4B55A

Crystal structure of the covalent adduct formed between mycobacterium marinum aryalamine n-acetyltransferase and phenyl vinyl ketone a derivative of piperidinols
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
273
structure length
273
Chain Sequence
LDLTGYLDRINYRGATDPTLDVLRDLVSAHTGAIAFENLDPLMGVPVDDLSAEALADKLVDRRRGGYCYEHNGLIGYVLAELGYRVRRLAGRVVWLAPPDAPTPAQTHTVLAVTFPGCQGPYLVDVGFGGMTPTAPLRLETGTVQQTALEPYRLDDRGDGLVLQAMVRDEWQALYEFSTLTRPQVDLRVGSWFVSTHPTSHFVTGLMAATVADDARWNLMGRNLAIHRRGGTEKILLEDAAAVVDTLGDRFGINVADVGERGRLEARIDKVCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Piperidinols that Show Anti-Tubercular Activity as Inhibitors of Arylamine N-Acetyltransferase: An Essential Enzyme for Mycobacterial Survival Inside Macrophages.
pubmed doi rcsb
source organism Mycobacterium marinum
molecule tags Transferase
molecule keywords ARYLAMINE N-ACETYLTRANSFERASE NAT
total genus 83
structure length 273
sequence length 273
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2012-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 4b55A02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 4b55A01
1W5RA 4GUZA 4NV8A 4BGFA 1E2TA 1W6FA 4NV7A 2BSZA 2VFBA 1W4TA 4B55A 4C5PA 2VFCA 3D9WA 1GX3A 3LTWA
chains in the Genus database with same CATH superfamily
5D48A 2BS6A 3FENA 2BSZA 4KCAA 1G7NA 1PBOA 1QG5A 2LKKA 4XMDA 5KIDA 2FS6A 1B56A 1QWDA 2HKDA 2NNQA 4TLJA 3B2HA 4YKMA 4ZHFA 3D96A 3FR5A 2QMIA 2JOZA 3QKGA 1LIEA 1LIBA 3RBYA 3VE2A 5AEOA 4YMYA 5EEDA 3BU1A 1ICNA 2Q2PA 1VWIB 1P6PA 4N7DA 5HZ6A 3B2JA 3NQ3A 3FEKA 5D45A 4IB6A 1RXJA 3UAQA 2CM9A 2MHDA 1QY1A 1VWNB 2Z4HA 2AMMX 1VWKB 1HXLA 3IA8A 2PI3O 3WOVA 5C0NA 1D3SA 1VWCB 4MVKA 3AKNA 5F6BA 4ORRA 4Z2PA 4NV8A 4KIIA 1T0VA 5CSEA 4EKVA 2Y32A 3EYCA 4GKCA 1NQMA 3VG6A 4AW8A 1LNMA 1ZNGA 2BS5A 4CPIA 3WJBA 4YFPA 1LELA 1GKAB 1ZNHA 1CBSA 3ELZA 2AF5A 1LDQA 1XCAA 1RLBE 2RQ0A 3SZIA 3ZW1A 4GETA 4BVMA 3FEPA 1IKJA 5B5FA 2QOMA 1SRFA 4QGWA 3CKFA 1QY0A 2CBRA 5L8IA 3EBKA 3ZW0B 4PJ2A 3VHMA 5LJBA 4ZHHA 1I9HA 2OYBO 4BQUA 2Z4IA 3ZUIA 2QO6A 2AT3X 1VWOB 3D4RA 1KL3A 2BLGA 1LCWA 2X45A 3PK2A 2AT0X 1U18A 1TVQA 5F1EA 1OPBA 4KT5A 2FT9A 4EFGA 3FR4A 4B55A 4C5PA 4Z2OA 2WUTA 5D4AA 3VG5A 3RY1A 3KZAA 2RTFB 1UYOX 3FA9A 4MIRA 5K06A 3VPJE 4TKBA 1VYFA 3MBTA 3PP6A 1KT7A 2OFRX 2RTRB 4O4XA 5L8NA 2O62A 1O1VA 1S44A 2OF9A 1EPAA 3I0AA 4O3YA 4U9CA 5F7GA 4LZVA 2R73A 3E3CA 4ES7A 3GAQA 1DZPA 1ALBA 2JGSA 1VWLB 1HN2A 4HFOA 1SWUA 3OJYC 4JHQA 3STKA 4AZRA 1KZWA 5HWZA 1ERXA 3FIQA 3C77X 2QOSC 2RTIB 2FHNX 1FJ1E 2JW1A 3EBWA 3FMZA 3MX7A 3Q6LA 4ZJ0A 3SLJA 5IRWA 1MUPA 4ZGUA 1YUPA 3H3IA 4BX6B 2X46A 3SZHA 5IO5A 4TKHA 1TOUA 3RDXA 3PDFA 1HBPA 1SY2A 3FYFA 3RZYA 4GDAA 3OBLA 1STRB 2FRSA 1GX8A 2POAA 2RTBB 2X8TA 2KW1A 1IIUA 2RTHB 1K24A 3S60A 2PQTA 5FAZA 4YGGA 3EC5A 3S26A 4EXZA 4DMOA 3WZPA 1B4MA 3F6ZB 5KICA 1RSTB 4UU2A 1PMPA 2JMBA 4WHIA 2HMBA 2RCTA 2VFBA 2OL7A 3MVFA 3FDCA 4O3XB 1ML7A 1EUOA 1VWPB 2Q2MA 2AT6X 3HOLA 2X34A 1GT5A 2UYWA 1KT6A 4OEMA 5KHPA 5LJHA 3PQUA 4ORYA 2X32A 3LTWA 2L67A 2XKLA 3F9DA 2WSJA 3RKGA 2NNEA 2IZLB 2QO5A 5HZ5A 5LJEA 2FGSA 1EIOA 1SRIA 2X8FA 4NNTA 5BVQA 2BT9A 2YG2A 1Y0GA 4ALBA 4M6SA 1FELA 1RSUB 3O19A 1Y53X 4L1NA 1SWGA 3GE2A 1VWRB 4YDBA 2G7BA 4TNNA 1LCZA 5B27A 1ZNLA 4TQ2A 3KFGA 1N7YA 1VWHB 4I6SA 4GJSA 5B5GA 4ZH6A 5EPQA 4COTA 2G79A 1IFBA 2MJIA 1YP7A 3EW2A 4CDFA 5HTEA 1T68X 5CHKA 1QFTA 1I78A 3KFHA 3U03A 2WEXA 1KFFA 2A5BA 3T1DA 1EPBA 2ACPX 1EXSA 2YMSA 1SWCA 4I95A 1MVGA 5LJKA 1BSYA 4XMFA 2KT4B 5H8TA 2FWVA 5B3MO 4EDEA 1Z24A 1SWSA 3FELA 3VE1A 1BSQA 1LICA 2Q4NA 2WPUA 1IKEA 1SLEB 3NQ9A 1QQSA 1EQDA 1VWDB 3APVA 5HZQA 3WJDA 4BGFA 5DG4A 3JQOA 1X89A 2MM3A 3P6HA 4ZCBA 4GDZA 1SXWA 3LHNA 3FLLA 4IB9A 4O4UA 4DNEA 4CPHA 1OBPA 3CR6A 3B2KA 3UEWA 5BVTA 2X8SA 1PM1X 1Y52X 1ZRYA 4FBVA 3NQKA 1KXOA 1OEJA 1UZ2X 2IZJA 4CPFA 1KL4A 1I06A 4NP1A 3ZWEA 2A8GA 1NC9A 1LUQA 4U3QA 5L3YA 1BWYA 4IB7A 4Y0SA 5IXGA 1VWQB 5HZ9A 3HTYA 3N91A 1TOWA 3T2XA 3U9PC 2EU7X 3STNA 2RTGB 4WFVA 3X00A 1AQBA 2FKGA 1BLRA 2OFMX 3RDSA 1S7DA 1VPRA 1XKIA 1HXZA 4N7CA 4Z28A 3APXA 1DC9A 3CMPA 3NX1A 3RE5A 3VG4A 1WUBA 4LZUA 4ORUA 4BCSA 2R74A 2PY1A 5FFHA 4DQ3A 2OY8A 2FR3A 1UYNX 3FW5A 3BY0A 2KD2A 3FA6A 4ZR2A 5HAEA 4JGLA 1SWJA 4U46A 4TKJA 3SOTA 5IRAA 1AVGI 1SWPA 4QYNA 2GTLM 4CPHB 3NX2A 4BX5A 3NPOA 1S2PA 1SLDB 3BLGA 4OKAA 4HWMA 4OMWA 3SZJA 2DJGA 3NADA 3BDRA 1YIVA 1JJUA 3AEHA 5B10O 1YWDA 4KH8A 1JYDA 5FQ8E 4NV7A 3VG3A 5IO7A 1SWNA 3JS1A 1B8EA 2K62A 1L6MA 5L8OA 1HY2A 1UREA 3L4RA 5F2BA 3WZQA 1VWAB 4D6BA 1TXLA 2OFBA 1BSOA 5FQ6E 2Q9SA 3HK1A 3EM0A 1T8VA 4GNWA 4GRJA 3AKMA 4MVIA 5HBSA 3VHHA 4D6AA 1SY3A 2CAMA 1GT1A 1U17A 3G7XA 1RAVA 4QYPA 5F6ZA 1JJJA 1SXXA 2IZAA 1JMXA 1SY1A 4CSBA 1DF3A 4IAXA 4OS8A 1A18A 3PPTA 4O9SA 1JIWI 2K23A 1YWCA 1LIDA 1W6FA 3SLOA 4HPAA 3ZZVA 2I5ZO 1DZMA 4ZHCA 2ZAGA 2NP1A 3TGCA 2A2UA 1EW3A 3VG2A 1VWJB 3MG5A 2IZIA 4Y0PA 2X56A 5EDCA 3S5XA 5HCDC 1BRQA 2VFCA 4HPCA 1X8QA 1N4JA 1X71A 1RBPA 4YH0A 1W5RA 1GT4A 1SWAA 3HOEA 3WYPA 3CKGA 4GGRA 4ORSA 4AYHA 3OE3A 4BX7A 1STSB 3FA7A 2DJFA 3CBCA 4O4SA 4ZFXA 1MEPA 1LKEA 1KOIA 1MX7A 2C1SA 2JU7A 1I05A 2QM9A 1YWAA 2Y3FA 1NP4A 2BC3A 3TZSA 2F01A 4YFRA 3TGBA 1NP1A 2GTFX 1ZNDA 4NYRA 2OY1O 2IZCB 2LB6A 4A1YA 1CBRA 2RD7C 4NLIA 3TF6A 3U0DA 2CBSA 3CWKA 2CZUA 4BJ8A 2OL8O 2LBVA 2IZKA 1VYOA 1JBHA 4CPEA 3ZW1B 3MM0A 2N93A 3KFFA 1DZJA 3RE6A 4Z2VA 2C4IA 2KTSA 2QO4A 2R56A 4QQ1A 4LKTA 3ZW0A 1SWTA 3KVNA 4ZHGA 3RY2A 1X8NA 4LKPA 1LPJA 2A3FX 4FBRA 1E00A 2X4MA 2W2FA 3O22A 4GU8A 4IRWA 4WFUA 4Y0QA 5JR8A 3BRNA 1GGLA 1WBIA 4I3BA 5HCEC 2JU3A 3WJGA 4BX5B 1Y9LA 4ORXA 4NLJA 3NR3A 1GM6A 1A3YA 1OEKA 3RDQA 3RDOA 5LKEA 3UEUA 3Q34A 3V8UA 2OY7A 2GH7A 3P02A 5HA0A 2C1QA 4I9RA 1JJXA 4CV7A 2FHLA 3QQ2A 5AJBA 1N43A 1SRJA 1VWFB 2BHVA 4YBPA 4YVBA 4XMGA 4TJZA 3BS2A 1HMRA 3T6FA 1IW2A 2MF6A 4XMCA 3C78X 3VG7A 4GH7A 4QZTA 1E2TA 5K67A 4QNIA 4M7MA 2ASNX 4YGZA 2RTMA 1D2UA 3APUA 1O1UA 2RCQA 5H9LA 4QAEA 1X8PA 1FDQA 2FR2A 2IJAA 3LNBA 1SWRA 3PH6A 4IB8A 3S5VA 2A0AA 2ZSCA 1FE3A 2RTLA 4U8UM 4HPBA 1B0OA 1QY2A 3P24A 4QGVA 1E02A 2GTLN 2F73A 4QZUA 3AUMO 4OMXA 3RSWA 3UEXA 1X8OA 3K3LA 5CE4A 1A2DA 1HMTA 3VU1A 4GGZA 2MWHA 4RUUA 1OBUA 4DCBA 1VWEB 1EIIA 2RTKA 2RTPB 1KT4A 3EMMA 1X8UA 4HPDA 2HZQA 3WZOA 2Q39A 4EEJA 4BX7B 1KT3A 4Y59A 5HCCC 4A8ZA 1SWOA 4MVEA 5LJCA 5CYBA 2Y3EA 4ID2A 2HNXA 4Y5DA 1OPAA 4AZPA 1SRHA 2RTEB 3KQ0A 1QFVA 2A5CA 4PSQA 3JSQA 3P6DA 3OD9A 1JV4A 1KL5A 5B2AO 4ORWA 4UU3A 2L5PA 1R0UA 3O2YA 4YDAA 1O8VA 2A2GA 2KTDA 1GT3A 3LV4A 4IBAA 3ZUOA 1NBXA 2G5LA 2HZRA 4Z6JA 2ALLX 5HTDA 1U0XA 3CQNA 3NP1A 4OELA 4OS0A 1LIFA 3C76X 1JZUA 1ICMA 5H9KA 1SWEA 1G74A 1KGLA 1GXAA 3WZNA 2OVEA 1Y9TA 2HYSA 2RTJA 5H9NA 3APWA 1HMSA 2I5VO 1ZNEA 1CJ5A 3FW4A 3SLTA 2RTNB 5HA1A 2RTQB 2AH7X 4O3ZA 1SXUA 3BX7A 3WJEA 1NQNA 2WWPA 1KQXA 3D97A 4U8UN 2IZGB 5F58A 2GTLO 3DTQA 4CDCA 2CZTA 1OSPO 5EEEA 1HQQA 4RUNA 3KFIA 1PEEA 3NBXX 4GJVA 4MISA 5LKFA 5HZ8A 4GGTA 2NNDA 1VWGB 2AL0X 3I17A 4ZGFA 1SXYA 1SWDA 1G85A 2E4JA 4R0BA 3P6FA 3ELXA 2LA7A 1VWBB 2OZQA 5EDBA 3VGWA 4ZHDA 1MDCA 3WVMA 5IO6A 2A13A 1GKAA 1SY0A 1AVEA 2FTBA 2GJ5A 2W2BA 3P6GA 4AZMA 2IZDB 2DM5A 2AT8X 1KQWA 1ACDA 2WQAE 1SLGB 2XSTA 4O3WA 5LJGA 4I60A 1BM5A 4CDEA 4LQZA 1N9MA 4FQBB 3PEDA 1STPA 1HQPA 1I04A 1SWHA 2WEWA 3UEVA 1A57A 2IFBA 4QRLA 4I9SA 4CDDA 2JU8A 3ZW2A 1EALA 4ON1A 2G78A 3B2LA 1FTPA 4YCEA 2ANSA 2HLVA 4K19A 1BBPA 2UZ2A 1SWBA 3HWEA 2P8GA 1E06A 3RDUA 3WJCA 1SWFA 2AVIA 1AB0A 2OF8A 2OVDA 3T2WA 1SLFB 2G8CO 1DV9A 1SMPI 4WBKA 1AELA 1PTSA 4ARHA 5AJCA 3P6EA 2GC9A 4JNJA 1BEBA 1K3BA 1QABE 2JN3A 4IMOA 1YP6A 2LBAA 3WYQA 4YFQA 4O49A 1MOYA 1JYJA 1MX8A 1N0SA 1GX9A 1AVDA 4IMNA 4ML7B 4GK9A 2OL6O 1NDJA 1H91A 3PECA 4MVLA 2ACOA 4ALOA 2IZHB 2QCBA 2L68A 2RTOB 3B2IA 4IABA 4I3DA 4XMEA 3FR2A 4ZH9A 4JO6A 4AZOA 1DF8A 1LDOA 1ZNKA 2FLJA 2MO5A 4QGXA 4NYQA 5JD2A 1YWBA 2OY5O 3WXQA 3CQRA 3BU9A 5FENA 4YKOA 4Y0RA 1SWKA 1GX3A 3FA8A 4GE1A 3VHIA 4AZNA 1ERBA 2IZEB 1HBQA 5B11O 2RA6A 4NNSA 1IFCA 2OFAA 1EI5A 2FS7A 2LFOA 4A1HA 3D9WA 2RTDB 1MK5A 1OEEA 5BVSA 2OVSA 1I4UA 1CRBA 4EQAC 4YBUA 3DSZA 3WJFA 3CBSA 3RWXA 2W2AA 5FQ7E 3PH5A 3STMX 4ODDA 1CBIA 2IZBA 5EZ2A 1G5WA 1JMZA 5D47A 4I3CA 1LCVA 4FGIB 4L3RA 1FENA 3F8AA 4INNA 3D95A 1LF7A 4FBOA 2AT5X 4MEEA 2X55A 1IJ8A 3PQSA 3TGAA 4XMHA 1VYGA 5D8JA 4IAWA 4BBOA 1DZKA 3T6LA 3HPEA 3BSZE 4Z27A 1SREA 1VWMB 3FIDA 1BJ7A 2RN4A 2RTCB 4GUZA 2AKQA 2L9CA 4CK4A 2RTAA 1CBQA 1DFVA 2VDFA 4GZVA 2OVAA 5IRUA 3ZI8A 3ZQ3A 4U8UO 1PBYA 3P6CA 2IZFB 3EW1A 3BX8A 4YGHA 2M4LA 1SWLA 1Y55X 1JQPA 3HWFA 1ADLA 5K68A 4OS3A 1KT5A 1MM9A 4O4OA 4NW4A 5H9AA 3SAOA 5BYPA 2PFRA 4GD9A 1KZXA 1W4TA 1TW4A 5AQ6A 1RXHA 2F09A 2WQ9A 4BOEA 4DQ4A 1LFOA 1FEMA 2ZAIA 4KC8A 1NGLA 5DPQA 5LJDA 5B29A 3HWDA 2FKJA 1SRGA 4AZQA 3RDMA 1BRPA 1N9YA 2CM4A 4GNYA 4BX6A 1E5PA 1SA8A 2WR6A 1OBQA 3IFBA 4KC7A 4YCHA 1RXKA 1SWQA 3WBGA 4A60A 3HWGA
chains in the Genus database with same CATH topology
1AECA 4BQVA 4RY2A 2BSZA 2P86A 2C0YA 4BPVA 1QOLA 3MHHA 3OVZA 1TL9A 3QSDA 4X6JA 1GECE 2DC7A 1BP4A 2G7YA 1MIRA 2AU1A 2HD5A 4DMXA 2B1MA 3I06A 3V6EA 4NV8A 1BY8A 1U9QX 2AUXA 1F2CA 2P0RA 5EF4A 3H89A 3WXFA 4YYUA 1CPJA 2F7DA 1X9YA 1GLOA 3P5VA 2AVWA 3D6SA 3HHIA 1MS6A 3QT4A 3KW9A 1BQIA 1PPDA 3O0UA 1CQDA 4YYWA 1Y4HA 1CJLA 4B55A 4C5PA 1F2BA 3TNXA 1AYVA 3PNRA 3WXEA 1ME3A 1YK8A 1YVBA 1K3BB 1ME4A 3QJ3A 1F29A 2DZZA 2G8JA 3B79A 5J94A 1NB5A 4PI3A 1IWDA 2G6DA 3CBKA 3PDFA 1M6DA 2YJ8A 1NQCA 2FQ9A 1MEGA 4XR7A 2VFBA 5CVNB 3LXSA 3K24A 1ZCMA 4N79A 4OEMA 1PPOA 1NPZA 3LTWA 3S3QA 1HUCB 2PNSA 3MTNA 3HWNA 3OISA 3N4CA 3USVA 3OVXA 2OP3A 2VHSA 2JQFR 1PPNA 1NLJA 1U5IA 1VSNA 4PP1A 1KHPA 4FJCA 3IV2A 2Y6EA 3IHPA 4XUIA 3E1ZB 4DMYA 4BGFA 1QMYA 4W4UA 1AU4A 2VHFA 2HHNA 2YJBA 3O1GA 1A6RA 3OF9A 1CVZA 3KSEA 1XKGA 4QRXA 1TU6A 2XU3A 2ARYA 1AU3A 3KWZA 2DC9A 1CS8A 1KFUL 5EGWA 1MDWA 5CHTA 4MSXA 1TLOA 5CHVA 2OULA 4NV7A 3RVVA 4G54A 4AXMA 3BCNA 2NQGA 3N3GA 1EWOA 2CIOA 1EWMA 3H6SA 2JQGR 3P5WA 1FH0A 4QH6A 2DC6A 4Q8HA 1W6FA 1AYUA 1BGOA 4N4ZA 1PXVA 1S4VA 2E02A 1ICFA 1CB5A 1PE6A 2VFCA 3GCBA 3OF8A 6PADA 5A24A 1ATKA 1EWLA 1W5RA 2PBHA 4PP2E 2ATOA 4W5BA 4BS5A 1DF0A 1VJVA 2BDLA 4W5CA 3PW3A 3I3TA 3MORA 2DC8A 2NQIA 1QDQA 1YT7A 4N8WA 2HXZA 8PCHA 4QRGA 2E00A 2NQDB 1KXRA 3WXGA 2WBFX 2BDZA 3K9MA 2XU5A 4P6GA 1AIMA 1QXPA 4X6HA 3K8UA 4CZWA 2R9NA 2FRAA 3IMAA 1ITOA 1E2TA 2DCDA 2IPPB 3F75A 4CDDB 3F5VA 4WA6A 3HD3A 4AXLA 2FTDA 4YVAA 3KX1A 3N3KA 1U9VA 3LFYA 3H8BA 3KWBX 2AYNA 2H7JA 5CVMA 2XU4A 1O0EA 5JA7A 2ACTA 1AU0A 3BC3A 2R9CA 3H7DA 2DJFB 3P5XA 3ERVA 4CDCB 2CB5A 2NQAA 1EF7A 1U9WA 3CBJA 1KHQA 4X6IA 1Y08A 1NL6A 4OELA 2R9OA 5K16A 3KFQA 3DF0A 9PAPA 2AIMA 2B1NA 2GFOA 1U9XA 4QBBA 4KLBA 1GMYA 4YYRA 3P5UA 3IUTA 2FT2A 1PIPA 7PCKA 4PADA 4Q8GA 1MHWA 2YJ9A 5JH3A 4HWYA 3PBHA 4YV8A 2F1GA 1THEA 4BS6A 3M99A 3C9EA 4K7CA 4YYVA 2PREA 3KKUA 1YK7A 3RVXA 1STFE 2R9FA 4QRVA 5F02A 2HH5A 4YYQA 2E03A 4BSQA 1F2AA 3MHSA 2DJGB 2FRQA 3BOWA 1Q6KA 4CDFB 2DCBA 4CDEB 1GCBA 1AU2A 3U8EA 3HHAA 2DZYA 1CV8A 1KFXL 2AS8A 1PCIA 1EWPA 2PADA 3IEJA 2E01A 3H8CA 1GX3A 1MEMA 1CSBB 2FUDA 3D9WA 4YYSA 2G8EA 3AI8A 2YJCA 2FO5A 4I07A 1POPA 3CH3X 1SNKA 3V6CA 4P6EA 1SP4B 2Y5BA 4MZSA 1DEUA 2DCCA 4I05A 2GHUA 3NHEA 1PBHA 5CVOB 3S3RA 3BPFA 4GUZA 2R6NA 1NB3A 3CH2X 2OZ2A 2DCAA 1CTEA 1JQPA 1ZIVA 2AYOA 3IOQA 5PADA 3RVWA 2O6XA 2YJ2A 3BPMA 1PPPA 1W4TA 3BWKA 5FPWA 2AUZA 4FIPA 1AYWA 2IBIA 2FYEA 3ZUAA 2XU1A 4I04A 2P7UA 4FK5A 4ZUXU 4MZOA 2R9MA 1YALA 1PADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W5R A;  4GUZ A;  4NV8 A;  4BGF A;  1E2T A;  1W6F A;  4NV7 A;  2BSZ A;  2VFB A;  1W4T A;  4B55 A;  4C5P A;  2VFC A;  3D9W A;  1GX3 A;  3LTW A; 
#chains in the Genus database with same CATH topology
 5D48 A;  2BS6 A;  3FEN A;  2BSZ A;  4KCA A;  1G7N A;  1PBO A;  1QG5 A;  2LKK A;  4XMD A;  5KID A;  2FS6 A;  1B56 A;  1QWD A;  2HKD A;  2NNQ A;  4TLJ A;  3B2H A;  4YKM A;  4ZHF A;  3D96 A;  3FR5 A;  2QMI A;  2JOZ A;  3QKG A;  1LIE A;  1LIB A;  3RBY A;  3VE2 A;  5AEO A;  4YMY A;  5EED A;  3BU1 A;  1ICN A;  2Q2P A;  1VWI B;  1P6P A;  4N7D A;  5HZ6 A;  3B2J A;  3NQ3 A;  3FEK A;  5D45 A;  4IB6 A;  1RXJ A;  3UAQ A;  2CM9 A;  2MHD A;  1QY1 A;  1VWN B;  2Z4H A;  2AMM X;  1VWK B;  1HXL A;  3IA8 A;  2PI3 O;  3WOV A;  5C0N A;  1D3S A;  1VWC B;  4MVK A;  3AKN A;  5F6B A;  4ORR A;  4Z2P A;  4NV8 A;  4KII A;  1T0V A;  5CSE A;  4EKV A;  2Y32 A;  3EYC A;  4GKC A;  1NQM A;  3VG6 A;  4AW8 A;  1LNM A;  1ZNG A;  2BS5 A;  4CPI A;  3WJB A;  4YFP A;  1LEL A;  1GKA B;  1ZNH A;  1CBS A;  3ELZ A;  2AF5 A;  1LDQ A;  1XCA A;  1RLB E;  2RQ0 A;  3SZI A;  3ZW1 A;  4GET A;  4BVM A;  3FEP A;  1IKJ A;  5B5F A;  2QOM A;  1SRF A;  4QGW A;  3CKF A;  1QY0 A;  2CBR A;  5L8I A;  3EBK A;  3ZW0 B;  4PJ2 A;  3VHM A;  5LJB A;  4ZHH A;  1I9H A;  2OYB O;  4BQU A;  2Z4I A;  3ZUI A;  2QO6 A;  2AT3 X;  1VWO B;  3D4R A;  1KL3 A;  2BLG A;  1LCW A;  2X45 A;  3PK2 A;  2AT0 X;  1U18 A;  1TVQ A;  5F1E A;  1OPB A;  4KT5 A;  2FT9 A;  4EFG A;  3FR4 A;  4B55 A;  4C5P A;  4Z2O A;  2WUT A;  5D4A A;  3VG5 A;  3RY1 A;  3KZA A;  2RTF B;  1UYO X;  3FA9 A;  4MIR A;  5K06 A;  3VPJ E;  4TKB A;  1VYF A;  3MBT A;  3PP6 A;  1KT7 A;  2OFR X;  2RTR B;  4O4X A;  5L8N A;  2O62 A;  1O1V A;  1S44 A;  2OF9 A;  1EPA A;  3I0A A;  4O3Y A;  4U9C A;  5F7G A;  4LZV A;  2R73 A;  3E3C A;  4ES7 A;  3GAQ A;  1DZP A;  1ALB A;  2JGS A;  1VWL B;  1HN2 A;  4HFO A;  1SWU A;  3OJY C;  4JHQ A;  3STK A;  4AZR A;  1KZW A;  5HWZ A;  1ERX A;  3FIQ A;  3C77 X;  2QOS C;  2RTI B;  2FHN X;  1FJ1 E;  2JW1 A;  3EBW A;  3FMZ A;  3MX7 A;  3Q6L A;  4ZJ0 A;  3SLJ A;  5IRW A;  1MUP A;  4ZGU A;  1YUP A;  3H3I A;  4BX6 B;  2X46 A;  3SZH A;  5IO5 A;  4TKH A;  1TOU A;  3RDX A;  3PDF A;  1HBP A;  1SY2 A;  3FYF A;  3RZY A;  4GDA A;  3OBL A;  1STR B;  2FRS A;  1GX8 A;  2POA A;  2RTB B;  2X8T A;  2KW1 A;  1IIU A;  2RTH B;  1K24 A;  3S60 A;  2PQT A;  5FAZ A;  4YGG A;  3EC5 A;  3S26 A;  4EXZ A;  4DMO A;  3WZP A;  1B4M A;  3F6Z B;  5KIC A;  1RST B;  4UU2 A;  1PMP A;  2JMB A;  4WHI A;  2HMB A;  2RCT A;  2VFB A;  2OL7 A;  3MVF A;  3FDC A;  4O3X B;  1ML7 A;  1EUO A;  1VWP B;  2Q2M A;  2AT6 X;  3HOL A;  2X34 A;  1GT5 A;  2UYW A;  1KT6 A;  4OEM A;  5KHP A;  5LJH A;  3PQU A;  4ORY A;  2X32 A;  3LTW A;  2L67 A;  2XKL A;  3F9D A;  2WSJ A;  3RKG A;  2NNE A;  2IZL B;  2QO5 A;  5HZ5 A;  5LJE A;  2FGS A;  1EIO A;  1SRI A;  2X8F A;  4NNT A;  5BVQ A;  2BT9 A;  2YG2 A;  1Y0G A;  4ALB A;  4M6S A;  1FEL A;  1RSU B;  3O19 A;  1Y53 X;  4L1N A;  1SWG A;  3GE2 A;  1VWR B;  4YDB A;  2G7B A;  4TNN A;  1LCZ A;  5B27 A;  1ZNL A;  4TQ2 A;  3KFG A;  1N7Y A;  1VWH B;  4I6S A;  4GJS A;  5B5G A;  4ZH6 A;  5EPQ A;  4COT A;  2G79 A;  1IFB A;  2MJI A;  1YP7 A;  3EW2 A;  4CDF A;  5HTE A;  1T68 X;  5CHK A;  1QFT A;  1I78 A;  3KFH A;  3U03 A;  2WEX A;  1KFF A;  2A5B A;  3T1D A;  1EPB A;  2ACP X;  1EXS A;  2YMS A;  1SWC A;  4I95 A;  1MVG A;  5LJK A;  1BSY A;  4XMF A;  2KT4 B;  5H8T A;  2FWV A;  5B3M O;  4EDE A;  1Z24 A;  1SWS A;  3FEL A;  3VE1 A;  1BSQ A;  1LIC A;  2Q4N A;  2WPU A;  1IKE A;  1SLE B;  3NQ9 A;  1QQS A;  1EQD A;  1VWD B;  3APV A;  5HZQ A;  3WJD A;  4BGF A;  5DG4 A;  3JQO A;  1X89 A;  2MM3 A;  3P6H A;  4ZCB A;  4GDZ A;  1SXW A;  3LHN A;  3FLL A;  4IB9 A;  4O4U A;  4DNE A;  4CPH A;  1OBP A;  3CR6 A;  3B2K A;  3UEW A;  5BVT A;  2X8S A;  1PM1 X;  1Y52 X;  1ZRY A;  4FBV A;  3NQK A;  1KXO A;  1OEJ A;  1UZ2 X;  2IZJ A;  4CPF A;  1KL4 A;  1I06 A;  4NP1 A;  3ZWE A;  2A8G A;  1NC9 A;  1LUQ A;  4U3Q A;  5L3Y A;  1BWY A;  4IB7 A;  4Y0S A;  5IXG A;  1VWQ B;  5HZ9 A;  3HTY A;  3N91 A;  1TOW A;  3T2X A;  3U9P C;  2EU7 X;  3STN A;  2RTG B;  4WFV A;  3X00 A;  1AQB A;  2FKG A;  1BLR A;  2OFM X;  3RDS A;  1S7D A;  1VPR A;  1XKI A;  1HXZ A;  4N7C A;  4Z28 A;  3APX A;  1DC9 A;  3CMP A;  3NX1 A;  3RE5 A;  3VG4 A;  1WUB A;  4LZU A;  4ORU A;  4BCS A;  2R74 A;  2PY1 A;  5FFH A;  4DQ3 A;  2OY8 A;  2FR3 A;  1UYN X;  3FW5 A;  3BY0 A;  2KD2 A;  3FA6 A;  4ZR2 A;  5HAE A;  4JGL A;  1SWJ A;  4U46 A;  4TKJ A;  3SOT A;  5IRA A;  1AVG I;  1SWP A;  4QYN A;  2GTL M;  4CPH B;  3NX2 A;  4BX5 A;  3NPO A;  1S2P A;  1SLD B;  3BLG A;  4OKA A;  4HWM A;  4OMW A;  3SZJ A;  2DJG A;  3NAD A;  3BDR A;  1YIV A;  1JJU A;  3AEH A;  5B10 O;  1YWD A;  4KH8 A;  1JYD A;  5FQ8 E;  4NV7 A;  3VG3 A;  5IO7 A;  1SWN A;  3JS1 A;  1B8E A;  2K62 A;  1L6M A;  5L8O A;  1HY2 A;  1URE A;  3L4R A;  5F2B A;  3WZQ A;  1VWA B;  4D6B A;  1TXL A;  2OFB A;  1BSO A;  5FQ6 E;  2Q9S A;  3HK1 A;  3EM0 A;  1T8V A;  4GNW A;  4GRJ A;  3AKM A;  4MVI A;  5HBS A;  3VHH A;  4D6A A;  1SY3 A;  2CAM A;  1GT1 A;  1U17 A;  3G7X A;  1RAV A;  4QYP A;  5F6Z A;  1JJJ A;  1SXX A;  2IZA A;  1JMX A;  1SY1 A;  4CSB A;  1DF3 A;  4IAX A;  4OS8 A;  1A18 A;  3PPT A;  4O9S A;  1JIW I;  2K23 A;  1YWC A;  1LID A;  1W6F A;  3SLO A;  4HPA A;  3ZZV A;  2I5Z O;  1DZM A;  4ZHC A;  2ZAG A;  2NP1 A;  3TGC A;  2A2U A;  1EW3 A;  3VG2 A;  1VWJ B;  3MG5 A;  2IZI A;  4Y0P A;  2X56 A;  5EDC A;  3S5X A;  5HCD C;  1BRQ A;  2VFC A;  4HPC A;  1X8Q A;  1N4J A;  1X71 A;  1RBP A;  4YH0 A;  1W5R A;  1GT4 A;  1SWA A;  3HOE A;  3WYP A;  3CKG A;  4GGR A;  4ORS A;  4AYH A;  3OE3 A;  4BX7 A;  1STS B;  3FA7 A;  2DJF A;  3CBC A;  4O4S A;  4ZFX A;  1MEP A;  1LKE A;  1KOI A;  1MX7 A;  2C1S A;  2JU7 A;  1I05 A;  2QM9 A;  1YWA A;  2Y3F A;  1NP4 A;  2BC3 A;  3TZS A;  2F01 A;  4YFR A;  3TGB A;  1NP1 A;  2GTF X;  1ZND A;  4NYR A;  2OY1 O;  2IZC B;  2LB6 A;  4A1Y A;  1CBR A;  2RD7 C;  4NLI A;  3TF6 A;  3U0D A;  2CBS A;  3CWK A;  2CZU A;  4BJ8 A;  2OL8 O;  2LBV A;  2IZK A;  1VYO A;  1JBH A;  4CPE A;  3ZW1 B;  3MM0 A;  2N93 A;  3KFF A;  1DZJ A;  3RE6 A;  4Z2V A;  2C4I A;  2KTS A;  2QO4 A;  2R56 A;  4QQ1 A;  4LKT A;  3ZW0 A;  1SWT A;  3KVN A;  4ZHG A;  3RY2 A;  1X8N A;  4LKP A;  1LPJ A;  2A3F X;  4FBR A;  1E00 A;  2X4M A;  2W2F A;  3O22 A;  4GU8 A;  4IRW A;  4WFU A;  4Y0Q A;  5JR8 A;  3BRN A;  1GGL A;  1WBI A;  4I3B A;  5HCE C;  2JU3 A;  3WJG A;  4BX5 B;  1Y9L A;  4ORX A;  4NLJ A;  3NR3 A;  1GM6 A;  1A3Y A;  1OEK A;  3RDQ A;  3RDO A;  5LKE A;  3UEU A;  3Q34 A;  3V8U A;  2OY7 A;  2GH7 A;  3P02 A;  5HA0 A;  2C1Q A;  4I9R A;  1JJX A;  4CV7 A;  2FHL A;  3QQ2 A;  5AJB A;  1N43 A;  1SRJ A;  1VWF B;  2BHV A;  4YBP A;  4YVB A;  4XMG A;  4TJZ A;  3BS2 A;  1HMR A;  3T6F A;  1IW2 A;  2MF6 A;  4XMC A;  3C78 X;  3VG7 A;  4GH7 A;  4QZT A;  1E2T A;  5K67 A;  4QNI A;  4M7M A;  2ASN X;  4YGZ A;  2RTM A;  1D2U A;  3APU A;  1O1U A;  2RCQ A;  5H9L A;  4QAE A;  1X8P A;  1FDQ A;  2FR2 A;  2IJA A;  3LNB A;  1SWR A;  3PH6 A;  4IB8 A;  3S5V A;  2A0A A;  2ZSC A;  1FE3 A;  2RTL A;  4U8U M;  4HPB A;  1B0O A;  1QY2 A;  3P24 A;  4QGV A;  1E02 A;  2GTL N;  2F73 A;  4QZU A;  3AUM O;  4OMX A;  3RSW A;  3UEX A;  1X8O A;  3K3L A;  5CE4 A;  1A2D A;  1HMT A;  3VU1 A;  4GGZ A;  2MWH A;  4RUU A;  1OBU A;  4DCB A;  1VWE B;  1EII A;  2RTK A;  2RTP B;  1KT4 A;  3EMM A;  1X8U A;  4HPD A;  2HZQ A;  3WZO A;  2Q39 A;  4EEJ A;  4BX7 B;  1KT3 A;  4Y59 A;  5HCC C;  4A8Z A;  1SWO A;  4MVE A;  5LJC A;  5CYB A;  2Y3E A;  4ID2 A;  2HNX A;  4Y5D A;  1OPA A;  4AZP A;  1SRH A;  2RTE B;  3KQ0 A;  1QFV A;  2A5C A;  4PSQ A;  3JSQ A;  3P6D A;  3OD9 A;  1JV4 A;  1KL5 A;  5B2A O;  4ORW A;  4UU3 A;  2L5P A;  1R0U A;  3O2Y A;  4YDA A;  1O8V A;  2A2G A;  2KTD A;  1GT3 A;  3LV4 A;  4IBA A;  3ZUO A;  1NBX A;  2G5L A;  2HZR A;  4Z6J A;  2ALL X;  5HTD A;  1U0X A;  3CQN A;  3NP1 A;  4OEL A;  4OS0 A;  1LIF A;  3C76 X;  1JZU A;  1ICM A;  5H9K A;  1SWE A;  1G74 A;  1KGL A;  1GXA A;  3WZN A;  2OVE A;  1Y9T A;  2HYS A;  2RTJ A;  5H9N A;  3APW A;  1HMS A;  2I5V O;  1ZNE A;  1CJ5 A;  3FW4 A;  3SLT A;  2RTN B;  5HA1 A;  2RTQ B;  2AH7 X;  4O3Z A;  1SXU A;  3BX7 A;  3WJE A;  1NQN A;  2WWP A;  1KQX A;  3D97 A;  4U8U N;  2IZG B;  5F58 A;  2GTL O;  3DTQ A;  4CDC A;  2CZT A;  1OSP O;  5EEE A;  1HQQ A;  4RUN A;  3KFI A;  1PEE A;  3NBX X;  4GJV A;  4MIS A;  5LKF A;  5HZ8 A;  4GGT A;  2NND A;  1VWG B;  2AL0 X;  3I17 A;  4ZGF A;  1SXY A;  1SWD A;  1G85 A;  2E4J A;  4R0B A;  3P6F A;  3ELX A;  2LA7 A;  1VWB B;  2OZQ A;  5EDB A;  3VGW A;  4ZHD A;  1MDC A;  3WVM A;  5IO6 A;  2A13 A;  1GKA A;  1SY0 A;  1AVE A;  2FTB A;  2GJ5 A;  2W2B A;  3P6G A;  4AZM A;  2IZD B;  2DM5 A;  2AT8 X;  1KQW A;  1ACD A;  2WQA E;  1SLG B;  2XST A;  4O3W A;  5LJG A;  4I60 A;  1BM5 A;  4CDE A;  4LQZ A;  1N9M A;  4FQB B;  3PED A;  1STP A;  1HQP A;  1I04 A;  1SWH A;  2WEW A;  3UEV A;  1A57 A;  2IFB A;  4QRL A;  4I9S A;  4CDD A;  2JU8 A;  3ZW2 A;  1EAL A;  4ON1 A;  2G78 A;  3B2L A;  1FTP A;  4YCE A;  2ANS A;  2HLV A;  4K19 A;  1BBP A;  2UZ2 A;  1SWB A;  3HWE A;  2P8G A;  1E06 A;  3RDU A;  3WJC A;  1SWF A;  2AVI A;  1AB0 A;  2OF8 A;  2OVD A;  3T2W A;  1SLF B;  2G8C O;  1DV9 A;  1SMP I;  4WBK A;  1AEL A;  1PTS A;  4ARH A;  5AJC A;  3P6E A;  2GC9 A;  4JNJ A;  1BEB A;  1K3B A;  1QAB E;  2JN3 A;  4IMO A;  1YP6 A;  2LBA A;  3WYQ A;  4YFQ A;  4O49 A;  1MOY A;  1JYJ A;  1MX8 A;  1N0S A;  1GX9 A;  1AVD A;  4IMN A;  4ML7 B;  4GK9 A;  2OL6 O;  1NDJ A;  1H91 A;  3PEC A;  4MVL A;  2ACO A;  4ALO A;  2IZH B;  2QCB A;  2L68 A;  2RTO B;  3B2I A;  4IAB A;  4I3D A;  4XME A;  3FR2 A;  4ZH9 A;  4JO6 A;  4AZO A;  1DF8 A;  1LDO A;  1ZNK A;  2FLJ A;  2MO5 A;  4QGX A;  4NYQ A;  5JD2 A;  1YWB A;  2OY5 O;  3WXQ A;  3CQR A;  3BU9 A;  5FEN A;  4YKO A;  4Y0R A;  1SWK A;  1GX3 A;  3FA8 A;  4GE1 A;  3VHI A;  4AZN A;  1ERB A;  2IZE B;  1HBQ A;  5B11 O;  2RA6 A;  4NNS A;  1IFC A;  2OFA A;  1EI5 A;  2FS7 A;  2LFO A;  4A1H A;  3D9W A;  2RTD B;  1MK5 A;  1OEE A;  5BVS A;  2OVS A;  1I4U A;  1CRB A;  4EQA C;  4YBU A;  3DSZ A;  3WJF A;  3CBS A;  3RWX A;  2W2A A;  5FQ7 E;  3PH5 A;  3STM X;  4ODD A;  1CBI A;  2IZB A;  5EZ2 A;  1G5W A;  1JMZ A;  5D47 A;  4I3C A;  1LCV A;  4FGI B;  4L3R A;  1FEN A;  3F8A A;  4INN A;  3D95 A;  1LF7 A;  4FBO A;  2AT5 X;  4MEE A;  2X55 A;  1IJ8 A;  3PQS A;  3TGA A;  4XMH A;  1VYG A;  5D8J A;  4IAW A;  4BBO A;  1DZK A;  3T6L A;  3HPE A;  3BSZ E;  4Z27 A;  1SRE A;  1VWM B;  3FID A;  1BJ7 A;  2RN4 A;  2RTC B;  4GUZ A;  2AKQ A;  2L9C A;  4CK4 A;  2RTA A;  1CBQ A;  1DFV A;  2VDF A;  4GZV A;  2OVA A;  5IRU A;  3ZI8 A;  3ZQ3 A;  4U8U O;  1PBY A;  3P6C A;  2IZF B;  3EW1 A;  3BX8 A;  4YGH A;  2M4L A;  1SWL A;  1Y55 X;  1JQP A;  3HWF A;  1ADL A;  5K68 A;  4OS3 A;  1KT5 A;  1MM9 A;  4O4O A;  4NW4 A;  5H9A A;  3SAO A;  5BYP A;  2PFR A;  4GD9 A;  1KZX A;  1W4T A;  1TW4 A;  5AQ6 A;  1RXH A;  2F09 A;  2WQ9 A;  4BOE A;  4DQ4 A;  1LFO A;  1FEM A;  2ZAI A;  4KC8 A;  1NGL A;  5DPQ A;  5LJD A;  5B29 A;  3HWD A;  2FKJ A;  1SRG A;  4AZQ A;  3RDM A;  1BRP A;  1N9Y A;  2CM4 A;  4GNY A;  4BX6 A;  1E5P A;  1SA8 A;  2WR6 A;  1OBQ A;  3IFB A;  4KC7 A;  4YCH A;  1RXK A;  1SWQ A;  3WBG A;  4A60 A;  3HWG A; 
#chains in the Genus database with same CATH homology
 1AEC A;  4BQV A;  4RY2 A;  2BSZ A;  2P86 A;  2C0Y A;  4BPV A;  1QOL A;  3MHH A;  3OVZ A;  1TL9 A;  3QSD A;  4X6J A;  1GEC E;  2DC7 A;  1BP4 A;  2G7Y A;  1MIR A;  2AU1 A;  2HD5 A;  4DMX A;  2B1M A;  3I06 A;  3V6E A;  4NV8 A;  1BY8 A;  1U9Q X;  2AUX A;  1F2C A;  2P0R A;  5EF4 A;  3H89 A;  3WXF A;  4YYU A;  1CPJ A;  2F7D A;  1X9Y A;  1GLO A;  3P5V A;  2AVW A;  3D6S A;  3HHI A;  1MS6 A;  3QT4 A;  3KW9 A;  1BQI A;  1PPD A;  3O0U A;  1CQD A;  4YYW A;  1Y4H A;  1CJL A;  4B55 A;  4C5P A;  1F2B A;  3TNX A;  1AYV A;  3PNR A;  3WXE A;  1ME3 A;  1YK8 A;  1YVB A;  1K3B B;  1ME4 A;  3QJ3 A;  1F29 A;  2DZZ A;  2G8J A;  3B79 A;  5J94 A;  1NB5 A;  4PI3 A;  1IWD A;  2G6D A;  3CBK A;  3PDF A;  1M6D A;  2YJ8 A;  1NQC A;  2FQ9 A;  1MEG A;  4XR7 A;  2VFB A;  5CVN B;  3LXS A;  3K24 A;  1ZCM A;  4N79 A;  4OEM A;  1PPO A;  1NPZ A;  3LTW A;  3S3Q A;  1HUC B;  2PNS A;  3MTN A;  3HWN A;  3OIS A;  3N4C A;  3USV A;  3OVX A;  2OP3 A;  2VHS A;  2JQF R;  1PPN A;  1NLJ A;  1U5I A;  1VSN A;  4PP1 A;  1KHP A;  4FJC A;  3IV2 A;  2Y6E A;  3IHP A;  4XUI A;  3E1Z B;  4DMY A;  4BGF A;  1QMY A;  4W4U A;  1AU4 A;  2VHF A;  2HHN A;  2YJB A;  3O1G A;  1A6R A;  3OF9 A;  1CVZ A;  3KSE A;  1XKG A;  4QRX A;  1TU6 A;  2XU3 A;  2ARY A;  1AU3 A;  3KWZ A;  2DC9 A;  1CS8 A;  1KFU L;  5EGW A;  1MDW A;  5CHT A;  4MSX A;  1TLO A;  5CHV A;  2OUL A;  4NV7 A;  3RVV A;  4G54 A;  4AXM A;  3BCN A;  2NQG A;  3N3G A;  1EWO A;  2CIO A;  1EWM A;  3H6S A;  2JQG R;  3P5W A;  1FH0 A;  4QH6 A;  2DC6 A;  4Q8H A;  1W6F A;  1AYU A;  1BGO A;  4N4Z A;  1PXV A;  1S4V A;  2E02 A;  1ICF A;  1CB5 A;  1PE6 A;  2VFC A;  3GCB A;  3OF8 A;  6PAD A;  5A24 A;  1ATK A;  1EWL A;  1W5R A;  2PBH A;  4PP2 E;  2ATO A;  4W5B A;  4BS5 A;  1DF0 A;  1VJV A;  2BDL A;  4W5C A;  3PW3 A;  3I3T A;  3MOR A;  2DC8 A;  2NQI A;  1QDQ A;  1YT7 A;  4N8W A;  2HXZ A;  8PCH A;  4QRG A;  2E00 A;  2NQD B;  1KXR A;  3WXG A;  2WBF X;  2BDZ A;  3K9M A;  2XU5 A;  4P6G A;  1AIM A;  1QXP A;  4X6H A;  3K8U A;  4CZW A;  2R9N A;  2FRA A;  3IMA A;  1ITO A;  1E2T A;  2DCD A;  2IPP B;  3F75 A;  4CDD B;  3F5V A;  4WA6 A;  3HD3 A;  4AXL A;  2FTD A;  4YVA A;  3KX1 A;  3N3K A;  1U9V A;  3LFY A;  3H8B A;  3KWB X;  2AYN A;  2H7J A;  5CVM A;  2XU4 A;  1O0E A;  5JA7 A;  2ACT A;  1AU0 A;  3BC3 A;  2R9C A;  3H7D A;  2DJF B;  3P5X A;  3ERV A;  4CDC B;  2CB5 A;  2NQA A;  1EF7 A;  1U9W A;  3CBJ A;  1KHQ A;  4X6I A;  1Y08 A;  1NL6 A;  4OEL A;  2R9O A;  5K16 A;  3KFQ A;  3DF0 A;  9PAP A;  2AIM A;  2B1N A;  2GFO A;  1U9X A;  4QBB A;  4KLB A;  1GMY A;  4YYR A;  3P5U A;  3IUT A;  2FT2 A;  1PIP A;  7PCK A;  4PAD A;  4Q8G A;  1MHW A;  2YJ9 A;  5JH3 A;  4HWY A;  3PBH A;  4YV8 A;  2F1G A;  1THE A;  4BS6 A;  3M99 A;  3C9E A;  4K7C A;  4YYV A;  2PRE A;  3KKU A;  1YK7 A;  3RVX A;  1STF E;  2R9F A;  4QRV A;  5F02 A;  2HH5 A;  4YYQ A;  2E03 A;  4BSQ A;  1F2A A;  3MHS A;  2DJG B;  2FRQ A;  3BOW A;  1Q6K A;  4CDF B;  2DCB A;  4CDE B;  1GCB A;  1AU2 A;  3U8E A;  3HHA A;  2DZY A;  1CV8 A;  1KFX L;  2AS8 A;  1PCI A;  1EWP A;  2PAD A;  3IEJ A;  2E01 A;  3H8C A;  1GX3 A;  1MEM A;  1CSB B;  2FUD A;  3D9W A;  4YYS A;  2G8E A;  3AI8 A;  2YJC A;  2FO5 A;  4I07 A;  1POP A;  3CH3 X;  1SNK A;  3V6C A;  4P6E A;  1SP4 B;  2Y5B A;  4MZS A;  1DEU A;  2DCC A;  4I05 A;  2GHU A;  3NHE A;  1PBH A;  5CVO B;  3S3R A;  3BPF A;  4GUZ A;  2R6N A;  1NB3 A;  3CH2 X;  2OZ2 A;  2DCA A;  1CTE A;  1JQP A;  1ZIV A;  2AYO A;  3IOQ A;  5PAD A;  3RVW A;  2O6X A;  2YJ2 A;  3BPM A;  1PPP A;  1W4T A;  3BWK A;  5FPW A;  2AUZ A;  4FIP A;  1AYW A;  2IBI A;  2FYE A;  3ZUA A;  2XU1 A;  4I04 A;  2P7U A;  4FK5 A;  4ZUX U;  4MZO A;  2R9M A;  1YAL A;  1PAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...