4B5ZA

Structure of the apo-rfnbpa(189-505) from staphylococcus aureus
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
310
structure length
310
Chain Sequence
GTDVTSKVTVEIGSIEGHNNTNKVEPHAGQRAVLKYKLKFENGLHQGDYFDFTLSNNVNTHGVSTARKVPEIKNGSVVMATGEVLEGGKIRYTFTNDIEDKVDVTAELEINLFIDPKTVQTNGNQTITSTLNEEQTSKELDVKYKDGIGNYYANLNGSIETFNKANNRFSHVAFIKPNNGKTTSVTVTGTLMKGSNQNGNQPKVRIFEYLGNNEDIAKSVYANTTDTSKFKEVTSNMSGNLNLQNNGSYSLNIENLDKTYVVHYDGEYLNGTDEVDFRTQMVGHPEQLYKYYYDRGYTLTWDNGLVLYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence for Steric Regulation of Fibrinogen Binding to Staphylococcus Aureus Fibronectin-Binding Protein a (Fnbpa).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus nctc 8325
molecule tags Cell adhesion
molecule keywords FIBRONECTIN-BINDING PROTEIN A
total genus 74
structure length 310
sequence length 310
ec nomenclature
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b5zA01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b5zA02
3IRZA 4JE0A 2F6AA 5IHWA 4RMBA 2YLHA 3IS0X 2F68X 2Y7LA 5CF3A 4BBWA 2VR3A 4F20A 3AU0A 4MBOA 4Q6KA 4MBRA 4B5ZA 2Z1PA 2Y7MA 4JDZA 4F1ZA 4F27A 3AT0A 4LE8A 4F24A 1R19A 2Y7NA 3IRPX 4LEEA 3ASWA 5CFAA 4FJ6A 4LEBA 1N67A 4JDZB 1R17A 3V10A 4B60A 2Y7OA 2RALA 3IS1X
chains in the Genus database with same CATH superfamily
3LPOA 4HEPG 1QHPA 4N9GA 1CFSA 3MREB 4AQ1C 1AXSA 3QDGE 3UZVB 5CN3A 4KO5A 4ANUA 2OA9A 5E8OA 1L3NA 1NBVH 4X80L 5E2WH 5IB5A 4AMWA 1RUKH 3KLDA 4W9GC 4JO5A 5B39G 2N56A 1T89C 3AC0A 3FTYA 4TRPH 5ABAA 5FWQA 5GGUB 3QFGA 3C6SB 5EU7C 2FL5A 4MMZB 3B9AA 4KO7A 3WFEH 2ICWA 2FIKA 5JOEA 5MEND 3C6LD 3AMKA 4ZMLA 3PDOB 4HMEA 2L7EA 5F3HB 1AVAA 1JWSA 2DB8A 3K71B 2VT0A 4CRPA 2A9CA 5SV3A 4ZOAA 4E9YA 2YAQA 2R51A 4UNVA 2EEBA 2ZP9A 2L7JA 4N2LA 2YBRB 4WFHD 2JH2A 3H9SE 2JJVA 3DHUA 4FEMA 4Y4KA 4M02A 2V7NB 1NEZG 4KRPC 2VLLA 3UFIA 4MJ4A 3II2A 4AKQA 1P7BA 2VSDA 1HAWA 4AT6B 5AYUL 4FGMA 5ABDE 2XZCH 1AHWC 3NIDB 4XMZA 3FNKA 4AL8L 4HIEB 2X4RA 2DWDB 1MPAH 1H3UA 3QYCA 4FMKA 5IB1B 3TCLB 1F58H 1HL5A 2OLDA 2DIEA 2QGCA 3D4ZA 2P8PB 1WRFA 1Q9WA 2IPUG 2G75B 4QTHA 3Q2WA 3QUHA 1TYRA 5HDBE 4FG6D 2FAUA 4JB9L 3VQ1C 2A6JB 1IAOB 3GXIA 3O2VH 4HV8B 4JFHD 4JDZA 3R8BB 5BUAA 2YPKA 4NENB 4PN6A 1MXGA 3FQ4A 4FQHA 4KKPA 4DP1X 3EG9B 1NGWA 3ZIMA 3GSQB 3LD8B 5L88L 2YAEA 5K33A 1HHJA 3OBAA 3T5WA 5TDOA 2EDFA 2WWNA 2FHCA 1Q72L 4NRXA 5TE6H 2J6EH 1F90H 2F5AH 5GGVH 1J9TA 2JELL 1SXSA 3AROA 3DSNB 1C8QA 1XHHA 3ARGD 3WN5A 4QHKJ 4OLWH 1W72B 3EJQA 2DYPD 1IGML 2VM4A 1I7RA 3K80A 5DA0B 3NN8A 5CLZA 5FXCH 3MBWB 4TNWK 3ZO0A 1RIHH 2AK4D 3ZTCC 1TYEB 5KG9B 1R3JA 3RHWK 5BRZE 3EBGA 3SKJH 4UNTA 1OVZA 3LNIA 3PNRB 2HKFL 2P47B 4HZ1A 2KQMA 4NGHL 3VRIB 2D3NA 4KNQA 3HZYA 3HFFA 4E2OA 4MHHI 1GJIA 4MMXB 1IO4C 1U91B 4J1UB 2EDWA 4LAQH 5DI8B 5I0YA 2MMXA 2ZSVA 2QV2A 1FUNA 3LN4A 3MAWA 4JFFD 5AVYB 3UAJA 4HU8A 5GS0C 3L9EA 4GJTB 4OJEH 1K3IA 1AI1H 1MRFH 3PRZA 4NKQB 3RFZC 3G08B 1VF5C 2R9HC 3LDBC 4X4ME 3F5WB 1PX3A 1L5GB 1MQKL 4WWKC 4JFPA 3OHXB 1AGBB 1EBPA 4GUCA 2ZOKB 2ZAIA 1HL4A 3SE4A 3TCTA 3KPLB 1T22B 4YBQC 5CD5C 4G43A 4LSDA 4OF7A 3C09C 2V5TA 3TCLA 2BRQA 5FW6A 1OXYA 4IS6B 4U1NA 5C0NC 4HV8A 2O6CA 1D7CA 1MUJA 4GRMB 4KKBC 4PJ8A 1RPUA 1KUMA 4LSQL 1TTBA 5DJAB 1NC2B 3IBEA 2OL3L 4MCYA 5I26A 4EZKA 1YEKH 5BMFH 2ZP8A 4MHHG 1MLBA 3FN0H 4BFEA 4XZ4A 4JL1A 1Z5LB 4X6DE 3LOWA 4JQIH 3RA7H 3T3ME 4ZUSA 3QNZA 4JO3L 1BF2A 1FO0L 2VDKH 3O4LE 1D9KA 3N06B 4J3OF 3EFDH 2NZ1A 2P46B 1AP2B 1NMBL 2FYYB 5BRPA 1JNLL 4AG4H 2EEDA 1QLEH 1AOHA 2FGWH 1E4JA 4K5LA 3A6BL 5BS0E 3TWCL 2ZG2A 4KX8A 3W2DL 1BVKB 1JWSB 4NOFA 3BMVA 2E4FA 4DHLA 2IXQA 4AJ0A 2JJSA 1SBBA 2IDSA 1GW0A 2OR9H 3NG5A 2OZ4L 2VXQA 3P0YL 4ZW6A 2BDNH 1MFUA 3ASNB 2GJZB 3BEVB 4MMYA 4JREB 2YUVA 1TMCB 2WXKA 2YMXL 4ONFL 5IHLB 1ZT1A 3MCKA 4K8RC 4HLEA 1ZA6B 4YHOL 1SJEB 3G08A 1KJMA 1WS8A 2FUTA 3EOYG 1NGXA 5FYJU 2J6WA 4LLMB 5HYIA 2AXWA 1CFTB 3AY4C 2AJZB 3FXIC 2E9WA 2FD6H 2O5XL 4MGXA 4ZAKD 3UG5A 5CXPA 4Z76A 2EUXA 3K46A 4HFWA 2YD4A 2VUKA 1QSEE 3CVIH 4JRFA 2D9CA 2G75A 3ETBF 3GPSA 4W1TA 3ABMB 1USQA 2HJLA 2K6YA 1IM9D 3D2UD 2WQVA 3N44F 5KSUA 1E40A 4JGNA 1UD3A 1CGXA 1NSNL 4X6BA 4LT7A 4KNSA 1HSAB 1ND0A 5AAWA 1I8LC 4NKOB 3F7VB 3T0WA 2FSEA 4UMGA 2XVKA 4O2EA 3BFQG 2IH3A 3PJSB 4F7PA 3VG9B 1LDPL 4R8WH 5FPIA 2DH2A 4HJTA 1GYAA 2AEQL 4K5NA 4KQ4L 5HHMB 3ZO9A 1QLFB 4A38A 5D1QB 3O11A 5F88B 2IANE 1P7QA 1KIQA 4XXCA 3FONA 4BFBD 3VSTA 1X5XA 3GMRB 2EVHA 5IJKA 3NCMA 4DTGL 5BS0A 2JTDA 1A3RH 4NO0D 4JB9H 4PJIE 1SMOA 2OULB 1KBKA 4QHLB 4NHCL 3WNMA 4W9EC 3NRFA 4QAMB 5DFAA 5ID1B 4M6OH 4EOWH 1MCLA 1KFAH 1HILB 5AOZA 1ECYA 4I2XB 4UM8B 4XWGH 2QQNL 2DY2A 4N8UA 1S9WB 1PF3A 1GOGA 4X6DA 1KCSH 5D5ME 1S7SA 2WWMC 2WVUA 3O2DA 3ULUC 5JXED 2RB8A 5IZ7A 4OFIA 5ID0B 2AXFA 2P80D 4WEMB 2L7QA 1T21A 1ZHKA 2CHXA 1ZT4B 4YDLB 4CSPA 3MCKB 3IJ9A 5I17B 2EO1A 2BLFA 5J12B 1U8MA 3MBEB 4ZS6C 3FO0H 3CLEL 2IDTA 3GSOB 3S48A 4L4VE 1YRKA 1E4WH 2DI8A 4B3EA 4DGVH 4Y5YA 3ABKB 4NAMA 2VDLH 3K4DA 2WMPA 5DF0A 1WAAA 4Q6IC 3ARWA 1MH5A 1PLAA 3BPLB 1AQMA 3DTUB 3L5WA 4J8RB 3UDWC 4LIQL 2JI1A 1A6TB 5I16B 1PMYA 3T65B 5E8NB 3I84A 3WUWA 4BELD 5I0XA 2YR3A 4JKWA 4GUPA 2Y5QA 2IPKB 1F90L 3Q9PA 3BAEL 1A1MA 1PNCA 2VAAB 4HEPA 4HA1A 3HR6A 3QJHA 3HG2A 2QR0A 1GZHC 4AUYA 1J8KA 3A6OA 1QNZL 5C08A 1SGKA 3HR5B 3KM2A 3FCTA 3T1FB 2CJ3A 2LLGA 3CVBA 4TSBL 3MV9E 4IOFD 4Y9CA 4XPAL 5DJ8B 5E2JA 1HC1A 1E9QA 4PJIA 1TTAA 5CCHE 2ARJA 1H9DA 3C87A 3SKOA 1QUPA 1N5YL 1G6RH 2AITA 2OW6A 3U7YL 2HP4A 3MV01 5INDB 3F2LA 2VDQL 3GSRA 4PYHA 3VWKA 2H1LM 3NCCB 4JPQA 4PM1A 3HMXA 2LLLA 4UYQA 4ZNCD 5B4MC 3T6XA 5D7JA 4YSCA 5ES4B 3DOSA 1WGOA 3C60B 1M71B 4LPCA 3RDJA 4TVPD 1S8DB 1DLFH 2Y06L 4KMLB 3IDXL 2AK4B 3ROOA 4FA7B 1MAML 4K5MA 3U2SB 1H5BA 2VDNB 4LRNH 2UX7A 1YMHA 3VGAC 2QQNH 5CLYA 1IAII 3SDCD 4P3CL 3HVDA 1T2QH 3VQMA 3B2XA 4LCIH 3VUAA 3Q43A 3APCA 3B7YA 2JJTA 4DVRL 3HZ3A 1HL8A 3RPKA 4UQAA 5E8NA 3WUWB 3HG5A 1QFWL 3QQDB 5C2BH 5AG9A 3QR0A 2ZCKL 5KOVC 3CFCH 4JRXD 3FFCB 3PYCA 1EAQA 1JDCA 1UM5H 5LAPA 1SOXA 3Q5YA 1SUJA 1NDMB 5TF1H 1MVYA 5K9JL 1QVOA 1TTCA 3GHPA 4AQ8A 2ZWKA 4MMZA 5LN4A 2CM6A 4W9LC 2R1XA 4PGDB 4WUUE 1I1AD 2OFQA 1SJHB 2JCWA 4N2NA 4X5QA 5HI3D 1K9TA 3NJKA 1Q9OA 1YUHB 5EU3B 2FNWA 1NMCB 5I8CA 2CU9A 4JHVA 1N5AA 3WFDH 2WLMA 2VZSA 2XFXB 1QSED 2DEXX 5DZVA 3WV0A 5J4MA 1CLCA 4LSRH 1E9QB 5AB9A 3ZXAC 1T04B 2WYZA 4Q52A 4PJ8C 4L8DB 1HNYA 4FFVD 4XMKH 3RP1A 2P8MA 1OAQL 4G7RB 1D5MA 1FGNH 1EEZB 5KS9B 1VEMA 4OZHA 4KI5D 3BSHA 2WPGA 4GT7A 2IGTA 3JUZA 1JZ5A 4ELKB 3L1GA 4Y4FD 4LSRL 3QEHB 5J6SA 1TJMA 3WYRA 2FECL 3DTDA 4ZX3A 4PRHE 2OL3B 4NUMA 2A74B 4W9KC 2IF7A 3ZGHA 3D05A 1DDHA 1U8QA 3DX1A 4N3TA 4Q6YA 3MUGA 3WXVH 2GW5A 3UROR 1H6TA 1M4KA 1N0LB 2EDLA 4UT9H 3FCBA 2F54E 2AAAA 1WYJA 3ZKMC 2X9XA 1GTNA 1E67A 3HS8A 3IJ8A 3GQFA 1Q38A 4MDIB 4NPJA 5DWPA 4ZZKA 4PJ5E 1PGRB 5CMAB 4YXHH 1SJVA 3QXVA 4HGMA 5HYSB 1P5UC 3I3DA 4N8CH 4X98A 4MCNA 4OGYH 3EYVB 4OM1L 3MV7A 1RK0B 4Z7VA 2YPLA 2X42A 4LE8A 2JLPA 4F27A 1P2CB 1FL5B 3IRPX 4BH8A 1WAEA 3ORJA 3W0WA 1ZSDA 5E4EB 2VDRH 3HG0A 1A4CA 5DU7A 4P3CH 5JORA 3QIBC 4JM2D 1FAKT 3MLTB 5HSFA 1G4RA 1E6OH 1KTLB 1R3LA 5DHYA 3LXCA 3H1ZA 3AGVA 1INQB 1OP9A 3V2AR 1DVFC 4M93B 3MUHL 3FU0A 3TPUA 4P46A 2ARJB 1OTSD 5MERB 2YKLH 2XTJE 4PG9A 4YSQA 4HALA 2CR6A 1A5FL 3ZE0E 1R33A 5EBWA 4CILA 4CN4A 2QADC 4XC3H 2YHGA 2KUTA 3WLBB 3ETBJ 3TPKA 2PCFB 3PIQB 3U82B 3FO2B 4JKNA 3V4UL 1K8DA 4YAQB 1HOCB 1NAKH 3VACA 1BVKA 4QRSB 4ZFZB 3UTQA 2HH0L 4J8QA 5DVNA 1R5IB 1AO7A 4XWOC 4GUPB 4Y5VB 1KGIA 2APVA 4N28A 2WKLA 2BIPA 3V9FA 3LRHA 2KL6A 2MKLC 1ZRUA 4Y5XB 1NOLA 1KG0A 3UEQA 1HINL 3F7KA 2RFXA 4WKXA 3HMXH 2C9SA 4TOYH 4DGYH 5DS8A 3L5HA 5HYQB 1E4XI 3QNZB 3WIAA 2AS5M 3BW9A 5IOPB 2NUPB 3HOGA 4CU6A 3VXUD 4OJYA 2IPTH 4LLVB 3H55A 2FEDD 1Q9LB 5D72H 4KRPB 5E1AB 2WWOA 3C5JA 1ETA1 4I48B 4XAKD 3LS5L 4Y8AA 1V7MH 3U1SH 1W80A 3FQTA 2EC9U 3ARDA 4X7TB 4WUKH 1HE7A 1A9EB 4PP1C 1XXFC 4DQAA 2WZAA 1D5ZA 1DP0A 1WTLA 3DGCR 2ZUQC 2H26A 2UZIL 1JAEA 4MAYA 1N2RA 1FZJB 2IV8A 2XN9A 4G9DB 5C97A 2VQ1A 1BGXL 4GLRH 3GSWA 2CKBB 2O5NA 4WDIA 1HXMB 3FQRA 4MX7B 1TJXA 3S2AA 3HI6L 4FQIL 1YY9C 1ZT1B 4XTRC 4HW6A 3T4YB 1MFAL 4Z0BH 3GKZA 1NL0L 2WXNA 3QG6A 2WQRA 3BEVA 2EVGA 7FABH 5CD5D 1F3RB 3H7LA 3WELA 1AR1C 3MRJA 1FNGA 4JHWH 6PAZA 1KXTA 1KMGA 1A4JB 3QQNA 1N7MH 2EACA 3BSZH 5ILTH 4PWJA 3OPUA 4Y4KC 3CPLA 4LK4A 4Z3HA 3BAKA 3QUML 5EN3A 3OMNB 4NWUL 4XX5A 3M8OL 6FABH 1K4CA 3QDME 5DD5L 3LMJH 4P23D 1BJMA 1MNNA 4QRSA 4D7BA 5B7EA 4NHCH 35C8H 4L4TA 1MRDL 3F04A 1UTDA 2XWTB 1PSKH 4N2BA 3IJHA 4CMHC 1SXAA 5LVEA 1AO7B 1A21A 4Y5VA 4EXPX 5LGYA 1V10A 2O1AA 4LAQL 4OZFH 4R7XA 4RESB 5DVMA 4Y5XA 1A3LH 2FT6A 1OF2B 2YA1A 1RZJH 4M7JL 1IC4L 1QLFA 2FO4B 4JJ5A 1ZWIB 2NY3D 4H88H 4PD4K 4JUSA 4Q0XL 2V17H 4ODHH 4KK6C 1MCOL 5ETUB 4AGQA 2BHYA 4UV7H 4DAGL 2UWEB 4N0UB 4QJ4B 2OJZH 1AD9B 2BP8B 4Z9KB 2DL2A 3HI1A 3UDWA 3T0XA 2X4UB 4AGPA 4OTXH 2EXWC 4YFDB 1HIML 1HFUA 3NDZE 2PTTB 2BHFA 2BFVH 1P2CA 4AMKH 3VTAA 2HRLA 5LAXA 1CD1A 5TDNB 4G2AA 1AAJA 2VERN 2JELH 1OP3K 3HB3B 4NUQA 4KZEL 3MLTA 1GVIA 1MZZA 1R3IH 3O0LA 5D1QD 2FB4H 1T66C 1J1OH 1BZ9A 5JDSB 5J11C 1QTYT 1J87A 5CP3H 2XJKA 2JMRA 1DBJL 4AM0B 4M5YH 1IVTA 3DPBB 5BRZD 3O6FD 2H1PL 4OGAC 1X3DA 4YO0A 4S1QL 3V4VL 4Z7OE 1CZ8L 5D71H 5EZIL 4R4BB 4WU5B 2L0DA 3GKWH 4MMXA 3MV7E 3WO4C 4P5TA 3ZDXF 3FOLA 3P4OA 3PHSA 3P3YA 3KBEA 4IU3A 1BA9A 5GISL 5I1HL 4E41D 2XPGA 4LKCA 4UT6H 1ZK9A 3RVVC 2DQEL 3C5ZC 5CSGA 4M93C 1PKQB 3S36X 4GXFA 1GGCL 4MDIA 4KPHH 3WTYA 5CF3A 4JN1L 4NUGH 5ENWB 4LO9A 2V4LA 2OTWB 4NZRL 3LKPB 1ROWA 3HUJF 1ZEAL 3EDFA 3E3QC 3F6IA 4XN8A 2P45B 2DJUA 2WTRB 2VKXA 3V6OA 1NL0H 2CLRB 3BUBA 4LEOB 4MSWB 1WITA 4FQHB 4RFEA 2YPKB 3BWZA 4R7NB 1IAKB 5HJ3A 4MA7H 3R7QA 3C6LC 2H41A 5KSBF 1J0IA 3S37L 3UYPB 5BZDB 2X2IA 5IB2B 1Y18B 1EFQA 5J3HD 2ITCB 3CZGA 4LHUA 3DRTA 5C07E 2YXVA 3KLAB 3QI9A 3VD3A 5E6IA 4XHJD 1RVFH 1R5WB 2NCMA 4KRNA 5DCCA 1NLBH 2H26B 1PZ2A 4FFZA 1E7VA 4PR5B 3S7GA 3CHSA 3WEXB 3WDIA 4E9QA 1J1PH 2PTTA 3P73B 3TH3T 4AKOA 4U7MA 3X14A 2R4RH 4KROC 4AQ1B 1UJ3B 4NZRH 3FK3A 3SQBB 2MOVA 1FP5A 4WUUA 4LSTL 3MRLB 3HZYB 3RB5A 5DK3A 2YAHA 3QA3A 4ZOBA 5IF0A 4LDEB 4RGND 2DQDH 2EYSB 1U92A 2MQ0A 2ERJB 4OZIB 1A3ZA 3H3PL 5L2KB 3TVMD 1MIEH 5SX5H 3CPLB 1YMMA 4F5CE 4NM8L 5IFJB 4FAAB 2F8XC 1V5JA 3J7HA 5CEYB 5IQ7L 1NPUA 1UH4A 4FTVB 2QL1A 4HAKA 2DQGH 2HCZX 5ADOH 5DQ9A 2C7UB 3DXAD 2Y6SD 3IJHB 2C1PA 1MDAA 1F3DH 2QVKA 4F33A 3BT2H 1W72H 1EJ6A 1PJWA 1NBZB 1UT1A 3QUYD 5F9WB 2CK0L 1ZS8B 2LE9A 3GSWB 4IK7A 4TPRH 4WDIB 4ZJ9A 4MJ6B 3VWJD 1GAFL 5IB2A 5CKAA 1DANT 2R23B 3T6VA 2E46A 3BIKB 4KXBA 1G1CA 1CXKA 4IU2B 2B5IC 2UX6A 5T5FL 3T0DA 3QG6B 2AFNA 4KZCA 4Y19E 1QQDA 3RNQB 4N1CA 4E9SA 5JHDD 3VD1A 5EDSA 4L3AA 1UM4H 3QFDA 3KXFB 4TNWF 1U8NB 3GMRA 4XVUC 3D69B 3DOHA 1KENH 2NY0C 1IBGL 1KV7A 4JFYA 1WHPA 1TLKA 2JJUA 3KNBA 3QDGB 4KTYA 1OD7A 4NQVB 1P9MA 3QYMA 5KJ4A 4WWID 1IGYA 5TPWH 3PQYA 5EN2B 1EDQA 3VGGA 3M17A 4V1DA 5TQ2H 5I71B 4ACTA 3O4LB 1XIWA 1C1EL 1JYXA 4PGCA 5EA0H 3IMUA 4CU8A 1JOIA 4LASL 4LLQA 2D0FA 3UZQA 1GW6A 1W0WB 1GC1C 4ZMVA 2E9BA 1NFAA 1DDHB 1U8QB 2OMUA 3H4FA 2NR6D 4HIIA 3HG4A 4GQZA 1T21B 4TF4A 3HI6H 1W6LA 4FQIH 4EQ3A 3MACL 2WLLB 3QJUB 3VRLF 2A73B 1I82A 3FUKA 3L5IA 4XCNA 2PPDA 5D1ZA 3NIGB 4MDJA 1MCSA 1R3IL 3MLUL 4OM0L 3RJQB 5F9WC 4E42B 2WLKA 1GGBH 1BZQK 3MRFA 1XB3A 1OZTG 5LAXB 4MNQD 2DLGA 2Z31C 2J1ZA 5D2LA 5CGYC 1MCWW 3MRGB 4ZMAT 1N4XH 4ZK8A 5JUEH 1XIWC 4G42A 3H6AA 1EHLL 3JV0A 1XD1A 1FNFA 5DUPH 4HBCH 4XN1A 5HJDA 3D33A 2I27N 1FSKC 2FDBP 4YHMH 2JKWA 1MOEA 3KJ4C 5E6IB 1CIDA 1EO7A 4HWBH 1IC4H 1A1OA 4QXVA 1AG0A 4Z5RA 3FONB 5LXVA 1PU0A 3QPXH 1T2JA 2O6DA 5DRXB 3AT9A 1R34A 3TONA 3O81A 4GXVL 5HHNB 4JFZL 1Q9LA 3FUEA 3FYIB 2PPAA 5AWNH 5KYXB 1IIKA 1TJHH 4KH9A 4FYQA 3GEWB 1MF2L 5JHLH 3QDJB 1IC1A 2WANA 4KXZI 4FJYA 1XEDA 3D4CA 1QO3A 5DTFA 3BH4A 4TXVB 1BW8A 1BZ7A 3DPDA 3IYLW 4DGVL 4ZFZA 3L81A 4F7TA 4JZNB 1AQHA 3QB7C 5FYJL 1YG9A 4K2UL 3UZQB 1T7WA 1BLNB 2BVTA 1Q4NX 1XDTT 1HKFA 3FPXA 3ZDZE 1V05A 1MCWM 5EOCH 4G8FB 5ESAA 4P2OB 5EOQL 2AV7B 1R5IA 3NTCL 5DD0H 4AYSA 4N9GB 5EF3A 4M03A 2RBLA 1DVUA 2VR3A 1Q8MA 2I9LA 2AMUA 5I1KL 5K1NA 4PB0L 3P0GB 4DUXA 4PJDA 4ZO6A 4Q14A 2JQZA 5EIIA 3OHXA 4NNXB 5JW3L 5I6LA 4MNQB 3HRPA 5EIVA 2N01B 1XCWA 2Y1VA 1JPTL 4D9RE 2NXYC 1X9UA 1D5ZB 1E42A 3RGVD 5C6PB 3BP7A 3W2DH 1RUKL 2VUYA 3MRGA 1HQ4B 3HG1D 3LS5H 3O8XC 5I6XC 3ZKXB 5D2LB 3KWUA 2WVSA 4O2CA 2KLRA 3I6GA 3IETB 2NDGA 4YWGH 4A6YB 1EHKB 4CVZB 3QUZA 5FM5M 4YXLL 2BK8A 4A7GF 2ZOTA 4PRDB 3DX2A 2HX9A 5T1KD 4F7CB 4JQIA 5FO9A 1AG6A 3WDHA 3EOAA 4RIRB 3CDZB 1WISA 4IKJA 4L1LA 5T33H 5GIRA 3ZE1B 3MNWA 4E9RA 2GAZA 4JRXE 4AQOA 4XNQA 1QVOB 4S0TD 3RVUC 3PL6D 4TNGA 1GY2A 5F89A 2EYSA 5SWSA 2A9ML 5HYEA 1YJDL 2JKLA 1BSIA 2VLLB 3P2DA 3QDJD 1B0GA 3R19A 3L4VA 4PJCF 5ESQB 1NDGB 5HDBF 5CEYA 1IFRA 4PGEA 4ZI8A 3K6NA 3LVEA 5JPMC 2X2UA 3O4LA 3IDIA 2VLKE 3DJSA 4I77L 2O6FA 1NFIA 3MRRA 1JBJA 2ZAGA 2A83B 4FFVC 4GBXC 4XC3L 3SO3C 4AKPA 5I2IA 2CMRH 2QHRL 4C4KO 1CYWA 1D5MB 2HJKB 2B59B 5CR1A 5E9NA 4QTFA 4XOCA 4B60A 3IN2A 1UA7A 4H8VA 5DLMH 2C5DC 5DQDH 5D96B 3RWEA 3LX9A 2HFTA 4FHBD 2D3VA 5T3XH 3Q06A 1M1SA 4LLMA 4XAWL 4EIGB 3RVUD 1JVLA 1KULA 1LEGB 5FECB 4MA1B 3ARFD 4QLRA 5C0RH 2NNCA 4WEBL 4I88A 2VJ0A 3S97C 3V9CA 3QRGH 3WE1A 1D7FA 4KU1A 3RTQA 5F3BB 1MCNA 3ESNA 3ZZ1A 3RY6A 3HNVL 3FPYA 4PUBL 2I60L 1PJ9A 2DKSA 1NKOA 2LU7A 5I5JA 1YPZA 1CI3M 5LDUA 2VLJD 1FZMA 5MEPB 1ZXQA 4HIHA 1JIBA 3LV3B 3RDTD 5E9DB 3WJLA 4CU7A 2F15A 3UACA 5B7MA 2I07B 2ATPB 3OG4B 2IAMA 3CFJA 5CJXC 1NEUA 1TZHB 4BZ2L 3WFHB 3BZFA 1IILE 4L29B 4MJHA 3HAEA 1G7PA 1T89A 5GHWH 2QADB 2QMJA 4WHDA 5DMIH 3HHRB 4WI0B 4MA1C 3QUMA 2K3TA 2JKIS 1AS6A 2FJUB 2J5LB 1XCQB 1U41A 4L9LA 2W9EH 5IVOA 1QAWA 1RJYA 2GQHA 3UO1L 4E68A 1P4IH 4XVSL 3IJSB 1CDHA 4MQ7A 1WBZA 3S88L 1EEYB 4JDTH 2AEPL 3QXAA 1J5CA 5EFIA 4YAQA 5SX5K 1UASA 3FHAA 2CPUA 2QVTA 3AWFA 3QQ9C 4XGZA 5B3JE 3G6JA 5H4ZA 1U3HD 2GIYA 4AYFB 1D6VL 4L0PB 3EJUA 1SMDA 3FL7A 4YXKH 4W9JC 3ZYZA 2GC7C 1SOKA 3N1MC 5E00A 1IT9H 3FRPA 1ACYL 4GRWB 3S3BB 2PTUA 2UXVA 1KJVA 1UQSA 2KDGA 4PCYA 2BVPB 3MOBH 2FWLB 4WY7H 1G4MA 4KUZH 3ZE2F 4UDTA 3EADA 5FKAA 4EF3A 2ZX8A 4HJUA 1Q0EA 2J5LC 3QT2A 4LLYB 4KZEH 3UAAA 3ILPB 5G4NA 3MLYL 1CD0A 4ZXBC 2Q8AH 5TFSH 3HZMA 2YRZA 4YHIA 4A2EA 4PH8A 3FFOA 4PU2A 2FX8H 4O58L 5KAQF 4W9FC 1BZ7B 3C8HA 3ZY7A 1EWHA 2A1WH 4R90H 4KGLA 5F3HA 5HDLA 2NQCA 4L23A 2H6OA 4PRIE 1KCUL 5C8JB 3OAUL 4H88L 2FTAA 1T5WA 4FFYH 5JIPA 4HG4K 2ICWB 2RCSL 3C5XA 1GSMA 1VERA 3IGAA 4P5MA 4RZKA 3SOBH 3V55A 3VXME 3WN5C 2V2TB 4QT5A 2VC2L 3SIKA 2J8UA 2QKIC 2B1HL 3SE8H 3WY4A 4BHUA 5F9JA 1QSZA 3NZSA 1GYCA 2CO2A 2X9YA 1CPUA 2Y25A 2X4NA 4Z7WB 1KIUB 4FXKB 1LQBC 3D0VA 5CEZH 5AVXB 3IPBA 3U6RB 3U79A 4NPYB 3QUMH 1DJIA 2Y23A 4YBLB 3KXFE 1NCBL 5DD5H 5HYJA 1R17A 1EZVY 5E6RB 3MRJB 3KNBB 3QDGA 1R0AH 4PBVC 5FDWB 2YGNA 4ANXA 1HHHA 2LGNA 1QG3A 2ARJQ 5E5LA 2VMFA 4ZBJA 1EFXA 1IAOA 4D9QE 1FNEB 1R24B 4JHWL 2VXVL 1YQVL 3G6JB 3QJSB 4GFTB 3GHEH 3VD9A 4H0IA 5I1CH 3AG2B 3VW3H 5HPMB 3WMSA 4XNUH 2OCFD 3AAZB 4F93B 3VWKD 1PD6A 2CRZA 2R1YB 5C0AD 2LVEA 3ES6A 4GBXB 4JG0L 3A4DA 3A22A 3BW9B 2YD9A 5DVPA 5IOPA 4RLDA 3HBGA 1LEKA 1KLGB 4NO3A 1PBYA 1Z9OA 4WGKA 2X38A 3QEQD 4NQXB 4ZMXA 1QFWM 3KJ6H 2ADIA 5H37A 4ZX6A 2G4GA 4FZEH 4YE4L 4APQC 4RAUB 3B2MA 3VNZA 2Z0UA 3RL2B 1BQHG 3ULVD 3NN8B 5BQ7A 1AJ7H 1FORH 1WEJH 4V1DB 5DZJA 5C08D 1L0YA 2Y07H 1HWHB 4F15C 1N0XH 4PD4J 2ROXA 2WZPA 5E9DE 4UQ2A 3RVXC 3R1GL 2PWFA 5E6SB 3KYOA 3ZDYF 2D73A 1T1ZB 1RJLA 3CC1A 5ECGA 2XV0A 2HMIC 3ELQA 1UEMA 1H15B 2X53A 4X4YB 1QX1A 4MQSB 4AENB 4Q2ZB 3BJ91 4R96B 3WLWC 5E2UH 4F9PA 1XF1A 1NCAL 2JVUA 5TPWL 1GJUA 1QSVA 3QJFA 3ZE2B 2ZWSA 4PBDA 1KSRA 4JFEE 4ONGL 3V4UH 2YK1H 2EXYD 4JFPB 4FKKA 2FLBT 4YIQB 4MDJB 3GM8A 3NZHH 1OOWA 4ZSOB 3TWCH 2ZKWA 4EKXA 4AYFA 1FNSL 5SWZD 5IM7B 4G43B 4KMQA 3DXAB 2JFCA 4N0YH 3ULVL 2Y7SA 1LD9B 5HGAB 3UTZA 1CS6A 4ANVA 1WWCA 3GIZL 3I02B 2A77H 4CW1B 4JJHA 4QTIH 2MSPA 2V2WA 3M07A 2C4FU 2WN2A 5L8KB 4OV5B 5C0IB 2EVIA 1KN2L 2A9NH 4RH4A 2YA2A 5G4OA 2WUBH 4P2RE 5GRZA 4R7NA 1VESA 3PP4L 1TT6A 4NIKB 3HAEB 4NYLB 3KPSA 2YUWA 2FYYA 4YLBA 1BVLA 3JVGA 3B8SA 2AC0A 4G6AC 4UIKH 4Z7UA 2IG2H 4H0HB 4JE0A 4LCCB 1KY6A 2APXA 1W72L 1TZIB 1E9PB 4BSVA 3FB8B 3P4NA 5SWSD 3TA3C 5E6ZA 4EKJA 1P7QD 3KHQA 4UT9L 5ACLA 5BQ7B 3QDJA 4Z7OB 4XO3A 43C9A 5IWLC 3Q8EA 1IBDA 4G11A 1QBAA 5F1KC 2Q10A 3H0TB 2Z0BA 3QORA 2FYVA 2HT2C 5CM1A 3G6DH 1QA9B 1HS6A 2AF2A 5AW5B 4HC1A 5LCVH 1Q0XL 4WWKD 5F7LB 3CVHA 3S34L 2R2CA 2Z8WC 4YO0B 3EO0B 1JD9A 1M2OA 4ALAH 3ARBB 3FRPB 4X9YA 2AXJA 1I1CA 2FIRT 4FNLL 2OYKA 1JGUL 4AENA 3LKOA 5JPMA 4UT9A 1INEL 1HT6A 2ICWJ 3MNDA 5ESVA 1F8TL 3HZVB 4L8BA 5IW3A 4AL8C 5E99L 5I74B 2HG0A 4BFOA 4R96A 3NJXA 4MS8C 4RA3A 1LDSA 1DN2A 1LQSR 4WNSA 1DANU 2X4QB 4BK8A 4XNXH 2J1WA 3FOMB 2UWEE 2X12A 4N0UE 4KKRA 1QSFD 4H8WH 3EH3B 5TE4L 2KH2B 4GSXA 4LXFA 1JNLH 4TNVF 4AG4L 5J3HC 3V9EA 2W0FB 3LZLA 5I8EA 1LMIA 3L6FB 3WS3B 4W9HC 3KEDA 4RFEB 1T5WB 3DMMA 5IEHA 4I0CC 2WK2A 4XNQB 2YBGA 2AJUH 2UZYA 4YXLH 4LP4A 5C0IA 4NQXA 5KBKA 3HHMA 4TQIA 1BM7A 2LABA 5AOJA 3TT3L 1ACXA 2F54B 2VMEA 4R84A 2PP7A 2UXGA 4Z18A 4KZ0A 2GJ6B 4HJ1A 4MXQD 4QXUH 3WSQL 4ZFGL 4N0YL 3ULVH 3O6FB 4HSQA 2AEOA 4GP4B 2VGLM 4GQPH 3VXSD 4U1SB 7CGTA 1W72A 3HA0A 2P5EB 2EDTA 1EGJH 3HNTH 1NM9A 4HS6A 3CSFA 1WBXB 3C6SA 1YNKH 3TN0B 1T1XB 5MEOB 1GZHA 4B3VA 1BQLL 2GJ6E 1S7SB 1H3PH 2DQEH 1UD5A 3FT4A 3GBLA 5AZEL 2X89A 4KRLB 4UT6L 2RAMA 4KTGA 5KANI 3ARDD 4OAWB 4YVNA 2AXFB 1PIFA 5C0AE 4Y0GA 5A1AA 1HDMB 1QA9A 4EJ1C 5LUMA 2WXLA 1ZHKB 3AWEA 3BUQA 1S7QA 2A9DA 4H40A 2NW2B 5EDXA 4OKVA 4G70B 4N2DA 3T4YA 5D71L 5EZIH 2Y1ZA 3CIQA 1T66D 5FYJH 1QBBA 1BYNA 1U91A 2A6DB 4J1UA 3LSOB 4L8BB 5F0LB 5B21A 5L4MA 5ICZB 2WNGA 3FFCD 5JPMB 4M00A 1DQMH 4JFDD 5I1JL 3N41B 2ZE0A 1UKTA 4WJ5A 3KD4A 3DX9A 4JM2A 4L9LB 4YSDA 5EUKB 5BV7C 2DM3A 2GI7A 1KY7A 1AO7D 3AU0A 1YYCA 3OKKB 2GABA 3T65A 2DLTA 3V4PA 2WLHA 4NI6A 4OZIF 4HPYL 1EEYA 1MH5B 2ADFL 3GS7A 3FFCE 4PJ7E 4FNQA 4U1IA 4O9HH 3Q8BA 2JB5L 5FGCE 2Y3NA 4DZBA 4ATWA 1Q72H 1JTTA 1FGVL 2R29L 3PJLA 3FQXA 2IPKA 1NMAL 4HIHB 1HHJB 2ZZUT 2Q3ZA 1ZE3H 4JBSA 4Q8BA 1ET8A 4IRSD 4JZOA 3KLHC 1DVSA 2EECA 3FAWA 4HS8H 2R4SH 2NNXA 3HE6C 4FLOA 4Q9CA 1KB5A 4LLUA 3P54A 5TGBA 5I75C 4XC1L 3SB3A 1ZTXH 2DDQH 2F61A 5I6PA 4X50A 3WLBA 1M05B 4A63A 4O5LL 4WKZA 4CKVX 3BXNB 3MFFA 4U0RB 2QHLA 2WTOA 4RGNB 5JIDA 3CX5J 5AAPA 1J0HA 1HJCA 2NRDA 3KLLA 2VDLL 3TN0A 5MEOA 5D1XB 1DEEA 5DC4B 4K3JH 5DD3H 5AYUH 2OMTB 3MLUH 3OPZL 4CVXA 1TVBB 2GHZA 5INDA 3H2QA 3BT0A 1TF4A 3ZKXC 1UOLA 4HJ0C 4P48A 4OKVB 1FC2D 1RJZA 2BRRH 4M48L 4UQ3B 12E8H 3LHAA 4FNSA 4P2RD 5E00B 2XICA 4WNJA 2GT9B 3CZFB 1FI8C 2NUPA 1E5CA 3B4NA 3T0EA 1ED3B 2Y2WA 4HUWB 4LLVA 1BQLH 1OANA 5BJTB 5KAQG 2OK0H 1MFEH 3WFCH 3N43B 3U6RA 4ZW7A 4Y4FA 2JNZA 4G1MA 4WIQA 1KPUB 1XH1A 4QRPE 4PJAE 1H3XA 5E1AA 4BFIA 3OKKA 1KT2A 4FTDA 4AEHH 3VFUA 2MOQA 3QHFH 3HFML 1JZHA 2W0FA 1XT5A 4HGWA 1JGIA 5K93A 4WUKL 4UM9A 3JV6B 4DKEH 1CURA 1PKQE 5KSUB 3GB7A 4QYOA 4LF3A 3VFTB 1UC6A 2GBVA 4Y1AA 5AAMC 5C8JA 4IYKA 1KBBA 1HSAA 4G5ZH 1JK9A 2WXPA 2O6EA 2BHZA 3BZ4B 2DH3A 4DZBB 1E4XL 3WKPA 4TVUA 1MCIA 3QPQD 5H2BA 3LNFA 3WIIH 4Z7NB 3GBNH 2HVJB 4BM7A 1T0MA 3SHSA 3QVAA 4PSRA 5K9OB 3QI9B 1E5UI 1F4XH 2F68X 2YEZA 2Z31D 3NPSB 5ESVB 4IKIA 4JPKL 1FV1B 1NAMA 3K6IA 2QGDA 5F89B 5D55A 1UURA 3SDAC 2EILB 2HH0H 3DURB 3IJEB 1QRND 4JDTL 5I9QC 5KJRH 5D4IA 3BGFB 1BMGA 4NZTH 4HUXA 4YDIL 4MA3A 4YDZA 2NY2C 2FHFA 3FHEA 2O5YL 1C08B 3CH8A 6TAAA 1BBDL 1HDMA 4PLKD 1JMZA 1TETL 4QDGA 2W9EL 5ID1A 1U4FA 4H25A 1P5UB 3HRZA 3FSOA 4JG5A 4W68A 5DZNA 3SZKC 3THMH 2OQJB 4HH9B 4LPWA 3NJNA 5DC0A 4ANKA 3RL1B 2GJZA 5FEBA 2N1TE 3U6XA 1VACB 4NBXB 4F2EA 4MJID 1WV7T 5IW1B 3ARDC 3V0DA 2ETWA 1AS8A 1AQDA 1JGDA 1KCSL 4LKXA 1NC4D 3VXRE 1J0JA 1R19A 4NKMA 2YJLA 3HE7C 4S1RH 3LH2H 4IOIB 1MW0A 4JO4L 1LK3H 1PX4A 3TM6A 1JI2A 3C08H 4QHKI 4G1MB 5CZXD 5FUCC 3ZMNA 3M6DA 3V4PB 2EDOA 3NFNB 1IBGH 4TSAL 1KNOB 5EMYA 5E6ID 4U6YB 3JTBA 4LF3B 1OGSA 4YPJA 4GG6A 5EEXA 3EYSL 5FK9B 4UM9B 3US0A 4A6YA 3DV4A 4RQQA 4AGMA 1HI6B 2VDPL 2ICEB 3M1BA 4Y4HC 1LLAA 5BW7A 5HGAA 4PWGA 2VR6A 5ISZB 4TS6A 4ADIA 1OSPH 3MNWB 4JQIL 2QQKH 4IJ3C 1ZVSB 3FTUA 4YDMA 3WKQA 5FW8A 1JRHI 4HIJB 2X89D 1JPSH 4OJFL 4XCYA 1BDYA 5B38G 1ZV9A 2H7WA 4IBTA 5M94B 2WBJC 5IR1B 3BZ5A 1RZGB 3CGTA 4V1DD 5TTRA 1ADQL 1HN1A 4L3EB 2QTVA 1TQTA 3IDGB 1AZZC 5BOJA 5DJ8A 2ZUSA 2FX9H 3QUMB 5HHOD 1OQXA 3LD8C 1M53A 3P4NB 1WWAX 4F57H 2OS7A 3Q3GA 1A22B 5D2NA 1V8HA 3EYQC 2BY0A 2DQCH 3HKZA 2B59A 4FQQB 2FZ3A 1OT1A 3MLPA 3QJOA 2E4TA 2PYFB 5I2IB 4XO8A 2NW3A 1U3JA 1VGEL 4ONFH 4Z7IA 3FFDB 1FJ1A 5D1XC 2EDHA 2MKWA 1VACA 3RWFB 3S35X 5IW1A 5J1SC 2PR9A 2Q0ZX 4PJEE 3RFZA 1J18A 1I9RL 4ZS7L 1F4YL 2FEJA 3KPSB 1WIPA 1CWVA 4KMTL 3UBXB 1MCJA 5F3FA 1I3GL 4BZ1L 4GP5B 1UD4A 1JF1B 3IKCB 1E3XA 4FXKC 3L1FA 1EEUA 2VWEC 1YMHB 2X2YA 3LRMA 4H2CA 3RWDB 2BY2A 2VRAA 4P2AA 1M3JA 2IAND 1A6VL 1F00I 2H6UA 1MFVA 4HUCA 4UU9A 5F70A 1TKWA 4A2DA 2XVGA 2FX7H 2VDKL 3VFWA 1G1YA 4PTUA 1AZVA 2WB1A 3TO4A 3X17A 4PV9B 3HI5H 5ISZA 3ESOA 2XTJB 2HT3C 2YXMA 5AVQB 1HXMA 1NICA 1T0MB 1WZMA 5GJTH 4WI9A 3HS9A 1XF2B 2FVNA 4YL4A 1NCGA 1PYWA 1F4AA 2VQ1B 3CVHL 3UG4A 2XX0A 4OSUL 4RMUA 3R0MA 1FH5L 3NSYA 1VRSA 1E8XA 4PW3A 4IRJA 4LPUA 1ETB1 4HIJA 3GRWL 3Q44A 2E7LC 3P1VA 4JFXB 5C09E 2J8UB 1XV8A 5IHHA 3O8XD 1AGDB 1FO0A 3MLWL 4FXKA 1DVYA 4PJIB 5IESH 4AL8H 1DQQA 2OW7A 2XZCL 3KPOB 3BVNA 1K4CB 2QPDB 3P30H 3PS6A 1BVNT 3QRBA 3GRGA 4PJ5B 4RMSA 3B2DC 3F65A 4I0KA 2Q2LA 1MJ7L 4QY8B 2W92A 2HMID 3BKYH 5GSVA 3MGAA 1WBYB 1GCYA 5EPMA 1AANA 1PZBA 5I5IA 3IMSA 2KLTA 5K39B 1LYQA 3TT1H 3W9DB 5DZAA 4ODBD 3VVWA 1T7ZA 1JUFB 4L4TB 2RGSA 3MUUA 5J7CC 4FQ1L 4JDEA 1C8PA 3LQZB 4HCIA 5DJAA 4YGAB 1SBSH 1Z9PA 2KDYA 3QXDB 1ODUA 1CF1A 2QPEB 3MMEB 4N8VG 4OIFA 3PU7A 1NCJA 4FFYL 4RRPG 1QRNE 1UXSA 2KPNA 4HCFA 4H7VA 1FV1A 1NAMB 5B1CA 1EZVX 2G60L 4X5XA 4KVNL 2WHVA 3KYAA 2GSIA 1IEAA 4UQ9A 4CN1A 4KGJA 4X6BB 1V7ML 1J11A 4JM4L 4OZFB 3TLRA 4O2CB 3VAEA 5GJSH 2DQIH 3OLIA 4HDIA 5TE6L 3BUYA 4Q9RL 3MV7B 4ZTOL 3FUNA 2PWEA 3WIFB 2Q8BH 3QCVH 3ML8A 1J5IA 4HUNB 2V2TA 2AI0L 2NW2A 2QSVA 3N5AA 4DK6A 3ZE1E 1WK0A 3L3OA 2OPCA 2IFFL 3V5KB 3GJFB 1BX2A 5C07D 5JQHC 4BEIA 4MMYB 2IIJA 2HT4D 4ZX4A 2GCYB 4LDCA 2VR7A 3Q1SH 5CCGE 2DICA 1A7BA 4JFDE 1A1NB 3MJ7B 2A73A 5E9DD 3U9UB 2ZKHL 3N0PB 4N5EC 5C6TH 1FVCB 5CP7B 1OCWH 1OAXL 1VAHA 4BINA 3C6EA 5FYJD 4UANA 1DQML 3BKCH 3PQYD 5D7HA 4D0DA 2PYFA 1MHPH 4BZYA 1UADC 3LHPL 2B2XL 1NFDE 4U4BA 4YQXH 2DQTL 4Y7MA 4GRWF 3SE6A 4U1IB 3FUFA 4AC4A 3L1OH 4KROB 3WKMH 5ERWA 3O3EB 4OJFH 4UF7C 2JV6A 1MFAH 5AFAA 1H19A 2FWSA 4MCYB 4H1LA 1CL7I 3X1NA 3O6LL 2YD7A 5A6IA 4U1MB 4EN3D 1PKOA 1T5KA 2CGZA 5IMKA 3G9AB 2H1XA 1IRAY 1HNGA 3OLEA 5J89A 1CBJA 2Q6WA 3WFEL 4XRCA 4BRVA 4EQ2A 4MFHA 3RGHA 1IEHA 4M1DL 1FVEB 1NZRA 5H37H 2MCPL 2OYLA 4HUVA 1P1VA 2XWDA 3SBPA 4UTCA 3B5GA 2M2DA 3OR7B 3VDCA 3RNKB 5IQMA 2FQDA 2A0LD 1HEZB 1SXBA 3MXVH 5D1XA 1BPVA 1MQ8A 3MGOB 3WEXA 3T4AB 3RB7A 3R4RA 2J71A 2QGEA 4WI3A 1UACH 5BCAA 1XF2A 1JE6A 4FQXC 4BH8B 2ZKXA 2EICA 2OMWA 4I87A 1QZ1A 3KPRA 3HN3A 1Q1JH 3ZN6A 4AE1A 2ZG3A 1PTZA 4HP5A 5IHUL 4UT7H 3FU9A 2IQ9L 4ORGA 2XOTA 4DGYL 4WK2B 4OF5A 2YD8A 4OCYH 4YXKL 2P49B 3N0AA 1AHWB 3IS0X 1IGTB 3A4FA 1JGUH 4X9BA 1KGCE 1N8ZB 5J1TC 2CBQA 1AS7A 2GG1A 5DLML 3J07A 1R5VB 2W5PA 1G7IB 2VNCA 4WI5A 1EXUB 2XN2A 4FHJA 4R2GB 3V6BR 4F57L 1WD8A 3OMZA 3ARYA 3IPFA 1A7PL 3NCYP 3WTTA 1URLA 2BS8A 2F19H 2X87A 1J9RA 1DQJB 2VABA 1ES0A 3MRIB 3RRQA 1FNGB 1PIGA 2NY2D 2F7IA 4XMKL 3WY2A 2ZSWA 2M83A 1AYRA 1J1XH 1Z9LA 4R5TA 4AYBA 4C58B 4LEXL 3P0VL 1V7NH 3V79C 2HYMA 2NX5E 2X7LA 3FQNB 5CCJA 3TVMC 3W11D 2Z64C 1M71A 1BD2D 4HH9A 1S8DA 5F8RC 3LRGA 1HL9A 1VENA 3CDZA 4CNIB 5JZ7D 1EUUA 3RGBA 1LO3H 1LEIA 3ARGC 3CN2A 2LTQC 3TO4D 4UZGA 4YHKH 3WU1A 5DHVA 3RLSA 3VFNB 4R4FH 2Q6WB 3ABLB 4JDVA 5LO7A 2IBGA 2E7CA 2JKNA 1THAA 4X9FA 1PG7L 5EU6B 2XSKA 2AERT 4IU2A 2V8LA 3IJEA 3EYSH 3OF6D 4F7MA 2P5WB 1LO2L 4XMPL 4IMLA 1XB8A 4W6WB 4NS0A 3D39A 3IMBA 2VDRB 3MYJA 4GKZB 5T3ZL 1E9PA 4BSVB 2KI6A 43C9B 5KVMC 1R3JB 5ANMA 1A6ZA 1RMFL 5E2UL 5MEQA 5D93B 3E9TA 4U6HA 1ZLUK 4OBRA 4ODUA 1TQCB 4KFZC 4WCYH 3DRQB 3WIHH 4NQSB 1EJ8A 4JPWH 5GGTA 1BXXA 3LQZA 4LCWE 5L2JB 1KZYA 1KIUA 2AKRB 4L0YA 3S4SB 3VTTA 3KR3L 4R4BA 4WU5A 4M5YL 5B7FA 1MKFA 3V7AE 4Y5YB 3GBML 5IJBC 3AABA 1E65A 1B0RA 2FRGP 2VKWA 3WN6A 3NJHA 1Y0LA 1NANH 2ZXBA 1FL6A 2EADA 1TJHL 4EZMA 2UVFA 1WDAA 3OKOA 3DIFA 1NJ9B 2LW3A 4NJAH 5GS0L 3KMDA 1J8HB 4BKSC 2X7LB 3FQNA 1YYML 4U1JA 1XGQA 3NFSL 5HI3C 4OF0A 1A4KA 5HPMA 1IGIH 5GGSB 4QYAA 4F8PA 3O9WB 1YC7A 2GI0A 5I23A 2CUAA 2VLJA 4M8UA 2JB6A 5AW6B 1JPST 1FZOA 1F6LL 3PWLB 2R1XB 3BCFA 1UM5L 3F05A 3REVB 4G6FB 3HI1B 4NN7B 3MZTA 1YHPA 2B3IA 1I1AB 1MHHB 3QHFL 1UXMA 1F5WA 2BWIA 2ZUYA 3D0AA 1HZHL 1KBPA 2VN4A 3G3LA 2WZPD 2FK9A 4NN7C 2UV3A 1WLHA 4C4KT 4B9GA 1WUNT 5GRUL 1J9CT 1ERNA 3GDCA 4MQ7B 3UC2A 4F7TB 5JHBA 4BRJA 1FL5A 4G8GE 1G7HB 1BZOA 1DL7L 3EO9H 5C07B 3QARA 5DT1H 2NY2B 1SVZA 3KCPB 4X7DC 4Y5YC 5DZOA 1TQBB 1QI5A 1VJSA 4ELKA 2W59A 4CA4A 3RWFA 1PLCA 5JNYA 1OW0A 2ENSA 5E94B 3BWAB 1YEJL 1VIWA 1O6SA 3QEGL 5MENB 4AVHA 3FOLB 4YVUA 3DECA 5CJQL 2BSCA 2DYRB 2FLRT 3FU6A 3MUGB 3MGTA 4Q4IA 3V5DB 1UOVA 2HJLB 4PWEA 1T6BX 1QKZL 1HEJC 5G55A 3RUGF 4M9PA 1BEYL 1JG9A 2VJ8A 4NT6A 4G6MH 3QIBB 1Y0LB 2ZNXA 2BNUB 4DPAX 5L6YL 3ARBD 3LB6D 5AWNL 1JWUA 4ZSOA 1WFMA 3OKOB 3BGFC 4PTUB 4TTDD 5EC1A 3UXFA 4NQEA 3VRJA 1WPCA 1Y07A 4KXCA 3EUDA 3PWUB 4OCWL 5I15L 5SX4H 4F2ME 5JPNC 4POYA 2ZCHL 4QT5B 4OLYL 1ZS8A 2NY7H 5DVKA 5AQ0A 4K0OA 1JGLL 3QJVB 1RLWA 5DUPL 1GPOL 1TO4A 3L48A 1UT2A 4GW5B 1SY6A 3CHOA 5EO1A 7TAAA 4TPRL 1U8IA 3WFBH 4LEXH 1BQHA 5JHMA 5TGBB 4LESA 4B9CA 4AK2A 2BSRA 2TRHA 4FFTA 5ANMB 4JFFB 3EGXB 5FYKU 1M7UA 5CLWA 2ZWYA 1JZ4A 2XXMB 1NFIB 3MRRB 1LWJA 1X5AA 2DLIA 5KG9A 1TYJA 3V0EA 4ZW8A 2UVEA 4P8QA 3ATBA 3MJ6A 1INEH 4X5WB 1JNNL 2XWRA 3BUYB 3FT2B 2Z92A 2BH0A 2FEEL 3PQYB 4BDVA 5ACZA 1FCGA 4F7KA 5CFAA 4L1DA 3QWNA 4Q58C 4R2GD 1BJ1H 3BFOA 4UQ3A 3C8KA 4JEGB 1XF4B 1C5CH 3AMLA 3B2VH 4UT7L 2XQBL 1GRWA 1D7DA 4RSVA 5DHVB 3VFNA 4BZ2H 5A2FA 3BP5B 1T4KA 5DZLA 2X6BA 2P52A 5D7LB 1E2WA 3CQFA 4NT6B 1TO5A 4FQ2L 5CNHA 1FRGL 2WXJA 1DFBH 3ARTA 3NOIA 4IMLB 3DX3A 3B3IB 2VERA 5FECA 5A3IC 5K59E 3ULUL 3CDCA 1NMBH 2KHAA 1GYVA 2LFGA 4WTQA 5ANHA 3BUDA 4F33B 1RZFH 2CK2A 1RHFA 2YPLB 2YSSA 4PS8A 4X5XB 1NLBL 4R4FL 4F80A 5EUOF 1W9XA 4GG6B 5HDOA 2XXGA 1LHZA 3HUJB 3GMLA 2IOOA 4JFOB 5HJGA 1XAKA 4WW2A 1OHZA 4RQQB 4XP1L 1S7TB 3PPEA 3TFKC 3BZFB 3II3A 3H9SB 1H3VA 4XP4L 1RUQL 1MWOA 4JPVH 3CSGA 3EZJB 1O9VA 1MG2C 2P3YA 4Y2NA 2CK0H 4NJ9H 4WI0A 3C12A 2IAMB 3GO1L 2HRGA 2XIIA 4YBHA 4MB3A 5D6CA 3UTSA 3V6FB 3VH8G 3RIKA 3N91A 1NSNH 4L29A 2MQ3A 2PYED 3WDJA 4YDKL 2J44A 1JFQL 3OWRA 1I9IH 2WCPA 5HHNA 1DFBL 4ADGA 4CDHA 4S1SH 5FHBH 3U2JA 1SJMA 3MODL 2KC0A 1NCAH 1DBBL 1NPNA 3Q8CA 1WE5A 2XKSA 3LH2L 2DYPA 3BD4A 4OU3A 4AH2A 3IDNA 1RY7B 4I8DA 4B9YA 3UTQB 4OLUL 1BZ9B 1SYSB 3U9WA 3ARRA 5HD8D 1ZANH 3HC0B 3KBPA 3T2NH 1BQUA 3NIFB 1MWAL 1A4KB 4M3JA 4M6NL 5I8OL 2L4OA 2OQJA 3GLEA 3QXAB 1SOSA 2CMRL 1IZJA 2QHRH 2A9MH 2I25N 4N2MA 4JVUA 3C60A 3OLDA 1UWYA 4MNHB 1L7IH 3NVQA 5HJBA 1YDPB 2C4XA 4PJ9B 3CXDH 2UWEF 3QW9A 1DJSA 3NIFE 1AGBA 3K8MA 2X5PA 2C34A 4OVUA 4ERSH 1KNOA 4LARL 4PRPA 1MREH 4X7SH 2BP8A 4P0DA 3GXPA 3QWQB 3TJEL 3ZL4L 3LKPA 4MJ5A 4BWUA 4I3SH 4LGRB 3A0OA 4IJ3B 3VFOB 3Q5OA 3MOAL 1B0WA 5IQ9B 4L5FH 1OM9A 5EHFA 1UM6H 1N12A 1MJ8L 4PJGA 1XEUA 1U2CA 3FCSB 4G7VL 1IAKA 5HJ3B 3C2SA 3L7FA 3RI5K 4MRCA 1S7TA 5KSBE 1OAUL 3F7QA 3RPIA 1IFGA 4QF1A 4R4NC 4HUMB 1G7LB 4ZUSB 4K55A 4B0MM 3O2VL 2E9GA 3IFOB 2GAZB 2Y06H 2HG5A 1FPTH 4NBYB 1ITBB 3B2PA 1P7QB 2J20A 1AHWA 4MD5B 5SWSB 1JGEB 2QFPA 2AVFA 4F7MB 2DQTH 5HI4D 5F7MC 4NUGL 4R6UA 1IAMA 1CFVL 4NQUA 2XPGB 3M8OH 3VU2A 6FABL 3AXLA 4PTTA 5AOKA 3QIUD 4E5XA 5J8OA 2E27L 5HYJB 3OXSB 4PMFA 5F6HI 5FAAA 2DQUL 4X6DB 2BNRD 3L3GA 1ZWIA 1MJJB 3BP5A 3OL2A 2VDOH 4QIRA 1N0XL 4PJ9D 1IM3D 2YXWA 4PJEF 1IBYA 3E1F1 3MRBB 4HZLB 5IG7B 4PEEA 4NGHH 3TV3H 5C0EB 1AD9A 1NGXB 1INDL 4ZD3L 1LTXA 4MZ2A 1XL6A 1JTOA 4FTVA 4JKMA 2VLRE 2VDNL 4BZ1A 5JOFA 3ABZA 2B7DT 4G7SB 1JF1A 2GBAA 3IKCA 4M7KH 2AABL 3ESUF 1ZY9A 3RL2A 4AMKL 1RZKL 3KVPA 4BK5A 3CTTA 2NMSA 2D3LA 2B9AA 4PJFE 3DYMA 2FSDA 2ADIB 3K5SA 2HX7A 4JFFE 2ENPA 2FSEB 3NIFF 3NPZB 4IOFC 1S4IA 5CUSH 3RPBA 4JG0H 1OP5H 1UFUA 3DETC 1DVXA 3V6ZA 4KK6D 3RIAK 1IT9L 5IB4A 1SHWA 1HH9A 4WUUB 3VMOA 2AAVA 3GUTA 5HHOB 1KPVB 4Z7WF 1YYMH 4JANA 5T1MB 4M62L 3HMXL 1DSYA 4JMXA 3NA4A 2KZWA 3VW3L 2VWEE 3QRLA 3N6YA 4HFUH 1F13A 1YUKB 3NJGA 5E2TL 3ZRFC 2CNYA 4EDWL 5CILL 1F02I 2DAVA 4AJVA 3CFKA 4PREB 2JKXA 2NYYD 2IGFL 4M5TA 5ITFA 5MERA 3FO2A 4Y5VC 5F9AC 2D4FA 3BVNB 4JFYB 4PG9B 1F11B 1SN2A 3FTVA 4X0NA 3L16A 1S7RA 1ESOA 1C08A 3U7WH 3OXSA 1EHNA 5AZUA 2Q7NA 4KTEH 4E5XB 1DVZA 3VH8A 3G6JF 4PJXE 5HVFB 2BC4A 1TTUA 4FOMA 5BVJA 3SDYL 4OJCA 1DBAL 3IRZA 3MVSA 3NEEA 2WCGA 1N8OE 1RI8A 1X5ZA 5ERWB 5F7YC 5AEAA 4F9LA 1NKRA 2FBRA 3FQXB 5AW2B 3IMTA 4GIOA 4JDEB 3SDDC 3CU1A 4N20A 4Q6KA 4YZFE 1G5AA 1O6SB 5HDBB 1AACA 5AVWB 5A16B 1UXSB 2J1KA 1CDBA 4RFNB 4UTBA 2ENYA 3KPMA 4OGYL 4OM1H 3EBIA 2RQ8A 3BDXA 3B1TA 4WHTA 1FG9C 1FZKB 4RGMB 5DEFB 5DHVH 4DKAA 1HCFX 3WE6A 1MCPH 3E8VA 5KJ7E 1A7QL 1FLTX 4BUHA 2B14A 2FEDC 1DBML 2E6JA 1G7HA 2WZ5A 4WHYH 3SGDH 3T0ED 4LCCA 5C0RL 1RUAH 3CPUA 4K73A 4Z6AT 1PD1A 1DCEA 3BOVA 3LV3A 1A14L 4A67A 3CLWA 4F37F 1CDYA 1OLZA 4NO0A 4P5KA 3WIFA 5IBTH 1F41A 1IGFL 1ACYH 4KV5E 5IF0B 3T09A 2VW4A 1KGXA 1TJIH 4OZGF 3OSKA 5T1LA 5DMKA 4ORGB 3EJCA 4D94A 4MNHA 3WEOA 3IMVA 3I50L 1RZIB 3QK0A 4PJ9A 2CXKA 4RWYH 1N5AB 4PREA 5ITFB 3CVDA 3UO1H 4UZSA 3U4EA 2XFXA 1JYNA 4ZUWA 4NQQA 2ZF9A 2BNUA 4IMKA 5TQ0L 4MB5A 4YDKH 3UL4A 3L4XA 4ZFOB 3EJYC 4ZMNA 1TMQA 4L2LA 3S8WA 2DQDL 4YSSA 4FI8A 1JGVL 3QNYB 1I8IA 1CDUA 4YDJA 5K9KA 2M1KA 4JHAH 2VR5A 2CDGA 2QDVA 1L9SA 1DVFD 3QWRD 2LT9A 3NABL 3SE3C 4AW4A 1IGFH 3CE1A 5IMKB 5JHDE 3OJVC 3W9EA 4KJWC 1NKGA 4KAQL 2R2HA 1G7LA 4RMBA 2ZNWA 1QP1A 3WN5B 4FKHA 3S8FB 2ZOLA 1X5JA 2HG5B 3Q9QA 3RU8H 1CE6A 4EBQL 5KUMA 5DMYA 5IUSA 2BNRB 3S3PA 5IP4A 2GK0A 4BZ2A 2I24N 5FLUA 2EXYC 2X1PA 2I60H 3ILPA 4HUXB 1FC1A 1XGTB 1N64H 4TYUA 3T4AA 3DTXA 1URZA 2RALA 3COOA 5J1AB 1KCVH 2OJEA 4PCSA 3QUZB 1UKSA 3PWJB 4GKZA 5L8JB 4Z7WE 1I8UA 5F7UA 3LPWA 2QBWA 5D1QE 4L2YA 4FLHA 4ZUUB 1CF8L 4DKFL 1MAMH 5JDSA 2A6DA 4XCEB 1EVTC 1OQOA 1BIIA 2ZQKA 4B9JA 3ESMA 3C75A 3ZDXE 3NQKA 4BUGA 3P3UA 3VD0A 3ECWA 5HVWA 1WA1X 5FYKE 1IKNA 4GKOA 2UZXB 5AW0B 3HC2A 5HI5D 3POHA 1H15A 4X4YA 2NQ3A 4HWZA 2OTWA 3ZGIA 1C7SA 1DQJA 3D87B 3BEWB 4A2MA 1VCAA 4NQCE 3L54A 4F37K 5F0PB 3RX7A 2I85A 3GJEB 1BOGB 3WJLC 4U7KA 3STZB 4U49A 2LLNA 4P99A 2P28B 4DT2A 4UZUA 4LLDB 4N8PA 3X13B 5BUGA 5IOKA 3ULAB 4JKPL 2QSCL 4JFUA 5E5RB 2FUQA 3E80A 3VXRB 3SYQA 3GMLB 5FO9B 4LL4A 2XZQH 3LZQA 4JM4H 5C0AB 4PRID 3FO9B 2V5YA 5I15H 5I8KH 4YWGL 3P11H 2EDQA 3MREA 1KB5H 4YE4H 2ZCLL 3JT2A 3LKSB 4L3EA 5KW9H 3UZVA 1QFWH 2H6PB 3HE6A 4U2YA 5C2BL 1P4UA 2IDFA 1MRDH 4I13B 2QVMA 5DZPA 1KIPB 5AOLA 2BIQA 3SBQA 5ISZD 3ARGB 2BXYA 1S7RB 2WNXA 1A2YB 1YSOA 1U93B 1WCBA 4EN3C 3RILA 3T2QA 3QQ4B 3QZPA 4XAKE 4BUQA 3GBMH 2IWEA 4BCZA 2V17L 2Z34A 3I6LE 4CMMA 3UTTD 3HC0A 1IBHA 1JHKL 5D7IA 3FU5A 5AVZB 3H53A 3EFFB 1SLXA 4UOW0 3H8NA 1NINA 2MNJB 4U3XA 4CVXB 4NKIL 1RZIA 1PSKL 2AV7A 3KYOB 4GQ9H 4LASH 3I9IA 1XGYH 2R69L 4QRFA 2R0WL 3GXUB 3RAJH 1JERA 1P7KA 1U30A 3U7WL 1VKXA 4FG6C 2JCCE 4GAGH 4Q6IB 5IV2A 1QFWI 3BWAA 4NB7A 5IMOA 1JP5A 4BFNA 3D85B 3QZOA 4D3CH 5KYNA 2PO6D 3EZ8A 2XIBA 3OKEB 5ICXB 4FP8H 2UZIH 1PPIA 4CJ1A 4TN9A 4RX4A 4NKOA 3GB7B 4QYOB 4DGWC 4JO2L 3U0PB 3VXUA 1I9JH 3O2DH 1YEGL 4LLAA 3X3FH 3ZYOA 5B3SB 1J88A 4P23A 3F6LA 3PJSA 1TITA 3QEQE 4MXQC 5F6HJ 5DEJA 2R2HB 5T5FH 1G1OA 4P2QD 5DMJB 4PWHA 4HPOL 5GIRB 4KQ4H 2RFXB 2NY5H 2ICEC 3F7LA 3DI2B 3VXTA 1LO3L 3DUUB 4WTZA 1X5IA 1SEBA 4FFZL 3AS0A 2K3HA 1MFMA 1CLZL 1R3HA 2A74C 1RPQA 2P24A 2CR0A 1RZKH 3LRSA 2CKBL 4OUUA 2LFEA 1GGIL 3H3KA 4NRXB 4OIIL 1H3WM 5DJ2A 5LGJB 3DUSA 1EANA 2ATKA 2EKJA 1Z0NA 4Y2DB 5K1JA 5LNDA 1VCBC 2IDCA 4HWNA 1A6PA 4NQVA 3AREC 5FOJA 1A9EA 1BP3B 2Y6SC 5HHXH 4PTTB 2IPTL 4I2XA 4UM8A 4X6EB 1ZLUH 3V7AG 4ILDA 3F64A 4FNRA 5A2AA 1J5OL 4P46D 1CDJA 5HGHB 4WI4A 4FZ8L 4CSZA 1A7PH 1T1XA 3BRFA 2DTMH 1CE1H 4LCUB 3W38A 4AX3A 5AKTA 4YUEH 2C7FA 3NCBB 4B9KC 4HIIB 5C1MB 3MXWL 5HHOA 3ML9A 3W1ZA 1OAKH 5LLIC 4GKNB 2N4IA 3U83A 1YPZF 4LLQB 5JMOC 5IBTL 3QIWB 5LHDA 1OCCB 4DP5X 4UUJA 3ARQA 2BMKB 4XBPB 1CGSH 3GMQA 3B7SA 3CIAA 2A6KA 5K59F 5FGCB 5C0EA 1BOGA 1TZOA 1A6TA 1AY1L 2FWUA 3EHBC 5FKAB 1BQSA 2CPCA 1I7ZA 5KOMC 4DP4X 5FCSH 5IWLA 5J11B 3HC3H 1XWVA 2GUOB 1BXVA 1RU9H 3HE7D 4A66A 3PPSA 4GEIA 2HUHA 1ZIAA 3BUTA 3QZWA 4OB5H 4PJHE 5T3ZD 5LWYH 1MW3A 4ZFQA 1N3NB 1MUJB 1OAZH 1Y1DA 4S0HA 3ESPA 4MB4A 5C09B 4B53A 5L9DH 1VADB 4L5FL 1NC2A 2AEQH 4HSAC 3HUJA 4XMLL 4IGBB 4J6IA 4Z78B 5C0FA 4JRYE 4JDVB 5DD6B 1UH2A 1D5BA 1V7NL 1ACZA 2YJQA 5LGJA 1BWMA 1ZVSA 2N59A 1MDTA 4LHUB 5EBGA 1FDLH 1K4DB 1MREL 4X7SL 1U93A 1JFHA 4AUJA 1U3YA 1RJYB 3WEAA 2P4AB 1H9VA 5C0BE 3JWNH 3KG5A 4GMSL 5AB2A 4FQLH 3G04A 4CMMB 5DFTA 1ASQA 1UZ6E 3F3HA 4WW2F 4RNRA 5FYLH 1M7IA 4XXDB 3OWEA 1F42A 3TJHC 4ZFOL 2I9TB 4L8CB 4LP5A 3OAYK 2VLME 3CDGA 4HS3A 2APTA 2V5MA 3M1OA 2B8OT 3JWOH 4K8RD 3IDNB 4I18B 4Z77B 1E5AA 5CN1A 2XQYA 1N6UA 4DGIH 3KLKA 4FQQA 2EZ0D 3DNKA 3QJQB 1B4RA 3RFZB 5CINH 1JL8A 2UY7A 3ZJAA 3QA3B 1A6AB 2OP4H 3V52L 1DJYA 1BREA 1OGPA 2BZ7A 3P4OB 2CALA 3GZOA 4G9FA 2DEWX 1YA5A 2BOCB 4U3HA 4XPHH 4L4TD 1T0OA 3T6WA 1U8JA 4KO6A 4YDIH 3S37X 1F4WH 3TCXA 2FQFA 1EFXD 1LP9E 1KGUA 2VDML 5ENWA 4ACPA 1KIRB 3GO1H 3V4PL 3TNNA 2DM7A 1CTNA 4O2FA 3I6GB 3IETA 4RRPA 3L3OC 1T3FA 3MGOA 5DUBA 3SE3A 4YFEA 4HMDA 1RVFL 5LDSA 1JZGA 2WD0A 3DBXA 3K3QA 5AAWC 1LD9A 3HG1E 3EYUH 1AGFB 2VZUA 4U1HB 3QG7H 3QJZA 4CW1A 2F5AL 5GGVL 4CVZA 4UILL 4QJ5B 5DMKB 3VXMB 4BKLB 4HXAL 1CC3A 2ITCA 2WO2B 2GHWB 4PJCE 3VGHA 5EEZA 2AJ3A 3K1KC 3LXBA 2W0PA 4JAMA 1OTTC 3EF4A 3KPRD 1D5BB 1NCOA 2R1WB 3EH4B 4G7YH 4XP6L 5B22A 3GZQA 3RWJA 2M26A 2R39A 4G6ML 2IWKA 2PP9A 1A8JH 2WBXA 3VXNA 1NDGA 3V6OC 3TIEA 4HISA 4YEEA 4YHYB 1FIEA 1KWGA 4JPIB 4K4KA 2XQBH 1KGYE 5E2VH 1NC4B 1T1WB 3NQIA 4PJBE 3ARPA 5DJZB 2HJKA 3QEGH 1KEGL 4B5ZA 4I18A 1TJIL 4R5XA 5EN2A 3ZUNC 3RWHB 1AI1L 1G9MH 4CADB 1O5PA 1K3ZA 4GKSB 3DV6B 1CE1L 1XCXA 5JDJA 2ZPKH 1MIMH 3O3BB 4AI7A 2OXGA 1G6RA 1XD0A 3ILDA 2FB4L 1LEKB 1N68A 2OMUB 2AI0H 3I02A 4H8QA 5DJ0B 5LN8A 1AQDB 1XFPA 2AJSH 3KM1A 3W9EB 3A6CL 1L3WA 1NCDH 1U8MB 3NAAH 5FYLE 4LSVL 4P9HH 3NIDF 4Q9BA 2CIIA 2YKKA 4GAYA 3JUYA 5DLLA 3FCUB 4U33A 1S9XB 4ZMTA 4HAGA 1JPFB 3NJMA 3RZCA 3E9UA 1IGMH 4OZFA 4KHXL 3OJMB 3KL5A 2OI9B 5EC1B 3S96B 1UKQA 3PWJA 5L4IA 4UAOB 4JFEB 2DWEB 1VPOH 3UJJL 2TAAA 1SBSL 5DJCA 2VDKB 4NQDB 4YDVB 3OX8B 4X6FB 4L3ED 4MLSA 4A6YL 4BQ6A 5C86A 4HJEA 2ALWA 5I74C 3X11B 4NC2B 4FERA 1FVDA 2DWTA 1J5HA 4HDIB 4PCTA 5IB3B 5FC9A 4APXA 1RK7A 1UJ3C 3K71A 3APFA 3MQIA 5KZCB 3QYNA 1LL1A 2PW2A 3WXWL 4Q2ZA 5JQIB 3A47A 4G7QB 5AVVB 4Y4KB 3ARED 5C71A 1QKZH 1WFIA 5I0WA 1F58L 3QFJA 1RZ7H 3F7PC 4MD0B 3V10A 5KYXA 4JFFA 4HEME 4Z3TA 3AUVA 4J3OH 3IT8D 2HTKD 2BIMA 3QGVA 4D0CA 1I7ZB 1XTMA 2XNAB 3MSPA 5CU5A 1B9ZA 3ZHNA 2HLAB 7FABL 5DJZA 2Z91A 5CSZB 3MRPA 2J73A 4GQ9L 1UWXK 1MI5E 2IMMA 2ZOUA 2ESVE 4TULH 1CGTA 4QD2E 4ZPVB 2D2CC 2ITDA 4LLDA 3X13A 3CVHH 4UOJA 5D7JB 2BINA 1TFHA 3GRWH 1IGJA 4A2HA 2XN0A 2IH8A 3B7TA 1G7MA 3GMOA 4Q56A 3UIYA 1E6OL 3FQ1A 1S78C 5TQ2L 1J7VR 3BRGC 4KJPC 2OX5A 3EG9A 1K6QH 3CBKB 5J6GA 1VKXB 2AK4A 2UZPA 4OJAA 3VA6A 2JQMA 5J06A 5E08L 3REVA 2FR4A 5JOFB 1UENA 4WJ5B 3OZ9H 3BIKA 4IDLA 1IM9A 3D2UA 4Y5XC 1IE4A 2WYIA 3NK4A 4HK0A 3ALPA 3NH7H 2G9HA 2GSMB 1IC5H 3HB3C 3UPCA 2IALB 1BCIA 1WCBB 4MVBD 4BZ1H 2VR9A 2JKRM 4ZDHA 3LN5A 2XPZA 4RGNE 1BFOA 5DR5L 4MXVE 5CJ5A 1KIPA 4U6VL 1O5DT 3RGVB 4WO4D 1PDKA 2V6HA 4W9DC 4PGJA 3C2AH 4M9OA 5KVFE 3OB0K 4B97A 3L1EA 3SKUD 3TZVA 1KPVA 4L5FE 1G9ML 1XR9B 4E9WA 4JRXB 3UG3A 1HINH 1A7RL 3D0VB 1X7SA 4MYWB 2OMYB 1S6NA 1M6UA 1R3HB 2C9QA 4E9VA 1A6WH 3PL6A 3TBWA 2YMXH 1CFBA 3UTSB 1X6NA 2BP3A 4RMWA 2VH5H 3FB6A 5IIEA 2BP5M 4DP8X 4GS7B 5F96H 1U3NA 3JWOC 1EAJA 4DETA 3B5TA 1KB3A 4H8UA 3CFBA 1U95B 2BNQD 3L9YA 2WVVA 4HJIA 3OR6A 4Z7AA 2DKUA 5D70L 1ID5I 3U0PA 4XCFH 3LZFH 3EH2A 2ORBH 5I8EB 1IBBA 4HXAH 4AYDC 5LGKA 2DLHA 1EEZA 5KS9A 4I7ZC 4QHUB 3WKYA 1HH6A 4R26L 3CCHA 4Y19D 3BO8B 4IS6A 2NW3B 3NCXA 2NNAA 1RMFH 1G0XA 1I1AC 4XP1H 3Q6FB 2AQPA 4PCKA 3PNWB 3VI4E 3LXUX 1CBVL 2FR4B 4P59L 1HCVA 4LDOB 5I6KA 5KUKA 2X4UA 1G0DA 4PJXB 3GMMA 3UGEA 1B2WH 1Y18A 4CC4A 1XB6A 3INUH 3N43F 3CFCL 2ESVA 1E3FA 4PLOB 2GTWA 2R2BA 4F8NA 2C1OA 3WJMA 1YEGH 4WW2C 3S96A 2KYIA 4RFOL 2B4CC 5DVLA 5L0QB 2WLZA 5I0VA 3ZE0F 4N4YB 5J0BA 2FBJL 4P4KD 4YZFF 4K7FA 1SVBA 3QUZC 3L3IA 1D7BA 3QFJD 5JW3H 4PJAF 4FL4C 4XBEH 4X98B 3UTPE 3VFWB 3CK0H 5TK2A 1IC7H 1JXFA 1KTDB 5ALCL 3RY6C 2N1KA 1EV2E 4C57C 1YEIL 2AQQA 1NEZA 3ARFA 3RWHA 3TBVB 3UC0L 3T3PF 3W0WB 2PN5A 1T1ZA 1S7XA 1BMWA 4QF1B 1ZDQA 4MB1A 1GYUA 4HULB 4HKJB 1G6RB 4QKTA 3IDMA 1OE2A 3HVNA 3ATAA 4QNPE 4QRPB 4WSGA 1R46A 3ZT7A 3NZHL 3VMNA 5J9PB 1Z1WA 2FJFA 3A5VA 1FLRH 1E2VA 5IIEB 4XPBH 3MCLL 4R97B 5KBDA 4EI6A 1S5HA 5LXGH 5J56B 2LHAA 3G04B 4ZUWB 2VDMB 3N55A 1FDLL 2HLFC 3Q7JA 2HFEB 3EOTH 4DWHA 1ZVNA 1XGZA 1M7IB 2EXWD 4XXDA 2O61B 5KYUA 1KPRB 2ICES 1P5UA 4JFZH 4P49A 4NKDB 5FUOH 4AIOA 4GG6F 1XCTB 2VN5A 3IFPA 3L3DA 2QDWA 3B9KD 4P4RA 1CLZH 4CC1A 1MFCL 3BVUA 1FYTA 4MJ2A 1OF0A 2FQGA 3SKNA 4NENA 1KYDA 5MP6L 4OZ4A 5TF1L 4ZFFA 3GXTA 2VITA 4S2SA 2QTEA 3O3DA 5DD6A 2A0LC 2D7TL 4AEEA 4MAUL 1L6PA 4FD0A 1H0DB 1BZDA 5MI0B 1EH9A 2DPKA 2BNRA 4G6AD 3FB5A 4JZJB 4M8QA 2ADFH 2XWXA 2GPZA 4Z78A 3N85H 3VXOA 2D0GA 2JLLA 3BWUF 1ZMYA 2YEZB 2XV2A 3ZE1F 4YFLF 4AQAB 5JHAA 4Z7UB 3TNNB 1XGTA 1XSKA 1XMEB 5HY9A 5C09D 3FBQA 4IIQC 4PB0H 3VXPB 1HI6A 2BNQA 2QSTA 3K2MC 4IBYA 5BXFB 4L1HA 4Z7UF 4LFHG 2I07A 1SM3H 5DRZB 5IUCA 4GQRA 4JKLA 1OHQA 2OMWB 1XIWB 2OMZA 1H8OA 4B0MB 2WXFA 2Y9RT 3IDMB 4JK0D 4C4BA 3L8QA 1A6AA 3BZDA 3V5KA 3BD3A 1XR8A 2XN9D 5J9PA 1YO4A 4KTEL 4Y88A 4N3UA 1N8ZA 2GCYA 2ZD0A 1O0VA 1P5VA 4MZIA 3PAVA 2WINA 1KBGL 4BFIB 1BVZA 4NQEE 1QFUL 3ZMRA 5KYYA 3F01A 5IMMB 3WFBL 2JXMA 2TSBA 1BQRA 4ZSOE 3DX7B 1KTRL 2K7PA 4HFUL 4K3EH 5GS3A 2R2EA 1KB5L 5FDWA 2WBKA 4RISH 4NM4L 4AIZA 5J13B 1P6FA 3PWUA 2Z1KA 4PRPD 4J27A 2VL5A 1P0SE 4FLRA 4MAZA 4QRUB 4WW1B 3LRLA 5FFLA 3D34A 3M46A 2V3FA 3FUMA 5H2BB 2O5ZL 4B6ZA 1MCRA 1MWAA 3EGDB 3IFNL 4HT1H 4KDTC 4LSPL 4KK5C 4NQEB 1MZYA 1E2ZA 2HVJA 5DD1L 4LVNC 4R90L 3AG4B 1FGVH 2XUWA 3D50A 1E9OB 4NQDD 2GK2A 2NY1D 3BAEH 3BE1H 3DIVA 3CHRA 3H85A 3WNLA 5I1EH 3BAWA 5DFWH 5JUEL 3DSFH 1GS6X 2IAAC 2HXAA 3UJIL 1BG1A 3I9GH 3F7YA 2X0UA 1UZ6F 1FF5A 3MV8B 1QFUH 4MQXD 5KZCD 3PGCB 4OI9A 3S9DB 4NSKB 1SDAB 3VXPA 4KUZL 1MCCA 1WC7A 3FMGH 5HPOA 3AWGA 1XCQA 4ODVH 4PVMA 5EEYA 2FD6L 2O5XH 1OLLA 5AL8A 4M1GH 4Z8FL 5D7KE 1TCMA 1UVQB 4FTVD 4RWYL 3AREA 3V52H 1WD9A 2OMZB 4A7QA 3HMWL 5JYMA 1T4WA 2GKIA 5DRZA 2BSSA 4HQQL 2MNWA 3QULB 2G5BB 2YGOA 3B9KC 4LCUA 4APXB 1OKEA 4AM0Q 4WZ9A 5SWQA 3UGUA 4KKAC 3JWOL 2DMGA 1S7QB 5IV2B 5F7HA 2FT7A 3V0WL 4URKA 3LDBB 3LEXB 3SJVB 4XBEL 2NTFB 3MNZA 1P6AB 1GMEA 1DUYB 1KJVB 1UQSB 3BVXA 3SDXA 1QSFB 2JQAA 4Z76B 1T20A 1TSRA 4NKDA 1JZFA 3RIAF 3W39A 2AJXH 4TVPH 5GGVY 4L48A 3QJFB 1KENL 2DZEA 3UTPD 4NOBA 1XH0A 2J25A 1CI5A 4M56A 1FNEA 1T1YA 4GAYB 3WNIA 4G42B 3ULUF 2IO5A 3GK8L 4S2SB 4KXZH 1RUQH 2Z35B 3TBYA 1THCA 5BV7H 4P4KA 4U1JB 5EUOE 1TUPA 1TIUA 4JRWA 2NNFA 2VDRL 2W94A 2CLVB 3CMGA 5FDYA 3NDYE 4XI5C 1WP6A 1L4IA 3JV4B 4HMCA 4U1KA 3SD2A 3REWA 1ZLSL 4FF9A 1S2EA 5J6GB 4KKBD 3IGAB 4P5MB 3U9PL 3B8YA 3FTSA 1IEBA 3B2UC 2HTLC 2IQAB 2HPOA 4V11A 3QFJB 4ABVA 5IFAL 3F7YB 5C0ND 4YHZH 5KWYC 4MD4B 2DN7A 2GJJA 4DO4A 2UYLA 2EYTB 3V6FA 1U36A 3BQUA 4OLVH 1BXAA 4PJHB 2IADB 2EIZB 3MYJB 3GSNH 2XBDA 5HGHA 2BW5A 2Z91B 5CSZA 4P2OC 5A7EA 3FSZA 3EFOB 2EDJA 5CZXC 2A4EA 3WTXA 4KI1A 4XVTL 1VGEH 2EUVA 3BH8B 4U6HB 3CDGB 1I75A 1RUPH 5GRYA 1MHCB 1PQZA 4XOEA 1DQDL 1WQVT 1Y6MR 2CR3A 3WO4B 3PAYA 4HJGA 1ETZA 1J0YA 1AGCB 4NRYA 4XCCL 4ZW3A 2EO9A 4LPXA 3H56A 3QHZH 5KSBB 1GY1A 3VSUA 2HWZH 5JW4Q 2JIXD 1HYRC 1DBKL 3LKOB 5GGTH 1TNNA 1EZSA 5D1QC 1RH8A 5CUSL 4PJ6A 3GNML 1NIAA 1MCEA 3GLZA 3AVEA 5IHBA 5JW5B 2BSTB 3KZ8A 1KEMH 1SLWA 1VB9A 1DZ0A 2W65A 4BSWB 1QLEB 5IROD 3WEBA 4NQCB 4ZNEA 5GZND 2MTAA 2BSEA 5F1SA 2NZIA 3MA9H 2C1PB 2C3HA 5AYQA 4ABQA 3X3GH 3QZWB 5A2IH 5FYKH 3MKKA 4M8RA 2OSLA 2JCCA 1TJGL 3RPIB 3S5LB 2NNAB 3NGBB 5DS2A 3D51A 4YR6B 3S98A 4HBQA 3C5SA 3ZDXB 5IEHB 3FCSA 4R26H 5EOTA 4LRIA 1CGVA 2VDOL 3HLAA 3HC4L 5IW6A 3L7FB 3GSUB 4BK5C 3DVGA 1BVLB 4I5BA 1T5XB 3VWJA 4MMXC 2RA1A 2B77A 3RX9A 2O72A 1C12A 5HDWA 4GH7B 2BNQE 1N59A 4FP8L 3WNJA 3LZNA 5A6LA 4IKNA 3BIBX 5EU6D 4L8CA 4WWOA 5FO8B 2ZUWA 4QXGH 2PCFA 3QEQB 4PWKA 3QNYA 4YDJB 4N8VB 1RSFA 1KCLA 4OGXL 2NT1A 3L3GB 4OGZA 3FT4B 3PLYA 2IQ9H 2PF6A 3P77A 1X5HA 4LZKA 2B1HH 4P5TD 3SE8L 2OM5A 1X4XA 4QHUA 3PAZA 2VXUL 5DQJB 3FN3A 1J0KA 3C8KB 3TIDA 5IY5B 1A7QH 3FMGL 3DX4A 2Q86B 1A7OL 3NFNA 1FFTB 3Q6FA 4LCYB 5FO7B 3SDAD 3CQQA 2MCPH 4YEFA 4K7PX 2V9RA 3Q48A 4EUPH 4NXKA 3OZ9L 2ZICA 5F0MB 5FX3A 4TSBH 1U6AH 3OXRA 1NCDL 3DX0A 2WQSA 2JWYA 4TUKH 43CAB 4ZO8A 5JIKA 3M86A 3FB8A 3P2BA 2D7TH 3JV4A 5D7SH 4P2YA 4DN3H 4BH7A 3C5SB 1UEYA 1DBAH 4NN5C 3EJZC 4MXWL 5FA4B 3SDYH 3KPRB 2IQAA 4AVKA 2C9XA 1P1ZA 1ZHLB 3OKDA 1MFCH 3SPIA 2NXYD 3O2DL 1XGRB 3BD5A 3H9YA 4P2QA 5FOBB 3GHEL 2CGRH 4A04A 1AC6A 1L7TH 4MJJA 5DRXA 4FULA 2DQCL 4WI8A 1RERA 3PREA 2NTFA 2WC7A 3EGSB 3MNZB 1FFQA 4KXAA 3UOAB 3KW8A 5ITBH 2ZX6A 4JG1L 5H4YA 5C7XH 4WRLA 5BS0D 5DJDA 2WOBA 3VI4B 2YOAA 4OFPA 4RGMC 5CEZL 4Y16D 1NGWB 1YNTF 1MVFA 3FULA 4ONHA 4XGZB 4XNDA 3GSNB 5D2NC 2OMTA 3FT2A 3K8LA 4XNMB 1ETZB 1E28B 1QRNA 1OAYL 2AJYL 3BYTA