4B5ZA

Structure of the apo-rfnbpa(189-505) from staphylococcus aureus
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
310
structure length
310
Chain Sequence
GTDVTSKVTVEIGSIEGHNNTNKVEPHAGQRAVLKYKLKFENGLHQGDYFDFTLSNNVNTHGVSTARKVPEIKNGSVVMATGEVLEGGKIRYTFTNDIEDKVDVTAELEINLFIDPKTVQTNGNQTITSTLNEEQTSKELDVKYKDGIGNYYANLNGSIETFNKANNRFSHVAFIKPNNGKTTSVTVTGTLMKGSNQNGNQPKVRIFEYLGNNEDIAKSVYANTTDTSKFKEVTSNMSGNLNLQNNGSYSLNIENLDKTYVVHYDGEYLNGTDEVDFRTQMVGHPEQLYKYYYDRGYTLTWDNGLVLYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRONECTIN-BINDING PROTEIN A
publication title Evidence for Steric Regulation of Fibrinogen Binding to Staphylococcus Aureus Fibronectin-Binding Protein a (Fnbpa).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus nctc 8325
molecule tags Cell adhesion
total genus 74
structure length 310
sequence length 310
ec nomenclature
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b5zA01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b5zA02
2RALA 3AT0A 2YLHA 5CF3A 2Y7OA 2Y7LA 4LE8A 5IHWA 4BBWA 2Z1PA 1N67A 2Y7NA 4Q6KA 1R17A 4B60A 5CFAA 3AU0A 4F20A 4MBOA 3IRPX 4JDZB 2Y7MA 3IRZA 4JDZA 4B5ZA 4F1ZA 3V10A 3IS0X 2F6AA 4FJ6A 4LEBA 4MBRA 4F27A 3ASWA 2F68X 1R19A 3IS1X 4RMBA 4F24A 2VR3A 4LEEA 4JE0A
chains in the Genus database with same CATH superfamily
1WIUA 2IPTL 4WW2C 3K2MC 1QRNB 2P43B 4XNBA 2EUWA 4EI6B 2BSBA 3NABL 3OR6A 4LKXA 5E6IB 3GO1L 4HGMA 5DJCA 3QIUC 4XNZB 2FJHA 3T0DA 4YHIA 3IXTB 5G55A 4N90D 4N8VG 3MUUA 3CZLA 1ZRUA 1KJMA 2I9TA 2WXPA 3DIDA 2IDCA 2CG9X 5ID0A 3O8XA 1FRGL 4OZFG 3WI9A 4J3XA 4PSPA 2O5XL 4BFKA 2GY7B 4IBWA 4IU2A 1A1NA 3WIIH 3G5VA 4I5BA 3BPOC 2LABA 4WTXA 2NYYD 5JIDA 1OAXH 1JGLH 3KXFE 3TNMA 1R3IH 4K5PA 5IMMB 3LCYA 3QDAA 5MEPB 1WCBA 3BZFB 2MNUA 3BGFC 4PJ7A 3RPKA 4CNIA 1ZHLA 1QSFE 1ZT1B 3X3GH 5D6CA 4XOBA 2XT1B 2NY4C 3U7WL 1QYGH 3DBSA 5D7LE 4LPCA 3MRFB 4N6RB 3OKDA 1N4XH 2B1OA 3VRLE 5FDWA 4ZTOH 3O4LB 3QJVB 3QDGB 4ODSH 3N40F 4JG5A 4MMZA 3C60B 4U7SA 3SD2A 4CA4A 4TV3A 1JFQL 2XY1A 5KSBB 4O51A 4PJDE 1VZIA 4X5LA 1CVRA 1BF2A 4QRFA 3WNKA 2VRAA 1E43A 2FX9L 3CQFA 3SDDA 2F5BL 2HN7B 4HC1L 2FEDD 7PAZA 1T5XA 4J4PA 1DFBH 4CKQA 4AZ8A 4PUBH 4X9GA 5HJ3B 4DZ8A 4F91B 1RK0A 2XKNA 3SDAA 4MNQB 4XXDA 3EJRA 2NTFB 2K4AA 3ZZLA 4WJG3 3TO4A 4DKDC 3G5WA 3CSGA 3LVEA 4IOSD 2BIMA 5DHDA 1ZA3B 3FQUA 1JGVH 5IWLC 1J1OL 3HCVB 2C9PA 3HAEB 3QBTB 3H9SD 2VXVL 1OM3H 2X6CA 1OP5K 4FP8H 1JVLA 1RFDL 3IGFA 1DQIA 3MLVL 3H2WA 2YEQA 3BD5A 2B08A 3HI6L 1OGSA 1S7RA 4DTGL 1W72A 2W95A 2H4EA 1A6UL 1ML0A 2QGCA 1AR2A 3QNZB 5DJXB 4QTHB 2IGFH 5I16A 5H35B 1IVTA 5J9PB 2J44A 5JO5B 2F1EA 1GPOH 4Y4KC 2VSKB 1BQ5A 3C5ZB 4YWGL 1UJ3A 4AYBA 4AE0A 2H1PL 1FZMA 2QADC 1RHHA 2VNCA 3IGUA 2A9DA 3H9YA 2Q8AH 3I9GH 5DLLA 4P4KB 2ZSWB 3TBTB 1WZ1L 1UM6L 3BKYH 3IFLH 3ARTA 4LLVA 3UTSB 1FL3A 1BAGA 1YNLH 4E41D 2X28A 2CRMA 2NW2B 4JQVA 1HINL 4QPEA 1HI6A 1ZS2A 1BREA 1SYSA 2FT7A 1UD8A 1KLGA 4WTWA 2WLHA 5CZVH 3DECA 1K2DB 5C3IA 4XI5C 3PGDB 4GO8A 4Y8DC 5J1AA 2ZX8A 5A3ID 5AAPA 4FXTA 1MHCB 2WYIA 2C4FT 3BQUC 1KIUB 4DOHE 1R47A 2NXYD 2RFXA 3KJ6L 2HFEA 1N0LB 4NNPH 2H2PD 3C5JB 4X0NA 2HH0H 1HDMA 4YAQB 1V7NH 3RWFA 4JFFA 1DO5A 2OM5A 4G8IB 4DP4X 5MEQB 4BK5C 4YSQA 1SOKA 1DLFH 2BXZA 4ZFZA 4Z0BH 4Q8BA 5KW9L 2P80D 4Z3EA 3MR9A 1P6FA 3V5HB 4FAAB 2DTMH 2YD4A 1KCBA 4Y4HD 1RZ7H 4HW6A 1ZS8B 2N7BA 4UT9L 5DEFA 5IJCC 2J56A 3A6BL 5ABZA 1UXMA 4WO4B 2NW3B 4YBLB 5JHLL 3GS7A 3STZA 2IV9A 2IDFA 3GMLA 1TZHA 4DFHA 2EDJA 4JY4B 2WM0A 4AL8H 4PCKA 4N8CH 4XBEL 3QNYB 1KYDA 4I18A 1N7ML 5F88A 5JHDB 1C7SA 2LHAA 5E2WL 5EU7C 2WVVA 3P02A 1N18A 4DZBB 1R75A 2XQYK 4GSXA 1DE4A 5FYJE 1V7ML 3PWPB 1TKWB 4MAUL 4OZHE 4IHOA 2PPFA 3AU1A 3UADA 1NEZG 4FC3E 4LL4A 2EUXA 2A77L 3HN3A 4EIBA 3L45A 4TPRL 4LQ1A 2O93L 1UA3A 3VVWA 1DVZA 1JWMA 4O58L 2OR7A 3D05A 1IEAB 4LLDB 5F9AC 1M7UA 4UOJA 2PTTB 4I9XA 2CA4A 3DOHA 4N0UE 4XT1C 3THML 5J3HD 4LASH 3V52H 2FQFA 4Z23A 3DX0A 3OPZH 2BP8A 1AGCB 4OVUA 5FKAB 3VXSE 2W0FB 4K3HA 1Q72H 1A6TA 4ANUA 3JV4A 5I1AA 4OM0H 5DJYA 5I0WA 1CXLA 1HX0A 1NMCB 3G6AB 4WNSA 4UMSA 3R06A 1BBDL 4LCIL 4UZSA 1KF9B 4L9LA 5HGGS 4J3OC 4Q89A 5F0PB 3F6IA 3NJXA 3V5DA 3RWJB 1KTDA 1NICA 4APQD 4QXGL 4AK2A 1MQ8A 2GIYA 4PR5A 5GGTA 3VDCA 5I0YA 2MH4A 2R27A 4OF7A 2XY2A 2VR9A 5CZRA 1GGIH 3WFDH 1N2RA 3QJHB 3BP6B 4H25A 2F54D 1NUNB 1I9JH 4QRUA 1ORQA 2RH0A 3SB3A 4BSWB 1UZ8B 4BQBA 4OIIH 2WXFA 3HG5A 1B0GB 5HVHB 1FNHA 1XR9A 1CWVA 2FAUA 1VERA 3GB7B 3INOA 4N26A 3MRDB 4UZGA 3T08A 3WELA 2VLJE 1RLWA 2JJVA 1ZLWK 1FFOB 1IGFH 1NBYB 2X38A 4FNQA 4F33B 3TYGH 4UQIM 2F61A 1FJ1B 4AV5A 1RUQH 2VLMD 3Q1EA 3VMPA 4KKPA 8FABA 3DO3A 3JWOL 4DP5X 3ZYJA 5DEJA 2H9GB 2V2TB 3U7AA 1ZLVK 3P54A 4DKEL 2HRPH 2ZOWA 3WUWG 5D1XD 3AFLA 4EN3A 5CINH 4DUXA 1PNDA 1VKXB 3U9PH 3RTLA 3MRKB 1U8PA 4FYTA 3MI6A 3OAYH 1J8HA 2HMID 2EH7H 1S7WB 4A1RA 3V5KA 4F8LA 4ZS6D 3TA3C 5T3XH 1F3DJ 4WK4B 3WHE1 1IGIH 2NX5B 4KUCD 3T0AA 4OQTA 1UOKA 4ZYKA 5B1KA 1OSZB 2G9HA 2VC2B 5FO8A 3WIIL 3MA7B 1EO8H 3RL2B 1KJ2A 4N0RA 4KKCD 2FSEB 1OAXL 2ZWKA 1JGEA 3UO8B 4ZDHB 1JAEA 2K9FB 1U3JA 5KUMA 2WXKA 4W9GC 5HHNA 5FOJA 2W0PA 5D7LB 3BLKA 5KZCB 5CUSL 1ZLUK 4KXAA 3X3GL 3NMEA 4JG1H 2X4QA 1CK0H 5FLUA 1DBJH 3GXNA 4PJIB 1CGSL 4YHNB 2FD6L 3OMIB 1A9VA 4PJDB 1ZHKB 3NPZB 2CHXA 4X5XA 2P3YA 1CDBA 2GITB 1OE2A 1LMKA 1LQSR 4TXVB 3PWLA 2WN2A 2FGWH 3GHEL 2VLRB 2RIKA 3FFCA 5HYJA 4GRWF 5DZOA 4FCHA 1IGYA 1DFBL 4XVTH 1MLBB 4PUBL 4EI5A 3UC2A 1KGYE 4MXVF 4TQ8A 5I8OH 4DP6X 1QSEA 4ODWA 3A23A 3I9AA 2QZQA 1KIRA 1Z9OA 4NS0A 4PGJA 4MBOA 3LN5B 4GLRI 4H8VA 1LP9A 3EJSA 5CN1A 2VITB 2BP0B 2Q7YA 3WDHA 3BP7B 3T6QC 1KTJA 3B3IA 3RJQB 4N2IA 3MU3A 4PPTA 2R1XA 3KWVA 4KTEH 4HEPG 1OM3L 4KAQL 4FP8L 3E1ZA 4PJGF 1A47A 3MV8A 1NFDE 4GIPD 5KYWA 2X2HA 1P7HL 5FWQA 4P46A 3OL2A 4GSDL 2X4UA 1TSRA 2ZUUA 2FYVA 4EI0A 3NEXA 3SY0B 1QR1B 1HHIA 4XTRD 2IGFL 4Q0XH 2DDQL 1HN1A 4B0MM 3NZUA 3GJFH 1JWSB 2YKKA 4OB5H 5E6RB 2BOBA 3KGRA 2FO1A 5K33A 2A3TA 2ATKA 2BNQD 4P0DA 5E6IC 5I1EL 3T8VA 3PDOA 3TN0C 4YS4A 4NQDE 4XNZC 4QRRD 1VADB 3KYOB 4QHMB 5TE7L 1A1OA 1F45A 1WJ3A 1TU2B 3OWRA 4NC2B 2UXFA 4OLEA 3S4SG 4U6YB 1EBAA 1NUFA 2EH8L 1H15B 4N2MA 3SJVE 4P2QD 3VFUB 1YMME 2B8OT 2OMYB 4X0KB 3IFLL 3UTQB 3X1NA 1R0AH 2AJ3B 3D8MA 1INDH 2NY0B 1AS7A 3A22A 5I2IB 2VZSA 4X6CE 5JPMC 4PJ9B 1FGVH 2C4XA 5DC0A 1EJFA 5B8CA 4W9CC 4H5SB 3FTSA 5KVDH 5LXGH 4YXKL 3B5HA 5HYSG 1F3JA 4RFEA 3Q5OA 3TBYB 2W0LA 1JZJA 5GISH 5KBPA 3WN5A 4DOHB 2F8VA 3UTPD 1RZIB 3L5XH 2XZQL 3TZVA 5KSVB 4AH2B 5F7WC 3ZZSA 2OQJA 3N55A 3LKQB 1KNOB 1A3ZA 2XG5B 3C60C 4B96A 2OX5A 2EE9A 1I75A 4E9VA 1V7NL 1IC5H 3I9IA 4C4UA 2I69A 1T2QL 2R69A 3QI9D 1DLFL 2ATAA 4WW1B 1JK8B 2WLZA 1BEYH 3MO1B 4Z0BL 5CCJA 5HJDA 1Q9WB 2DI8A 1TDQA 2XTJD 3BP4A 4U1MB 2WLYA 5D6DA 1E3ZA 4LLWA 5JW3H 3BO8A 2DYPD 2DWDA 2JV6A 3RVXD 2Q7NA 2YUWA 4M7JH 5C0CB 2NCEA 1AHWC 1OGAD 4MTMA 3GINA 1SDDB 2PWGA 5ACZB 4WENB 5A7EA 3QUXA 1MHEB 4K9JA 4F5CA 2APSA 4L8CA 1E65A 3T65A 5BQ7A 4Y4FC 3UZQA 4X4YB 3HLAA 2FX7H 4AIZB 4GG6E 2AQNA 4TNGA 1FLTX 4G6AC 1T21A 4K71C 2UZXB 3VI4E 1U92B 3QUMB 2ZCHL 2VUOA 3OX8A 1WHOA 1AHKA 1LMIA 3UDWA 4CU6A 5C2UB 5IBTH 2FX8L 1UM5L 2X12A 4IBZA 3K6SA 1HHHA 1EDHA 1P5UB 4NCDA 4NX0A 3IJHB 4N0UB 1S9KC 3FQTB 2E7HA 3LQZA 5G4OA 5FWRA 3W5MA 2CE6A 3VXSB 5DJDB 3HTLX 1HXMA 1MFDH 4LASL 1N68A 1YPZA 4KK8C 3HB3D 4LDCA 4HKZA 4MJ2A 3UZVB 3C12A 4XP9L 1AGDB 3QJFB 4KHXH 4R3SB 1Q72L 1JIBA 4JRWA 4OM0L 5ANMA 2UY7B 4IOIA 4RMRA 3PHQA 4N1CA 5FYKD 1PBYA 1MZZA 5J1SC 1WC7A 2GT9A 3QQ3B 1IKOP 1T5WA 1UB5B 4HWZB 4ZFOA 4XXWC 4PJ7E 3VFPA 1BECA 2IXQB 1BWWA 3BKCL 4KZCA 2WLIB 3MXWL 5K93A 3WY1A 4U4IA 2XNAB 4NJ9H 2NR6D 4KRMB 3HA0A 1KIPA 1P4BL 2Z1PA 2I7SA 3Q6GH 5EPMA 5ESAB 1SVBA 5HDLA 1ZV9A 1ZA6B 2X3BA 4M5TA 4Z7OE 2H6PA 4OIIL 4GBXA 2H45A 2K8QA 1R4XA 4I13B 4U1JB 1HQ4B 3SHSA 3VXMD 3FB7A 5B7EA 3SGKC 2DIJA 4RBPK 3QZBA 4W9HC 4GG8A 2R0LH 4AM0Q 1NAKL 1USZA 2R2HA 5TQ0L 5ECGA 3CC5A 5BZWB 4B9FA 4N0YH 3B43A 1RUQL 4M7KH 3SDYH 3RU8H 4YC2B 2A0LC 3WAKA 3OKEB 5LGHL 5FHBH 5T5FH 2LFGA 1M05B 1TTAA 4ANXA 2BSSB 1F18A 1HAUA 1NAMB 2CLRA 2JKRM 5D7JB 2W92A 2HRPL 5DDHB 4JFYA 3MLYH 4LLMA 5CINL 5A2LH 5KYYB 4ETYA 5F7MC 5IQNA 1U95A 4RGNB 5A6LA 4RISL 2ZONA 1B0RA 3ELQA 4M8QA 4UQ2B 2BFGA 4YSRA 3HR6A 4TNVK 4Z76B 2JVUA 2QPFA 2V7NB 4L3EA 4PB0H 1IGIL 5CCGE 3VM7A 5EEZA 1DLHA 3RY6C 3FCUB 4Y16B 5EBMB 2G0KA 4AQ8A 4UT6A 5L2KD 2LVEA 2OJEB 5FYKL 4AJVA 1JZ6A 4TRPH 4JPWH 4OGAC 4U7KA 3D85A 1S7XA 3RJOA 5KJ7E 1NCGA 4PBXA 4IRJD 4M48H 5M95B 1HNYA 1CO1A 1MAMH 3MCYA 4AMKH 5CSBA 3Q1SH 1CK0L 1YUHB 2FECI 1DBJL 3GDBA 2QFPA 2XX0A 1OP9A 2NNXA 4AJWA 1QBAA 1G43A 3VO0A 3SCMC 3GRBA 4X4MA 1OARH 1NMCC 2EEAA 2EYTA 3ALXA 1GW6A 4XCEB 5ERWA 3WKYA 2NY2D 4TYUA 3BHBB 3Q2WA 4WV1C 1G1YA 3QJRB 4XVTL 3WKPA 3OLGA 4X6EB 2AVFA 5C0RL 2GJ6A 5ISZD 1ZXKA 4FF9A 3BH9B 2G2NA 4DEUA 1LVEA 3EFDL 3ZT7A 4FA8A 1NTDA 3OG6B 5DHVA 3C8DA 5TDOB 4K3DL 1QVOB 5C0BD 3BAXA 1YVLA 2PKDA 3MJ8A 3QIBB 1ZVHA 5DMGC 3OKKB 1NFDB 5FF6B 1S7QA 4F7CA 4GKNB 2ZKXA 4JFFE 2FO4A 4U1KB 1NM9A 1JYWA 1CT8B 5TGBA 1CGTA 1PEZA 3BH8A 4S1QH 2VM9A 4JM2D 4JQIH 4FQHB 3D4GA 1X5LA 3F12B 2V3FA 4L5FH 2NNCA 1J8RA 3KWWA 5ABAA 2F5AL 2VMEA 5L88H 1EUUA 4AV0A 4Q0XL 4M4RB 4A2FA 2OMZB 3L3HA 4NQDB 1UXSB 4OB5L 5CM1A 4LPXA 2EE0A 2V2XB 3AMLA 4Z7IA 2E6PA 3ARGD 5GIRA 1DJYA 1ECYA 1YMMB 1UXLA 3I6KB 2QZ5A 2XVKA 4XCYB 4ENED 4Q4IA 4KROD 4EMZA 1R0AL 2ZKMX 4AOFA 5F1NB 4I48A 4L23A 1INDL 3EFOA 1I7ZB 5C09B 5E5MA 1FGVL 5CBEB 1D5MB 2KI6A 3P11H 3ZE1F 4WLCA 5KVDL 1SJEA 4FI6A 5LXGL 2J5LB 2X09A 4FN0A 4D0CB 3W11C 2YAPA 4N2OA 5GISL 4A7GA 4NQEA 2VWEC 5E94A 5KG9B 4YK4C 4NRYA 4XBGB 1NL0L 3HKFA 3L5XL 1KCVH 3MBEA 1XIWA 3LEVH 1SXCA 1W6LA 5E7FA 4OLXL 3Q6FA 1KLUB 1NIFA 1KPUB 2QPEB 4NLHA 4BEIA 3I6LE 4Y19A 2XXGA 4YN3A 1IC5L 1DVUA 5I74B 3QYNA 4ZAKA 3SDCC 2AGJL 1JYNA 4HKXB 3FQRB 1S6NA 4N68A 4A6YA 3LN4A 1QRND 4GUQA 3LXUX 4NZ8A 5JOFA 4MA7L 2B59A 1OY3B 2W5PA 2XQYA 3MGTB 4HT1L 1D7CA 1CLYH 5JW3L 4Z7VB 5C0GA 3T4AA 3PP3H 2HJFB 3QDMA 4XPFH 3WLWD 4MAZA 3TBCA 1JHLH 3C6LB 1RV6X 4M7JL 4FFVC 4CL7A 4BYHA 4X4XB 2AI0H 5F0LB 4UOW0 4GG6B 2X05A 2CHZA 2BS71 2OR9L 1D7DA 1E6JH 4MB4A 4BUGA 5J6HA 2F2HA 3L3DB 4P2YA 1A65A 2AXFA 4R26H 3VI4B 3H8NA 3DX9A 3DBXB 4XOAA 3H4FA 4BM7A 2RAMA 1MAKA 2QVFB 4HMEA 1QKZH 1NFAA 2WTRB 4PRNB 3V6BR 4FULA 4PS4H 3G7TA 3D07A 4MJIB 4GMSL 3FO0L 1U36A 3O4LD 4J3WA 3I6SA 1SXNA 2YGPA 3G6DH 3QDGD 5AKSA 5I8EA 5IBTL 4AENA 3NJGA 4NHUA 2LLGA 3LIUA 3KYKH 4AKPA 2F74B 4LKXB 3CUPB 4AWJC 1F5WA 4EQ2A 1OSYA 5J6GA 1YQ2A 3P0YL 4YHIB 3WBDA 2A9AA 3AM8C 4LPVA 4OY9A 2I9TB 1F41A 3FU5A 4PJEF 4UQEA 3O8XB 1RL1A 1KB9K 5JLZA 1J8HE 3M86A 1RMFH 4P2RD 4NPKA 4MNQD 2YUVA 5FHAL 1E4XH 2YD5A 4PP2A 5ESVA 4RCAA 1KY7A 1A4KA 2ZUSA 2EACA 1GGBH 4PJ7B 4RZCB 2GPZA 1A7BA 2Z35A 5CBAA 1KWGA 3C09C 5DJ2B 2WB7A 3ARZA 2BIIA 3FU0A 2YD8A 3PXLA 1E5UI 2WTOA 3S5LB 1XT5A 5C86A 1ZANH 4XBMA 3NFPA 5IMKA 4NJ9L 4TQHA 2Y23A 5A40E 4S1SH 4MMZB 1PDKB 3Q01A 4JFHE 4WCYL 2EVGA 4O51B 4U1HA 1JD7A 2XWTA 5ADOH 1KJ3L 1T5XB 5AKVA 2BMKA 5C07A 4AZ8B 1YYMH 3Q8AA 4AX3A 1U4EA 1LYQA 4DZ8B 4U6XA 4NYLA 2DQTH 4BXVA 3C5ZD 2PN5A 3SKUD 2XKNB 5HYJE 3SDAB 5D1ZD 3WIAA 4HBCH 3ZL4H 3LKOA 4P9HL 4H1LA 3EH5B 4N0YL 2A9MH 3RU8L 3S48A 4UU9A 1QSEE 3KMDA 3TU6A 4P4KD 3EXLA 4PRIB 2WWKT 2PTUA 3FQUB 5FHBL 5T5FL 1T66D 3F64A 3HAEG 5DTFA 3UTSD 2HYMA 3VD7A 1LP9E 2Q3XA 3PL6B 5BS0B 5HI5C 1HWHB 4L1HA 3N2JA 1PY9A 3KLAA 1NANH 2IGLA 3JTTB 4NN7B 2X9YA 5AD0B 4CVXB 4JZOB 3I84A 4K7PL 4RQQA 4W9DC 5DHYA 3ZYZA 4DWHA 5BW7C 1DQDH 3ETSA 4XPHH 1KSRA 1W72B 4DVBA 3SYQA 4YSTA 2VL4A 2D3VA 4F58H 3FO9B 3MBWA 3K6DA 3EDDA 4WHTB 1EA9C 2AXHA 4HU8A 1ZSHA 2WXNA 3LMJH 1ACZA 1DVFA 1HYSC 3CXHK 1P5UC 4D9QE 1U8LB 1OAJA 1FZMB 2EDRA 4UWQB 2E0PA 2VN7A 5F7BA 1RHHB 2W1NA 3HUJA 2HJLA 1MAML 2APBA 3B9DA 1L4IA 1LEGA 4JO4H 15C8H 4J3VA 4AMKL 2VDKH 3Q1SL 5LBSH 5HHQB 5JW4N 1IBYA 5DFVD 4IOFD 3PXJA 1Q38A 3H2QA 4HKJA 3ESVF 2XIBA 2B4CC 1AGFB 3ARRA 1JGDA 4Z3IA 2WHVA 2BWIA 3QUYB 2GG1A 4LZKA 3D09A 1A14H 3CFJA 4WO4D 4XOCA 2ZKWA 3L2LA 1T7YA 4UTAA 3BWSA 4ODXB 3BGMB 2V7HA 4JW3A 2UWEA 4KK9D 5JHDD 2YXWA 4HK0A 1ZY9A 4Q6IA 4IBQA 2UZYA 4MSWB 5IHZB 3ROOA 2DBLH 3U4AA 4KITB 4PW3A 3PWPD 3AACA 3RPIA 4QKTA 3LRSB 2YRBA 3FQXA 3IBOA 2CCVA 5GGQL 4O9HH 1K6QH 4L2YA 1SMAA 1U41A 1M53A 3L4VA 4ZFZB 5AOMA 5TE4H 2AXGA 3TBSA 5E95B 2FQDA 1TG8A 3RAJH 1FHGA 4TSCH 1EHXA 3O3BA 4S1QL 4CSSA 4F2MA 1P4LA 1EZVY 1XL4A 3V4VA 2DKUA 5E00B 4PRDA 3PWUB 2CO7A 2BP5M 2IBZY 1OP3H 4MQ7A 2CLZB 3CE1A 4JQXA 3QPQC 5D1QD 4LLUB 1I8IA 5F88B 1FA4A 1D5XA 2A7BA 3BIKA 4YNYA 2HX8A 4RGNC 1MEXL 2QLYA 1N19A 2EDKA 3KEDA 4FX5A 4MNGE 4E2OA 3MRCB 4OV6F 3DROA 4R96B 1AKPA 4IHOB 3F65A 3SBPA 3AU1B 5CIPB 5DJ8B 3KPSB 1AZRA 4Y16C 4BZ1H 4P23C 1P5VB 4DESA 3P11L 2EDDA 1T04B 3UTZB 5BPPA 2EILB 3TEUA 3PV7A 1F58H 1MJJA 1XSIA 2BO0A 2CKBA 1KEMH 1N9PA 2XXCB 3BLBA 1IJNA 5FYJH 3KYAA 5LGJA 3MA9H 2D3NA 4MS6A 1BIIA 4GW1A 3SZ6A 4Y5YA 4XMPL 1FG2B 2ARJA 1TQBB 2BP8B 2CRYA 2YPLA 4FNSA 2E46A 1KCVL 3LEVL 3QH3B 2OL3B 2CO4A 4WGVB 2DH2A 1YPZE 4M5ZH 2WWOA 3JV4B 3MV7A 3NIDF 4BFRA 3RURA 3KG5A 1ITBB 1QTYT 5HTSA 1AI1H 1EZVX 2N1KA 3R06B 4LRIA 2UVEA 4YQXL 5L9DL 4LRNL 5ANME 3PREA 3QQ9D 4M03A 3X13A 3WMSA 4OF5A 3NCYS 1KTDB 3GKWH 2FQGA 3MLZH 4PR5B 4KO7A 1N2RB 3U30C 1CLYL 1JOIA 4RA0C 4XXCC 2WLLA 4H25B 1HXYA 2ZWLT 5KVGE 4QRUB 1KPRA 1OSPH 2DM2A 4OM1H 1O6SA 2ED8A 4XPFL 1KPVB 3MC0A 3ILQC 1B2YA 1JHLL 2B1HL 2X4PB 4OFQA 5EZLA 3SGJA 3CDZA 4XMKH 3L3OA 1CU4H 1WFOA 1CYWA 4JZNB 4OIBA 2C1PA 1D9KB 4AE1A 4G9FA 1HZLA 1E6JL 2H5UA 1NCHA 1ZK9A 2JTYA 1IM9A 4JRYA 3ERXA 4ISVA 4MS8D 5D7LD 5ICZA 3U25A 1A9BA 4W93A 2YPKB 2MWCA 4ODHL 3RIAK 3IYLW 4PS4L 8FABB 1YZZA 3P4MB 4ZO7A 3FULA 2C3VA 4LPYA 2XRAH 3REWA 1DCLA 5FCUL 3UP1A 2AQTA 1KIQA 5C6TL 2ROXA 4DKAA 1M7XA 3LHPL 1WA2X 2IFFL 3K6FA 4ONHA 5I6MA 1BQLL 2ED6A 1QTSA 3QORA 5TTRA 5TH2A 3ZX1A 2VLRD 5IZ7A 2HG0A 3RIFF 3V5KB 1UA6H 3BH4A 1KGCE 2BOCB 5L7XL 4LAQH 2OXGA 2UZIH 1IEBA 1CQKA 1RMFL 4NKIH 5DZVA 4DT2A 1PZAA 1KJ2B 2JELH 3NACL 1RPQA 4L3EE 1E4XL 4HH9B 5I82A 3U0PB 3VJ6B 4QRSB 5GS2H 2A9NL 1GGBL 3P0GB 1SEQL 3VD3A 1G84A 4JKWA 4MB5A 3P3SA 1CF8H 1DO6A 4F57L 3JWDL 5EV7A 1LEIB 1SXSA 2WBXA 1JN6B 1K4DA 5MERA 1BX2A 1YNTA 5CKGA 3O11A 5JIHA 1ZANL 1NCTA 5EO9B 2DBJA 4S1SL 3HS0C 3WFHA 4X5XB 1FFNA 2VC2L 3L16A 4M1CD 4AW4A 4UQBA 1KB5B 2PXYB 3ZTNH 1T03L 5FA3A 3EGSB 3R0MA 1U2CA 4XBPA 5HYJB 1IGYB 4U1LB 5I1GH 2NY5C 5GGSA 1MI5A 1YYML 3LIZA 5FYKU 4TUJB 2VO8A 3MJ9H 2XBZA 3QWRD 5E0QA 2YC1B 2DQTL 1WGOA 3ARDA 3VD9A 4ZFFA 4FG6D 4NBZB 3IM1A 4M62H 3ZL4L 1GJUA 4J2QA 3QDHA 1VGKA 1KTLB 1S9WA 1SMDA 5CEZE 1LP9B 4CDHA 5AVXB 3N0PB 4LB8A 4NB7A 4YE4L 3PP4H 4PD4J 2JE8A 4EO5A 1T83C 3MRJA 2NY0D 3UGEA 3AXLA 3KBHE 4PJ9D 4WU7A 4NC1E 3F5WA 1L9OA 1KYOJ 1RZGB 5AEAA 2YWYA 1M2VA 3HLKA 3WDIA 2NUTB 3MNWB 1PLGL 4MJ5B 3TCXA 3MUGA 4F58L 1HHIB 1VLXA 1XGTA 4FNUA 5HDBE 5CR1A 2HG5A 2XFGB 4BWWA 5I24A 4X8CA 1BLNB 2Y7MA 3R18A 1CD0A 3KDMB 4KJWC 4RVBA 4CJ0A 3HZKB 2P8MA 3IS0X 4OFIA 2VDMH 1HCVA 5DYOB 3MRHB 4FFYA 4JO4L 3O2DA 1CICA 1HHGA 2EE6A 1W8NA 2C3WA 5LBSL 5KVFE 3DTUB 1GOFA 3EG9B 5F89B 4CMMA 1R3KA 1UADC 3M8OL 3C08H 43C9B 3KPQA 1N6VA 4MD5A 4HLZH 4PP1D 4NZTH 7PCYA 4MASA 5SV3A 2YS4A 4AXWB 3RI5F 4CGTA 3I02A 2Q3AA 2NNFA 5C0CD 2KPNA 4YHZL 3RFZA 3OSVA 2KQNA 3P3YA 2CKNA 4GFTB 4QAWA 3WN5B 4J3TA 4MAYB 1E67A 4P5TA 4WWKB 5EOCJ 3M88A 4YLQT 5AW1B 5FYJD 4G7VH 3TZVB 4JEGB 5B22A 4NQEE 1AR1C 2DBLL 4DGVH 4YSCA 3KLDA 3KW7A 5I5MA 1NDMA 1CTMA 4QNPF 1AE6L 4D3CH 2D7PA 4W9LC 2EVJA 2GAZA 5IB1A 4Z5RA 2E4TA 3BWUF 4O9HL 5KVEH 5KAQF 4QGTA 3A5VA 4Y19E 4MWFB 3L81A 1XZWA 4UNVA 4R97C 3RAJL 3EKCA 2R2CA 4MD4A 4M3JA 3VXSD 1H0DB 4LLWB 4PG2A 3QFGA 3F7VB 2EIBA 2WKLA 4F37F 5I30H 1P7QA 4PV9A 4RWHA 3X11A 1DBAH 1T80A 3EGXA 4BZ2H 3BAWA 4S0SD 2VQTA 4JN2A 4WJKB 3ZO0A 4YDKH 2QGDA 3QNXA 4C58B 2BPBA 1BXXA 4K8RH 3SD5A 3TNNA 4NO0A 3T65B 2K8MA 4MNGB 1FFRA 3VXNA 1I3RA 5AB1A 3VRIA 2ADGA 3EO0B 4NOFA 1VCAA 2YMOA 5EUOF 4JHAH 3D2UA 2G75B 4G80A 3DYOA 5JXED 1BAFL 3IDIA 3NIFF 4F7EB 2BSEA 4J27A 1PAMA 4BZ1L 4ELKA 1DBBH 2WLKA 3FZUD 4QXWA 4P59H 4JN1H 4ORGA 3RYMA 3PHSA 4JFPB 3VFWB 1AC6A 4AQAA 4UAOC 5CJBA 1RKRA 2CAKA 5FYJL 3MA9L 2EDOA 1MCIA 2KDYA 2OSYA 2B2XH 2QDWA 5I6LA 3TC9A 3LPGA 2PO6A 5I15H 3MRLA 5BZXA 2MHAA 4M5ZL 2JXMB 4N3UA 5IQ9A 1IBFA 1PKQA 4HJIA 2AQPA 2WSPA 4IOIB 1TQCC 5DA4A 4N2FA 3CIAA 4G8EA 2NYKA 4BIKA 4HUVA 1RJYB 5F3BA 1FGNL 2GT9B 3FT0A 2MPVA 5FUOL 2N59A 3T0WA 4BJLA 1SHWA 4QXUH 4Q58C 5D7JD 1U21A 3MDJA 1YDPA 1XB8A 4O00A 3CSYB 3QZWB 4HVBA 4A2DA 1DDHB 4YUEH 1CDUA 3OAWA 5EPMB 1D6VH 2R9HD 2XIDA 5T1KA 1BCIA 1M3IA 1OSPL 2YUXA 3BP5A 4Q6KA 3MNVA 3U46B 3IJSA 2F7IA 3D39A 4GBXB 4UB0H 5AL8A 1QPKA 5FO2A 2KMWA 4CADB 5C6PB 1SN2A 1CB4A 4KKAC 4NQSB 3CVHH 4WUUB 4J5VA 4M7LH 3FB7B 2FHCA 4UINL 5DA0B 4OGYL 2ITCB 4N9GA 4W9EC 1CU4L 1CI3M 1USQA 4E0RA 2A6JB 3FTWA 4NP4L 3V0DA 5D70H 4G7QB 3O2VH 3QEQA 3E6FB 5C07E 4YHYB 1WFTA 4Y5VB 5KUKA 4Y7MA 3CC5B 4XNMA 2BVOA 5AENA 4Z0XA 5C0ND 4JR9H 3ZTEA 1OVZA 4KTDH 3U82B 3DSFH 2ODHA 3CFUA 3RNKB 3FRPG 2XRAL 3FL7A 3QS2A 4G8GB 4YZFF 1I9RH 1UCTA 1A0QL 4UQ3A 3KLLA 1U95B 5L8JB 4JDZB 2CMRH 4JFXA 4QAMB 1DEEB 3QUZA 3MFFA 4IDJL 4NPJA 2G5RA 1NANI 3GLAA 4JGJA 4L3EB 4LAQL 2UZIL 2YK1H 2Z7YA 2VISA 2DN7A 3LD8B 2R0KH 1PKOA 4NKIL 1KBGL 3DK2A 1Z9MA 3L95B 3TGXA 1ZSDA 2JELL 4AL8C 1MQKH 1QBLL 4JG0H 3D85B 1JNNL 4R0LA 4A2LA 3D50A 3MLTA 1NAML 1EZLA 4W4OC 1HEZA 4NKQB 2BRQA 2R2EB 1MLCA 3CFEA 3QIBD 2XWDA 5E7BA 1H3XA 1RUPH 2BVEA 4ZMXA 1WSST 2AERT 3GGWA 2H47C 5IF0B 3HUJE 1EIBA 1TQBC 3G5XA 3LKSB 4GAYB 3FUMA 1BZ9A 1OT4A 1W72H 2WLJA 3O6FD 4NZJA 3VH8A 3DMMC 1O0VA 2FJFB 3BPLB 4H0HB 3SJVB 5B21A 1UWYA 4PEEA 3DSNB 2JCCA 3GRWA 5H94A 4F3FB 5GSVB 3UTTE 4ONGH 5JPNA 3QARA 5I1GL 1BXUA 1F4XH 3CZSA 2HLFD 4NQDD 1I1RA 1A6AA 4P3DB 3QJXA 4YE0A 1PG7H 5CP7B 1OTTD 5E6UB 5AALA 4FJYA 2LU4A 1I1FA 1W0YT 1YMMD 3G5ZB 2YA2A 3OXSA 1LDPH 4UV4L 3EJZD 1L3WA 3QI9C 4B7LA 5D7IF 4HJTA 3H3BC 4UDTA 3VI3A 3MJGX 3MJ8B 4AYEC 4P2OA 2ICWA 3DURA 2JIXA 3DPBA 4JFZH 1VFAB 4H8PA 5GS0H 3LNGA 4LSVL 4JFEA 1PZBA 5D9SB 3A4AA 2FNBA 2QKIA 4LP4A 4YIQA 1MCDA 4JKKA 4U4BA 5HDBB 1AP2A 1L3NA 3CN0A 3KPMA 4NAQA 4EOWH 1SVZA 3D3VB 3KAAA 3GMOA 25C8H 5EN2A 2EDMA 3ZRSA 5LG1A 4JPIB 4F2ME 5E1AB 5F9OH 4YXHH 4M9OA 2BIOA 2Y1YA 3KPRA 5D7KE 1J8SA 1M3JA 1ZVSB 3HC0A 4DGYH 4K8RD 4X7DC 5E8NA 1PTZA 5KS9A 1L0QA 2JKIS 3T2PA 4PRBB 1D6EA 1V3LA 1J5DA 5D2NA 1JCKA 3VB9A 5C0EA 4I1NB 4OCXH 1NGZB 4W4NA 2XVBA 2IJ0C 3QEHB 4I48B 4AQ1A 3MUJA 2K7QA 1PJWA 4YXLH 4AVHA 2OMWA 4U6TA 2E27H 5F9WB 1JPEA 1FAIH 3SPIA 3E9UA 1SJEB 1SM3H 3DTXA 3C6LD 3RHWF 4I0CC 4QF1A 4W9KC 2J1YA 2PYEE 4UDUA 1MSPA 4OGXH 1D2OA 1JHTA 1PX4A 3MBEB 3MRPA 5EBLB 3MV01 1F2XK 3VWJB 5I0ZA 3D0LA 3PCYA 1NOLA 3H9HA 4FHJA 4FXKB 4PJ8A 1A4BA 5IOKA 2R2BA 3GZKA 4MYPA 4QHUB 3QO1A 4Y19B 4D3CL 4CKVX 1UASA 2WO3B 3RVVD 3MV7E 4ZAKB 1IAIH 3S8GB 1M4KA 4FABH 4A6YB 5IJDC 5I9QB 4LVNC 4QCIB 1JWUA 4KRPD 2A83B 4GSQA 1BM3H 5JOFB 5IG7A 1UKSA 2ENJA 4LCVA 4FEMA 3RGVA 5I71B 5KBLA 3KL0A 3VGFA 4QRTA 5EC1A 4KV5F 2WW8A 4XZ4A 3QULA 2WCPA 3SYOA 1IEHA 2N0MA 4GFXA 4XOEA 3O8XD 2BJMH 1COBA 5E8PA 4BZ2L 2YSSB 3L1OL 3LKPB 3II1A 1J9RA 2A73A 2WQSA 1A5FL 1QTPA 2VDRH 3IBEA 4JO8A 4K8RL 3IJYA 3OJ2C 4GRWB 5I8CA 2BIPA 2UYLA 1BXVA 1X7QA 4HSQA 4Z7AA 1YY8B 2CQVA 3R4DA 5GHWL 3DX9B 2KS0A 4QRPA 5F3HB 2AJZA 2QVTA 4G9FE 1K8IB 4J1UA 4AMXA 5KSAA 1MCCA 4NHCL 1ZLEA 4FI8A 4JHAL 4MCYA 1A4CA 4N2AA 4Z95H 5HDQH 1O7VA 1UD5A 4TQPA 5I8EB 1I7TA 3VFGL 5AW6B 3TASA 5I1KH 4G6MH 1DBBL 3U9WA 1Q90A 3HPJB 1RP8A 4P59L 4JN1L 4UTBA 5J6GB 4HP5A 4PV1C 3LB6C 3GF8A 4J4PD 1LILA 3UBXI 4HWUA 4LOFA 1RIVH 2YD7A 3RVWD 1QR4A 3H53A 5JLZB 4GNKB 3CD4A 3MXVH 5AOIA 2F19L 1PX3A 4C56E 3NCJH 5I15L 3SDAD 3NZSA 4UIKL 3PV6B 5C70A 2J25A 2RQEA 3HEIB 3ISRA 5D72L 4FFZA 2DQCH 5AB9A 1DQVA 1LNUA 4JCMA 3EZ8A 4WSJA 2Z35B 5FW7A 4M1DL 5CJXA 1F2QA 1JXGA 2AK4A 3D30A 3E3QC 4QXUL 4DUWA 2IQAA 4FNRA 4JANA 3PL6D 4KY1H 3SDXA 3S5LG 1Q0YL 1A6VH 1FLRL 3ORJA 5E4EC 3TXAA 4O4YH 4ODTL 3U4BL 5J4MA 4OQTH 3UP6A 1XGYH 3AREC 3BEVA 1XBRA 4GRMB 1KJ2H 5DT1L 5C0AB 2OJZL 4V11A 4UB0L 4PGZA 2XWTB 3KLHC 5EUKB 2BMKB 5C07B 3Q7JA 4DPCX 5DRNA 2XQ0A 4U6XB 2C7UA 3CX2A 4L8DA 1BYPA 5D70L 1U3HA 2WINA 4NKOB 2XXFA 1MI5E 3S9DB 1HVXA 2VLLB 4WI9A 2EZ0D 3HI1A 4H1LB 1KYAA 3DI3B 4BDVA 1CFBA 3O3EB 2YARA 1KZYA 2AEPH 4UU9B 2P24B 4JGNA 1FZKB 4KTDL 3DSFL 3VXPB 2WMPA 4C57C 5HHOA 5DTFB 2DLEA 2V5YA 4L8SA 3LPPA 4B50A 5E99H 4LCUA 1I9RL 1EJ8A 2ATPA 4RSYA 3QUYD 4KJQD 2GW5A 4N86A 1OOWA 1R6VA 1BVNP 2CMRL 1G7QA 2VL5B 4IEFA 4KJPD 3H56A 5DVOA 4DGIL 2LV4A 4F92B 1FI8C 5DI8B 1I8MA 2MKWA 1IL1A 4LU5L 1IUZA 4XC3H 5KN5B 2R0KL 4XVOA 4KXBA 4MVBD 2B39A 3UACA 3RTQB 1S3RA 1PLBA 4QY8B 1DVFB 3U9UB 3K1DA 2XI9A 4JFFD 3MV11 4ENEC 1WA1X 5IOPB 3K80A 4DN4L 3HUJB 5EIIB 3FO2A 3RZCB 3DVGA 4QXTB 4X5WB 1RUPL 3NJHA 1J0HA 4OI9A 2UVFA 5H37G 4YDNA 3MGOB 2NSQA 5D2LF 3JV0A 3RUGF 3ZT5A 5EU4A 1W72L 1OZUA 5HVGB 2GFBA 2APXA 2DKSA 1AMYA 3UTTB 3NESA 4PTTA 4HUXA 4B5EA 2GTWB 4PGDA 1BM7A 5JZ7D 3UYPA 2DL9A 5AVTB 1RUKH 1CN4A 1I9EA 4AUYA 3V0FA 2YZ1A 3QA3A 3RWGA 5DQJB 4MB1A 3IFNH 2Q7AA 4GEIA 1PG7L 2PF6A 1CFTA 4Q6IB 2UZYB 1W0WA 4X9BA 1OB1B 4KQ4L 2OMVA 3ROOB 5EF3A 4KXCA 2QHLA 3B3BA 3IJ9A 4HIIB 1AQDB 1OD7A 4AM0A 3FQXB 5JDSA 3SY6A 4FHKA 4M93B 1GIGH 3JXAA 2AXGB 5GRVL 3TBSB 5JXAL 5FOBA 3QJTB 3PQYA 1B4TA 5IGXH 1OGPA 3O4OB 1J87A 2YBRB 1F56A 1BQKA 1FG9C 2P8PA 3V0AC 1NCNA 3VFNA 1ADQA 2CA3A 2YLKA 4J6RH 5TJWK 3W56A 2AV7A 2C9RA 3ET9F 4PRDB 2GJRA 3M45A 1UKQA 3FBQA 3I6LD 5F9OL 4YXHL 4DCQA 4R90H 2XACC 3GZPA 3RVTD 5E9NA 1DR9A 4R7VA 3TCLA 3LX9A 1A22B 5GGRA 4U05A 4U1GB 5AB2A 2X7LA 4HDIA 1D5XB 4YNYB 4DGYL 3K71A 5FO7A 1HL5A 4G9DA 1A21A 1VZGA 3DA0A 4NI6A 4K0OA 3TBVA 3L13A 3ROLB 1B3IA 2WGXA 4BQ9A 2DICA 1H8SA 3JUYA 1IQDA 1QG3A 5DD1H 4WW2F 5F1IA 2FATL 3IN2A 3N1PC 1RIHL 2J8OA 3P4NB 2E27L 2PYEB 2Z65C 4TM9A 3ULVE 5ALBH 1R5WA 3FT9A 5F6HI 2I5YH 3MCLL 1SN0A 3TVMA 1D2PA 1MJJB 4NM4H 4PJFF 3U79A 1H8LA 1Z9NA 3PFUA 3NSJA 5CSZB 4Y5YB 1D9KD 5LQBH 4X8JA 1X5GA 2WJ5A 5ETUA 3MRRB 2X6MA 4HHWA 2ZXCA 3MV7B 4JY6B 1QPXA 1AAJA 1B4JH 1FN4B 2HUHA 2FT8A 5IQOA 3GXDA 3ARFB 3W57A 1PKQE 5D96C 1IAIL 1WG3A 4JDEA 4UIMA 4FABL 2Y2YA 4JG9A 1SXZA 1YY9C 3NSDA 3PY9A 2WWMC 3K2UL 5GJTL 4HZLA 4YGAB 3EOAB 1BM3L 3DLQR 4N8VA 3VMOA 1UD4A 5E6ZA 3LTVA 1XGRA 1J8HD 1YNKL 2CDGA 1HXYB 4OZFA 2E6QA 2NNAA 4Y2LA 4JE0A 2F53A 2K1MA 1G9MH 2F18A 3FTYA 2YLHA 4WAFA 3RY4A 2BSTA 2Q8BH 3MZGB 3HN8A 3CDZB 1SQ2N 3T0EB 3RX8A 4WEBH 3MROB 3D39E 5TK2A 4WK2B 3V7MA 1F4WH 3S96B 2BNRA 2QTEA 4JO3L 5DK0B 3SO5A 1IM9B 3P3UA 2YA1A 1MRFH 3HE7B 5GGTL 1QASA 5KVGH 4PHXA 2YD6A 3KYMA 1AZCA 1GZQA 2D4FA 2HX9A 1RZJH 4JREB 4HIJB 3QEQE 1AO7A 3ZT6A 4Y1TA 3Q8BA 1MNNA 1Y18B 2DIBA 3EOTH 4JFHD 5DR5H 2Y2TA 3RILA 4QJ5B 4ZO8A 5DJ0B 1BVLB 3K1KC 5I1KL 2HT4C 3FH8A 3QHFH 2A5UA 4TUUA 4WEMB 5A2JH 3SN6N 3U2SB 2PXYD 3HR5B 3MN8A 4ONHB 3QORB 4MDJA 4S1RH 2X87A 4C56B 5HYJD 3SKMA 2ZUXA 2R1YA 1M6OB 1CYXA 3MXVL 4LLAA 5IEHB 1U91A 1B88A 1G6VK 3V10A 1QSED 2EEDA 2K6YA 1E4KC 2BP3A 3OTTA 5B1JC 3MRMB 3GM8A 1XCQA 5G2NA 3KNBA 3NZ8B 2ZWSA 5C0JA 4HCFA 4PJXF 4B41A 2C9VA 3MODH 1Q0EA 4A7TA 3D9AH 3HZMA 4UBDC 5KYXA 4N1HB 3O11B 1ZKAA 3TEZA 5HXMA 1LK2A 2VR5A 3SKNA 1A6VL 1FFPA 5HBBA 3WFEH 5BNXD 4LMQI 3VWJC 5HYIA 4P46D 5CEYA 2OPCA 4ANVA 4C8XA 4FXKC 4UT6H 1A64A 1KJ2L 3QHZL 2J6EL 2NUPA 4FG2A 4NZRH 3VYOA 3ZE1B 4D9QD 4XBPB 2OMTA 1KFAH 5GGSB 1TJHH 4CN6A 4O2FA 2JCCE 2P7TA 3GUTA 4NZUL 2Z31C 4UOQA 2W91A 2BIQA 3LKRB 3QPXL 4IOSA 3CZUB 1JXDA 2AQ3A 3RY5A 3U0WH 3SPCA 2AEPL 3QEGL 2AC0A 1TVHA 1QABA 3UG3A 2ETWA 3B8SA 2ADJA 4PJ5A 4WI6A 2EDLA 4H2AA 4BRVA 2EXWD 2PUQT 3AXLB 3BAIA 3VI3E 1P84K 1XGUB 3AQZA 3HE6A 3WS6C 5K69A 4OJYA 1OP5H 2GUOA 2ICEA 3GNML 1CBJA 2SEBB 2YMXL 4DTGH 4EDXA 5J13B 3VAEA 4UT9A 3TFKD 2ERJB 2OA9A 4JFEE 5CEZH 1HCFX 1M2VB 1YQVL 2A6KB 5H2BB 3X12A 1CL7H 1A9EB 4C83A 3FQWB 4MAYD 1U8IA 4XC3L 4WWKD 1NBZA 4A7QA 1HNGA 1W80A 7TAAA 3KVDD 3TZVD 2CXGA 1GC1H 3L4TA 5DHVH 5BJTA 2RHEA 3FSWA 4PW9A 1G7MA 3T2NH 1DTUA 1T20A 3UERA 2RB8A 1KXVA 3QZLA 3VFRB 2P8MB 3QIWC 3KPRE 1MW2A 4PI2A 5CZXC 1RHFA 1UZ6F 1CICB 3GIVB 4E41A 4FS0A 1OANA 5IMLA 1KWKA 5KS9E 2WQWA 4MMYA 5F44A 5FK9A 3ZDZF 2CIKB 5D2NE 3KPQB 4URKA 2O1AA 1CDJA 2IADB 3C75A 5EU5A 1C5CH 6PCYA 2NQ3A 4K94H 2WZAA 1H3VA 2B3IA 1YEDA 1BXAA 4LARL 2DWSA 4JY5H 1MREL 2Q76A 4Z7NF 3QG6B 3QXUA 5KVFH 3CFIC 1CLOL 1ZIAA 4ZZFA 3V4LA 4P5TB 4PJEB 3MX0A 1HEHC 1WFJA 3MAWA 3UROR 2BW4A 5I73C 3PGCA 2NY3C 3BX7C 2PR4L 5DZNA 5IW1B 4AITA 1WLHA 4OJAA 1TVDA 1NDMB 2X4OA 2FBRA 1A7RL 2DQDL 1NEZA 3LQAH 4Z5RB 3IU4H 1VFMA 2VAAA 4Y4HA 4TUKH 1UWXH 1IAII 3ZZ1A 5IGXL 4DP1X 4ETQB 4MD4B 2FWUA 4P49A 4NQCE 2IDQA 1E27B 3APDA 3GXIA 3KYNA 4PV9B 1KTKE 2VDOB 2VM4A 2WBJC 3I74A 1AD9B 1OO2A 2YGVA 3CXDH 3FAXA 5EOTB 3GZOA 2VQ4A 4R4BB 4R90L 2RMNA 4JUSA 2X1WL 1DSFH 4EDWL 4U1SB 3DWTA 2EICA 3TNNB 2FR4A 2FL5A 2R69L 1KY6A 2XBDA 4PWIA 4XO8A 5ICUA 3TLRA 4N2GA 3VRIB 2CDEA 1S7VB 1C5BH 1B0WA 3T2LA 3S3SA 1I31A 3ZHDA 1T1XA 3NP4A 3OWEA 1UUNA 4CMHC 1J5HA 5CEXB 1FCGA 1E4HA 3P77B 1ROWA 1ETZB 2W9EL 3IDIB 2PPEA 3L9RB 4UILH 3E7JA 5DD1L 5SWZE 5SV4A 4X6BA 1MCSA 4ZXBA 3RTQC 2MCAA 3CFBA 3LRHA 5F9JB 4PW4A 5DSCA 1LO0H 1ZPUA 1F86A 1U6AH 2G2RA 4ORGB 4GBXD 1HSAA 1Q1JL 2N7SA 2ZAGA 3FTGA 1LJMA 1H5BA 3JVFC 3FT2A 2BIHA 1EHNA 1WGVA 4B9KC 3OC5A 4XCFH 4WRLA 4QT5A 5LQBL 1HKLH 2PO6B 5FYLE 3P30L 4IK6A 1Z5LA 1EHKB 2MHAB 3S98A 1I1AB 1PKQB 1T4KA 3CSTA 4MCZA 1MJ8L 1JG9A 3DUSB 1EAPB 1TFPA 4O2EA 5F3BB 2H26A 2MKLC 1A7NL 3WUWA 3QZNA 2V5TA 4G8GD 3QGVA 3RDTC 2DWYA 3QZWG 1KGCD 1BMGA 2AK4E 3GI9H 2MQ3A 3SDXE 2QVMA 2LR4A 3B5TA 2OZ4A 4M5SA 3V0WL 3BP5B 4L3ED 1G9ML 1BFSA 1OHQA 3ILPA 2V3EA 4HJJH 1S3KH 1P1ZA 3D87B 3QSKB 4JFTA 2Q8BL 3GSWA 4JLRA 1AXSB 1ZLWH 1HH9A 3Q9QA 3D85D 5FFGA 4ZFOL 1XTLA 2D3JA 3QRBA 1OLZA 4NC0B 4XPGL 1ID5I 3O4OC 5KVGL 1U8MB 4RAUA 4XNMB 4XNXH 2BVOB 3O9WA 2ODIA 2KBGA 2XPYA 1RZJL 3EBGA 3MKKA 5KBDA 5D1XA 1X9RA 4Z8FL 5BOJA 3FF7A 2W9DH 4DP2X 2VLKA 3QHFL 5K9QI 5CJOH 1SLWA 4M6AA 3RLSA 3ZSTA 3SJVD 2ADIA 1IGCH 1G7PA 1T1ZA 3QEUA 5I5RA 1SMOA 1TLKA 3BD3A 3WJMB 2IV8A 3PWJB 1DVQA 3DC0A 4G5ZH 3OXRB 3LPFA 1WBZB 5JIQA 1F90H 4H1LH 3UPAA 5BV7H 5CEZD 1H3UA 5HJBA 2DQHH 5DO2C 4JCWA 5D5MF 1E9PA 4R0LB 2A74A 1ACXA 1G9EA 1XGQA 1PSKH 4HEPA 2JB6A 2G60L 3O3AA 5ES4B 2ZP0T 4CN4A 4F7TA 4P05A 1M7IA 4P07A 5ELIA 1N3NB 1JZ4A 2XWRA 3D9AL 4MHHG 3R8QA 1Q94B 4PP1C 2CPCA 5DS2A 1BZ9B 3IRCA 4GYBA 1CS6A 5KBKA 2ZKHH 4NIKB 1K72A 1BYNA 1WCQA 2B5IC 4KKBC 4MLSA 3B9EA 3WIHA 2BC4B 4UT6L 5H8DA 1P6WA 3NA9H 4IRZH 4PLKD 1G7JB 2HTKD 3ARFC 3MPCA 5H94B 2JCCB 1SY6L 4NZRL 1LEKB 1HQRA 3RE0A 1ET7A 3MLUH 3QCTH 4ZK8A 1KFAL 3TIEA 1UURA 3AT8A 1D5BA 1FDLH 1TJHL 5INCA 2C7FA 1OAQH 2ZOUA 3FBKA 3LV3A 1MFNA 1NMAH 3UABA 2QQNL 2D7TH 3S4SA 5L4MA 1ZJBA 1EO5A 1I1FB 3S37L 3RB5A 1YECH 2CK0L 4WHDA 3NIDB 2XQBH 4WHCA 2UXVA 4U7MA 3QZOA 4UANA 2ICWB 3DURB 4NENB 3T0EC 4QHLB 5HYSA 1KELL 4UTAH 1Y6KR 1EEYB 3IEAA 4M6ML 1SJVA 4G1EA 4NBXB 1J9SA 4NN6B 2CR6A 4JGMA 2CGRL 2F58H 3FN0H 3PQYE 4JFQA 4NO2B 4NQED 4X9YA 2BFVH 5F7KC 4JGUA 5AYTA 3ZE2F 4JREC 2FUTA 1Q4NX 1UZGA 3GMOB 3RGHA 4NQXA 5EN2B 3MBED 4IMLB 1XIWD 4FKHA 4NAJA 2EIZA 4ZUWA 4E9SA 4AC2A 1GC1L 4GKSA 1CXFA 3KPRB 3T2NL 4YDVA 4QRRA 2WIIA 3VXOA 3ARQA 2DTSA 3CHQA 4Y19D 1BSIA 4W9JC 3HC0B 2DKMA 4G1MA 2W65A 5EDXA 4ZAKD 4P2QA 5E8NB 5KS9B 2AS5M 3OB0K 1AZZC 4G72B 1D6EB 1YEIH 4OLWL 5C0EB 2W8CA 4JO2H 2VM3A 1Z9SB 3IGAA 4X99A 2EXSA 2BS8A 3V4VH 4DNLA 2L7EA 4AQ1B 3N43F 3FO1B 3QHTC 2IWFA 1G6RA 5IWLA 5C08A 3KWXA 2OMWB 4M43H 2OSLA 2Z8SA 3BUBA 1NCAL 4OW6A 2PETA 4K94L 3S0PA 1N26A 4O2CA 5ICYA 4H0IA 4QF1B 2XJKA 4TS6A 1CGXA 3L1FA 4Z6AT 4HUCA 3EHBC 5KVFL 1EMTH 1A7OL 4HJ1A 5F71A 3V6FB 5DS1A 1DJSA 1IFHL 3N9GH 1QNIA 3MRPB 5F7HA 3D0VA 4TSAL 4OF6A 2FLBT 5A2IH 3D0LB 2K0RA 4PMFA 5HHXH 4Y4KA 4YLCA 2IO5A 4BQCA 2K78A 3LQAL 4P57B 1U58A 3GYRA 2IALB 4JO1H 4TUKL 2CKBH 2GIMA 4NQCB 1Z66A 1MFAH 1KDIA 3BPNB 5CCKL 5EDSA 1A02N 2ADYA 2QMKA 3Q0HA 1M1SA 1NSNH 3OLDA 1Q8MA 1SJHB 4QRTB 4A7UA 2DMGA 2Z1KA 3PJLA 3TJHC 1CFMA 3S3CB 4FMKA 5DFTA 3L3KB 1IC1A 3SQRA 4K7PX 4I4WA 2AVGA 2A73B 2ZKYA 4KHTH 3ZGIA 3CXDL 1LE9A 2F53E 3CU7A 4F80A 2EKSA 3FFDA 3MOQA 1CF1A 5I8CB 3OR7A 5JW4Q 1GCFA 1C08B 3DUUA 4JHBA 4A6YL 2G3ZA 4MCNA 2VDQB 4XGZA 2AJZB 4L37A 2O5YH 3BQUA 5DUMH 2ERJC 3II3A 4Q2ZB 5GSRB 5SWZB 3WUZA 4WI0A 1UKTA 1EERB 4MCYB 2UY6A 1NC4B 1VFBB 5LCVL 2JNZA 2W07A 2AMUA 4KMTL 1AO7E 2VKWA 4BK5A 2VIRA 5IJKC 2VDNH 4NGHH 1LO0L 4HZAA 5D7IE 5C0AD 1T7VA 1E9QA 2DEWX 1QLFA 5DHMC 4I8DA 1CZ8H 4MJHA 3GBNH 1O6VA 2QSQA 4LIQH 5C07D 4KZDH 1U8KA 4XCFL 4LF3A 4BUQA 4ALAC 1HKLL 3W82A 4HJEA 1QA9B 3WO4B 1KXQA 2PP9A 2FBJL 2R1WB 1PYWA 5GPRA 4L1TA 4CVWA 1KGWA 5DK2B 4KFZC 1AIFA 4QYOA 3IE4A 3PNWA 3GSRA 1KGJA 3T3PE 1DUYA 1HHKB 2AK4B 5DVMA 4R7LA 2F7QA 2NR6A 3C2SA 4FGMA 4JANB 5IKCA 5J06A 1P7KA 3KCWA 3O6FC 3O6MH 2HTLC 3M17A 2OCCB 1LO5B 2OSWA 3A6CL 3T3MF 2ZYRA 1OPOA 3VXMA 3NH7H 4R8WL 2P8LA 1JYVA 4HJJL 1S3KL 4IJ3B 4IGBC 2ZG2A 4IKLA 4RMUA 2Y6SC 5DRNB 5BXFA 3BUPA 1DVFD 2D7QA 2ZP8A 1C7TA 3EYOA 4MJ6A 2WINB 4MBRA 1L9MA 2HJKA 1B90A 2V5RA 3FUJA 2VN6A 3RZCD 5K9JH 3DIFB 1HCZA 3LPOA 4YSSA 4D7BA 3MUY1 2XN9B 4W9FC 3G6JA 2WMPB 4OD1L 1TCRB 2G3MA 5B3NA 4ANKA 2W9DL 3TO2A 1VA9A 2IANE 4LCUB 4BE5A 3UTTD 2HPTA 4PJ5E 5DF0A 5SX5K 2H8PB 2CJTA 3FT1A 3BZEB 5AVWB 1BF8A 2CBTA 1G7QB 1JZFA 4OLYH 2FIRT 4FTVA 2E59A 4M00A 3IDNB 1IAIM 2BVPB 5IUSA 4L8BA 2MQCA 2Q6WA 5IROC 2O6FA 1CL7I 2BXYA 4ICXA 3V6OC 4JKMA 4RIRA 3CV5A 1YUKB 3MNZA 3VGAC 5EIIG 3HVDA 5B39B 2H3NA 2EDWA 4BFFA 3FO2B 5FB8A 2X9WA 3DVGB 3N91A 2J57A 2HPOA 2CLVB 1L7IH 4JFOB 1YEHH 1R34A 5EUOB 1OAYH 1OCZB 4XCCH 5F1OB 5FFLA 3VXUB 1ZJAA 3U0TA 2AKRA 3F58H 3GSQB 2ZKHL 5TK4A 1GKOA 4V1DB 3S36H 1I1AC 3NIFB 4H0LC 3AQYA 3FMGH 2E7LC 2BVQA 4PTTB 3UAJC 4XP1H 3I85A 5D7KD 4PGDB 5IBUG 4H8WL 4MMXB 43CAB 4PTUB 3QCTL 4JMXA 2VXUH 2OMXA 4WO0A 3QA3B 4OCNC 3RWGB 2IMMA 1ANUA 3TA3A 5ESQA 1ZMYA 3Q2CA 1NMAL 4FFYH 1CFTB 4KI5F 2EXYD 3BI9X 2F8XC 4K3JH 1G1KA 3CPLA 4I0KA 1SDYA 4WDIB 4XVJL 1G7LA 5C0BA 4NJAH 1YECL 4BSVB 3KLQA 5MENB 4JPQA 2WQAA 4HIHA 5A2BA 4F24A 3V6ZA 1IC0A 2GSMB 3I2CH 3ABZA 2PYED 2NZIA 3PQYB 5B3JE 4UTAL 2ZOOA 3WN6A 1AFVL 2MOVA 5T3ZH 2NMSA 2P8PB 3VE0B 3FN0L 1JPFB 2BFVL 3RP1A 4NQVB 3VVVA 3RX9A 1IM3B 3VSTA 4FTDA 4AJ0A 5I76A 1DSWA 1WA0X 3L6FA 3L17A 3MRIB 5FO9A 3MV7D 4N85A 4DCQB 2VW7A 3GBDA 4EZKA 1JZ3A 1HNFA 4DK6A 1E90A 2X7LB 1EXUA 3CZFA 2CDFB 2X1PA 2YEZA 3STLA 4L3CA 1XD1A 3LZPA 1XFPA 4PS3A 3TOPA 1EZUA 1YEIL 1KTRL 3QDJA 3V0VA 1M57B 4JO2L 3B2PA 1OL0A 2O5ZL 4ZS7H 1CIUA 1DN2A 2O61B 1R24A 4PBWD 2YD3A 4MA8L 5AW9B 3SEPA 1WS8A 1DUZA 4UCFA 3SDDC 4M43L 2WGNB 1HS6A 2Z93A 3O0LA 1KXTA 1XX9C 5TDNB 1G9NL 1QO3A 4R6UA 4G7SB 4K3EL 4RMTA 3VYNA 1JV2A 4OZGF 4G6JH 5EF2A 3DDGA 5FIEA 1BD2B 3TO4C 1EMTL 3NPSB 3T09A 3TS8A 3HNTL 4G9FD 3N9GL 3QRGH 2AJSH 1IM9D 5ETUB 1TYEB 3HE7D 4LSPL 3EH3B 3RWHA 1BOGA 1JI2A 4YSOA 4AI7A 5HHXL 3JWNC 3ULVH 4XPTH 3BAYA 5I6PA 1QRNA 3F8UB 5CGBA 3B2UC 1QLRB 2H2SC 1TTBA 4EI6A 1NUDA 1ND0B 1OT2A 3AITA 5E6IA 1WF5A 1XH2A 2CKBL 2CU9A 3QXTA 1MFAL 3O6KH 4FOMA 1I4FB 3B6SB 4NUPA 3QORD 2FB4L 2OTWA 5D93C 4C56D 4F9PC 1JF5A 4GQPH 3ULUH 2F53B 2FIKB 2PTVA 4JM4H 4ZUUA 3ZKMC 1SHMA 5IMMA 2WVSA 2CK2A 4UF7C 5MEPA 4H13C 4CSZA 2Y72A 3HRZB 2ENPA 4WF7A 1ZT1A 1JBJA 1BBJA 3GTVA 3LOWA 5IVXA 4TTDD 4N6RA 5T5NF 4NN6C 1GZQB 2O5YL 3O4LA 3CFDB 4UQCA 3B2VH 3QDGA 1SUHA 1AO7B 3C60A 5DGQA 4MYWB 2OP4H 1EK3A 4AKOA 1AY1H 1JJUA 3GZQA 5KSBA 5D7IB 1TETH 2Z0UA 4DW2L 5GS0C 3ASWA 4Z9KB 2RTTA 2V5SA 1F11B 5D1XE 4UQAA 2VDNL 2BY1A 2PCXA 4NGHL 2H1LM 3E8UL 4HK3J 5BUAA 1CMOA 1JDCA 1BHGA 2VLKE 4MQXC 3L3JB 2FTAA 5IMOB 4YDJB 1EGJL 4MNQA 4YH6A 4FLSA 2CBPA 4N5UA 4RGMC 2NTFA 4OI7A 3ARDD 4IBTA 3WD5H 4KK6C 2QL1A 4OCMC 1UGNA 2RCSL 1XCQB 5GXBB 3T3PB 4ZMVA 3KNBB 4OCWH 3HCVA 1SNRA 3HAEA 5BRZB 2ITDB 1RH8A 4Q9RH 4N87A 4Y4FA 5AWNH 1NCBL 5FR3A 2D8KA 3ZQWA 3V9EA 3H7BB 3BKMH 3CG8A 1QFUH 4PJBE 3S8FB 5LDUA 4ZTPH 4MCMA 4RFNB 1LK2B 3SKNB 2ZUWA 1FFPB 1IQWH 4JHWL 1XF3B 2XG4B 5JQ6H 3ML8A 4ONOA 4QTHA 5DJXA 4D0DA 5CFAA 5H35A 1MCLA 1HILB 1UYWL 4B9IA 5J9PA 1D7BA 3RWIA 5I1CH 1WTLA 4U49A 4I18C 2ZOLB 1YC7A 2OMTB 3IGKA 2MCMA 1J11A 5G5DA 2WUCL 5FS5A 5E8EA 4O2FB 1T3FA 3GUTB 4OV5B 1F4YL 1YEFL 5A2FA 2ZSWA 4WY7H 3TBTA 3U6XA 2IC2A 3EYQD 3UTSA 3CIQA 5D71L 4ECNA 1CICD 2IANB 1TVHB 2NW2A 1KCRH 1CTOA 3KL3A 5DUBB 2VSMB 5BOZG 4PJ5B 3UGUA 3WEMA 3CHXA 2VDPB 5ANHA 1K2DA 1OALA 3GRWH 2WP3T 4XXWA 2GABA 3HE6B 1UT2A 2GUOB 2ICEB 4F7MA 3LIZL 4QLRA 3PGDA 3D12B 1JPSH 3S6CA 5IVNA 4OLYL 1RLBA 1E3FA 3X12B 2P45B 1WFNA 1KIUA 3ARBB 4PRHE 2XA8H 1MCOH 2AK1H 2V8MA 1NBZB 4P5TD 1N0LA 2QVKA 3C5JA 2BZDA 1O9VA 3N1QC 4YAQA 4L9LC 4YFDB 1K4CA 2CGYA 4G8IA 3ZDYF 5BJTB 4NRZB 2ED9A 3OB8A 2JCWA 1JSYA 2JJSA 1UACL 4HISA 5C7ZA 3V5HA 4S11A 3RNQB 1GVIA 1GAFH 3MOBL 3D4ZA 1ZS8A 2QJDA 1OCRB 3T8MA 5IMLB 3TEYA 4P2QE 3ZDXE 2NCMA 1FO0B 4MMYB 5JA9A 4RX4A 2FLMA 3BSHA 5FK9B 1YEJH 4QRQB 3K8LA 2JI2A 3DJRA 3FMGL 4XB3A 1DBMH 4XE0A 3UMTA 1P7QD 2ORBH 4JY4A 4S1DD 5E1IA 4D9RD 4L05A 1KULA 1YEDB 1J12A 1KBPA 2VSDA 3QNYA 5C08E 3EJJX 3LH9A 2DPKA 5JHDA 1PEWA 2QSCL 4HS3B 4JFDA 2VXUL 4HHGA 3RWCB 4CVZB 4DZBA 4TVPE 3DJSA 3MX0B 3ZR6A 4PJHF 1RJCA 4F2FA 4FFYL 3O2DL 3PWPA 2X4TB 3RY6A 1FNEB 3PGCB 2JH2A 4K55A 4Z7QF 1GY2A 3X17A 4NJAL 1PFOA 2IVFC 3S2AA 1XCXA 1RZ8B 2A4CA 4EN3C 2D2CC 3D2UD 3T6XA 4PLJC 1QHOA 3ULVD 1JNHB 2DQUL 5E8DH 3FUEA 5FFOA 4XO4A 3UJJH 1IEAA 3P1VA 3I2CL 2PTTA 1C8PA 3QCUH 5K59E 2XTJE 3B9KB 5CD3A 5L8KB 3GXTA 4XH2A 1AGCA 5FKAA 1PQZB 5IBLC 2I9LB 2UV3A 4LQFH 2W0FA 4ESKA 1TVBB 1J86A 5CP3A 2B20A 2BSDA 3L4CA 3LKNA 1YLBB 2QQLH 2PO6D 3G6AA 2VXTL 2E7BA 1B9ZA 3HG0A 1NLBH 5JOPD 4WV1A 2EIDA 3BWUC 4FFTA 3RWJA 1J05B 4IMKC 5DEGB 2FR4B 1FNGB 1OK0A 2HKHH 3FPYA 5HHPB 4AYGA 1UG9A 1BQRA 2YFOA 3QJHA 1BFTA 3BP6A 2EYRA 3D33A 1PGRB 3FQ2A 3IAPA 4ZS7L 4BSWA 1HOCB 35C8H 3CHPA 1OLLA 2VDOL 3CFBB 5AAMC 2X70B 3GB7A 1G0XA 3MRDA 5DSCB 3QYCA 1AQ8A 4OCYH 1FFOA 4EI5C 3D39D 1TYJA 4GRLB 1QMUA 1NBYA 3FTGB 4Q14A 1CR9H 1RJZB 5CGYD 4F33A 3FHQA 1JERA 1FJ1A 4FQIL 1TFHA 3IDYC 5DD3L 3MUZ1 4QT5B 4X5QA 1BFVL 3WNNA 1KBWA 1JDAA 2AJSL 5I26A 3QEQD 1Z5LB 3FNKA 3WEBA 5F7UA 1F00I 3C87A 4OAWB 1H19A 1QI3A 3L5IA 2LOEA 3ULVL 1L9RA 2H9GA 2VMCA 5E24E 2V2TA 3V4PB 1NGWA 3L4XA 1JV5B 4Y8AA 2WAHA 1H6EA 5I6XB 2O26U 2XPGA 1TZIB 3MRKA 3SOBH 1E28B 2DMKA 4UTBH 1WICA 4UT7H 4JE4B 1S7WA 3T5WA 5EU7E 5I1DB 3ETBF 4AYMC 2NX5A 2XX1A 2KC0A 4Y2OA 3FPXA 3WFBH 1OSZA 4KUZH 4WU5B 3MA7A 3GC3A 2VERA 3RL2A 4JM4L 2FSEA 2X1OA 3DX7A 2DRUA 4POUB 1P1ZB 4FFZH 2IAAC 1IC4H 3GSWB 4JLRB 1MDTA 4ZMTA 1WFUA 1HH9B 3ZTDC 1ZV5A 3N42B 4XWOC 5DYFA 1ZEAL 3FSOA 4PJIA 3OAUH 4YHNA 1NIBA 2X3AA 3O9WB 1QHQA 1JCVA 1ZHKA 4PH8A 3BDYL 3MLRH 2OP4L 1QUPA 1AY1L 2GITA 3AS0A 4EJ1C 1TETL 3SDCA 2HZHA 2VLRA 3HJEA 2B15A 5DRWA 4H88L 3G6JE 4HJ0C 2BCMA 5F96L 4U3SB 1MLBA 3QEUB 4Y2NA 4P5KB 4NBYB 4AMWA 5GQBA 1TO5A 3GI8H 2YWZA 2WZ0A 3H54A 3UC0H 3DHPA 3WYRA 1GYCA 2JTDA 5EF1A 2NY6D 3FT3A 3WD5L 4FTVE 2BP0A 1NEUA 3BP7A 3DETC 4L48A 4G7YH 3N85H 3F7RA 1E9PB 1NGPH 4G59C 2A74B 1F13A 5CD5D 2R0ZH 3W38A 4PJBB 1DJWA 1RURL 1IGMH 3AWFA 4P2OD 4F7TB 4XMZA 1M7IB 1NOFA 2JIXD 4LESA 2CIIA 4KKQA 2Q5BA 1GS7A 5FGCE 2OV0A 3EJTA 2Z91B 4JFED 5J8OA 4ZTPL 4ZUSA 1IQWL 3JWNG 3EYSL 3SY0A 1QR1A 4WW2B 5JQ6L 5IVZA 4OZIF 2OR8A 2AJUH 3M1CA 1U9KA 2K45A 5I1CL 1JWSA 3NCFB 3QUXC 4ZZKA 3PWNB 1ZLSH 3WEAA 4S0TD 3QIUB 2W60B 1OV8A 4M61A 3TIEB 1DQKA 2WKOA 5I19H 3AM8A 4OCRL 3KPRD 2ZWZA 4PJFB 5DK3A 5KYUB 4HGKC 1IMHC 1QLEH 4QHMA 1BF5A 3TL5A 1J5OL 2MOGA 1TJIH 1TU2A 2H7WA 3ETBJ 4HOXA 3S4SB 1H15A 2DQMA 1IBHA 4XN7A 3VFUA 3UDWC 2OMYA 4AUJA 4X0KA 4OI8A 3BPOB 4LOUC 3UGXA 2HCZX 4Y0GA 2C1OB 3ZHLA 4F8PA 5I2IA 4WIQA 5CGTA 4PJ9A 3BGFB 1A3QA 4XB7A 5EBGA 5JMRA 5I18L 4FL4C 5KANG 3WKMH 4KVCH 2ZX5A 1CYGA 3DIVA 5HYSB 4E9WA 5IB2B 4H0GA 4ZPVB 4PRHB 4G1EB 5J6SA 3V0JA 2UXTA 1GOGA 4N5ED 2FWSA 3W9EB 4APXA 3RWEB 5KSVA 4AH2A 3LKQA 1KNOA 2XA8L 5HI3D 1MCOL 2AK1L 2VRQA 4NQXB 4PS7A 1JDDA 1GR7A 3SPJA 3X3FL 3B7RL 4ZUWB 2WO4A 1OQXA 3BRDA 1UFGA 2A6DB 4YDVB 3CSBA 2WIIB 2Q0ZX 3BIBX 3TJEH 3VXOB 5HHVH 1ZHNB 1SLVA 2FJSA 3T2QA 1XD0A 3NA4A 1JK8A 3BN9C 3MO1A 4G1MB 3ZDXB 3ESNA 1Q9WA 1RUMH 4HEMA 4U1MA 4NQTA 5HPMA 5IQMA 5EU6E 1MWOA 3BVWA 2PCYA 2AAVA 4NQCD 5I1HH 1U3YA 2OZNA 4DH2A 4ABQA 4LEEA 4FXGC 1ADQH 1WRFA 1YEJL 2DWEA 3WJLA 3QDJE 1QHPA 5C0CA 1KN2H 1A3RL 1SDDA 4KOBA 2ORBL 2CHWA 4KUCF 4YHMH 4ZO6A 5DMIH 5ACZA 2DQEH 4POZC 4O2CB 1MHEA 4HAFA 2OSXA 5LBVA 4X4YA 4AIZA 3C6SB 2UZXA 1YSOA 1U92A 3QUMA 3DVNB 4NPYB 5J12C 1ULVA 2PYFB 1TNMA 4LBEB 5SWZD 5KSAD 4Y4KB 2RA1A 4BH8B 2G4EA 5AVYB 1NC4D 1P5UA 3IJHA 3NABH 1U58B 2QADB 3FQTA 4PJXB 3B2MA 3DKHA 5E8DL 3LZLA 3UJJL 5DJDA 1FVCB 2Z7WA 3TP4A 5ITFA 2J1KA 2O5XH 3UZVA 2W80C 4TLUA 5FYLD 3QJFA 3EFFB 3OKMB 5EEVA 4R3SA 1IIIA 4BXSV 1O7DC 1RZPA 4O5LH 4I4WB 3BOVA 1CPUA 1Y6NR 2DJUA 5F7AA 1M9WA 4XZUB 4ZUVA 1NLBL 4KK5D 4RMSA 2Y0SA 4DSYA 1NQBA 1B6UA 4ENZA 3DTDA 3QQ3A 4X9HA 1UB5A 2IXQA 4BQ6A 3U7WH 4DO4A 3B7SA 2WLIA 1NLDL 4LEOB 5E2TH 4NQUA 2VTFA 3NN8A 2AK4D 3BQUB 4L37B 1VCBC 2XNAA 3L5WB 4B9GA 4MXWL 5IVXE 1AZUA 4WI0B 1RPUA 4OZFH 2UY6B 1JFQH 1ZA6A 1NC2B 3O4LE 2WVTA 3QDGE 2BWDA 35C8L 3VSQA 2FX9H 1RZQA 4U1JA 2BM3A 3OAYK 2F5BH 4TLKA 1AZVA 1HQ4A 4NXKA 3WSQH 4OCYL 5JA8B 4RMWA 3B2DC 2A4ZA 4X7TB 5AFAA 4PG9A 5BZWA 4PJAF 1GC1C 1U3HD 4MNQE 2ITFA 1SOQA 2ZCZA 1M05A 4FQCL 1PG7X 1J1OH 3OQRA 2BSSA 5FM4A 2YPVL 3TH2T 1NAMA 2VXVH 5DDHA 2BCKB 3FRPA 4QI3A 2XN9D 4KQ3L 4QYOB 1QFWH 3GSRB 1RFDH 1T6WA 1XSJA 1JZ7A 4NNXA 1OCOB 4UTBL 4UQ2A 3CLWA 1T1WA 4DQOH 5FYLL 4ACPA 4Z76A 2AQ2A 3OZ9L 2V7NA 1ERNA 4X7CC 1HKFA 3Q5YA 4JJ5A 2B3RA 4YDZA 2LU5A 3WFBL 2P5EA 4KUZL 3VSVA 4Y16A 5EBMA 3ZDZB 2OJEA 3UCQA 3CWGA 2A9BA 3H3PL 4Z7UF 2E8ZA 1A6WH 3MKGA 2PLTA 4FFZL 4FQXB 4JZJC 5SX4H 4EZLA 4QHKI 1CDYA 3AG4B 1X5KA 4Z7NB 3V4UH 1YUHA 3KZ8A 3OAUL 3L9YA 3UJIL 4AVIA 2KZKA 3JT2A 1RU9L 2FWOB 3LQAC 3ZE0E 1MFCH 3KBFA 1AGEB 4ZW5A 3VXUD 2BDNH 3UTSE 5IR1B 2YQGA 3FU8A 5DQ9B 3TO2B 1CD8A 4XCEA 4PGCB 5E5RB 5KAQG 5C1MB 4Y1AE 3VDBA 2YN3A 5GRJL 4KKRA 3AUVA 3VWKC 4LVOC 4X6EA 3U36B 2NT1A 4XVUD 1AH1A 4XXCA 2J8UE 4FTVB 4EN2A 3BH9A 4PRPA 3SPGA 3KJ6H 3UC0L 2GEEA 2VSCA 5K1NA 5E56A 5TDOA 3N85L 2JJWA 1AS8A 3OKKA 5DZ9A 1BQHG 1NFDA 1IC7L 3FB6B 4HF5H 4MXQD 4XNUH 4GKNA 5B39G 4Q74A 5MEND 5FGCB 4N2DA 4WKXA 3TF7C 1CGVA 5FB8B 1IGML 1CT8A 5LJYH 4FQHA 3F12A 4M4PA 2C3XA 4UT9H 3PQYD 2QBWA 4X6FB 1NCDL 3U0TB 3U2JA 3F85A 1QP1A 3QJZA 4K4KA 4TSBL 4YZWA 2WQUA 3PNRB 3GSVB 2AJUL 4M4RA 1F6AB 1KCUL 4NCC1 3SKOB 3IVKB 1MFBL 1QSZA 4G70B 1IM3D 1UXSA 4NQDA 3OHXC 4G8AC 3CN1A 2V2XA 1E8YA 2I60L 1ZLSL 1N12A 1N7MH 4H20H 4IRSB 2OMXB 1C16B 3F7YB 3TA3B 3I6KA 2NZ9C 3NIGF 3ECBB 1OE3A 4RESB 4XCYA 3D69B 3QISA 3FUKA 4JFDE 5AZUA 4F93B 1MG3C 3CPLB 2Q87A 4Z18A 1N10A 3APMA 4IJTA 5F1NA 1PMYA 2Z9TA 3O0RL 1I7ZA 4HV8A 5C09A 3RX7A 1U8QB 4TPRH 4MDIA 1DYZA 2EDHA 2YFNA 3PE9A 1F3RB 3UCRA 1HTYA 2Y06L 3WKML 4KVCL 1IKNC 4D0CA 4OU3A 2D7OA 1RIUL 3ZGHA 5AOJA 4CUCA 3TVMD 4FNLH 1MWAB 3AS2A 4I3RH 4ZT1A 3VGBA 1EUTA 1KLUA 4XMTA 2CBQA 1RK1B 2AAAA 4HPOL 1BBDH 5FO9B 3ZKNC 1KG0B 4D0BB 4HKXA 3FQRA 3TJEL 3UBFA 5EU6B 5HHVL 1EXUB 2WYHA 3GT6A 4QXGH 4Y2DC 3HZVA 4MD0A 3RVUD 3D51A 2YEZB 2EVFA 1I1YB 3CDCA 1RUML 2J6WA 1H8NA 1GJIA 1CXEA 2EDBA 4IIZA 3V0VB 4Z7VA 3FCBA 5I1HL 2HJFA 2GEQA 1ADQL 3EYFA 4TN9A 5D7EA 1DUZB 2IH3B 3C6LA 3DUHA 2XN1A 2F53D 1OPGL 1KN2L 3FCSB 3QWOB 4YHML 3WU1A 2DQEL 4GG6A 4LL9A 1TITA 3PDDA 5C0DB 1JV2B 4ANWA 5EC2B 4RRPG 3ZMNA 2H0EA 3L3DA 3VI4A 2AQRA 4LDEB 3DBXA 3EF4A 5F7LB 5BV7C 1MHPL 2X6UA 4DF9A 5C9JA 3VB8A 2WTRA 4PRNA 1OW0A 1ZE3C 4JFUA 2HT2C 5DZPA 2NSMA 1E2WA 4MJIA 1TQUA 1TEYA 1UB6B 1KEGH 1BOGB 4U6VH 4XP5H 4DKFH 1BJ1H 1AO7D 1WUNT 2QPSA 3OGCA 4DKEH 5CJQH 3TPUB 2X0VA 1E5CA 5FUCC 2F74A 3CUPA 3TN0B 3L2MA 4ZNEA 1U4FA 3SZKC 1P4IL 1BVZA 2OTWB 3ATBA 4HG4J 4NWUL 4R5XA 3VW3H 4ZUUB 5JPMB 4C54A 4O5LL 2NX5E 3ARVA 3OD3A 4OLUL 4YFEA 2EINB 4FYQA 4FA7B 1V05A 4RZCA 1Z5YD 1MH5B 2VDLH 5CUSH 5C71A 5DJ2A 2RR3A 1T7ZA 1BBJB 3C6EA 5AOZA 5IVXB 1QBML 4D8OA 1UC6A 1CGSH 2FD6H 4LP8A 5E2TL 3S5LA 5FLVA 5E03A 1GHFH 3TEWA 4N28A 4MKMA 4B9JA 4X5RA 4PJIE 1PDKA 4XCNA 3GHEH 3GKZA 3NEEA 4JM2F 3E8VA 5J11B 4XMLL 2RD0A 4HUMB 3WSQL 1MJ7H 4MNHB 2Y4SA 2VLRE 5BVPH 2DQIL 3QFDB 4R7XA 5DZAA 3RQ3A 1T22B 1X44A 4PBDA 5JTWA 3ZE2B 5IESL 2FH8A 4QDGA 4GUOA 1W91A 4MZ2A 1XSKA 1KDJA 4PRIA 4CVUA 3SYCA 4HOZA 1AHWB 1JHKH 3PWVB 4LCWA 4F9LA 3EDEA 1II4E 4X7FC 1CD1B 2IAND 4AZUA 3R7QA 4KAQH 3PL6A 5BS0A 4Y4FB 1QFWL 4UM8A 2Y36L 4PJ5D 1PL3A 3JTTA 3K81A 5AD0A 4CVXA 4JZOA 1V27A 2J1XA 2IG2H 3HE6D 4K71B 4GSDH 2XWZA 4DQOL 3OSKA 4YX2H 2K6WA 1OAUH 5I6KA 2M1KA 3HZ3A 5FUZH 3FO9A 4D0DB 2DDQH 3N43B 2E9WA 1G5GA 1AYOA 2X41A 3ARBD 4WHTA 3US0A 1EAJA 3RWIB 1LO4H 3AMKA 1A6WL 1BOYA 1DJIA 2OMNA 5ITBH 1U8LA 2NLJB 5G5DB 4LBAA 5I1EH 3SYAA 2KZBA 3KBPA 5E8EB 1T3FB 5TE7H 4QMEA 4A2HA 1U42A 3N6YA 3ZE0B 2R0WL 1JRHH 4FHBD 2EH8H 4NUQA 1QZNA 3V4UL 5HHQA 3S34L 5H37A 1HOEA 3AWGA 1L6ZA 5D7SL 1LLAA 1MFCL 3F6JA 4Y1AB 3WTYA 1AGFA 3WIHH 3QUYA 2BDNL 2ZNXA 5LUMA 5EIQA 2CBMA 1SF5A 4YXKH 1S5IH 2WPGA 4RSVA 1FYHB 4ODXA 1RULL 2EADA 2J8UB 3BGMA 4ELMA 4F7MB 1W2KT 3I3EA 5BO1L 1JK9B 2XZQH 4MSWA 4WFHE 5IHZA 1SYVA 1JPGB 4M29A 4AIEA 1ICTA 4OIAA 1YRKA 1K4CB 3LRSA 4OUOA 3WNIA 1T2QH 4HF5L 4XNUL 2BSRB 2VDPL 3V7AG 5DC2A 4FE9A 3I50L 3EUDA 3F6LA 2WC7A 3JQOB 1WBYA 3FDWA 5HD8D 4QTIL 3PIQB 4G83A 1S78C 1E9OB 2NDGA 1CXKA 4QR7A 4HEME 1MCJA 3JBG7 2XV3A 1LK3L 3B9KD 12E8H 2ZAHA 5E00A 3MYZA 4YDIH 3PWUA 2XCMC 4OQ1A 1NBVH 2CLZA 3L3OC 3CGTA 5GGUA 1IGTB 3BXNA 3D4CA 5J0BA 2IH1B 1CFQB 2BZCA 2VJ8A 5C0CE 4LLUA 2ZUQC 4N0CD 1HL9A 4XVSH 4ZW6A 4H20L 2XFXB 4JFDB 2P9RA 1QUNA 2DB8A 1CIDA 1JZGA 2L7JA 5IFJB 3EGDB 4FMVA 3MRCA 3RBGA 2DYSB 2NQCA 4OFDA 4R96A 2ZCHH 2NXZC 4PQXA 4KVNH 5CIPA 5DJ8A 2FX8H 1UM5H 3KPSA 4G11A 5DJZB 2EVIA 4RAHA 4BGDA 2PCPB 1P5VA 3ML9A 1G6RH 4YBQD 1I8KB 2D