKDA 5HGHB 2BX5A 3N0PB 4PRBA 3EO1A 2OZ4L 1AHWC 3MRJB 2GITA 2G5BB 5E56A 2B5IB 1G0DA 5A2LH 1ZA3A 4M5ZL 5F8QC 2UYLB 1DL7H 2HJKA 4Y4KB 5T3ZE 4LLUB 3L5JA 5IW6B 4KGLA 1NBQA 1UQSA 5E8EA 3R0MA 4IOFC 2A83A 2WNGA 4R90L 3MYZA 2DB8A 1YPZE 4E42B 1YPZA 2DMBA 2W0PA 4HFWA 3NCJL 5CGYC 3TJEH 2CXKA 2FEDD 2P4AB 3EJZD 3QEGL 4KTDL 4PJFB 3V4VL 5T3XD 4AM0A 4KMQA 3VH8G 4P49A 5DJ6A 1F4XL 5GS3A 4YDLB 1TENA 1ZT7B 3H3PH 4QY8A 3ZTNH 4N8PA 3PV6B 3GHEL 2H8PB 1YEEL 2B1AL 1WBZB 4H26B 4LSTH 3GMMA 3NH7H 4OCLC 5JHDE 1BOGA 1F4HA 1U8KA 4JJHA 5D7JB 3V6FA 3FB8A 2NZ9D 3JTSB 5K9JH 1NKOA 4Z7OF 5CEXA 2IMMA 5SWSA 3D9AH 4HKZA 4P5MA 3RKDC 3IAQA 2EIDA 3NTCH 4Y1AD 3WSQH 2FX9L 2F19H 5JW4M 1U8OB 5J12B 4N1EA 2QSVA 4YHMH 1J1PH 3LPFA 1CR9H 1IFHH 3DX8B 1R0AH 2F19L 2I27N 3QXUA 3MLSH 2CO7B 1OAZL 1W72A 1NCCL 3QPQD 1SMOA 4JRYB 5GRJL 1OAYL 2YR3A 1CXIA 1Y6NR 2AEQH 1QFWL 1NLBH 5FV2A 1UM5H 5HVGB 3EDKA 4NO0D 4HUMB 3P77A 3VXRE 3ZDXF 1BVKA 1HIMH 2O5YH 4PJ9A 1FYTD 4PRNB 2D4FA 4P2OC 1F3JB 1XZ0A 5DLMH 3PXJA 2WK2A 3HE7C 3CFKA 2VNCA 4F7MA 5CKAA 1OGAA 2Z9TA 3MBEC 4MXQD 1G9MC 4LSVH 1TZGL 3IRPX 5J13B 1BX2A 1RY7B 2JIXB 4XVUC 2KQMA 2VR4A 4LU5L 2MQCA 4YHPA 5ICYA 1YEFL 3MV8E 4NQTA 1KCUH 3JUZA 4JG0L 4Z7QE 4LSSL 3BX7C 4J2XA 3TN0D 2IWGA 3AFLA 4MA3B 1UJ3C 4Y16B 2HJFB 3NZHL 3HI1B 4YZFF 1S7WB 1W0VA 1IAMA 2IPTL 2ZUUA 4APQD 4LBEB 4HXAH 4CADB 3BUYA 5LVEA 4TQEL 1LILA 4HMDA 1U92B 3NAAL 5HYJA 5JXEC 4UDTA 4U6HA 1ZLSL 4MXVF 3ABZA 4KXZH 3KDMB 3RDTA 2YRPA 3RBSA 1TETL 1FAKT 3IJHA 2APVA 3MR9A 4P3CL 2EXYC 2G75B 3PHQB 1R6VA 4PJ9C 4GG6B 1U8JB 3BKJL 1XGQB 3NIFF 4XPBL 2KZWA 5I0ZA 3L7EA 5IESH 2XN9B 3FOLA 4U1MA 3WS6C 2X89A 3ARED 4RGNB 3RA7L 2VLJB 1UCBH 3BPOC 4JPIA 3MGAA 5F9JA 5MHSD 4L3EB 5C8JA 1UCBL 2AJ3A 2N1KA 2AEPL 4F8QA 4CDGC 5C0BB 1VGEH 3WJLC 2HFFB 2C4XA 4YPGA 3SDCC 5FUOH 3DO7A 3ZHKA 5CD5C 1FJ1B 1L7TH 1A6AA 4CW1B 1YQ2A 2OSLB 3TP4A 1C16A 4QF1A 5E2VH 3VE0A 1INQA 5FUZL 1Q1JH 2CLZA 5GGSA 1LO4H 4LLYB 1RUML 1I8LA 2XA3A 3QRFM 4E42A 5DMGC 3MLRL 1DBKL 1IGCL 4L9LC 1U95B 5EUKB 1J18A 4XPTH 1JPTL 4S1QH 3TCXA 4HWEH 1DDHB 1JF1B 4GRLA 2XFXB 4X4XA 1TNMA 1ZANH 1MCHA 4PJ5A 1IQWL 4PV9B 4QGYA