4B55A

Crystal structure of the covalent adduct formed between mycobacterium marinum aryalamine n-acetyltransferase and phenyl vinyl ketone a derivative of piperidinols
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
273
structure length
273
Chain Sequence
b'LDLTGYLDRINYRGATDPTLDVLRDLVSAHTGAIAFENLDPLMGVPVDDLSAEALADKLVDRRRGGYCYEHNGLIGYVLAELGYRVRRLAGRVVWLAPPDAPTPAQTHTVLAVTFPGCQGPYLVDVGFGGMTPTAPLRLETGTVQQTALEPYRLDDRGDGLVLQAMVRDEWQALYEFSTLTRPQVDLRVGSWFVSTHPTSHFVTGLMAATVADDARWNLMGRNLAIHRRGGTEKILLEDAAAVVDTLGDRFGINVADVGERGRLEARIDKVCF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARYLAMINE N-ACETYLTRANSFERASE NAT
molecule tags Transferase
source organism Mycobacterium marinum
publication title Piperidinols that Show Anti-Tubercular Activity as Inhibitors of Arylamine N-Acetyltransferase: An Essential Enzyme for Mycobacterial Survival Inside Macrophages.
pubmed doi rcsb
total genus 83
structure length 273
sequence length 273
ec nomenclature ec 2.3.1.5: Arylamine N-acetyltransferase.
pdb deposition date 2012-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 4b55A02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 4b55A01
1GX3A 1E2TA 4GUZA 1W5RA 1W4TA 2VFCA 3LTWA 2BSZA 4NV7A 4C5PA 4B55A 3D9WA 4NV8A 1W6FA 4BGFA 2VFBA
chains in the Genus database with same CATH superfamily
3V8UA 1E5PA 1VPRA 5LJHA 2HYSA 1B0OA 5EEDA 4ZHFA 2HLVA 1YUPA 4ZCBA 5HTEA 2HZQA 2MO5A 4UU3A 4YKMA 2FTBA 2X32A 3EBWA 4GJVA 1VWJB 3VG2A 5KICA 4ON1A 1SLGB 4UU2A 2F09A 2WEXA 4A1HA 2A2GA 2FLJA 2GTLN 4L3RA 4NLJA 3RDUA 1KQWA 2WWPA 2WQAE 1B56A 1W5RA 2E4JA 4IABA 1VWOB 1YWBA 1LIBA 2KW1A 5FQ6E 3T6FA 4FBVA 3APVA 3GAQA 4AYHA 4GNYA 2FGSA 3AEHA 3S5VA 5IO5A 4IAXA 1Y0GA 4GUZA 3VE2A 3ZW1A 4C5PA 2CBRA 5HZ5A 3U0DA 2AT3X 4GU8A 2IZGB 2KTSA 4CPFA 4NLIA 1GT4A 3FW4A 5LJEA 2JOZA 3OJYC 5D47A 4O3XB 3VHHA 3PP6A 4ES7A 2CZUA 2PFRA 2IZFB 2L67A 3UAQA 4DQ4A 1I4UA 1GT1A 2VFBA 4DMOA 4O3ZA 1SWGA 3BU1A 1I78A 2IZJA 1Y9LA 4U3QA 2OL8O 1Y52X 4YFQA 1W4TA 2XSTA 4IB8A 2DJGA 1GT3A 3U03A 2IJAA 2PQTA 1HMTA 1VWRB 3WJCA 3UEVA 5LJGA 3ZW0A 1ZNLA 2OF8A 1BJ7A 4MVIA 5DPQA 3NADA 3QKGA 5H9AA 4KH8A 5KIDA 1SXWA 3C76X 4NYQA 1ACDA 2EU7X 1EIOA 4JHQA 2LKKA 2X56A 1ZNKA 1PM1X 2A5BA 3QQ2A 5FQ7E 3BY0A 5C0NA 3NR3A 1SY3A 4MVEA 2Y3EA 1KZXA 3MM0A 4ORYA 3N91A 2OVEA 5HCDC 5LJCA 1STRB 3D96A 5H9NA 4QYNA 3ZZVA 1FEMA 1AQBA 2K23A 1ICNA 3LHNA 4ML7B 2R73A 3HWEA 1O1VA 4IAWA 2I5VO 4IMOA 1GM6A 4MISA 2QO6A 3NP1A 4JGLA 1X8OA 1SRIA 3RDQA 2RTOB 1HN2A 3TGAA 2WSJA 1VWGB 3ELXA 4QZUA 3BLGA 3I0AA 3ZI8A 1MOYA 3ZUIA 3BRNA 1LCWA 2OFMX 1OEEA 4BX7B 4WFVA 4PJ2A 2DM5A 4Y59A 2AH7X 2C1SA 1BSOA 3CBSA 3FA6A 1E06A 4XMHA 1SMPI 1I9HA 4QNIA 3B2IA 4HFOA 1JMZA 2BS6A 3FENA 3RDXA 1KT5A 4ID2A 3VG3A 4A60A 5HTDA 5BVSA 3CWKA 1T8VA 2ZAIA 5B2AO 4ZGFA 1U0XA 4LQZA 4CSBA 1N43A 1X71A 5CYBA 1IJ8A 3ELZA 4OMWA 4GGTA 5AJCA 5B3MO 4CDFA 2HZRA 4OKAA 4Z28A 4ORUA 2ACPX 1VYOA 2HNXA 3NX1A 1CJ5A 2X55A 4RUNA 4OS3A 3P6EA 5IRUA 3MX7A 3VG6A 1NQNA 4A8ZA 2QM9A 3BDRA 5FAZA 3BS2A 2HKDA 4EXZA 2RTNB 2OL6O 2OYBO 3FR2A 2GTLM 4I3BA 4IMNA 2G7BA 3UEUA 1SRFA 5HCCC 5HWZA 5K67A 3OD9A 1Z24A 5EDBA 3PDFA 1VWFB 5F1EA 1VYGA 1HXZA 5K68A 1IIUA 4FGIB 2ACOA 1N4JA 2NNEA 5BVQA 3STMX 1KOIA 2X4MA 2Q9SA 4YFRA 1KT4A 1BLRA 2WEWA 2NP1A 1VYFA 3WBGA 1RSTB 2FS6A 2A3FX 3RSWA 3EC5A 3Q6LA 2GTLO 1FJ1E 4U8UN 4YBUA 3FDCA 3UEXA 2FS7A 1MK5A 1MM9A 2RTGB 4HPAA 2RTAA 4INNA 4O49A 4ORWA 1SWUA 3C78X 3WZPA 2CM4A 1IFBA 3F9DA 4QGXA 2LB6A 3RY1A 5D48A 3D4RA 1SLEB 2AT6X 4KT5A 4XMFA 3RE5A 1B8EA 1S44A 1LELA 3PQUA 2AL0X 3FA8A 1ICMA 1YWDA 1QABE 4YMYA 3I17A 3PH5A 2G79A 4TNNA 1KXOA 2BHVA 1KQXA 2VFCA 4IB9A 4DQ3A 1UZ2X 2X34A 1CBSA 1SRHA 1SWJA 1SWTA 3DSZA 3OE3A 4ZR2A 3SZHA 3T2WA 3WVMA 1SWQA 1OSPO 4EQAC 2QMIA 1HMRA 5IO6A 1E2TA 2CM9A 1PTSA 4ZHCA 2GH7A 1ERXA 4PSQA 4NNTA 2RD7C 4HWMA 5EZ2A 1CBQA 5AQ6A 5F7GA 3EYCA 1QWDA 3HTYA 1RBPA 1SWSA 1AVGI 1AB0A 4YGZA 3FIQA 1X8PA 5HZ9A 5F58A 1B4MA 2KD2A 3EM0A 2G78A 2WR6A 1OBPA 3VGWA 4FQBB 4GETA 2RTDB 2AT0X 2A5CA 2GJ5A 5B10O 1MX8A 4B55A 1X89A 3KFGA 1TVQA 1VWBB 1S2PA 1RXKA 1EQDA 1KGLA 1VWEB 2ZSCA 5K06A 1JIWI 4XMEA 4DNEA 3KQ0A 2XKLA 1DZPA 1JZUA 3H3IA 2GC9A 4U8UM 3AKNA 3WZQA 4BGFA 1HQPA 3TGCA 4TJZA 3APWA 2RTJA 1RSUB 1VWIB 4KC7A 3ZQ3A 5BVTA 5JR8A 4GKCA 1JJXA 1SWNA 2X8SA 2G5LA 2VDFA 1FTPA 4M6SA 1SWCA 1YIVA 3CQRA 4M7MA 1T68X 1PBOA 1VWLB 1EPAA 2WUTA 2NNQA 4Y0PA 1YP6A 1KL4A 2M4LA 3BX7A 1IFCA 4Z6JA 1GKAA 3P6CA 3ZW1B 3NX2A 4O4OA 4BVMA 4ZHDA 1ML7A 2C1QA 1EXSA 1GX9A 4I3CA 4BJ8A 4BBOA 4AZMA 2A13A 5EDCA 2WPUA 1O8VA 1LNMA 1QFVA 2RTFB 3P6GA 4ARHA 1FE3A 2FRSA 2R74A 1A18A 1I06A 2ASNX 2RTIB 3GE2A 1WUBA 4FBOA 1ZRYA 4OS8A 1LIEA 2GTFX 2LFOA 1SLDB 2IZHB 3HOEA 1YWAA 4QRLA 5B29A 1AELA 1LDQA 5IXGA 1XKIA 4D6AA 1NDJA 3SOTA 2CZTA 2MJIA 3P6FA 2RQ0A 5L8IA 1LCZA 4BX5B 1G74A 3FA7A 5B5FA 5FENA 1QY1A 3L4RA 1A2DA 3NQKA 3CKFA 3STKA 2Q39A 2UZ2A 4CDEA 5IO7A 3LNBA 4I9RA 2IZAA 5AEOA 1PBYA 3WXQA 3P6DA 3ZW0B 3FELA 4Z27A 5HZ8A 3SLJA 5KHPA 2RTLA 3FEKA 4I3DA 2L9CA 3PH6A 3SAOA 3FW5A 5D4AA 4O4SA 1OBQA 2K62A 3WJBA 4I6SA 4QAEA 4OEMA 4TKBA 4GNWA 4CDDA 4COTA 4WHIA 3B2KA 3ZW2A 3TZSA 2O62A 5B5GA 2FT9A 5AJBA 1SWLA 4ZFXA 2MWHA 2POAA 1GX3A 2F01A 4QYPA 4U8UO 1VWKB 1Y53X 2AVIA 3PECA 5CSEA 4O4UA 4YKOA 4HPDA 4LKPA 1BBPA 5L3YA 1SWKA 1LDOA 2R56A 4GGZA 2KT4B 1LUQA 1S7DA 1YP7A 1SY2A 2W2AA 3FR4A 3MG5A 2ANSA 3MVFA 4ZGUA 2FR3A 4JO6A 1ERBA 1JQPA 3ZWEA 5EEEA 1N0SA 4LZUA 5BYPA 1K24A 1SRGA 1SY1A 1U17A 2W2BA 1JMXA 1GGLA 4GK9A 3FMZA 3WOVA 1SREA 2ZAGA 1UREA 1VWMB 3FR5A 1ADLA 1VWPB 5LKFA 1BRPA 1D3SA 1SRJA 1UYNX 2IZDB 1U18A 4MVLA 2QOMA 3X00A 4CK4A 2A0AA 2MM3A 3APUA 5D45A 4OS0A 1SWBA 3B2HA 1LPJA 1HBQA 4O9SA 3WJEA 2OY1O 1BWYA 3NQ3A 2G8CO 2W2FA 3RDMA 1A3YA 3WJDA 2RCQA 2RTHB 5HA1A 5HZQA 1HY2A 1NBXA 1HBPA 2CAMA 3IA8A 1E02A 2OVSA 3P6HA 4WFUA 3RBYA 2RA6A 3SLOA 2IZLB 4O3YA 2L5PA 1JBHA 5B11O 2IZCB 2OZQA 4D6BA 1E00A 1KL5A 3FEPA 1IW2A 4CPHA 2OY8A 4HPBA 4N7CA 3EW2A 1D2UA 3EBKA 4QZTA 4TKHA 2RCTA 4YDAA 4TKJA 3MBTA 4BX6A 4QGVA 2JW1A 4KC8A 5HCEC 3HK1A 3NBXX 2IZBA 1DZKA 1SWRA 2A2UA 1SWOA 1DC9A 1QFTA 1SWEA 2OFRX 4ORXA 3T6LA 3EW1A 2RTEB 1KL3A 3CR6A 3RY2A 1SLFB 1GKAB 1HXLA 3RDSA 4BX5A 3PPTA 1RAVA 2IZKA 4YDBA 3FIDA 4TQ2A 2AF5A 1R0UA 1VWCB 4O3WA 4Z2PA 4QGWA 2CBSA 3ZUOA 4I9SA 4IB7A 1CRBA 1KT6A 4AW8A 2OY7A 1DF3A 5HAEA 3TGBA 1JV4A 2JU8A 1I04A 4AZRA 5IRWA 1SA8A 5LKEA 3RZYA 1VWAB 4GDAA 1MX7A 1SWFA 2QO4A 3G7XA 2LBVA 4EFGA 1G5WA 5FQ8E 2AMMX 3BU9A 4XMCA 1HQQA 3KFFA 1DF8A 3VE1A 4U9CA 2RTMA 1HMSA 1SWPA 3WZNA 1DZJA 4AZOA 1TOWA 1PMPA 4BCSA 2OVAA 4ORSA 4BOEA 3D9WA 2OF9A 3WZOA 4DCBA 2FR2A 2P8GA 3VHIA 2DJFA 1YWCA 2A8GA 4FBRA 4ORRA 3F6ZB 4YCEA 5HZ6A 3T1DA 1FELA 1AVEA 1JJUA 1G85A 1RXHA 1SXXA 1KFFA 2AT5X 1OEJA 4QQ1A 1Y55X 4OELA 4NP1A 2FKJA 3VPJE 3FLLA 3B2LA 1LIFA 2F73A 3RDOA 3VG4A 1N9YA 1WBIA 3U9PC 4Y0RA 1L6MA 2IZEB 1NP1A 1OEKA 1RXJA 3NQ9A 4L1NA 3Q34A 3VU1A 1ZNHA 3AUMO 1N9MA 1H91A 1Y9TA 4Z2OA 1EPBA 5LJBA 2JU7A 3HWDA 1PEEA 1TOUA 4AZQA 2UYWA 3E3CA 3O2YA 5EPQA 2BT9A 1SWDA 1DZMA 3JSQA 4YGHA 1NP4A 1T0VA 1STPA 2BLGA 2AT8X 2FWVA 2RTCB 2RTKA 3PK2A 4KIIA 4ODDA 3LTWA 2Y32A 4YGGA 3UEWA 3HPEA 1ZNEA 2BC3A 2RTRB 1EI5A 2OFBA 3HWFA 4YFPA 4AZPA 2Q2MA 3KFIA 3NPOA 4I60A 4ZHHA 1DFVA 4BX7A 3BX8A 2BSZA 4Z2VA 2I5ZO 1GX8A 4N7DA 1MDCA 1W6FA 2RN4A 3FYFA 4LKTA 4YVBA 1LCVA 5H9LA 4YCHA 2N93A 3O19A 2JMBA 5FFHA 5DG4A 1BSQA 1EUOA 4U46A 1KT3A 2FHNX 3FA9A 1RLBE 1LFOA 1KT7A 1VWHB 1K3BA 3P24A 2LBAA 2OVDA 1SY0A 2WQ9A 4MVKA 2YG2A 4Y5DA 1NGLA 5D8JA 3RWXA 2JN3A 3O22A 5F6ZA 5CHKA 4GJSA 4XMDA 2OFAA 4TLJA 4AZNA 3VG7A 3WJGA 2IFBA 3S26A 1IKJA 4GD9A 1IKEA 1ALBA 1LKEA 2ALLX 1UYOX 3SLTA 4EEJA 1XCAA 4CDCA 2X8TA 2YMSA 4K19A 2IZIA 1MEPA 2X8FA 3F8AA 1CBIA 1X8NA 4A1YA 4NW4A 3JQOA 2Z4HA 4O4XA 1VWDB 2OY5O 1TXLA 5IRAA 5JD2A 1FDQA 3D95A 2Z4IA 2PI3O 1ZNGA 3JS1A 3DTQA 4IBAA 3K3LA 1LIDA 3OBLA 1CBRA 2Q4NA 3IFBA 2JU3A 2PY1A 4GGRA 1OPBA 1TW4A 2NNDA 3RE6A 3KFHA 4NNSA 4BX6B 4HPCA 3CBCA 2JGSA 4WBKA 4KCAA 1BRQA 4ZH6A 4YBPA 4IRWA 2Q2PA 4ZHGA 4OMXA 4RUUA 2OL7A 3SZIA 2QO5A 1QY2A 3AKMA 1EIIA 2L68A 1X8UA 4NV8A 4NYRA 1I05A 5L8NA 4GH7A 3PEDA 3D97A 5H9KA 3VG5A 1AVDA 3HWGA 4MIRA 4Y0SA 3STNA 5CE4A 1JYDA 2X46A 3SZJA 4CPEA 1G7NA 1SXUA 2QOSC 1A57A 1SXYA 2AKQA 5B27A 4BQUA 4I95A 5LJKA 2RTPB 1NQMA 3HOLA 2MHDA 1SWHA 1JJJA 1P6PA 1LF7A 4IB6A 3T2XA 3KVNA 3C77X 1O1UA 3LV4A 4ALOA 4YH0A 1MVGA 4GE1A 3PQSA 2FKGA 4Y0QA 4GZVA 5HBSA 4EKVA 3CKGA 3VHMA 2LA7A 3WYPA 1OPAA 2HMBA 2KTDA 3KZAA 4GRJA 1BSYA 1QQSA 1OBUA 3S60A 1GXAA 3WJFA 4CV7A 1VWNB 5F6BA 4GDZA 2BS5A 4NV7A 4CPHB 3WYQA 1SWAA 3EMMA 1EALA 3S5XA 4CPIA 5H8TA 4EDEA 1EW3A 3CMPA 2C4IA 3TF6A 1X8QA 1VWQB 3B2JA 5LJDA 5F2BA 5L8OA 4JNJA 1GT5A 2FHLA 5HA0A 2RTQB 3BSZE 4MEEA 2Y3FA 1JYJA 1ZNDA 1BM5A 4XMGA 1FENA 3CQNA 4ALBA 3RKGA 4ZJ0A 4R0BA 2X45A 1N7YA 2MF6A 3P02A 1KZWA 2QCBA 4LZVA 1QG5A 3APXA 1DV9A 1LICA 4ZH9A 1BEBA 1NC9A 1MUPA 2RTBB 1STSB 1QY0A
chains in the Genus database with same CATH topology
1BQIA 3P5WA 1VJVA 1F2BA 1W5RA 1DEUA 3WXEA 3RVVA 4GUZA 2DCBA 3F5VA 3BWKA 4C5PA 3H6SA 1TU6A 4P6EA 5EF4A 4YYWA 1NB3A 2NQGA 4QH6A 2ARYA 2VFBA 2R9OA 1W4TA 2IPPB 2HD5A 3U8EA 2NQIA 1EF7A 2OP3A 1HUCB 2DCDA 1ITOA 3WXGA 1AYWA 2HXZA 2AU1A 3IUTA 5JA7A 3OF9A 1PIPA 1NB5A 1MIRA 1FH0A 1QDQA 4PADA 3MHSA 4Q8GA 1MHWA 1U9WA 1TL9A 3MHHA 1SP4B 4BPVA 1YK7A 4I05A 3NHEA 3HD3A 1GMYA 3E1ZB 4Q8HA 2ACTA 1CVZA 3ZUAA 3WXFA 1EWOA 1SNKA 2R6NA 1POPA 2FQ9A 3CBKA 9PAPA 4G54A 2O6XA 1CTEA 2CB5A 2HH5A 3IMAA 2PREA 3PDFA 2R9NA 4MZSA 1AU4A 2PBHA 2HHNA 2AVWA 1PCIA 2XU3A 4RY2A 5K16A 5CHTA 5EGWA 3I06A 3CH3X 1QOLA 4AXLA 1AYVA 4N8WA 2VFCA 2R9MA 3P5XA 1PADA 4CZWA 1CB5A 1E2TA 4X6HA 4I04A 4FIPA 1PBHA 3H7DA 3IHPA 1PXVA 3C9EA 3K8UA 1Y08A 2WBFX 1A6RA 4YYRA 1NQCA 3OF8A 4B55A 1BY8A 1KFXL 1ME4A 5PADA 1S4VA 3LXSA 2E01A 2YJ2A 4YYSA 4BGFA 4XR7A 2FYEA 1ZCMA 1NPZA 3CH2X 3M99A 4YYQA 1QXPA 3H8CA 2C0YA 1EWPA 2G8EA 1EWLA 3HHIA 2VHFA 2NQDB 1YVBA 2DC7A 4YV8A 1STFE 2AYOA 3USVA 1AECA 3OVZA 3AI8A 1F2AA 3BCNA 2P7UA 1AU3A 1IWDA 3RVXA 1THEA 1YALA 1U9XA 4OEMA 1MDWA 4YYUA 2YJCA 2P0RA 2F7DA 1XKGA 1CJLA 3I3TA 3BPMA 2BDLA 2DC6A 1GX3A 5JH3A 4DMYA 2E03A 2XU4A 1O0EA 4BS6A 5CHVA 4QRXA 1MEMA 3KSEA 2XU1A 3IEJA 1PPDA 2E02A 1JQPA 3DF0A 2FTDA 4CDCB 1Y4HA 3MTNA 4W4UA 2YJ9A 5FPWA 2GHUA 3CBJA 3QJ3A 2IBIA 1PPOA 4MSXA 2FRQA 4YYVA 4X6JA 4DMXA 1U5IA 2G8JA 2OZ2A 3QSDA 2AYNA 1ICFA 2BDZA 5F02A 2B1NA 1YK8A 3KFQA 4HWYA 2DC9A 5CVMA 2B1MA 4P6GA 3N4CA 1QMYA 4ZUXU 1CV8A 4FJCA 1DF0A 1NLJA 3HWNA 1X9YA 3RVWA 3KX1A 4BQVA 3V6CA 1GCBA 4AXMA 1CSBB 2ATOA 3QT4A 1YT7A 3PW3A 4FK5A 4KLBA 1PPNA 2FO5A 4X6IA 2YJ8A 3B79A 2DC8A 2H7JA 3IV2A 2Y5BA 4W5CA 3D9WA 3ERVA 3GCBA 4YVAA 2PADA 3HHAA 4N79A 4QRVA 5J94A 3P5VA 1U9VA 4K7CA 2AUZA 2F1GA 3KWZA 1KHPA 3V6EA 4OELA 3K24A 2G7YA 3O1GA 2G6DA 1CS8A 3H8BA 1ATKA 1F2CA 4QRGA 3LTWA 2DJFB 2DZYA 2DJGB 1AU2A 1M6DA 3O0UA 5CVOB 2AS8A 4WA6A 2NQAA 2AUXA 2BSZA 3BC3A 2E00A 1CPJA 4BSQA 8PCHA 1W6FA 3PBHA 3P5UA 3LFYA 1VSNA 1BP4A 2PNSA 1TLOA 3BOWA 3S3QA 1AYUA 1MS6A 4CDFB 2Y6EA 2R9FA 1MEGA 2GFOA 1K3BB 2FRAA 1NL6A 1ME3A 1KHQA 3BPFA 2DZZA 3K9MA 3MORA 3S3RA 1KXRA 4CDDB 4NV8A 2FUDA 3KWBX 2AIMA 3KW9A 1CQDA 1ZIVA 2CIOA 5CVNB 1F29A 2XU5A 1Q6KA 2R9CA 1BGOA 2FT2A 4I07A 1PE6A 5A24A 2OULA 2JQFR 3IOQA 4BS5A 3D6SA 4W5BA 3OVXA 4PI3A 3N3KA 3H89A 4QBBA 3F75A 3TNXA 2YJBA 4NV7A 4PP2E 2JQGR 2VHSA 3N3GA 3PNRA 2DCCA 1EWMA 1GLOA 1AU0A 1AIMA 2DCAA 1PPPA 4PP1A 2P86A 4XUIA 4MZOA 3KKUA 7PCKA 1KFUL 4N4ZA 6PADA 4CDEB 1U9QX 1GECE 3OISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GX3 A;  1E2T A;  4GUZ A;  1W5R A;  1W4T A;  2VFC A;  3LTW A;  2BSZ A;  4NV7 A;  4C5P A;  4B55 A;  3D9W A;  4NV8 A;  1W6F A;  4BGF A;  2VFB A; 
#chains in the Genus database with same CATH topology
 3V8U A;  1E5P A;  1VPR A;  5LJH A;  2HYS A;  1B0O A;  5EED A;  4ZHF A;  2HLV A;  1YUP A;  4ZCB A;  5HTE A;  2HZQ A;  2MO5 A;  4UU3 A;  4YKM A;  2FTB A;  2X32 A;  3EBW A;  4GJV A;  1VWJ B;  3VG2 A;  5KIC A;  4ON1 A;  1SLG B;  4UU2 A;  2F09 A;  2WEX A;  4A1H A;  2A2G A;  2FLJ A;  2GTL N;  4L3R A;  4NLJ A;  3RDU A;  1KQW A;  2WWP A;  2WQA E;  1B56 A;  1W5R A;  2E4J A;  4IAB A;  1VWO B;  1YWB A;  1LIB A;  2KW1 A;  5FQ6 E;  3T6F A;  4FBV A;  3APV A;  3GAQ A;  4AYH A;  4GNY A;  2FGS A;  3AEH A;  3S5V A;  5IO5 A;  4IAX A;  1Y0G A;  4GUZ A;  3VE2 A;  3ZW1 A;  4C5P A;  2CBR A;  5HZ5 A;  3U0D A;  2AT3 X;  4GU8 A;  2IZG B;  2KTS A;  4CPF A;  4NLI A;  1GT4 A;  3FW4 A;  5LJE A;  2JOZ A;  3OJY C;  5D47 A;  4O3X B;  3VHH A;  3PP6 A;  4ES7 A;  2CZU A;  2PFR A;  2IZF B;  2L67 A;  3UAQ A;  4DQ4 A;  1I4U A;  1GT1 A;  2VFB A;  4DMO A;  4O3Z A;  1SWG A;  3BU1 A;  1I78 A;  2IZJ A;  1Y9L A;  4U3Q A;  2OL8 O;  1Y52 X;  4YFQ A;  1W4T A;  2XST A;  4IB8 A;  2DJG A;  1GT3 A;  3U03 A;  2IJA A;  2PQT A;  1HMT A;  1VWR B;  3WJC A;  3UEV A;  5LJG A;  3ZW0 A;  1ZNL A;  2OF8 A;  1BJ7 A;  4MVI A;  5DPQ A;  3NAD A;  3QKG A;  5H9A A;  4KH8 A;  5KID A;  1SXW A;  3C76 X;  4NYQ A;  1ACD A;  2EU7 X;  1EIO A;  4JHQ A;  2LKK A;  2X56 A;  1ZNK A;  1PM1 X;  2A5B A;  3QQ2 A;  5FQ7 E;  3BY0 A;  5C0N A;  3NR3 A;  1SY3 A;  4MVE A;  2Y3E A;  1KZX A;  3MM0 A;  4ORY A;  3N91 A;  2OVE A;  5HCD C;  5LJC A;  1STR B;  3D96 A;  5H9N A;  4QYN A;  3ZZV A;  1FEM A;  1AQB A;  2K23 A;  1ICN A;  3LHN A;  4ML7 B;  2R73 A;  3HWE A;  1O1V A;  4IAW A;  2I5V O;  4IMO A;  1GM6 A;  4MIS A;  2QO6 A;  3NP1 A;  4JGL A;  1X8O A;  1SRI A;  3RDQ A;  2RTO B;  1HN2 A;  3TGA A;  2WSJ A;  1VWG B;  3ELX A;  4QZU A;  3BLG A;  3I0A A;  3ZI8 A;  1MOY A;  3ZUI A;  3BRN A;  1LCW A;  2OFM X;  1OEE A;  4BX7 B;  4WFV A;  4PJ2 A;  2DM5 A;  4Y59 A;  2AH7 X;  2C1S A;  1BSO A;  3CBS A;  3FA6 A;  1E06 A;  4XMH A;  1SMP I;  1I9H A;  4QNI A;  3B2I A;  4HFO A;  1JMZ A;  2BS6 A;  3FEN A;  3RDX A;  1KT5 A;  4ID2 A;  3VG3 A;  4A60 A;  5HTD A;  5BVS A;  3CWK A;  1T8V A;  2ZAI A;  5B2A O;  4ZGF A;  1U0X A;  4LQZ A;  4CSB A;  1N43 A;  1X71 A;  5CYB A;  1IJ8 A;  3ELZ A;  4OMW A;  4GGT A;  5AJC A;  5B3M O;  4CDF A;  2HZR A;  4OKA A;  4Z28 A;  4ORU A;  2ACP X;  1VYO A;  2HNX A;  3NX1 A;  1CJ5 A;  2X55 A;  4RUN A;  4OS3 A;  3P6E A;  5IRU A;  3MX7 A;  3VG6 A;  1NQN A;  4A8Z A;  2QM9 A;  3BDR A;  5FAZ A;  3BS2 A;  2HKD A;  4EXZ A;  2RTN B;  2OL6 O;  2OYB O;  3FR2 A;  2GTL M;  4I3B A;  4IMN A;  2G7B A;  3UEU A;  1SRF A;  5HCC C;  5HWZ A;  5K67 A;  3OD9 A;  1Z24 A;  5EDB A;  3PDF A;  1VWF B;  5F1E A;  1VYG A;  1HXZ A;  5K68 A;  1IIU A;  4FGI B;  2ACO A;  1N4J A;  2NNE A;  5BVQ A;  3STM X;  1KOI A;  2X4M A;  2Q9S A;  4YFR A;  1KT4 A;  1BLR A;  2WEW A;  2NP1 A;  1VYF A;  3WBG A;  1RST B;  2FS6 A;  2A3F X;  3RSW A;  3EC5 A;  3Q6L A;  2GTL O;  1FJ1 E;  4U8U N;  4YBU A;  3FDC A;  3UEX A;  2FS7 A;  1MK5 A;  1MM9 A;  2RTG B;  4HPA A;  2RTA A;  4INN A;  4O49 A;  4ORW A;  1SWU A;  3C78 X;  3WZP A;  2CM4 A;  1IFB A;  3F9D A;  4QGX A;  2LB6 A;  3RY1 A;  5D48 A;  3D4R A;  1SLE B;  2AT6 X;  4KT5 A;  4XMF A;  3RE5 A;  1B8E A;  1S44 A;  1LEL A;  3PQU A;  2AL0 X;  3FA8 A;  1ICM A;  1YWD A;  1QAB E;  4YMY A;  3I17 A;  3PH5 A;  2G79 A;  4TNN A;  1KXO A;  2BHV A;  1KQX A;  2VFC A;  4IB9 A;  4DQ3 A;  1UZ2 X;  2X34 A;  1CBS A;  1SRH A;  1SWJ A;  1SWT A;  3DSZ A;  3OE3 A;  4ZR2 A;  3SZH A;  3T2W A;  3WVM A;  1SWQ A;  1OSP O;  4EQA C;  2QMI A;  1HMR A;  5IO6 A;  1E2T A;  2CM9 A;  1PTS A;  4ZHC A;  2GH7 A;  1ERX A;  4PSQ A;  4NNT A;  2RD7 C;  4HWM A;  5EZ2 A;  1CBQ A;  5AQ6 A;  5F7G A;  3EYC A;  1QWD A;  3HTY A;  1RBP A;  1SWS A;  1AVG I;  1AB0 A;  4YGZ A;  3FIQ A;  1X8P A;  5HZ9 A;  5F58 A;  1B4M A;  2KD2 A;  3EM0 A;  2G78 A;  2WR6 A;  1OBP A;  3VGW A;  4FQB B;  4GET A;  2RTD B;  2AT0 X;  2A5C A;  2GJ5 A;  5B10 O;  1MX8 A;  4B55 A;  1X89 A;  3KFG A;  1TVQ A;  1VWB B;  1S2P A;  1RXK A;  1EQD A;  1KGL A;  1VWE B;  2ZSC A;  5K06 A;  1JIW I;  4XME A;  4DNE A;  3KQ0 A;  2XKL A;  1DZP A;  1JZU A;  3H3I A;  2GC9 A;  4U8U M;  3AKN A;  3WZQ A;  4BGF A;  1HQP A;  3TGC A;  4TJZ A;  3APW A;  2RTJ A;  1RSU B;  1VWI B;  4KC7 A;  3ZQ3 A;  5BVT A;  5JR8 A;  4GKC A;  1JJX A;  1SWN A;  2X8S A;  2G5L A;  2VDF A;  1FTP A;  4M6S A;  1SWC A;  1YIV A;  3CQR A;  4M7M A;  1T68 X;  1PBO A;  1VWL B;  1EPA A;  2WUT A;  2NNQ A;  4Y0P A;  1YP6 A;  1KL4 A;  2M4L A;  3BX7 A;  1IFC A;  4Z6J A;  1GKA A;  3P6C A;  3ZW1 B;  3NX2 A;  4O4O A;  4BVM A;  4ZHD A;  1ML7 A;  2C1Q A;  1EXS A;  1GX9 A;  4I3C A;  4BJ8 A;  4BBO A;  4AZM A;  2A13 A;  5EDC A;  2WPU A;  1O8V A;  1LNM A;  1QFV A;  2RTF B;  3P6G A;  4ARH A;  1FE3 A;  2FRS A;  2R74 A;  1A18 A;  1I06 A;  2ASN X;  2RTI B;  3GE2 A;  1WUB A;  4FBO A;  1ZRY A;  4OS8 A;  1LIE A;  2GTF X;  2LFO A;  1SLD B;  2IZH B;  3HOE A;  1YWA A;  4QRL A;  5B29 A;  1AEL A;  1LDQ A;  5IXG A;  1XKI A;  4D6A A;  1NDJ A;  3SOT A;  2CZT A;  2MJI A;  3P6F A;  2RQ0 A;  5L8I A;  1LCZ A;  4BX5 B;  1G74 A;  3FA7 A;  5B5F A;  5FEN A;  1QY1 A;  3L4R A;  1A2D A;  3NQK A;  3CKF A;  3STK A;  2Q39 A;  2UZ2 A;  4CDE A;  5IO7 A;  3LNB A;  4I9R A;  2IZA A;  5AEO A;  1PBY A;  3WXQ A;  3P6D A;  3ZW0 B;  3FEL A;  4Z27 A;  5HZ8 A;  3SLJ A;  5KHP A;  2RTL A;  3FEK A;  4I3D A;  2L9C A;  3PH6 A;  3SAO A;  3FW5 A;  5D4A A;  4O4S A;  1OBQ A;  2K62 A;  3WJB A;  4I6S A;  4QAE A;  4OEM A;  4TKB A;  4GNW A;  4CDD A;  4COT A;  4WHI A;  3B2K A;  3ZW2 A;  3TZS A;  2O62 A;  5B5G A;  2FT9 A;  5AJB A;  1SWL A;  4ZFX A;  2MWH A;  2POA A;  1GX3 A;  2F01 A;  4QYP A;  4U8U O;  1VWK B;  1Y53 X;  2AVI A;  3PEC A;  5CSE A;  4O4U A;  4YKO A;  4HPD A;  4LKP A;  1BBP A;  5L3Y A;  1SWK A;  1LDO A;  2R56 A;  4GGZ A;  2KT4 B;  1LUQ A;  1S7D A;  1YP7 A;  1SY2 A;  2W2A A;  3FR4 A;  3MG5 A;  2ANS A;  3MVF A;  4ZGU A;  2FR3 A;  4JO6 A;  1ERB A;  1JQP A;  3ZWE A;  5EEE A;  1N0S A;  4LZU A;  5BYP A;  1K24 A;  1SRG A;  1SY1 A;  1U17 A;  2W2B A;  1JMX A;  1GGL A;  4GK9 A;  3FMZ A;  3WOV A;  1SRE A;  2ZAG A;  1URE A;  1VWM B;  3FR5 A;  1ADL A;  1VWP B;  5LKF A;  1BRP A;  1D3S A;  1SRJ A;  1UYN X;  2IZD B;  1U18 A;  4MVL A;  2QOM A;  3X00 A;  4CK4 A;  2A0A A;  2MM3 A;  3APU A;  5D45 A;  4OS0 A;  1SWB A;  3B2H A;  1LPJ A;  1HBQ A;  4O9S A;  3WJE A;  2OY1 O;  1BWY A;  3NQ3 A;  2G8C O;  2W2F A;  3RDM A;  1A3Y A;  3WJD A;  2RCQ A;  2RTH B;  5HA1 A;  5HZQ A;  1HY2 A;  1NBX A;  1HBP A;  2CAM A;  3IA8 A;  1E02 A;  2OVS A;  3P6H A;  4WFU A;  3RBY A;  2RA6 A;  3SLO A;  2IZL B;  4O3Y A;  2L5P A;  1JBH A;  5B11 O;  2IZC B;  2OZQ A;  4D6B A;  1E00 A;  1KL5 A;  3FEP A;  1IW2 A;  4CPH A;  2OY8 A;  4HPB A;  4N7C A;  3EW2 A;  1D2U A;  3EBK A;  4QZT A;  4TKH A;  2RCT A;  4YDA A;  4TKJ A;  3MBT A;  4BX6 A;  4QGV A;  2JW1 A;  4KC8 A;  5HCE C;  3HK1 A;  3NBX X;  2IZB A;  1DZK A;  1SWR A;  2A2U A;  1SWO A;  1DC9 A;  1QFT A;  1SWE A;  2OFR X;  4ORX A;  3T6L A;  3EW1 A;  2RTE B;  1KL3 A;  3CR6 A;  3RY2 A;  1SLF B;  1GKA B;  1HXL A;  3RDS A;  4BX5 A;  3PPT A;  1RAV A;  2IZK A;  4YDB A;  3FID A;  4TQ2 A;  2AF5 A;  1R0U A;  1VWC B;  4O3W A;  4Z2P A;  4QGW A;  2CBS A;  3ZUO A;  4I9S A;  4IB7 A;  1CRB A;  1KT6 A;  4AW8 A;  2OY7 A;  1DF3 A;  5HAE A;  3TGB A;  1JV4 A;  2JU8 A;  1I04 A;  4AZR A;  5IRW A;  1SA8 A;  5LKE A;  3RZY A;  1VWA B;  4GDA A;  1MX7 A;  1SWF A;  2QO4 A;  3G7X A;  2LBV A;  4EFG A;  1G5W A;  5FQ8 E;  2AMM X;  3BU9 A;  4XMC A;  1HQQ A;  3KFF A;  1DF8 A;  3VE1 A;  4U9C A;  2RTM A;  1HMS A;  1SWP A;  3WZN A;  1DZJ A;  4AZO A;  1TOW A;  1PMP A;  4BCS A;  2OVA A;  4ORS A;  4BOE A;  3D9W A;  2OF9 A;  3WZO A;  4DCB A;  2FR2 A;  2P8G A;  3VHI A;  2DJF A;  1YWC A;  2A8G A;  4FBR A;  4ORR A;  3F6Z B;  4YCE A;  5HZ6 A;  3T1D A;  1FEL A;  1AVE A;  1JJU A;  1G85 A;  1RXH A;  1SXX A;  1KFF A;  2AT5 X;  1OEJ A;  4QQ1 A;  1Y55 X;  4OEL A;  4NP1 A;  2FKJ A;  3VPJ E;  3FLL A;  3B2L A;  1LIF A;  2F73 A;  3RDO A;  3VG4 A;  1N9Y A;  1WBI A;  3U9P C;  4Y0R A;  1L6M A;  2IZE B;  1NP1 A;  1OEK A;  1RXJ A;  3NQ9 A;  4L1N A;  3Q34 A;  3VU1 A;  1ZNH A;  3AUM O;  1N9M A;  1H91 A;  1Y9T A;  4Z2O A;  1EPB A;  5LJB A;  2JU7 A;  3HWD A;  1PEE A;  1TOU A;  4AZQ A;  2UYW A;  3E3C A;  3O2Y A;  5EPQ A;  2BT9 A;  1SWD A;  1DZM A;  3JSQ A;  4YGH A;  1NP4 A;  1T0V A;  1STP A;  2BLG A;  2AT8 X;  2FWV A;  2RTC B;  2RTK A;  3PK2 A;  4KII A;  4ODD A;  3LTW A;  2Y32 A;  4YGG A;  3UEW A;  3HPE A;  1ZNE A;  2BC3 A;  2RTR B;  1EI5 A;  2OFB A;  3HWF A;  4YFP A;  4AZP A;  2Q2M A;  3KFI A;  3NPO A;  4I60 A;  4ZHH A;  1DFV A;  4BX7 A;  3BX8 A;  2BSZ A;  4Z2V A;  2I5Z O;  1GX8 A;  4N7D A;  1MDC A;  1W6F A;  2RN4 A;  3FYF A;  4LKT A;  4YVB A;  1LCV A;  5H9L A;  4YCH A;  2N93 A;  3O19 A;  2JMB A;  5FFH A;  5DG4 A;  1BSQ A;  1EUO A;  4U46 A;  1KT3 A;  2FHN X;  3FA9 A;  1RLB E;  1LFO A;  1KT7 A;  1VWH B;  1K3B A;  3P24 A;  2LBA A;  2OVD A;  1SY0 A;  2WQ9 A;  4MVK A;  2YG2 A;  4Y5D A;  1NGL A;  5D8J A;  3RWX A;  2JN3 A;  3O22 A;  5F6Z A;  5CHK A;  4GJS A;  4XMD A;  2OFA A;  4TLJ A;  4AZN A;  3VG7 A;  3WJG A;  2IFB A;  3S26 A;  1IKJ A;  4GD9 A;  1IKE A;  1ALB A;  1LKE A;  2ALL X;  1UYO X;  3SLT A;  4EEJ A;  1XCA A;  4CDC A;  2X8T A;  2YMS A;  4K19 A;  2IZI A;  1MEP A;  2X8F A;  3F8A A;  1CBI A;  1X8N A;  4A1Y A;  4NW4 A;  3JQO A;  2Z4H A;  4O4X A;  1VWD B;  2OY5 O;  1TXL A;  5IRA A;  5JD2 A;  1FDQ A;  3D95 A;  2Z4I A;  2PI3 O;  1ZNG A;  3JS1 A;  3DTQ A;  4IBA A;  3K3L A;  1LID A;  3OBL A;  1CBR A;  2Q4N A;  3IFB A;  2JU3 A;  2PY1 A;  4GGR A;  1OPB A;  1TW4 A;  2NND A;  3RE6 A;  3KFH A;  4NNS A;  4BX6 B;  4HPC A;  3CBC A;  2JGS A;  4WBK A;  4KCA A;  1BRQ A;  4ZH6 A;  4YBP A;  4IRW A;  2Q2P A;  4ZHG A;  4OMX A;  4RUU A;  2OL7 A;  3SZI A;  2QO5 A;  1QY2 A;  3AKM A;  1EII A;  2L68 A;  1X8U A;  4NV8 A;  4NYR A;  1I05 A;  5L8N A;  4GH7 A;  3PED A;  3D97 A;  5H9K A;  3VG5 A;  1AVD A;  3HWG A;  4MIR A;  4Y0S A;  3STN A;  5CE4 A;  1JYD A;  2X46 A;  3SZJ A;  4CPE A;  1G7N A;  1SXU A;  2QOS C;  1A57 A;  1SXY A;  2AKQ A;  5B27 A;  4BQU A;  4I95 A;  5LJK A;  2RTP B;  1NQM A;  3HOL A;  2MHD A;  1SWH A;  1JJJ A;  1P6P A;  1LF7 A;  4IB6 A;  3T2X A;  3KVN A;  3C77 X;  1O1U A;  3LV4 A;  4ALO A;  4YH0 A;  1MVG A;  4GE1 A;  3PQS A;  2FKG A;  4Y0Q A;  4GZV A;  5HBS A;  4EKV A;  3CKG A;  3VHM A;  2LA7 A;  3WYP A;  1OPA A;  2HMB A;  2KTD A;  3KZA A;  4GRJ A;  1BSY A;  1QQS A;  1OBU A;  3S60 A;  1GXA A;  3WJF A;  4CV7 A;  1VWN B;  5F6B A;  4GDZ A;  2BS5 A;  4NV7 A;  4CPH B;  3WYQ A;  1SWA A;  3EMM A;  1EAL A;  3S5X A;  4CPI A;  5H8T A;  4EDE A;  1EW3 A;  3CMP A;  2C4I A;  3TF6 A;  1X8Q A;  1VWQ B;  3B2J A;  5LJD A;  5F2B A;  5L8O A;  4JNJ A;  1GT5 A;  2FHL A;  5HA0 A;  2RTQ B;  3BSZ E;  4MEE A;  2Y3F A;  1JYJ A;  1ZND A;  1BM5 A;  4XMG A;  1FEN A;  3CQN A;  4ALB A;  3RKG A;  4ZJ0 A;  4R0B A;  2X45 A;  1N7Y A;  2MF6 A;  3P02 A;  1KZW A;  2QCB A;  4LZV A;  1QG5 A;  3APX A;  1DV9 A;  1LIC A;  4ZH9 A;  1BEB A;  1NC9 A;  1MUP A;  2RTB B;  1STS B;  1QY0 A; 
#chains in the Genus database with same CATH homology
 1BQI A;  3P5W A;  1VJV A;  1F2B A;  1W5R A;  1DEU A;  3WXE A;  3RVV A;  4GUZ A;  2DCB A;  3F5V A;  3BWK A;  4C5P A;  3H6S A;  1TU6 A;  4P6E A;  5EF4 A;  4YYW A;  1NB3 A;  2NQG A;  4QH6 A;  2ARY A;  2VFB A;  2R9O A;  1W4T A;  2IPP B;  2HD5 A;  3U8E A;  2NQI A;  1EF7 A;  2OP3 A;  1HUC B;  2DCD A;  1ITO A;  3WXG A;  1AYW A;  2HXZ A;  2AU1 A;  3IUT A;  5JA7 A;  3OF9 A;  1PIP A;  1NB5 A;  1MIR A;  1FH0 A;  1QDQ A;  4PAD A;  3MHS A;  4Q8G A;  1MHW A;  1U9W A;  1TL9 A;  3MHH A;  1SP4 B;  4BPV A;  1YK7 A;  4I05 A;  3NHE A;  3HD3 A;  1GMY A;  3E1Z B;  4Q8H A;  2ACT A;  1CVZ A;  3ZUA A;  3WXF A;  1EWO A;  1SNK A;  2R6N A;  1POP A;  2FQ9 A;  3CBK A;  9PAP A;  4G54 A;  2O6X A;  1CTE A;  2CB5 A;  2HH5 A;  3IMA A;  2PRE A;  3PDF A;  2R9N A;  4MZS A;  1AU4 A;  2PBH A;  2HHN A;  2AVW A;  1PCI A;  2XU3 A;  4RY2 A;  5K16 A;  5CHT A;  5EGW A;  3I06 A;  3CH3 X;  1QOL A;  4AXL A;  1AYV A;  4N8W A;  2VFC A;  2R9M A;  3P5X A;  1PAD A;  4CZW A;  1CB5 A;  1E2T A;  4X6H A;  4I04 A;  4FIP A;  1PBH A;  3H7D A;  3IHP A;  1PXV A;  3C9E A;  3K8U A;  1Y08 A;  2WBF X;  1A6R A;  4YYR A;  1NQC A;  3OF8 A;  4B55 A;  1BY8 A;  1KFX L;  1ME4 A;  5PAD A;  1S4V A;  3LXS A;  2E01 A;  2YJ2 A;  4YYS A;  4BGF A;  4XR7 A;  2FYE A;  1ZCM A;  1NPZ A;  3CH2 X;  3M99 A;  4YYQ A;  1QXP A;  3H8C A;  2C0Y A;  1EWP A;  2G8E A;  1EWL A;  3HHI A;  2VHF A;  2NQD B;  1YVB A;  2DC7 A;  4YV8 A;  1STF E;  2AYO A;  3USV A;  1AEC A;  3OVZ A;  3AI8 A;  1F2A A;  3BCN A;  2P7U A;  1AU3 A;  1IWD A;  3RVX A;  1THE A;  1YAL A;  1U9X A;  4OEM A;  1MDW A;  4YYU A;  2YJC A;  2P0R A;  2F7D A;  1XKG A;  1CJL A;  3I3T A;  3BPM A;  2BDL A;  2DC6 A;  1GX3 A;  5JH3 A;  4DMY A;  2E03 A;  2XU4 A;  1O0E A;  4BS6 A;  5CHV A;  4QRX A;  1MEM A;  3KSE A;  2XU1 A;  3IEJ A;  1PPD A;  2E02 A;  1JQP A;  3DF0 A;  2FTD A;  4CDC B;  1Y4H A;  3MTN A;  4W4U A;  2YJ9 A;  5FPW A;  2GHU A;  3CBJ A;  3QJ3 A;  2IBI A;  1PPO A;  4MSX A;  2FRQ A;  4YYV A;  4X6J A;  4DMX A;  1U5I A;  2G8J A;  2OZ2 A;  3QSD A;  2AYN A;  1ICF A;  2BDZ A;  5F02 A;  2B1N A;  1YK8 A;  3KFQ A;  4HWY A;  2DC9 A;  5CVM A;  2B1M A;  4P6G A;  3N4C A;  1QMY A;  4ZUX U;  1CV8 A;  4FJC A;  1DF0 A;  1NLJ A;  3HWN A;  1X9Y A;  3RVW A;  3KX1 A;  4BQV A;  3V6C A;  1GCB A;  4AXM A;  1CSB B;  2ATO A;  3QT4 A;  1YT7 A;  3PW3 A;  4FK5 A;  4KLB A;  1PPN A;  2FO5 A;  4X6I A;  2YJ8 A;  3B79 A;  2DC8 A;  2H7J A;  3IV2 A;  2Y5B A;  4W5C A;  3D9W A;  3ERV A;  3GCB A;  4YVA A;  2PAD A;  3HHA A;  4N79 A;  4QRV A;  5J94 A;  3P5V A;  1U9V A;  4K7C A;  2AUZ A;  2F1G A;  3KWZ A;  1KHP A;  3V6E A;  4OEL A;  3K24 A;  2G7Y A;  3O1G A;  2G6D A;  1CS8 A;  3H8B A;  1ATK A;  1F2C A;  4QRG A;  3LTW A;  2DJF B;  2DZY A;  2DJG B;  1AU2 A;  1M6D A;  3O0U A;  5CVO B;  2AS8 A;  4WA6 A;  2NQA A;  2AUX A;  2BSZ A;  3BC3 A;  2E00 A;  1CPJ A;  4BSQ A;  8PCH A;  1W6F A;  3PBH A;  3P5U A;  3LFY A;  1VSN A;  1BP4 A;  2PNS A;  1TLO A;  3BOW A;  3S3Q A;  1AYU A;  1MS6 A;  4CDF B;  2Y6E A;  2R9F A;  1MEG A;  2GFO A;  1K3B B;  2FRA A;  1NL6 A;  1ME3 A;  1KHQ A;  3BPF A;  2DZZ A;  3K9M A;  3MOR A;  3S3R A;  1KXR A;  4CDD B;  4NV8 A;  2FUD A;  3KWB X;  2AIM A;  3KW9 A;  1CQD A;  1ZIV A;  2CIO A;  5CVN B;  1F29 A;  2XU5 A;  1Q6K A;  2R9C A;  1BGO A;  2FT2 A;  4I07 A;  1PE6 A;  5A24 A;  2OUL A;  2JQF R;  3IOQ A;  4BS5 A;  3D6S A;  4W5B A;  3OVX A;  4PI3 A;  3N3K A;  3H89 A;  4QBB A;  3F75 A;  3TNX A;  2YJB A;  4NV7 A;  4PP2 E;  2JQG R;  2VHS A;  3N3G A;  3PNR A;  2DCC A;  1EWM A;  1GLO A;  1AU0 A;  1AIM A;  2DCA A;  1PPP A;  4PP1 A;  2P86 A;  4XUI A;  4MZO A;  3KKU A;  7PCK A;  1KFU L;  4N4Z A;  6PAD A;  4CDE B;  1U9Q X;  1GEC E;  3OIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...