4B55A

Crystal structure of the covalent adduct formed between mycobacterium marinum aryalamine n-acetyltransferase and phenyl vinyl ketone a derivative of piperidinols
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
273
structure length
273
Chain Sequence
LDLTGYLDRINYRGATDPTLDVLRDLVSAHTGAIAFENLDPLMGVPVDDLSAEALADKLVDRRRGGYCYEHNGLIGYVLAELGYRVRRLAGRVVWLAPPDAPTPAQTHTVLAVTFPGCQGPYLVDVGFGGMTPTAPLRLETGTVQQTALEPYRLDDRGDGLVLQAMVRDEWQALYEFSTLTRPQVDLRVGSWFVSTHPTSHFVTGLMAATVADDARWNLMGRNLAIHRRGGTEKILLEDAAAVVDTLGDRFGINVADVGERGRLEARIDKVCF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARYLAMINE N-ACETYLTRANSFERASE NAT
publication title Piperidinols that Show Anti-Tubercular Activity as Inhibitors of Arylamine N-Acetyltransferase: An Essential Enzyme for Mycobacterial Survival Inside Macrophages.
pubmed doi rcsb
source organism Mycobacterium marinum
molecule tags Transferase
total genus 83
structure length 273
sequence length 273
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2012-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 4b55A02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 4b55A01
1W4TA 4NV7A 4BGFA 2BSZA 3D9WA 4NV8A 4GUZA 3LTWA 1W5RA 1W6FA 2VFCA 2VFBA 1GX3A 4B55A 4C5PA 1E2TA
chains in the Genus database with same CATH superfamily
1SWDA 1NP4A 4BGFA 3PDFA 5EZ2A 1ZRYA 2X8TA 1DF8A 1UZ2X 1LDOA 3CKGA 1ZNHA 3STMX 5LKFA 4MISA 5FAZA 5F6ZA 4BVMA 3CR6A 5D8JA 3SLJA 2JGSA 3O22A 5CE4A 1STRB 2E4JA 2RTMA 1OBQA 3LHNA 4Z2VA 4O4XA 1LNMA 1LIEA 3C78X 3WJFA 3K3LA 4ORSA 1H91A 5LJKA 5HZ5A 1VWNB 2BS5A 1SRIA 3GE2A 4QGXA 5CSEA 2C1SA 1SWUA 3SAOA 1FENA 4EXZA 1KGLA 4GH7A 1VYGA 1ADLA 3B2HA 1OPBA 2OL6O 1SWOA 1VPRA 3KFFA 4GETA 4IAXA 2L67A 1HQPA 3STNA 3UEXA 2IJAA 2OY7A 3JSQA 5K06A 2X8SA 2FR2A 1U18A 3APXA 2POAA 4JGLA 3WZNA 1X8QA 3ZWEA 5LJHA 3I17A 1DZMA 4QGWA 4I3BA 1VWLB 4QAEA 5IRUA 3WZOA 4CPHA 3JS1A 3MX7A 4I6SA 1HMTA 1LELA 1X71A 2GH7A 1VWOB 3CBSA 4MVLA 5F1EA 1GGLA 4QGVA 2RN4A 4COTA 2WR6A 4Y0PA 1ERXA 3D97A 2YG2A 3ZQ3A 1E2TA 2QOMA 2FTBA 4OKAA 4L3RA 3BLGA 1VWRB 2Y32A 4IB8A 4O4SA 4O3YA 1SWGA 1SWCA 5IO5A 1ALBA 1JJUA 1I04A 4UU2A 3TZSA 1X89A 1OEEA 1LICA 4CK4A 4AZPA 1LIDA 1AVEA 4YGHA 3T1DA 1TW4A 4CDCA 1CBQA 3EYCA 3WZQA 4ZGUA 2WEWA 4AZNA 1GXAA 2HZQA 3AKNA 2FGSA 3HTYA 3FEPA 2KTDA 5HCCC 1MUPA 2MWHA 3VG7A 2R73A 2GTLO 1JJXA 3TGAA 2R74A 1NQNA 1GT5A 4GNWA 5FENA 1EPBA 3CQRA 1VWPB 4O49A 1EXSA 1MDCA 5FFHA 3NQKA 5IRWA 1MEPA 4QQ1A 2IZFB 1EPAA 1D2UA 1EQDA 2IFBA 4GJVA 1LF7A 4GKCA 4N7DA 4YKMA 1T8VA 1K24A 2RTQB 4Y0RA 3RY2A 3STKA 4AYHA 2G5LA 1N43A 3NQ9A 4IB7A 3WJCA 2XKLA 4ZCBA 5HZ9A 4KC8A 2QO4A 5IO6A 4CPIA 3ZW1A 2RTLA 1QY1A 1GKAB 4C5PA 1O1UA 5LKEA 3AEHA 1B56A 3FA9A 1NC9A 4CPEA 1VYFA 4Z28A 4BX5B 3NBXX 3SLOA 2W2AA 2RTOB 1HN2A 4GK9A 5HAEA 1OSPO 3NR3A 1UYNX 2MF6A 3QKGA 2A2GA 3RE6A 5H9KA 4D6BA 2OY5O 1ML7A 1N9MA 4MVKA 4ARHA 1RAVA 1P6PA 1VWAB 4IB6A 2G79A 1RXHA 3P02A 4FBOA 4GDAA 3RWXA 4TQ2A 1A2DA 4YMYA 2JU3A 2OVAA 2Y3EA 5D47A 1YUPA 1BSYA 5LJBA 1VWKB 2ACOA 1LCZA 4LQZA 2X45A 2OZQA 1K3BA 4YFPA 3NX2A 1PEEA 4IB9A 4OMWA 1HMRA 1S2PA 3RDSA 2HNXA 3AUMO 4FBRA 1QFVA 2OFBA 1VWBB 2QO5A 2AT6X 4O3WA 4WHIA 2PFRA 1CRBA 1QABE 2RD7C 3VGWA 2A3FX 2W2BA 1NQMA 4XMFA 5H8TA 5K68A 4AZRA 4CDEA 1QWDA 1W5RA 2DJGA 1FELA 2FS6A 2L9CA 2QCBA 4GZVA 4TLJA 4WFUA 4YDBA 3SZJA 1GT3A 2EU7X 3GAQA 2C4IA 3EM0A 4FBVA 4GGTA 2RTJA 1PTSA 2OL8O 2LBAA 4A60A 3WZPA 1KT3A 3PH6A 2GTLM 1RSUB 4NV8A 1LDQA 1SRHA 4HPCA 2RCQA 1Y53X 2JW1A 1E5PA 4LZVA 2OF9A 3CMPA 1BSQA 3FELA 1BBPA 4ORXA 1KT4A 1PBOA 4YKOA 3FDCA 3LV4A 2G7BA 2GC9A 1SLGB 3BY0A 1KZWA 3APVA 1SY3A 2C1QA 2HMBA 2PI3O 2QM9A 2X46A 3FEKA 4R0BA 2CM9A 2G78A 1SWTA 5CYBA 3NADA 2FHNX 3O2YA 4U9CA 4EFGA 3ZW0A 1X8UA 1WBIA 3T6LA 4Z27A 3MG5A 4CPHB 1JJJA 1HBPA 2X8FA 4B55A 1GM6A 1W4TA 4U8UN 1O1VA 1Y9TA 3PECA 4ALBA 5HTEA 2HLVA 2IZGB 4BX7A 2AT3X 3WBGA 1SMPI 1Y9LA 1E00A 3HWDA 3T6FA 4HPBA 2MHDA 2X55A 1XCAA 1FE3A 4XMDA 1N9YA 4TKJA 1JYDA 1AB0A 4XMEA 3SLTA 3NQ3A 4ZFXA 3ZI8A 2KT4B 3F6ZB 3HOEA 1BRPA 1SWEA 4YGZA 3NP1A 2A5BA 5FQ7E 3SOTA 1DV9A 2AT8X 2Z4HA 1ICNA 1VWFB 4FQBB 4OMXA 3VG2A 2K23A 4GDZA 4YH0A 1YWCA 3PEDA 1SXWA 1YP6A 2MJIA 3KFGA 5LJDA 5FQ6E 4KT5A 5HWZA 2HZRA 2WUTA 3SZHA 1EIOA 1JIWI 2QO6A 2AT0X 3WOVA 4QYPA 5HCEC 4IAWA 1BEBA 1IKJA 5B3MO 3C77X 1ZNDA 3BSZE 1TVQA 2ASNX 4LKPA 4QRLA 2OVSA 1VWHB 3UEVA 4ZGFA 5BVTA 5L3YA 3FLLA 4QYNA 1X8OA 4U46A 2RTIB 3ZW1B 2W2FA 3BX7A 3HOLA 3KFHA 2RTBB 4K19A 1LUQA 4AZMA 3APUA 3KZAA 1PBYA 4JHQA 3X00A 4HPAA 1A57A 3MM0A 2IZAA 2A8GA 3CKFA 4GU8A 2OFMX 2UZ2A 5EEDA 1PM1X 2KW1A 4NLJA 4HWMA 1SRJA 1I9HA 2I5VO 4TNNA 2RA6A 1SA8A 4Z2PA 2NNDA 1FEMA 1QY2A 1SXXA 3FW4A 1SLFB 1YWAA 2L5PA 2WSJA 3S5VA 5HZQA 1SREA 2RTKA 2ZAGA 3APWA 3D96A 4ZR2A 1KT6A 2F01A 3VG5A 1EUOA 1SWHA 2RTFB 3B2KA 4YBPA 3HWGA 4GD9A 2OF8A 5L8NA 1GT4A 1OEJA 2GJ5A 5F2BA 1LIFA 3ZW2A 4YCHA 2R56A 1FJ1E 2FHLA 2FRSA 3EC5A 5H9LA 4O3ZA 5DG4A 4DMOA 4Y59A 1A18A 1MX8A 1SWPA 2OVDA 4ZH6A 1N0SA 2A5CA 4CPFA 3DTQA 4CV7A 4ZHGA 2XSTA 2JMBA 3RDOA 4A1HA 3BU9A 1IW2A 1S7DA 4YBUA 2AH7X 3OD9A 3U03A 1EI5A 3NX1A 4XMHA 1JMXA 1SWJA 3PQSA 4PSQA 1JMZA 5B2AO 3S5XA 2NP1A 3WJEA 4BCSA 1X8NA 3ELXA 4U3QA 3BDRA 3FA6A 3RDMA 4ES7A 3T2XA 4NNSA 3KFIA 3LTWA 2AVIA 1DC9A 1W6FA 3P6FA 1T68X 4ORRA 1NGLA 4ORUA 3P6DA 1G85A 1ZNGA 5HBSA 4A1YA 1I05A 1KQXA 1G7NA 2X32A 3MVFA 4GJSA 1QFTA 5DPQA 5HA1A 3EW1A 1VWIB 3ZUIA 5HCDC 3WJDA 2WWPA 1AVGI 4O4OA 5BYPA 5D4AA 2OY1O 4BBOA 1SRFA 1KT7A 3BS2A 4GGRA 1LFOA 4IMNA 5F7GA 3VG6A 2M4LA 1AQBA 1JYJA 3FA8A 1CBSA 2CBSA 3IFBA 4AZOA 2WQAE 1GX9A 2Q2PA 3OBLA 4INNA 2AF5A 2LA7A 4KCAA 3RDUA 1EIIA 2WQ9A 1Y55X 1HBQA 2JOZA 2X34A 1L6MA 2OFAA 1BM5A 1B0OA 2MO5A 3ZW0B 1SRGA 4YDAA 3RDQA 3VE2A 3VHMA 2WEXA 2LBVA 3RDXA 3VPJE 1RXJA 4HPDA 4UU3A 5L8IA 2UYWA 1O8VA 3PP6A 5HZ8A 4LKTA 2RTCB 4HFOA 3UAQA 3EBKA 2A13A 4BX7B 4EEJA 1I06A 2LFOA 2VDFA 1IJ8A 5AQ6A 1IKEA 2RTAA 2DJFA 1QY0A 2QOSC 4QZUA 2BHVA 5IXGA 4AW8A 4U8UO 4OEMA 1STSB 1YP7A 2ANSA 3G7XA 4IBAA 1BJ7A 4D6AA 4ALOA 2OFRX 2A2UA 1BSOA 4A8ZA 4KH8A 1SWQA 1Y52X 3RZYA 5LJEA 3MBTA 4EDEA 4QZTA 1TOUA 1KT5A 3CBCA 4QNIA 1YIVA 4EKVA 1LPJA 1SLEB 1OPAA 1ZNKA 3FW5A 4RUUA 1SWFA 2IZJA 2FKJA 1CJ5A 2IZDB 3VU1A 5IRAA 2O62A 2X56A 1VWGB 2VFBA 5D48A 3F8AA 5EDCA 4O9SA 3B2JA 3WYQA 4I3DA 1KL3A 1LKEA 3FMZA 4GUZA 4KIIA 2FR3A 4NNTA 4ORWA 5CHKA 4AZQA 5KICA 2NNEA 2RTEB 2OYBO 2AMMX 3UEUA 3ZUOA 4I9SA 1VWCB 3O19A 4OELA 4NV7A 3P6EA 4IABA 1G5WA 4ML7B 1HY2A 1KFFA 4OS8A 4Y5DA 3U0DA 2RTPB 3EBWA 1SLDB 2FT9A 1KQWA 1D3SA 2CAMA 1ICMA 1SY1A 3EMMA 3UEWA 2F73A 2BLGA 4DNEA 2Q4NA 1U0XA 2Q39A 2Q9SA 3P24A 3E3CA 4CDFA 2PQTA 1DZKA 4GGZA 5AJCA 5B5FA 3PH5A 4I95A 4NP1A 3ZZVA 3Q6LA 3HPEA 2RCTA 4MEEA 4I3CA 3V8UA 4BX6A 3P6HA 3WJGA 1RXKA 2VFCA 2RTGB 1YWBA 3CQNA 3JQOA 1BRQA 5B27A 3B2LA 1SWLA 3AKMA 2PY1A 4I60A 1VWEB 2GTFX 4GE1A 4GRJA 2IZKA 5JD2A 3RY1A 2OVEA 4DQ3A 3DSZA 1JZUA 2BS6A 5B29A 2BSZA 1B8EA 1E06A 4CSBA 1KXOA 1QQSA 4TKBA 4ZHFA 1SWKA 2BC3A 5H9AA 1I4UA 1GX3A 1N4JA 3TF6A 5AEOA 5KIDA 1SWSA 1SY0A 5BVQA 3EW2A 4M7MA 4WFVA 3OE3A 4L1NA 2IZCB 2RTRB 3FR4A 1JV4A 1RBPA 4IRWA 1HXZA 1Z24A 4U8UM 1HMSA 2AT5X 4N7CA 4ON1A 4PJ2A 3BU1A 3KVNA 1KOIA 2K62A 3N91A 3P6GA 3PPTA 4XMCA 5EPQA 3RE5A 4O4UA 2RQ0A 3OJYC 4ZHDA 5KHPA 1HQQA 4NYQA 5B11O 4EQAC 3S60A 4YGGA 3FENA 5F6BA 1RLBE 2RTNB 4O3XB 1N7YA 1STPA 4GNYA 3S26A 5IO7A 1NDJA 3TGBA 1S44A 1ZNEA 1GT1A 2BT9A 3RKGA 2ACPX 5BVSA 4OS0A 3WJBA 5C0NA 2IZIA 3F9DA 1FDQA 4JO6A 5L8OA 2IZBA 1LCVA 1SWAA 1VWJB 2Q2MA 1WUBA 3HWEA 3NPOA 4Y0SA 1SXYA 4Z2OA 5HZ6A 3LNBA 4XMGA 4BJ8A 1IFBA 1LCWA 1VWMB 3VE1A 4DCBA 1SWRA 1QG5A 2CZTA 2ZAIA 1EALA 1SXUA 4JNJA 5H9NA 3VHIA 1JBHA 4NW4A 1IFCA 4ORYA 4IMOA 3RBYA 1I78A 3VG4A 1A3YA 1BWYA 2ZSCA 2G8CO 3BX8A 2HKDA 3T2WA 3U9PC 1IIUA 4MVIA 2AL0X 1G74A 1DZJA 1DFVA 2Z4IA 5AJBA 3WYPA 5LJCA 1NBXA 3WVMA 1OBUA 1B4MA 2AKQA 1VYOA 1TXLA 1XKIA 2X4MA 3Q34A 1NP1A 4BQUA 4NYRA 1MK5A 3FYFA 5JR8A 2JN3A 1MM9A 2ALLX 1ERBA 5HA0A 4YFRA 2CBRA 2GTLN 4ID2A 4TKHA 4YFQA 1GX8A 2I5ZO 1ZNLA 4YCEA 4DQ4A 3CWKA 1CBIA 2WPUA 3KQ0A 1X8PA 2YMSA 4Y0QA 3FR2A 5EEEA 3VG3A 4ZH9A 2JU7A 3FIQA 4OS3A 3FIDA 3C76X 1R0UA 1LIBA 1MOYA 1Y0GA 3H3IA 3P6CA 5F58A 5B5GA 2LB6A 5HTDA 3D4RA 2LKKA 2L68A 4ZHHA 1UYOX 2CM4A 2P8GA 1DF3A 4CDDA 1FTPA 2FS7A 3B2IA 3QQ2A 5B10O 1OEKA 3D95A 4M6SA 1KL5A 1CBRA 2MM3A 1AVDA 3I0AA 1E02A 2HYSA 1U17A 4TJZA 2NNQA 2IZEB 2RTHB 1SY2A 5FQ8E 3D9WA 4MIRA 1JQPA 2JU8A 1SWBA 3RSWA 3HWFA 4RUNA 1OBPA 3WXQA 1YWDA 2IZLB 2OY8A 3FA7A 5EDBA 4ZHCA 1GKAA 1BLRA 4Z6JA 4BX6B 3IA8A 1VWQB 3PK2A 3L4RA 4BX5A 4BOEA 2RTDB 1EW3A 2OL7A 2Y3FA 1RSTB 2FKGA 2FWVA 2KTSA 4YVBA 3PQUA 1KZXA 1HXLA 1PMPA 2N93A 4ODDA 4ZJ0A 5K67A 3ELZA 1MVGA 3BRNA 3VHHA 3FR5A 4WBKA 3SZIA 5LJGA 3TGCA 2F09A 4NLIA 2FLJA 1VWDB 4FGIB 1UREA 1MX7A 2CZUA 2DM5A 4LZUA 4I9RA 1DZPA 4MVEA 2KD2A 1KL4A 2QMIA 1AELA 1ACDA 3HK1A 1TOWA 5D45A 4KC7A 2IZHB 2A0AA 1T0VA 1SWNA
chains in the Genus database with same CATH topology
4BGFA 3PDFA 3HHAA 1EWMA 1QOLA 4P6EA 1GLOA 2HD5A 5K16A 3OISA 3PBHA 3P5VA 1CSBB 4X6IA 1AYWA 3N3KA 2FQ9A 3IUTA 1CVZA 2DCBA 2NQAA 1CJLA 2CB5A 2OZ2A 1PXVA 1ME4A 1VSNA 2BDZA 4Q8HA 1EWOA 1E2TA 1MHWA 2Y6EA 1ME3A 2OP3A 1AIMA 2E01A 3KWZA 1PPPA 1MIRA 4DMXA 2R9NA 4PI3A 4QH6A 2DCDA 1AU4A 3PW3A 2XU3A 3ZUAA 4CDDB 1AYVA 2DC8A 4QRGA 2G6DA 6PADA 2JQFR 3H8CA 1YALA 4PP2E 4I05A 4C5PA 2OULA 3GCBA 2R9FA 1BQIA 2VHFA 3M99A 2F7DA 1GMYA 1AYUA 1AU3A 2DZYA 1EWLA 1BGOA 2E02A 2DZZA 1CQDA 4YYSA 3BOWA 3P5XA 1THEA 1A6RA 3DF0A 4XR7A 1W5RA 8PCHA 3USVA 2FRQA 3H7DA 2E03A 2FO5A 3QSDA 3IOQA 4NV8A 1PPOA 3QJ3A 3S3QA 9PAPA 1U9WA 1KHQA 1O0EA 1AECA 1Y08A 2PADA 3HD3A 1U9QX 4B55A 1W4TA 4QRXA 4MSXA 5JH3A 2F1GA 3KW9A 4AXMA 4PP1A 2AVWA 1PCIA 4QBBA 2YJCA 1MDWA 3CBJA 4WA6A 1YK7A 1EF7A 4CDCB 2FT2A 2G8JA 5JA7A 3K8UA 4N4ZA 3OVXA 1ZIVA 4MZSA 3D6SA 2IPPB 3F5VA 3IMAA 2NQIA 2NQDB 1QMYA 2HXZA 1NB5A 1NLJA 2WBFX 2HH5A 1NB3A 3QT4A 5EGWA 5CVMA 1QXPA 1F2BA 1Y4HA 3MHSA 1MEGA 1S4VA 4XUIA 3HWNA 3WXEA 4RY2A 4K7CA 4YVAA 3E1ZB 3RVVA 2DC7A 4CZWA 2AU1A 4KLBA 5EF4A 1CPJA 1BY8A 3MHHA 4BS5A 1XKGA 3LFYA 1PADA 4W4UA 1ATKA 3KKUA 2ACTA 2CIOA 4G54A 1K3BB 2P86A 2YJBA 7PCKA 3BWKA 1NQCA 3WXFA 3P5UA 1KXRA 2AYNA 1BP4A 3N4CA 4YYUA 4CDEB 3BPMA 2G8EA 4I07A 4Q8GA 2DJGB 3V6EA 4PADA 2DC6A 3LTWA 1W6FA 3U8EA 3K9MA 1YT7A 2FTDA 2PNSA 4YYVA 2VHSA 2R9CA 1PE6A 3IHPA 4AXLA 3MORA 1MS6A 2DCAA 5CHTA 2IBIA 4X6JA 1PBHA 4FK5A 1DEUA 1KFUL 2YJ9A 5J94A 3NHEA 3F75A 4BSQA 3CBKA 2BDLA 1STFE 3IEJA 3H6SA 4W5BA 2R9OA 2DC9A 3OF8A 3KWBX 4OEMA 4YYQA 1CB5A 4FIPA 4BS6A 1U9XA 1CS8A 1NPZA 1Q6KA 4N79A 5A24A 1U9VA 3KFQA 3H89A 3ERVA 5CVOB 1HUCB 2NQGA 3OVZA 2VFBA 1IWDA 2AIMA 1ITOA 3I3TA 4GUZA 3OF9A 1MEMA 3KSEA 1YK8A 4OELA 2XU1A 1QDQA 4NV7A 3TNXA 1GCBA 1FH0A 2DCCA 3BPFA 1F29A 1AU2A 2FUDA 4X6HA 3WXGA 2AYOA 3P5WA 1TL9A 2FRAA 5CHVA 3I06A 2GHUA 2YJ8A 4HWYA 2VFCA 1POPA 2AUXA 2XU4A 3CH2X 2GFOA 3RVWA 5FPWA 2BSZA 2XU5A 3IV2A 1GX3A 1F2CA 2PREA 4YV8A 1YVBA 4W5CA 1KHPA 2H7JA 3B79A 3BC3A 2B1MA 1GECE 1U5IA 1EWPA 1X9YA 4N8WA 3C9EA 1M6DA 1SP4B 3O0UA 1VJVA 3KX1A 5F02A 2JQGR 2YJ2A 4QRVA 1PIPA 1ICFA 1TLOA 2C0YA 3O1GA 3S3RA 3K24A 1TU6A 3H8BA 2AUZA 1PPNA 2DJFB 2R9MA 4I04A 1KFXL 2P0RA 1CTEA 2O6XA 5CVNB 1AU0A 4P6GA 2FYEA 3N3GA 2ATOA 4BPVA 3V6CA 2HHNA 1DF0A 2B1NA 2E00A 3D9WA 1JQPA 3AI8A 3LXSA 4CDFB 4YYRA 3CH3X 3BCNA 1SNKA 3PNRA 2P7UA 4MZOA 2G7YA 4BQVA 2ARYA 2AS8A 1ZCMA 1F2AA 4YYWA 3RVXA 2Y5BA 4FJCA 3HHIA 2PBHA 4DMYA 1PPDA 1CV8A 5PADA 2R6NA 1NL6A 4ZUXU 3MTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W4T A;  4NV7 A;  4BGF A;  2BSZ A;  3D9W A;  4NV8 A;  4GUZ A;  3LTW A;  1W5R A;  1W6F A;  2VFC A;  2VFB A;  1GX3 A;  4B55 A;  4C5P A;  1E2T A; 
#chains in the Genus database with same CATH topology
 1SWD A;  1NP4 A;  4BGF A;  3PDF A;  5EZ2 A;  1ZRY A;  2X8T A;  1DF8 A;  1UZ2 X;  1LDO A;  3CKG A;  1ZNH A;  3STM X;  5LKF A;  4MIS A;  5FAZ A;  5F6Z A;  4BVM A;  3CR6 A;  5D8J A;  3SLJ A;  2JGS A;  3O22 A;  5CE4 A;  1STR B;  2E4J A;  2RTM A;  1OBQ A;  3LHN A;  4Z2V A;  4O4X A;  1LNM A;  1LIE A;  3C78 X;  3WJF A;  3K3L A;  4ORS A;  1H91 A;  5LJK A;  5HZ5 A;  1VWN B;  2BS5 A;  1SRI A;  3GE2 A;  4QGX A;  5CSE A;  2C1S A;  1SWU A;  3SAO A;  1FEN A;  4EXZ A;  1KGL A;  4GH7 A;  1VYG A;  1ADL A;  3B2H A;  1OPB A;  2OL6 O;  1SWO A;  1VPR A;  3KFF A;  4GET A;  4IAX A;  2L67 A;  1HQP A;  3STN A;  3UEX A;  2IJA A;  2OY7 A;  3JSQ A;  5K06 A;  2X8S A;  2FR2 A;  1U18 A;  3APX A;  2POA A;  4JGL A;  3WZN A;  1X8Q A;  3ZWE A;  5LJH A;  3I17 A;  1DZM A;  4QGW A;  4I3B A;  1VWL B;  4QAE A;  5IRU A;  3WZO A;  4CPH A;  3JS1 A;  3MX7 A;  4I6S A;  1HMT A;  1LEL A;  1X71 A;  2GH7 A;  1VWO B;  3CBS A;  4MVL A;  5F1E A;  1GGL A;  4QGV A;  2RN4 A;  4COT A;  2WR6 A;  4Y0P A;  1ERX A;  3D97 A;  2YG2 A;  3ZQ3 A;  1E2T A;  2QOM A;  2FTB A;  4OKA A;  4L3R A;  3BLG A;  1VWR B;  2Y32 A;  4IB8 A;  4O4S A;  4O3Y A;  1SWG A;  1SWC A;  5IO5 A;  1ALB A;  1JJU A;  1I04 A;  4UU2 A;  3TZS A;  1X89 A;  1OEE A;  1LIC A;  4CK4 A;  4AZP A;  1LID A;  1AVE A;  4YGH A;  3T1D A;  1TW4 A;  4CDC A;  1CBQ A;  3EYC A;  3WZQ A;  4ZGU A;  2WEW A;  4AZN A;  1GXA A;  2HZQ A;  3AKN A;  2FGS A;  3HTY A;  3FEP A;  2KTD A;  5HCC C;  1MUP A;  2MWH A;  3VG7 A;  2R73 A;  2GTL O;  1JJX A;  3TGA A;  2R74 A;  1NQN A;  1GT5 A;  4GNW A;  5FEN A;  1EPB A;  3CQR A;  1VWP B;  4O49 A;  1EXS A;  1MDC A;  5FFH A;  3NQK A;  5IRW A;  1MEP A;  4QQ1 A;  2IZF B;  1EPA A;  1D2U A;  1EQD A;  2IFB A;  4GJV A;  1LF7 A;  4GKC A;  4N7D A;  4YKM A;  1T8V A;  1K24 A;  2RTQ B;  4Y0R A;  3RY2 A;  3STK A;  4AYH A;  2G5L A;  1N43 A;  3NQ9 A;  4IB7 A;  3WJC A;  2XKL A;  4ZCB A;  5HZ9 A;  4KC8 A;  2QO4 A;  5IO6 A;  4CPI A;  3ZW1 A;  2RTL A;  1QY1 A;  1GKA B;  4C5P A;  1O1U A;  5LKE A;  3AEH A;  1B56 A;  3FA9 A;  1NC9 A;  4CPE A;  1VYF A;  4Z28 A;  4BX5 B;  3NBX X;  3SLO A;  2W2A A;  2RTO B;  1HN2 A;  4GK9 A;  5HAE A;  1OSP O;  3NR3 A;  1UYN X;  2MF6 A;  3QKG A;  2A2G A;  3RE6 A;  5H9K A;  4D6B A;  2OY5 O;  1ML7 A;  1N9M A;  4MVK A;  4ARH A;  1RAV A;  1P6P A;  1VWA B;  4IB6 A;  2G79 A;  1RXH A;  3P02 A;  4FBO A;  4GDA A;  3RWX A;  4TQ2 A;  1A2D A;  4YMY A;  2JU3 A;  2OVA A;  2Y3E A;  5D47 A;  1YUP A;  1BSY A;  5LJB A;  1VWK B;  2ACO A;  1LCZ A;  4LQZ A;  2X45 A;  2OZQ A;  1K3B A;  4YFP A;  3NX2 A;  1PEE A;  4IB9 A;  4OMW A;  1HMR A;  1S2P A;  3RDS A;  2HNX A;  3AUM O;  4FBR A;  1QFV A;  2OFB A;  1VWB B;  2QO5 A;  2AT6 X;  4O3W A;  4WHI A;  2PFR A;  1CRB A;  1QAB E;  2RD7 C;  3VGW A;  2A3F X;  2W2B A;  1NQM A;  4XMF A;  5H8T A;  5K68 A;  4AZR A;  4CDE A;  1QWD A;  1W5R A;  2DJG A;  1FEL A;  2FS6 A;  2L9C A;  2QCB A;  4GZV A;  4TLJ A;  4WFU A;  4YDB A;  3SZJ A;  1GT3 A;  2EU7 X;  3GAQ A;  2C4I A;  3EM0 A;  4FBV A;  4GGT A;  2RTJ A;  1PTS A;  2OL8 O;  2LBA A;  4A60 A;  3WZP A;  1KT3 A;  3PH6 A;  2GTL M;  1RSU B;  4NV8 A;  1LDQ A;  1SRH A;  4HPC A;  2RCQ A;  1Y53 X;  2JW1 A;  1E5P A;  4LZV A;  2OF9 A;  3CMP A;  1BSQ A;  3FEL A;  1BBP A;  4ORX A;  1KT4 A;  1PBO A;  4YKO A;  3FDC A;  3LV4 A;  2G7B A;  2GC9 A;  1SLG B;  3BY0 A;  1KZW A;  3APV A;  1SY3 A;  2C1Q A;  2HMB A;  2PI3 O;  2QM9 A;  2X46 A;  3FEK A;  4R0B A;  2CM9 A;  2G78 A;  1SWT A;  5CYB A;  3NAD A;  2FHN X;  3O2Y A;  4U9C A;  4EFG A;  3ZW0 A;  1X8U A;  1WBI A;  3T6L A;  4Z27 A;  3MG5 A;  4CPH B;  1JJJ A;  1HBP A;  2X8F A;  4B55 A;  1GM6 A;  1W4T A;  4U8U N;  1O1V A;  1Y9T A;  3PEC A;  4ALB A;  5HTE A;  2HLV A;  2IZG B;  4BX7 A;  2AT3 X;  3WBG A;  1SMP I;  1Y9L A;  1E00 A;  3HWD A;  3T6F A;  4HPB A;  2MHD A;  2X55 A;  1XCA A;  1FE3 A;  4XMD A;  1N9Y A;  4TKJ A;  1JYD A;  1AB0 A;  4XME A;  3SLT A;  3NQ3 A;  4ZFX A;  3ZI8 A;  2KT4 B;  3F6Z B;  3HOE A;  1BRP A;  1SWE A;  4YGZ A;  3NP1 A;  2A5B A;  5FQ7 E;  3SOT A;  1DV9 A;  2AT8 X;  2Z4H A;  1ICN A;  1VWF B;  4FQB B;  4OMX A;  3VG2 A;  2K23 A;  4GDZ A;  4YH0 A;  1YWC A;  3PED A;  1SXW A;  1YP6 A;  2MJI A;  3KFG A;  5LJD A;  5FQ6 E;  4KT5 A;  5HWZ A;  2HZR A;  2WUT A;  3SZH A;  1EIO A;  1JIW I;  2QO6 A;  2AT0 X;  3WOV A;  4QYP A;  5HCE C;  4IAW A;  1BEB A;  1IKJ A;  5B3M O;  3C77 X;  1ZND A;  3BSZ E;  1TVQ A;  2ASN X;  4LKP A;  4QRL A;  2OVS A;  1VWH B;  3UEV A;  4ZGF A;  5BVT A;  5L3Y A;  3FLL A;  4QYN A;  1X8O A;  4U46 A;  2RTI B;  3ZW1 B;  2W2F A;  3BX7 A;  3HOL A;  3KFH A;  2RTB B;  4K19 A;  1LUQ A;  4AZM A;  3APU A;  3KZA A;  1PBY A;  4JHQ A;  3X00 A;  4HPA A;  1A57 A;  3MM0 A;  2IZA A;  2A8G A;  3CKF A;  4GU8 A;  2OFM X;  2UZ2 A;  5EED A;  1PM1 X;  2KW1 A;  4NLJ A;  4HWM A;  1SRJ A;  1I9H A;  2I5V O;  4TNN A;  2RA6 A;  1SA8 A;  4Z2P A;  2NND A;  1FEM A;  1QY2 A;  1SXX A;  3FW4 A;  1SLF B;  1YWA A;  2L5P A;  2WSJ A;  3S5V A;  5HZQ A;  1SRE A;  2RTK A;  2ZAG A;  3APW A;  3D96 A;  4ZR2 A;  1KT6 A;  2F01 A;  3VG5 A;  1EUO A;  1SWH A;  2RTF B;  3B2K A;  4YBP A;  3HWG A;  4GD9 A;  2OF8 A;  5L8N A;  1GT4 A;  1OEJ A;  2GJ5 A;  5F2B A;  1LIF A;  3ZW2 A;  4YCH A;  2R56 A;  1FJ1 E;  2FHL A;  2FRS A;  3EC5 A;  5H9L A;  4O3Z A;  5DG4 A;  4DMO A;  4Y59 A;  1A18 A;  1MX8 A;  1SWP A;  2OVD A;  4ZH6 A;  1N0S A;  2A5C A;  4CPF A;  3DTQ A;  4CV7 A;  4ZHG A;  2XST A;  2JMB A;  3RDO A;  4A1H A;  3BU9 A;  1IW2 A;  1S7D A;  4YBU A;  2AH7 X;  3OD9 A;  3U03 A;  1EI5 A;  3NX1 A;  4XMH A;  1JMX A;  1SWJ A;  3PQS A;  4PSQ A;  1JMZ A;  5B2A O;  3S5X A;  2NP1 A;  3WJE A;  4BCS A;  1X8N A;  3ELX A;  4U3Q A;  3BDR A;  3FA6 A;  3RDM A;  4ES7 A;  3T2X A;  4NNS A;  3KFI A;  3LTW A;  2AVI A;  1DC9 A;  1W6F A;  3P6F A;  1T68 X;  4ORR A;  1NGL A;  4ORU A;  3P6D A;  1G85 A;  1ZNG A;  5HBS A;  4A1Y A;  1I05 A;  1KQX A;  1G7N A;  2X32 A;  3MVF A;  4GJS A;  1QFT A;  5DPQ A;  5HA1 A;  3EW1 A;  1VWI B;  3ZUI A;  5HCD C;  3WJD A;  2WWP A;  1AVG I;  4O4O A;  5BYP A;  5D4A A;  2OY1 O;  4BBO A;  1SRF A;  1KT7 A;  3BS2 A;  4GGR A;  1LFO A;  4IMN A;  5F7G A;  3VG6 A;  2M4L A;  1AQB A;  1JYJ A;  3FA8 A;  1CBS A;  2CBS A;  3IFB A;  4AZO A;  2WQA E;  1GX9 A;  2Q2P A;  3OBL A;  4INN A;  2AF5 A;  2LA7 A;  4KCA A;  3RDU A;  1EII A;  2WQ9 A;  1Y55 X;  1HBQ A;  2JOZ A;  2X34 A;  1L6M A;  2OFA A;  1BM5 A;  1B0O A;  2MO5 A;  3ZW0 B;  1SRG A;  4YDA A;  3RDQ A;  3VE2 A;  3VHM A;  2WEX A;  2LBV A;  3RDX A;  3VPJ E;  1RXJ A;  4HPD A;  4UU3 A;  5L8I A;  2UYW A;  1O8V A;  3PP6 A;  5HZ8 A;  4LKT A;  2RTC B;  4HFO A;  3UAQ A;  3EBK A;  2A13 A;  4BX7 B;  4EEJ A;  1I06 A;  2LFO A;  2VDF A;  1IJ8 A;  5AQ6 A;  1IKE A;  2RTA A;  2DJF A;  1QY0 A;  2QOS C;  4QZU A;  2BHV A;  5IXG A;  4AW8 A;  4U8U O;  4OEM A;  1STS B;  1YP7 A;  2ANS A;  3G7X A;  4IBA A;  1BJ7 A;  4D6A A;  4ALO A;  2OFR X;  2A2U A;  1BSO A;  4A8Z A;  4KH8 A;  1SWQ A;  1Y52 X;  3RZY A;  5LJE A;  3MBT A;  4EDE A;  4QZT A;  1TOU A;  1KT5 A;  3CBC A;  4QNI A;  1YIV A;  4EKV A;  1LPJ A;  1SLE B;  1OPA A;  1ZNK A;  3FW5 A;  4RUU A;  1SWF A;  2IZJ A;  2FKJ A;  1CJ5 A;  2IZD B;  3VU1 A;  5IRA A;  2O62 A;  2X56 A;  1VWG B;  2VFB A;  5D48 A;  3F8A A;  5EDC A;  4O9S A;  3B2J A;  3WYQ A;  4I3D A;  1KL3 A;  1LKE A;  3FMZ A;  4GUZ A;  4KII A;  2FR3 A;  4NNT A;  4ORW A;  5CHK A;  4AZQ A;  5KIC A;  2NNE A;  2RTE B;  2OYB O;  2AMM X;  3UEU A;  3ZUO A;  4I9S A;  1VWC B;  3O19 A;  4OEL A;  4NV7 A;  3P6E A;  4IAB A;  1G5W A;  4ML7 B;  1HY2 A;  1KFF A;  4OS8 A;  4Y5D A;  3U0D A;  2RTP B;  3EBW A;  1SLD B;  2FT9 A;  1KQW A;  1D3S A;  2CAM A;  1ICM A;  1SY1 A;  3EMM A;  3UEW A;  2F73 A;  2BLG A;  4DNE A;  2Q4N A;  1U0X A;  2Q39 A;  2Q9S A;  3P24 A;  3E3C A;  4CDF A;  2PQT A;  1DZK A;  4GGZ A;  5AJC A;  5B5F A;  3PH5 A;  4I95 A;  4NP1 A;  3ZZV A;  3Q6L A;  3HPE A;  2RCT A;  4MEE A;  4I3C A;  3V8U A;  4BX6 A;  3P6H A;  3WJG A;  1RXK A;  2VFC A;  2RTG B;  1YWB A;  3CQN A;  3JQO A;  1BRQ A;  5B27 A;  3B2L A;  1SWL A;  3AKM A;  2PY1 A;  4I60 A;  1VWE B;  2GTF X;  4GE1 A;  4GRJ A;  2IZK A;  5JD2 A;  3RY1 A;  2OVE A;  4DQ3 A;  3DSZ A;  1JZU A;  2BS6 A;  5B29 A;  2BSZ A;  1B8E A;  1E06 A;  4CSB A;  1KXO A;  1QQS A;  4TKB A;  4ZHF A;  1SWK A;  2BC3 A;  5H9A A;  1I4U A;  1GX3 A;  1N4J A;  3TF6 A;  5AEO A;  5KID A;  1SWS A;  1SY0 A;  5BVQ A;  3EW2 A;  4M7M A;  4WFV A;  3OE3 A;  4L1N A;  2IZC B;  2RTR B;  3FR4 A;  1JV4 A;  1RBP A;  4IRW A;  1HXZ A;  1Z24 A;  4U8U M;  1HMS A;  2AT5 X;  4N7C A;  4ON1 A;  4PJ2 A;  3BU1 A;  3KVN A;  1KOI A;  2K62 A;  3N91 A;  3P6G A;  3PPT A;  4XMC A;  5EPQ A;  3RE5 A;  4O4U A;  2RQ0 A;  3OJY C;  4ZHD A;  5KHP A;  1HQQ A;  4NYQ A;  5B11 O;  4EQA C;  3S60 A;  4YGG A;  3FEN A;  5F6B A;  1RLB E;  2RTN B;  4O3X B;  1N7Y A;  1STP A;  4GNY A;  3S26 A;  5IO7 A;  1NDJ A;  3TGB A;  1S44 A;  1ZNE A;  1GT1 A;  2BT9 A;  3RKG A;  2ACP X;  5BVS A;  4OS0 A;  3WJB A;  5C0N A;  2IZI A;  3F9D A;  1FDQ A;  4JO6 A;  5L8O A;  2IZB A;  1LCV A;  1SWA A;  1VWJ B;  2Q2M A;  1WUB A;  3HWE A;  3NPO A;  4Y0S A;  1SXY A;  4Z2O A;  5HZ6 A;  3LNB A;  4XMG A;  4BJ8 A;  1IFB A;  1LCW A;  1VWM B;  3VE1 A;  4DCB A;  1SWR A;  1QG5 A;  2CZT A;  2ZAI A;  1EAL A;  1SXU A;  4JNJ A;  5H9N A;  3VHI A;  1JBH A;  4NW4 A;  1IFC A;  4ORY A;  4IMO A;  3RBY A;  1I78 A;  3VG4 A;  1A3Y A;  1BWY A;  2ZSC A;  2G8C O;  3BX8 A;  2HKD A;  3T2W A;  3U9P C;  1IIU A;  4MVI A;  2AL0 X;  1G74 A;  1DZJ A;  1DFV A;  2Z4I A;  5AJB A;  3WYP A;  5LJC A;  1NBX A;  3WVM A;  1OBU A;  1B4M A;  2AKQ A;  1VYO A;  1TXL A;  1XKI A;  2X4M A;  3Q34 A;  1NP1 A;  4BQU A;  4NYR A;  1MK5 A;  3FYF A;  5JR8 A;  2JN3 A;  1MM9 A;  2ALL X;  1ERB A;  5HA0 A;  4YFR A;  2CBR A;  2GTL N;  4ID2 A;  4TKH A;  4YFQ A;  1GX8 A;  2I5Z O;  1ZNL A;  4YCE A;  4DQ4 A;  3CWK A;  1CBI A;  2WPU A;  3KQ0 A;  1X8P A;  2YMS A;  4Y0Q A;  3FR2 A;  5EEE A;  3VG3 A;  4ZH9 A;  2JU7 A;  3FIQ A;  4OS3 A;  3FID A;  3C76 X;  1R0U A;  1LIB A;  1MOY A;  1Y0G A;  3H3I A;  3P6C A;  5F58 A;  5B5G A;  2LB6 A;  5HTD A;  3D4R A;  2LKK A;  2L68 A;  4ZHH A;  1UYO X;  2CM4 A;  2P8G A;  1DF3 A;  4CDD A;  1FTP A;  2FS7 A;  3B2I A;  3QQ2 A;  5B10 O;  1OEK A;  3D95 A;  4M6S A;  1KL5 A;  1CBR A;  2MM3 A;  1AVD A;  3I0A A;  1E02 A;  2HYS A;  1U17 A;  4TJZ A;  2NNQ A;  2IZE B;  2RTH B;  1SY2 A;  5FQ8 E;  3D9W A;  4MIR A;  1JQP A;  2JU8 A;  1SWB A;  3RSW A;  3HWF A;  4RUN A;  1OBP A;  3WXQ A;  1YWD A;  2IZL B;  2OY8 A;  3FA7 A;  5EDB A;  4ZHC A;  1GKA A;  1BLR A;  4Z6J A;  4BX6 B;  3IA8 A;  1VWQ B;  3PK2 A;  3L4R A;  4BX5 A;  4BOE A;  2RTD B;  1EW3 A;  2OL7 A;  2Y3F A;  1RST B;  2FKG A;  2FWV A;  2KTS A;  4YVB A;  3PQU A;  1KZX A;  1HXL A;  1PMP A;  2N93 A;  4ODD A;  4ZJ0 A;  5K67 A;  3ELZ A;  1MVG A;  3BRN A;  3VHH A;  3FR5 A;  4WBK A;  3SZI A;  5LJG A;  3TGC A;  2F09 A;  4NLI A;  2FLJ A;  1VWD B;  4FGI B;  1URE A;  1MX7 A;  2CZU A;  2DM5 A;  4LZU A;  4I9R A;  1DZP A;  4MVE A;  2KD2 A;  1KL4 A;  2QMI A;  1AEL A;  1ACD A;  3HK1 A;  1TOW A;  5D45 A;  4KC7 A;  2IZH B;  2A0A A;  1T0V A;  1SWN A; 
#chains in the Genus database with same CATH homology
 4BGF A;  3PDF A;  3HHA A;  1EWM A;  1QOL A;  4P6E A;  1GLO A;  2HD5 A;  5K16 A;  3OIS A;  3PBH A;  3P5V A;  1CSB B;  4X6I A;  1AYW A;  3N3K A;  2FQ9 A;  3IUT A;  1CVZ A;  2DCB A;  2NQA A;  1CJL A;  2CB5 A;  2OZ2 A;  1PXV A;  1ME4 A;  1VSN A;  2BDZ A;  4Q8H A;  1EWO A;  1E2T A;  1MHW A;  2Y6E A;  1ME3 A;  2OP3 A;  1AIM A;  2E01 A;  3KWZ A;  1PPP A;  1MIR A;  4DMX A;  2R9N A;  4PI3 A;  4QH6 A;  2DCD A;  1AU4 A;  3PW3 A;  2XU3 A;  3ZUA A;  4CDD B;  1AYV A;  2DC8 A;  4QRG A;  2G6D A;  6PAD A;  2JQF R;  3H8C A;  1YAL A;  4PP2 E;  4I05 A;  4C5P A;  2OUL A;  3GCB A;  2R9F A;  1BQI A;  2VHF A;  3M99 A;  2F7D A;  1GMY A;  1AYU A;  1AU3 A;  2DZY A;  1EWL A;  1BGO A;  2E02 A;  2DZZ A;  1CQD A;  4YYS A;  3BOW A;  3P5X A;  1THE A;  1A6R A;  3DF0 A;  4XR7 A;  1W5R A;  8PCH A;  3USV A;  2FRQ A;  3H7D A;  2E03 A;  2FO5 A;  3QSD A;  3IOQ A;  4NV8 A;  1PPO A;  3QJ3 A;  3S3Q A;  9PAP A;  1U9W A;  1KHQ A;  1O0E A;  1AEC A;  1Y08 A;  2PAD A;  3HD3 A;  1U9Q X;  4B55 A;  1W4T A;  4QRX A;  4MSX A;  5JH3 A;  2F1G A;  3KW9 A;  4AXM A;  4PP1 A;  2AVW A;  1PCI A;  4QBB A;  2YJC A;  1MDW A;  3CBJ A;  4WA6 A;  1YK7 A;  1EF7 A;  4CDC B;  2FT2 A;  2G8J A;  5JA7 A;  3K8U A;  4N4Z A;  3OVX A;  1ZIV A;  4MZS A;  3D6S A;  2IPP B;  3F5V A;  3IMA A;  2NQI A;  2NQD B;  1QMY A;  2HXZ A;  1NB5 A;  1NLJ A;  2WBF X;  2HH5 A;  1NB3 A;  3QT4 A;  5EGW A;  5CVM A;  1QXP A;  1F2B A;  1Y4H A;  3MHS A;  1MEG A;  1S4V A;  4XUI A;  3HWN A;  3WXE A;  4RY2 A;  4K7C A;  4YVA A;  3E1Z B;  3RVV A;  2DC7 A;  4CZW A;  2AU1 A;  4KLB A;  5EF4 A;  1CPJ A;  1BY8 A;  3MHH A;  4BS5 A;  1XKG A;  3LFY A;  1PAD A;  4W4U A;  1ATK A;  3KKU A;  2ACT A;  2CIO A;  4G54 A;  1K3B B;  2P86 A;  2YJB A;  7PCK A;  3BWK A;  1NQC A;  3WXF A;  3P5U A;  1KXR A;  2AYN A;  1BP4 A;  3N4C A;  4YYU A;  4CDE B;  3BPM A;  2G8E A;  4I07 A;  4Q8G A;  2DJG B;  3V6E A;  4PAD A;  2DC6 A;  3LTW A;  1W6F A;  3U8E A;  3K9M A;  1YT7 A;  2FTD A;  2PNS A;  4YYV A;  2VHS A;  2R9C A;  1PE6 A;  3IHP A;  4AXL A;  3MOR A;  1MS6 A;  2DCA A;  5CHT A;  2IBI A;  4X6J A;  1PBH A;  4FK5 A;  1DEU A;  1KFU L;  2YJ9 A;  5J94 A;  3NHE A;  3F75 A;  4BSQ A;  3CBK A;  2BDL A;  1STF E;  3IEJ A;  3H6S A;  4W5B A;  2R9O A;  2DC9 A;  3OF8 A;  3KWB X;  4OEM A;  4YYQ A;  1CB5 A;  4FIP A;  4BS6 A;  1U9X A;  1CS8 A;  1NPZ A;  1Q6K A;  4N79 A;  5A24 A;  1U9V A;  3KFQ A;  3H89 A;  3ERV A;  5CVO B;  1HUC B;  2NQG A;  3OVZ A;  2VFB A;  1IWD A;  2AIM A;  1ITO A;  3I3T A;  4GUZ A;  3OF9 A;  1MEM A;  3KSE A;  1YK8 A;  4OEL A;  2XU1 A;  1QDQ A;  4NV7 A;  3TNX A;  1GCB A;  1FH0 A;  2DCC A;  3BPF A;  1F29 A;  1AU2 A;  2FUD A;  4X6H A;  3WXG A;  2AYO A;  3P5W A;  1TL9 A;  2FRA A;  5CHV A;  3I06 A;  2GHU A;  2YJ8 A;  4HWY A;  2VFC A;  1POP A;  2AUX A;  2XU4 A;  3CH2 X;  2GFO A;  3RVW A;  5FPW A;  2BSZ A;  2XU5 A;  3IV2 A;  1GX3 A;  1F2C A;  2PRE A;  4YV8 A;  1YVB A;  4W5C A;  1KHP A;  2H7J A;  3B79 A;  3BC3 A;  2B1M A;  1GEC E;  1U5I A;  1EWP A;  1X9Y A;  4N8W A;  3C9E A;  1M6D A;  1SP4 B;  3O0U A;  1VJV A;  3KX1 A;  5F02 A;  2JQG R;  2YJ2 A;  4QRV A;  1PIP A;  1ICF A;  1TLO A;  2C0Y A;  3O1G A;  3S3R A;  3K24 A;  1TU6 A;  3H8B A;  2AUZ A;  1PPN A;  2DJF B;  2R9M A;  4I04 A;  1KFX L;  2P0R A;  1CTE A;  2O6X A;  5CVN B;  1AU0 A;  4P6G A;  2FYE A;  3N3G A;  2ATO A;  4BPV A;  3V6C A;  2HHN A;  1DF0 A;  2B1N A;  2E00 A;  3D9W A;  1JQP A;  3AI8 A;  3LXS A;  4CDF B;  4YYR A;  3CH3 X;  3BCN A;  1SNK A;  3PNR A;  2P7U A;  4MZO A;  2G7Y A;  4BQV A;  2ARY A;  2AS8 A;  1ZCM A;  1F2A A;  4YYW A;  3RVX A;  2Y5B A;  4FJC A;  3HHI A;  2PBH A;  4DMY A;  1PPD A;  1CV8 A;  5PAD A;  2R6N A;  1NL6 A;  4ZUX U;  3MTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...