4B5DA

Capitella teleta achbp in complex with psychonicline (3-((2(s)- azetidinyl)methoxy)-5-((1s,2r)-2-(2-hydroxyethyl)cyclopropyl)pyridine)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
211
structure length
211
Chain Sequence
b'NGLMAKRLRRELLNTYEQLGKSGLPFLDDIGKVDVKFGLSLQLLKSIEQRGMGFNSIGTFKAIVKLSWVDTILRWDPEPPFDFQKIEISPDEIWTPDIKLFNSVDLDMTLDRTTQAIVFSNGTVLWIPPAVLKVLCVSQDDVDSCHFQFGSWVYSVDEVDIHFMDDKAEVLLDFYQDSLEILENSAQRQEVVYPCCESAYVEMKYLLALRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into the Structural Determinants Required for High- Affinity Binding of Chiral Cyclopropane-Containing Ligands to Alpha4Beta2-Nicotinic Acetylcholine Receptors: An Integrated Approach to Behaviorally Active Nicotinic Ligands.
pubmed doi rcsb
molecule keywords CAPITELLA TELETA ACHBP
source organism Capitella teleta
molecule tags Acetylcholine-binding protein
total genus 46
structure length 211
sequence length 211
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4b5dA00
3UU8A 3GUAA 4PIRA 3WTHA 3WTLA 5HCMA 3WTJA 3WTOA 4ZZBA 4QAAA 3TLTA 4QACA 3WTMA 4AFHA 5AFJA 5IUXA 4UM1A 5L47A 5LG3A 3UUBA 3UQ7A 2XZ6A 2YN6A 3JADA 4HFBA 4ZK4A 3UQ4A 5J5HA 4Z91A 4UM3S 2WN9A 4TWHA 2XQ4A 4HFCA 4A97A 4TNVA 5KE4A 3TLSA 4DBMA 2YMDA 4LMJA 3U8KA 2XQ9A 4BQTA 4ILCA 2BYPA 5BRXA 4ILBA 2BYQA 4Z90A 5AFNA 4TNWA 2XYTA 4NZBA 4BFQA 2BG9B 2C9TA 3LSVA 2XQAA 2ZJVA 5AFHA 5HEHA 5AFKA 1UW6A 2XNUA 2XQ7A 2Y58A 4HFDA 4XHEA 4ZRUA 5HEJA 2ZJUA 5AINA 5AFLA 3JAFA 3C79A 4HQPA 3WTIA 4B5DA 2W8FA 2BYRA 4FRRA 3RIFA 5CFBA 3EHZA 3U8MA 2BYNA 5L4EA 4LMLA 2XNTA 2XQ6A 4HFEA 1UV6A 2PH9A 3U8JA 5HCJA 5AFMA 4UXUA 4A98A 2XYSA 2BG9C 4TWFA 3IGQA 3SQ9A 3UU3A 4IL9A 5KZUA 3UU4A 2X00A 2XZ5A 4COFA 3UU5A 5TVCA 4ZZCA 4QH5A 3SQ6A 3WIPA 5LXBA 2YOEA 3PEOA 1UX2A 4QABA 5JMEA 2BR7A 2W8GA 4ZJTA 3P50A 2BJ0A 2XQ5A 4ZK1A 3U8NA 3T4MA 3RQUA 3TLVA 5CO5A 2WNJA 4F8HA 2Y7YA 4UM3A 2WNCA 2UZ6A 4LMKA 2XNVA 2PGZA 3ZDGA 4EZ1A 2Y54A 4IL4A 5SYOA 4AFTA 5HEOA 3EAMA 3RQWA 3TLWA 4ILAA 4ZJSA 3SH1A 2XQ8A 4IREA 5L4HA 2BR8A 5HEGA 4D01A 4HFHA 2Y56A 4XK9A 1I9BA 3RHWA 2BYSA 3ZDHA 2XQ3A 3P4WA 2WNLA 2BG9A 3EI0A 5J0ZA 4X5TA 2BG9E 2Y57A 2YMEA 4ZR6A 3TLUA 4QH4A 5J5GA 3C84A 4HFIA 5HEUA 4WV9A 2QC1B 3WTNA 4TWDA 4UY2A 2X00D 2YKSA 4NPPA 2VL0A 5AFMB 3ZKRA 5BW2A 3RI5A 4UM3P 5FJVA 5J5IA 5J5FA 4AFGA 5BP0A 4ALXA 4QH1A 3UU6A 2WZYA 3SIOA 3WTKA 3U8LA 3RIAA 3JAEA 3PMZA
chains in the Genus database with same CATH superfamily
3UU8A 3GUAA 4PIRA 3WTHA 3WTLA 5HCMA 3WTJA 3WTOA 4ZZBA 4QAAA 3TLTA 4QACA 3WTMA 4AFHA 5AFJA 5IUXA 4UM1A 5L47A 5LG3A 3UUBA 3UQ7A 2XZ6A 2YN6A 3JADA 4HFBA 4ZK4A 3UQ4A 5J5HA 4Z91A 4UM3S 2WN9A 4TWHA 2XQ4A 4HFCA 4A97A 4TNVA 5KE4A 3TLSA 4DBMA 2YMDA 4LMJA 3U8KA 2XQ9A 4BQTA 4ILCA 2BYPA 5BRXA 4ILBA 2BYQA 4Z90A 5AFNA 4TNWA 2XYTA 4NZBA 4BFQA 2BG9B 2C9TA 3LSVA 2XQAA 2ZJVA 5AFHA 5HEHA 5AFKA 1UW6A 2XNUA 2XQ7A 2Y58A 4HFDA 4XHEA 4ZRUA 5HEJA 2ZJUA 5AINA 5AFLA 3JAFA 3C79A 4HQPA 3WTIA 4B5DA 2W8FA 2BYRA 4FRRA 3RIFA 5CFBA 3EHZA 3U8MA 2BYNA 5L4EA 4LMLA 2XNTA 2XQ6A 4HFEA 1UV6A 2PH9A 3U8JA 5HCJA 5AFMA 4UXUA 4A98A 2XYSA 2BG9C 4TWFA 3IGQA 3SQ9A 3UU3A 4IL9A 5KZUA 3UU4A 2X00A 2XZ5A 4COFA 3UU5A 5TVCA 4ZZCA 4QH5A 3SQ6A 3WIPA 5LXBA 2YOEA 3PEOA 1UX2A 4QABA 5JMEA 2BR7A 2W8GA 4ZJTA 3P50A 2BJ0A 2XQ5A 4ZK1A 3U8NA 3T4MA 3RQUA 3TLVA 5CO5A 2WNJA 4F8HA 2Y7YA 4UM3A 2WNCA 2UZ6A 4LMKA 2XNVA 2PGZA 3ZDGA 4EZ1A 2Y54A 4IL4A 5SYOA 4AFTA 5HEOA 3EAMA 3RQWA 3TLWA 4ILAA 4ZJSA 3SH1A 2XQ8A 4IREA 5L4HA 2BR8A 5HEGA 4D01A 4HFHA 2Y56A 4XK9A 1I9BA 3RHWA 2BYSA 3ZDHA 2XQ3A 3P4WA 2WNLA 2BG9A 3EI0A 5J0ZA 4X5TA 2BG9E 2Y57A 2YMEA 4ZR6A 3TLUA 4QH4A 5J5GA 3C84A 4HFIA 5HEUA 4WV9A 2QC1B 3WTNA 4TWDA 4UY2A 2X00D 2YKSA 4NPPA 2VL0A 5AFMB 3ZKRA 5BW2A 3RI5A 4UM3P 5FJVA 5J5IA 5J5FA 4AFGA 5BP0A 4ALXA 4QH1A 3UU6A 2WZYA 3SIOA 3WTKA 3U8LA 3RIAA 3JAEA 3PMZA
chains in the Genus database with same CATH topology
3UU8A 3GUAA 4PIRA 3WTHA 3WTLA 5HCMA 3WTJA 3WTOA 4ZZBA 4QAAA 3TLTA 4QACA 3WTMA 4AFHA 5AFJA 5IUXA 4UM1A 5L47A 5LG3A 3UUBA 3UQ7A 2XZ6A 2YN6A 3JADA 4HFBA 4ZK4A 3UQ4A 5J5HA 4Z91A 4UM3S 2WN9A 4TWHA 2XQ4A 4HFCA 4A97A 4TNVA 5KE4A 3TLSA 4DBMA 2YMDA 4LMJA 3U8KA 2XQ9A 4BQTA 4ILCA 2BYPA 5BRXA 4ILBA 2BYQA 4Z90A 5AFNA 4TNWA 2XYTA 4NZBA 4BFQA 2BG9B 2C9TA 3LSVA 2XQAA 2ZJVA 5AFHA 5HEHA 5AFKA 1UW6A 2XNUA 2XQ7A 2Y58A 4HFDA 4XHEA 4ZRUA 5HEJA 2ZJUA 5AINA 5AFLA 3JAFA 3C79A 4HQPA 3WTIA 4B5DA 2W8FA 2BYRA 4FRRA 3RIFA 5CFBA 3EHZA 3U8MA 2BYNA 5L4EA 4LMLA 2XNTA 2XQ6A 4HFEA 1UV6A 2PH9A 3U8JA 5HCJA 5AFMA 4UXUA 4A98A 2XYSA 2BG9C 4TWFA 3IGQA 3SQ9A 3UU3A 4IL9A 5KZUA 3UU4A 2X00A 2XZ5A 4COFA 3UU5A 5TVCA 4ZZCA 4QH5A 3SQ6A 3WIPA 5LXBA 2YOEA 3PEOA 1UX2A 4QABA 5JMEA 2BR7A 2W8GA 4ZJTA 3P50A 2BJ0A 2XQ5A 4ZK1A 3U8NA 3T4MA 3RQUA 3TLVA 5CO5A 2WNJA 4F8HA 2Y7YA 4UM3A 2WNCA 2UZ6A 4LMKA 2XNVA 2PGZA 3ZDGA 4EZ1A 2Y54A 4IL4A 5SYOA 4AFTA 5HEOA 3EAMA 3RQWA 3TLWA 4ILAA 4ZJSA 3SH1A 2XQ8A 4IREA 5L4HA 2BR8A 5HEGA 4D01A 4HFHA 2Y56A 4XK9A 1I9BA 3RHWA 2BYSA 3ZDHA 2XQ3A 3P4WA 2WNLA 2BG9A 3EI0A 5J0ZA 4X5TA 2BG9E 2Y57A 2YMEA 4ZR6A 3TLUA 4QH4A 5J5GA 3C84A 4HFIA 5HEUA 4WV9A 2QC1B 3WTNA 4TWDA 4UY2A 2X00D 2YKSA 4NPPA 2VL0A 5AFMB 3ZKRA 5BW2A 3RI5A 4UM3P 5FJVA 5J5IA 5J5FA 4AFGA 5BP0A 4ALXA 4QH1A 3UU6A 2WZYA 3SIOA 3WTKA 3U8LA 3RIAA 3JAEA 3PMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UU8 A;  3GUA A;  4PIR A;  3WTH A;  3WTL A;  5HCM A;  3WTJ A;  3WTO A;  4ZZB A;  4QAA A;  3TLT A;  4QAC A;  3WTM A;  4AFH A;  5AFJ A;  5IUX A;  4UM1 A;  5L47 A;  5LG3 A;  3UUB A;  3UQ7 A;  2XZ6 A;  2YN6 A;  3JAD A;  4HFB A;  4ZK4 A;  3UQ4 A;  5J5H A;  4Z91 A;  4UM3 S;  2WN9 A;  4TWH A;  2XQ4 A;  4HFC A;  4A97 A;  4TNV A;  5KE4 A;  3TLS A;  4DBM A;  2YMD A;  4LMJ A;  3U8K A;  2XQ9 A;  4BQT A;  4ILC A;  2BYP A;  5BRX A;  4ILB A;  2BYQ A;  4Z90 A;  5AFN A;  4TNW A;  2XYT A;  4NZB A;  4BFQ A;  2BG9 B;  2C9T A;  3LSV A;  2XQA A;  2ZJV A;  5AFH A;  5HEH A;  5AFK A;  1UW6 A;  2XNU A;  2XQ7 A;  2Y58 A;  4HFD A;  4XHE A;  4ZRU A;  5HEJ A;  2ZJU A;  5AIN A;  5AFL A;  3JAF A;  3C79 A;  4HQP A;  3WTI A;  4B5D A;  2W8F A;  2BYR A;  4FRR A;  3RIF A;  5CFB A;  3EHZ A;  3U8M A;  2BYN A;  5L4E A;  4LML A;  2XNT A;  2XQ6 A;  4HFE A;  1UV6 A;  2PH9 A;  3U8J A;  5HCJ A;  5AFM A;  4UXU A;  4A98 A;  2XYS A;  2BG9 C;  4TWF A;  3IGQ A;  3SQ9 A;  3UU3 A;  4IL9 A;  5KZU A;  3UU4 A;  2X00 A;  2XZ5 A;  4COF A;  3UU5 A;  5TVC A;  4ZZC A;  4QH5 A;  3SQ6 A;  3WIP A;  5LXB A;  2YOE A;  3PEO A;  1UX2 A;  4QAB A;  5JME A;  2BR7 A;  2W8G A;  4ZJT A;  3P50 A;  2BJ0 A;  2XQ5 A;  4ZK1 A;  3U8N A;  3T4M A;  3RQU A;  3TLV A;  5CO5 A;  2WNJ A;  4F8H A;  2Y7Y A;  4UM3 A;  2WNC A;  2UZ6 A;  4LMK A;  2XNV A;  2PGZ A;  3ZDG A;  4EZ1 A;  2Y54 A;  4IL4 A;  5SYO A;  4AFT A;  5HEO A;  3EAM A;  3RQW A;  3TLW A;  4ILA A;  4ZJS A;  3SH1 A;  2XQ8 A;  4IRE A;  5L4H A;  2BR8 A;  5HEG A;  4D01 A;  4HFH A;  2Y56 A;  4XK9 A;  1I9B A;  3RHW A;  2BYS A;  3ZDH A;  2XQ3 A;  3P4W A;  2WNL A;  2BG9 A;  3EI0 A;  5J0Z A;  4X5T A;  2BG9 E;  2Y57 A;  2YME A;  4ZR6 A;  3TLU A;  4QH4 A;  5J5G A;  3C84 A;  4HFI A;  5HEU A;  4WV9 A;  2QC1 B;  3WTN A;  4TWD A;  4UY2 A;  2X00 D;  2YKS A;  4NPP A;  2VL0 A;  5AFM B;  3ZKR A;  5BW2 A;  3RI5 A;  4UM3 P;  5FJV A;  5J5I A;  5J5F A;  4AFG A;  5BP0 A;  4ALX A;  4QH1 A;  3UU6 A;  2WZY A;  3SIO A;  3WTK A;  3U8L A;  3RIA A;  3JAE A;  3PMZ A; 
#chains in the Genus database with same CATH topology
 3UU8 A;  3GUA A;  4PIR A;  3WTH A;  3WTL A;  5HCM A;  3WTJ A;  3WTO A;  4ZZB A;  4QAA A;  3TLT A;  4QAC A;  3WTM A;  4AFH A;  5AFJ A;  5IUX A;  4UM1 A;  5L47 A;  5LG3 A;  3UUB A;  3UQ7 A;  2XZ6 A;  2YN6 A;  3JAD A;  4HFB A;  4ZK4 A;  3UQ4 A;  5J5H A;  4Z91 A;  4UM3 S;  2WN9 A;  4TWH A;  2XQ4 A;  4HFC A;  4A97 A;  4TNV A;  5KE4 A;  3TLS A;  4DBM A;  2YMD A;  4LMJ A;  3U8K A;  2XQ9 A;  4BQT A;  4ILC A;  2BYP A;  5BRX A;  4ILB A;  2BYQ A;  4Z90 A;  5AFN A;  4TNW A;  2XYT A;  4NZB A;  4BFQ A;  2BG9 B;  2C9T A;  3LSV A;  2XQA A;  2ZJV A;  5AFH A;  5HEH A;  5AFK A;  1UW6 A;  2XNU A;  2XQ7 A;  2Y58 A;  4HFD A;  4XHE A;  4ZRU A;  5HEJ A;  2ZJU A;  5AIN A;  5AFL A;  3JAF A;  3C79 A;  4HQP A;  3WTI A;  4B5D A;  2W8F A;  2BYR A;  4FRR A;  3RIF A;  5CFB A;  3EHZ A;  3U8M A;  2BYN A;  5L4E A;  4LML A;  2XNT A;  2XQ6 A;  4HFE A;  1UV6 A;  2PH9 A;  3U8J A;  5HCJ A;  5AFM A;  4UXU A;  4A98 A;  2XYS A;  2BG9 C;  4TWF A;  3IGQ A;  3SQ9 A;  3UU3 A;  4IL9 A;  5KZU A;  3UU4 A;  2X00 A;  2XZ5 A;  4COF A;  3UU5 A;  5TVC A;  4ZZC A;  4QH5 A;  3SQ6 A;  3WIP A;  5LXB A;  2YOE A;  3PEO A;  1UX2 A;  4QAB A;  5JME A;  2BR7 A;  2W8G A;  4ZJT A;  3P50 A;  2BJ0 A;  2XQ5 A;  4ZK1 A;  3U8N A;  3T4M A;  3RQU A;  3TLV A;  5CO5 A;  2WNJ A;  4F8H A;  2Y7Y A;  4UM3 A;  2WNC A;  2UZ6 A;  4LMK A;  2XNV A;  2PGZ A;  3ZDG A;  4EZ1 A;  2Y54 A;  4IL4 A;  5SYO A;  4AFT A;  5HEO A;  3EAM A;  3RQW A;  3TLW A;  4ILA A;  4ZJS A;  3SH1 A;  2XQ8 A;  4IRE A;  5L4H A;  2BR8 A;  5HEG A;  4D01 A;  4HFH A;  2Y56 A;  4XK9 A;  1I9B A;  3RHW A;  2BYS A;  3ZDH A;  2XQ3 A;  3P4W A;  2WNL A;  2BG9 A;  3EI0 A;  5J0Z A;  4X5T A;  2BG9 E;  2Y57 A;  2YME A;  4ZR6 A;  3TLU A;  4QH4 A;  5J5G A;  3C84 A;  4HFI A;  5HEU A;  4WV9 A;  2QC1 B;  3WTN A;  4TWD A;  4UY2 A;  2X00 D;  2YKS A;  4NPP A;  2VL0 A;  5AFM B;  3ZKR A;  5BW2 A;  3RI5 A;  4UM3 P;  5FJV A;  5J5I A;  5J5F A;  4AFG A;  5BP0 A;  4ALX A;  4QH1 A;  3UU6 A;  2WZY A;  3SIO A;  3WTK A;  3U8L A;  3RIA A;  3JAE A;  3PMZ A; 
#chains in the Genus database with same CATH homology
 3UU8 A;  3GUA A;  4PIR A;  3WTH A;  3WTL A;  5HCM A;  3WTJ A;  3WTO A;  4ZZB A;  4QAA A;  3TLT A;  4QAC A;  3WTM A;  4AFH A;  5AFJ A;  5IUX A;  4UM1 A;  5L47 A;  5LG3 A;  3UUB A;  3UQ7 A;  2XZ6 A;  2YN6 A;  3JAD A;  4HFB A;  4ZK4 A;  3UQ4 A;  5J5H A;  4Z91 A;  4UM3 S;  2WN9 A;  4TWH A;  2XQ4 A;  4HFC A;  4A97 A;  4TNV A;  5KE4 A;  3TLS A;  4DBM A;  2YMD A;  4LMJ A;  3U8K A;  2XQ9 A;  4BQT A;  4ILC A;  2BYP A;  5BRX A;  4ILB A;  2BYQ A;  4Z90 A;  5AFN A;  4TNW A;  2XYT A;  4NZB A;  4BFQ A;  2BG9 B;  2C9T A;  3LSV A;  2XQA A;  2ZJV A;  5AFH A;  5HEH A;  5AFK A;  1UW6 A;  2XNU A;  2XQ7 A;  2Y58 A;  4HFD A;  4XHE A;  4ZRU A;  5HEJ A;  2ZJU A;  5AIN A;  5AFL A;  3JAF A;  3C79 A;  4HQP A;  3WTI A;  4B5D A;  2W8F A;  2BYR A;  4FRR A;  3RIF A;  5CFB A;  3EHZ A;  3U8M A;  2BYN A;  5L4E A;  4LML A;  2XNT A;  2XQ6 A;  4HFE A;  1UV6 A;  2PH9 A;  3U8J A;  5HCJ A;  5AFM A;  4UXU A;  4A98 A;  2XYS A;  2BG9 C;  4TWF A;  3IGQ A;  3SQ9 A;  3UU3 A;  4IL9 A;  5KZU A;  3UU4 A;  2X00 A;  2XZ5 A;  4COF A;  3UU5 A;  5TVC A;  4ZZC A;  4QH5 A;  3SQ6 A;  3WIP A;  5LXB A;  2YOE A;  3PEO A;  1UX2 A;  4QAB A;  5JME A;  2BR7 A;  2W8G A;  4ZJT A;  3P50 A;  2BJ0 A;  2XQ5 A;  4ZK1 A;  3U8N A;  3T4M A;  3RQU A;  3TLV A;  5CO5 A;  2WNJ A;  4F8H A;  2Y7Y A;  4UM3 A;  2WNC A;  2UZ6 A;  4LMK A;  2XNV A;  2PGZ A;  3ZDG A;  4EZ1 A;  2Y54 A;  4IL4 A;  5SYO A;  4AFT A;  5HEO A;  3EAM A;  3RQW A;  3TLW A;  4ILA A;  4ZJS A;  3SH1 A;  2XQ8 A;  4IRE A;  5L4H A;  2BR8 A;  5HEG A;  4D01 A;  4HFH A;  2Y56 A;  4XK9 A;  1I9B A;  3RHW A;  2BYS A;  3ZDH A;  2XQ3 A;  3P4W A;  2WNL A;  2BG9 A;  3EI0 A;  5J0Z A;  4X5T A;  2BG9 E;  2Y57 A;  2YME A;  4ZR6 A;  3TLU A;  4QH4 A;  5J5G A;  3C84 A;  4HFI A;  5HEU A;  4WV9 A;  2QC1 B;  3WTN A;  4TWD A;  4UY2 A;  2X00 D;  2YKS A;  4NPP A;  2VL0 A;  5AFM B;  3ZKR A;  5BW2 A;  3RI5 A;  4UM3 P;  5FJV A;  5J5I A;  5J5F A;  4AFG A;  5BP0 A;  4ALX A;  4QH1 A;  3UU6 A;  2WZY A;  3SIO A;  3WTK A;  3U8L A;  3RIA A;  3JAE A;  3PMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...