4B5ZA

Structure of the apo-rfnbpa(189-505) from staphylococcus aureus
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
310
structure length
310
Chain Sequence
GTDVTSKVTVEIGSIEGHNNTNKVEPHAGQRAVLKYKLKFENGLHQGDYFDFTLSNNVNTHGVSTARKVPEIKNGSVVMATGEVLEGGKIRYTFTNDIEDKVDVTAELEINLFIDPKTVQTNGNQTITSTLNEEQTSKELDVKYKDGIGNYYANLNGSIETFNKANNRFSHVAFIKPNNGKTTSVTVTGTLMKGSNQNGNQPKVRIFEYLGNNEDIAKSVYANTTDTSKFKEVTSNMSGNLNLQNNGSYSLNIENLDKTYVVHYDGEYLNGTDEVDFRTQMVGHPEQLYKYYYDRGYTLTWDNGLVLYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords FIBRONECTIN-BINDING PROTEIN A
publication title Evidence for Steric Regulation of Fibrinogen Binding to Staphylococcus Aureus Fibronectin-Binding Protein a (Fnbpa).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus nctc 8325
total genus 74
structure length 310
sequence length 310
ec nomenclature
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b5zA01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b5zA02
4RMBA 2F68X 1N67A 2Y7MA 4LEEA 4F24A 2Y7NA 4F1ZA 2YLHA 4BBWA 4MBRA 3IS0X 2Z1PA 4LEBA 3V10A 2Y7LA 3ASWA 4B5ZA 3IRPX 3AT0A 3AU0A 5IHWA 1R19A 4Q6KA 4F27A 4JE0A 4MBOA 5CF3A 2Y7OA 3IS1X 2VR3A 3IRZA 4FJ6A 4LE8A 4JDZA 1R17A 2RALA 5CFAA 2F6AA 4F20A 4JDZB 4B60A
chains in the Genus database with same CATH superfamily
3MRPB 1WGVA 1S7QB 5LXGL 3GHBH 1UXLA 2ALWA 3AXIA 3D4ZA 3ZR6A 2R0KH 3BOVA 2EEAA 4G43A 4LOFA 2H2SC 4GRLD 2DQIH 4FQLH 5EUKB 4R0LB 3BISA 3RTLA 4K5NA 2HRPH 3QFJD 1UOLA 3AGWA 2MQGA 1A6ZA 3M1BA 3PGCB 3PV6A 3RX7A 3FRPA 1QFWM 2JKWA 3SGDI 3FTSA 3V4VH 1PX4A 1WFIA 1FVDB 3CFKA 3HFMH 5T1KB 3RY5A 1FI8C 1RLWA 4FCHA 3EO9L 3Q5TA 4MS8C 3UDWA 2PO6A 3EGXA 5D2LA 4JVUA 5CGMA 3F12B 1DQKA 4UOZA 1JGVL 1PKQA 4Y1TA 5I76B 4FG0A 3WFZA 2D7NA 3K6FA 4HETA 2IIJA 3OG4B 3IBOA 4YGVB 2IH3A 3B9DA 5GRJH 1AO7B 1R3IL 3F85A 2C9XA 2HRGA 2WVSA 4P3CL 5B3JE 1OAJA 5FYKL 1JXDA 1ZLWK 1EIBA 1OSZB 1NBVL 3FRUA 5EULV 2MOVA 2VLLA 1V7NH 3O11A 5L2JA 1IJ9A 1CFMA 2A6JB 2WGXA 1AP2B 5A2AA 1RJCA 2HTKC 4G7VH 1NGZB 3P2BA 4BE6A 1FNGA 1WT5A 2HYMA 1PZ5B 4JM4H 5BV7L 1JK9B 4G6MH 1A6TA 4UDTB 2FO4B 1XCTA 1QRNB 1WH0A 5BRZE 2J2ZB 4ENEC 1QKZH 4HAGA 1KB9K 4K2UL 3JVFC 5D8JL 3IJEB 4HOWA 4F7TA 5GIRA 1JIBA 5HDOA 4MD5A 4L4TD 4IEFB 2XOTA 4YHPA 4I3RH 2E9IA 3T0VA 4Q2ZB 4K3JL 3M7FB 3VGGA 2WUBL 2G3ZA 2MJWA 1JGUH 2AQ3A 4AC4A 4LE8A 3ZY7A 5ADOH 1ICTA 2XHNA 4N2GA 4GRLA 2CGZA 5IB5B 3KPRD 2QHLA 4WZ9A 4FFVC 3WS3A 1QPKA 7FABL 4NI3A 2ZE0A 1PL3A 2AJ3A 5IREA 4MQ7B 5E0QA 5IY5B 3HR5B 4KXDA 3KYNA 4O02H 2R69L 1MVYA 1VCBC 4TL4A 3JWDL 4I3SH 2VTFA 3K6DA 1T3FB 5BV7C 5EU3A 5FC9A 2CLVA 5EZJB 3UO8B 1FPTL 5K5YA 5DMGC 4ETQB 1L9OA 3QS2A 4IQHA 4HCIA 1GW0A 1ZPLA 1TTAA 2BIIA 2R23A 3PJSB 4NKOA 1Z0MA 2GUYA 1RULL 3VO0A 2MCPH 1MCWW 4RQQA 5KYYA 2ZOKA 1YUHB 2MTPA 4OKVA 1FNFA 4KK8D 1KPRA 1NIFA 3CFNA 5FGRA 3FHEA 2FQDA 4N2AA 3WNMA 2Y06H 3FUJA 4B0MM 1MCLA 4GUPB 1M9WA 3G6JA 1CL7L 4WCYH 3RGVD 3VGEA 4XE0A 1JPEA 5FO9B 2DJSA 4ELMA 1YJDH 5AW6B 1JGLH 4FI7A 4OZFG 4O02A 3ZDYB 4WHYH 4Y4HD 4CRPA 2Z4TA 4JN1L 5DDHA 4MMXB 1VGKA 3F8UB 3WO3B 3MJ8A 3FB5B 4QRQA 1EEQA 3PLYA 4JY4B 3S8WA 3PWJA 3SYAA 3GXTA 2F54A 3OF6D 4FERA 3GXMA 3L4VA 3JWDC 4LKCB 3W9DB 5JDSA 1HHIA 1JUFB 3EJUA 2LFGA 2XIBA 5FR3A 1ZA6B 3NIFF 1NDTA 5I1HH 2EXYC 4P59H 5GGSA 1I1AD 4ZMLA 3IU4H 3Q2WA 1DFBL 1T22A 4ZMYA 3KPRA 4N2MA 1E9QB 4QKTA 4UDUA 4XVTH 1OK8A 4PUBH 3P0YH 7PCYA 1CXLA 2NNRA 4JHBA 4X7SH 5IEHA 1ID5I 2HG0A 3L9BA 4TQHA 3WGUB 3FO9B 3EJSA 1LO0L 3ESNA 3Q01A 5A2IH 1K5NA 1NCOA 1S7VB 3BAXA 1QLEH 1NC4D 3KD4A 4EUPA 4F3FA 2OR9H 1E5ZA 2FDBP 1JG9A 2JELH 4G70B 2XWDA 4MTMA 4Q8BA 5AVUB 1KENL 4KVCL 1XAUA 1I4FB 1N68A 5DVMA 2IQAA 3AT8A 3BZ4B 4MJ5B 3ATBA 3TO4C 4K7PH 2YXMA 1NJ9A 4ZBJA 5C0RL 3BUYB 3VI4E 4Z8FL 2IANA 5BRZD 4GKOA 3DYPA 4GO6B 2NX5B 2RALA 3BEWA 4A2GA 3IU3A 3HE6D 1OANA 2HLEB 3MNZB 4JKPL 3O0RL 3R8BB 3KH3A 3BFQG 3SPVB 5I1EH 2ETWA 3X3FH 4YUEL 2WKOF 5B39G 1R24A 3Q8AA 4G6AC 3NIGF 4IMLB 4MDIB 4KZEL 2CPUA 3D39E 1TXKA 3QRGH 1G1KA 3D0VA 1VB9A 2R56H 4GAYB 2HJFA 3T8MA 1HHKA 1NIAA 1K4CA 3I6KA 1T0NB 3GMOA 1CTMA 3CQQA 4YPGA 3HTLX 3QA3B 1TCMA 4LOVA 3CZEA 2J1ZA 2X6AA 3OMAB 2CM5A 3GZOA 3HZKB 4LL1A 2F53E 5CBAA 1KLFA 1JWSA 4FYQA 3OF6A 4HZAA 1JF6A 4K71C 5CUSL 3WEBA 3E6HA 4WLCA 2PW2B 4CC1A 4FQPA 5I1JL 5HD8D 1RZFH 1BF8A 1PFCA 5DEZA 4NWTL 4G3YH 3DGDA 2RQEA 3S4SB 4YLBA 2Y3AA 4LSVH 4AMKL 5JOEA 5HVFB 4MX7B 3VG9B 2WTOA 5I30L 4X6CE 5IP4A 3LN5B 3MO1A 2XV2A 1EO8L 3L3HB 3IS1X 3RZCD 2YAQA 1JF1A 1MVUA 2VKWA 1UWFA 3VYOA 3CHQA 3KNBA 5LNGA 3H53A 4JY6A 5DS1A 3ZZ1A 5D7EA 4N0UE 3DYMA 1A66A 2BSDA 3HUJE 4KWUA 1U8JA 3VXQA 4WUKH 1H6EA 3KCWA 1YA5A 3H9YA 3OSVA 2FBJH 3SKNB 1PDKB 3PP3H 2QDVA 1JV5B 5HDQL 5CS7A 1DJIA 2EDWA 4RRPG 5HVHC 5BRZA 4WI5A 1IGYB 1FHGA 2WUCL 3FYIB 4UI2A 4WWKC 5TDPA 2H47C 3KHOA 3SBRA 2R2CA 1N4XH 2Z8WC 3VXMB 1GRWA 3PCYA 2A0LC 2BIQA 1COBA 5E7FA 4DVBB 1J05A 3X2QB 3AADB 2X10A 3HNTH 2VR9A 4DTGH 4AYBA 5BS0E 1SMOA 4FHJA 2CHXA 5C07B 3H2PA 3N85L 1TJGL 2Z3FA 2C4FT 2BIPA 3L3OB 2VMJA 3TEXA 3REVA 3UIZA 1VADA 3CN2A 3ILEA 5D93B 1AOHA 1N8ZB 5E94A 3GDCA 2H6PB 3DHUA 4KNUA 3KXFE 4OLXL 5I1CL 1CXKA 1MNNA 2GSGA 2YMTA 4PJ8C 2XN2A 5J3HC 1UCBL 2VITA 3NJKA 2DLTA 1QUPA 2WV3A 3SHSA 4B9FA 2JIXB 2MNUA 1A0QL 1MWOA 1FCCA 2H4EA 2RMNA 3MGAA 5DZ9A 3UC2A 4OT1H 3ZDXB 2H26B 4ENZA 3D69B 3NIDE 2P7TA 5C0BB 3GKWH 2AQTA 4DGVL 1ZXKA 3JWNG 5JA9A 1JTPA 3NCXA 1AACA 4UM8B 2UYLB 2D3LA 1IGFL 3FN3A 4PP2A 1CXIA 5EF1A 1QI4A 4Y2LA 3P69A 5F7EH 5KS9B 1RUMH 1U6AH 5ICUA 2QFRA 3L5XH 4X6EB 4TPRH 1MFNA 1FFNB 2HA1A 2CU9A 2PXYD 4M8UA 1GZQB 4AQZA 4HCRL 5CD5C 4AVIA 3D39D 1B2WH 3OKYA 2D7QA 5LGHH 4JG9A 5ESAA 2X4TA 3I6SA 4MXQC 2FHBA 3HBGA 2XTJB 4ZAKC 3PXLA 3OX8B 4YK4B 4ZPTB 1QSFE 5DU7A 3CSPA 1IL1A 4YMPA 5I1AA 2ZWNA 4G43B 2J20A 2BHFA 3TA3C 4OZGE 3GBNH 2EDJA 4R9HA 1F3RB 3PU7A 4CW1B 5I6XB 1BFOA 3EYUH 4JDEB 1J0JA 1QZ1A 2F53D 5DA4A 3M1BB 3PWPD 3ULVH 2E27L 1GW6A 4AZUA 1WHPA 2OW6A 2CLZB 3GHEH 12E8H 2XA3A 4YHMH 2AJSH 3BSZA 4A1RA 1VESA 4WU5B 2PO6B 3N40F 5HGAB 4GRWF 1QQDA 4DK5A 1HHGA 4PTTA 1OSPH 1ML0A 4XBPA 3GIZH 2I9TB 1O5DT 4BHUI 3QO0A 5L6YL 1J5HA 2WXIA 3N42B 4BQBA 5E70A 4EDWH 3LNHA 3SZKC 1WF5A 1N5YH 1KG0A 1U8KB 2CJ3A 1P69B 3DX1A 5AB1A 3X13A 4JGNA 2ZXDA 3MJWA 1KIRB 3U6RA 1MEXL 4YHZL 2IXQA 2ZSVA 4JE0A 1CXEA 3SE3C 2VDPL 4P3WA 5IR1B 3SODB 3E1ZA 3S5LA 1IQWL 4LLDA 1XGQB 5AYQA 2E47A 3F7VA 4HXAL 4GKSA 1YPZB 1EGJH 1AG0A 2F1EA 2HPOA 4PJIB 4Y4FB 4NAQA 4LLAA 3VJ6A 2DJ4A 1FO0B 5DHVH 1ZJAA 4FFYA 4X50A 1ACYH 4EIUA 1KXVC 2Z6FA 4M4RB 5C1MB 5DHDA 3MRIA 3QEHB 3GMPA 2ZCHL 1A3QA 3TT3H 4G42A 4GSRA 1CVSC 1S9WA 2NTFB 2PXYA 5GIRB 4MD5B 4BZ1H 1OALA 1CF1A 1L7IH 1N26A 3X11B 5HVWA 2BFVL 2DTML 3ARGA 2J55A 5I8KH 4MVBC 3T0EC 5BS0D 1CPUA 3DMMC 3CFCH 4M7JL 4ZX3A 4J3TA 2A9BA 5KYXA 5CGYD 1EH9A 3QDJA 4CVUA 1FVEA 1I8IB 2HTLD 4GRLB 3OJVC 3U30B 2D3JA 3QFJB 1G9EA 3BKCL 1N0XH 2F53A 2OJEA 3BKMH 3KXFD 4R6UA 3VDBA 4NZ8A 2ZG1A 2QV2A 1X5GA 2D0GA 4X6BB 4YXKH 3WE6B 2AJ3B 2WQWA 3N0AA 2WVVA 3N41F 3QAQA 3CFDA 4MD4A 4TULH 3W37A 3QUKA 5L8JB 2Z7YA 1Q1PA 1XSIA 3KYNB 3QZBA 5DJZA 3B9EA 3T4YA 1O9ZA 3VUAA 3CFEA 2ADIA 4E5XA 3CQPA 4X5XB 3MA7B 3QG7H 2VDQB 3WG7B 2O6FA 1F6LL 1LO4H 5GGVL 2X5PA 4X6CA 4BZ1A 4H13C 5F3BB 3QPQC 3L4ZA 3QXAA 1B4RA 5KYYB 5IOKA 4YGAB 3U4EB 2ZAHA 5J6HB 3T0XA 1KC5L 3HUJA 4GJTB 5LB1A 4B3VA 1WHOA 1NEUA 5HGHB 1ZXQA 1BZQK 3K72A 5EU5B 3B2UC 4M62H 2CBMA 4Z7VB 1T03L 4HBCL 3CSYB 2QGDA 4J8QA 4WTWA 1L9SA 1QSFD 2LHAA 3MNWB 2IGFH 1PCSA 3DIVA 3TBYB 3GI8H 4W6YB 3C2AH 2R4SL 5EO9A 1A1OB 5F6HJ 3RGBA 3RIFF 4AYMC 1KIQA 2XPGB 1XGPA 4L5FE 3KDPB 1N70A 2FSDA 4LVEA 3DVFA 4BWWA 4L4TB 4QRQB 3LKQA 5CCKL 4ES9A 5E2UH 4PRDA 1CLVA 5F8QC 2UWEE 1A02N 4B96A 3PAZA 3RWGA 4R96A 5FCUH 5L2KE 5B38B 3NFPA 1MLCB 2IADA 3L1EA 2YA0A 4HALA 1DDTA 1IGTA 2AVGA 3KPRB 2NW2A 4Q6IA 4QTIH 4UDUB 5CXPA 2YR3A 4F5CA 1KJVA 4K15A 2NZ1A 4FL4B 2HUEA 4QT5B 3KXFA 4FP8H 3UYOD 5EU6E 4YQXH 4Q0XL 4R83A 5DZVA 3V0GA 4NP9A 4EKJA 4CN1A 1A3LL 3GSRA 2AJUL 1FIGL 1EQWA 5K69A 4AL8H 1BFVH 3ISRA 4L23A 4KMQA 5IMOB 5GHWL 1F6FB 2DTSA 2ZX9A 3BP4B 4AT6A 3GSNH 5HJDA 3O2VL 3HC3L 2LGNA 1JVKA 3QUMA 4JK0D 4V33A 1P2CA 4S1DD 1YEFL 3IXTB 3QWOB 3IMSA 1R47A 5JW4R 1BVLB 2XWBB 2V7NB 1IARB 3DX6A 4Y5XC 4X5PA 1W6WA 1YNKH 3DETC 3N1FC 3HN8A 3ZSSA 3O6KH 4IHOB 4KJPD 3RX8A 2BP8A 3RGVB 4JDVB 3IDJA 4N3TA 5IIEA 3QIBD 2R2BA 5AEAA 4HWZB 4LCUA 3DX2A 2CKBB 2NUTA 3BAJA 1OCWH 3DV4A 3BESR 4JFDE 1T2QL 4K3EH 3I6KB 4M1CC 5ITBL 4YHOL 1JCVA 3GMOB 4HGWA 4Y4HB 4YPGB 3VRJB 1E4XI 3GSNA 1VZGA 4ABVA 3PWNB 5CBAB 3FQUA 4WK4B 1KLFB 5IKCA 1ZA3A 5IHUH 3RG1C 5EEVA 4U3SB 3BLPX 1T7VA 1GA2A 2Z35B 3DK2A 5TF0A 1LE5A 1MHPH 1YEGL 1W0YT 3QI9D 3A67H 5FLUA 4PWIA 1I1AB 4NQCE 1ZLSL 2ATPA 5JO5B 5EUOE 2DMHA 5EWIH 4PJ7E 1VFBA 1OWRM 2XKNB 2E76C 5CU9A 1U3YA 5DMKA 2YD1A 2FIKB 3GMLA 3IAQA 4GW5A 2IC2A 2QADC 3LKPB 5HDBE 1FE8H 5IVNA 3QEUA 4Q9BA 2QGCA 2I60L 1PG7H 1MJ8H 4NX0A 1UENA 1NIEA 3KNBB 2RJMA 1NC4B 2ZX8A 4PTUA 1IKFH 1CU4L 3GS4A 5DJ2A 4DETA 4Z7NB 3QJQB 3VXQB 3MUJA 1N7ML 4AYGA 3TBSA 5C0AE 1FUNA 4OZHE 1GTFA 1EHLL 1IAOB 3CPUA 3WL9A 3IMTA 3VGHA 4G80A 1QFWH 3QGVA 4PG9A 5CD3B 4YSTA 5KANI 1WICA 5KN5A 2B59A 3ECVA 4LLMA 3ULSB 4UTAH 3HE6B 5TDPB 4JPVL 4KXZI 3VCLA 2XFGB 4M3JA 2YJLA 4PJBE 1AS7A 3WKMH 5INCB 3WXVH 4N24A 3MRGB 1EZSA 2SODB 1OTUD 3QIBA 3UTQA 5HHQA 2FUTA 4X8GA 3EBGA 1YECH 2OL3A 4EJ1C 2Q76A 3MHZA 5L2KD 4E9SA 4R7VA 1DTUA 4KTEL 2FX9H 3ZMRA 5IFJA 1X7SA 2CWRA 2A83A 3JUYA 2P5PA 3PDGA 5EU6D 4BZ2A 4XO9A 2ZG3A 2GSGB 2HKFL 4MAYC 1B4TA 5GSRB 4HS3A 5HVGB 4N9OB 4XMKL 3QI9A 4IBTA 4JFOB 1LEKB 3P0VL 2ZXGA 3CFTA 2QPFA 1UQSB 2A4EA 3KJ6L 5IVXF 1AOZA 4AKQA 2F19L 1BMWA 5F21B 1ZHLA 1VGEH 1JXGA 2GEQA 1TDQA 1A7PH 4QTFA 4WDIA 2YD5A 3L5HA 3MRJB 1HNFA 1CF8L 1MQKH 3G04B 4J28A 4PJHE 3RZCB 4NKMB 1WAPA 3W2DL 3C6LB 1S9YA 3QIWB 1KGXA 1NUNB 4U31A 4WI2A 4YDKH 4ANWA 3KJ4B 1QWHA 2JFCA 5C6PB 1MHEB 1NDGB 1PLBA 3Q05A 1N6VA 4MYPA 1K8IA 3ARYA 1A6PA 2YPLE 3KEHA 3BPNB 4JFDD 2R29L 4M93B 4HBQA 1IEAA 3O4OB 1AHWC 3SCMD 3VYPA 2MRYA 4FNTA 3A6BL 4UAHA 4FMKA 1U8OB 5GGRY 5KVEH 1OM3H 2JQMA 3UBXA 3TBVA 1GYCA 4CSTA 3O0LA 4PEEA 4XMUA 2VR8A 4I77H 3T4AB 3IXAB 4MJ2A 4IMKA 2WYTA 3RAJL 1LD9A 2R8SH 2UWEA 3US1A 2CR0A 3CXHK 3VWKD 2OTWB 3R1GL 4LPXA 2CIIA 2ZYSA 3K4AA 5L2KA 3B2VH 4NQCD 3GK8H 4YVUA 2JI2A 3ZTEA 2EP6A 3K4ZA 3KLKA 3ARDC 2QTVA 1X9LA 3QO0B 1J10A 5EU6A 5AFAA 1JXJA 1NCAH 1G7JA 3CX5J 1KG0B 1HZLA 1CLOH 3KGTA 5KVGL 4JJOA 4RMVA 1TTCA 4PWGA 4XRCA 5BZDA 1PY9A 1GGCH 3EYVA 3FTXA 3DARA 4TXVB 3DX9B 25C8L 4ZX5A 1TSHA 4XP5L 3UCRA 1BQUA 1PZBA 1MWAA 4HS6A 1ZAGA 5C08E 3F7VB 3OPZL 5C0AD 2G0LA 4GKSB 4L1DA 1ZVNA 4W9IC 4HV8B 4OM0H 2F58L 1PQZA 2ADFL 1OKEA 2P4AB 1JHTA 1R3JA 3I9GL 3VNYA 2VW6A 4U1MA 1XGRA 4HG4K 1K8DA 3VI4B 4LCVA 4WIQA 3MRIB 3NZHL 3FUDA 2ICES 2J8UE 4BKSC 1S9WB 1TSRA 2PXYB 5TDOB 3GMNA 2Q8BH 1ITBB 4NNPH 1SXNA 1WV7T 4DN4L 3D39B 4UBDC 1QTYT 1FG2A 2YC1B 2BLFA 4XOCA 1JK8B 3WUWG 5D6CB 3B3IA 4OR1A 4ZZFA 1QZNA 4I9WD 4JFDA 4FQXD 2RCSH 5EC1A 5C0EA 1ZTXH 2GI7A 1X5FA 2VO5A 1KGIA 4QXUH 4XN7A 3DOIA 2VN6A 3LDBC 1OP4A 2BSTA 5I6MA 1AE6L 2P80A 5E8NA 5BOZG 4H25B 3BQUD 3PWPB 2W38A 1XIWD 4NXKA 3S97C 1LL1A 2H2PC 2WVVB 3LPPA 3JYCA 3UABA 1WFTA 3AY4A 3VWKA 1A2YA 1YYML 5MP6H 4PJGE 2IALA 1MAJA 5LWYH 3EYSH 1WPCA 4X5LA 3FUNA 3IDYC 5EUOA 1GJIA 1SUHA 4PJ7A 3T2PA 5AB0A 3H3KA 3BRGC 4GO9A 3DLQR 3A4AA 5L9DL 1V55B 1I1RA 3PG2A 5DGRA 4A66A 5D1XC 3NCJL 4Y2DD 3E8UH 2UX7A 3QQNA 2R0ZH 2W9EH 1KGWA 4HUXB 4XXWA 5LBSL 4DW2H 1UZGA 1CFTB 4N0UB 3BYTA 1WD9A 4CMMB 3S34L 2C5DC 4P04A 5C0AA 1UVQA 4JO2L 1MCFA 4OZHA 4RX4D 3D08A 5FM5M 4OIIH 4DAGL 5KAQG 2JJSA 2YPLD 2OK0L 3BUIA 4HEPA 3FT4B 4S0HA 2EE3A 3RDTC 4X9FA 1CFSA 3CUPA 3U48A 2CM6A 5HYJB 1QSVA 1KTJA 1ACZA 2VZTA 5EO9B 1TCRB 4TL5A 1JDCA 3M86A 2CO6B 4RETB 2B9AA 1KIQB 2X1QA 4PJBA 4XTRC 5ELIA 1IBZA 3SGDH 2YWYA 4MQSB 2IG2H 4YHKH 2LVEA 4FLOA 1JFQL 1JGDA 3S37X 3NFSH 4CNIA 1G87A 5AUMA 4AVKA 5BS0B 3WJLA 5BVPL 5IJVB 2GG1A 3KS0H 3AREC 3O2WL 3QRFM 4FQXA 3LHPH 3GJFB 3RWGB 2I7SA 2ZKXA 4YH6A 2IADB 4Q6IB 1RJLA 2Q3XA 3IKCA 4WRLA 5I2IB 3TBWB 2J6EA 2QT6A 2C26A 4P5TD 4G8EB 4W9KC 3C08L 4NKQB 2R59A 1BQHG 1NCCH 1RK0B 4LMQE 5AW2B 4HIPA 4NUJA 1BBJB 3W57A 3OZKA 3GMQA 3GSRB 3ZTJG 1MHCB 2FX8L 4PGCB 4HU8A 1M53A 1U8LB 3GSWB 4JRYE 3ZHNA 1QNZL 1TZOA 3KL3A 4AT6B 4N26A 5EN3A 4CAGA 5C08D 3NIDB 3QORD 5JUEL 3K8LA 1SHXA 1LE9A 4PJHA 1ASPA 3MJ9L 4GSXA 4Y2DA 3S3SA 3GSOA 4G2AA 3CVHL 4LAJH 3LQZB 4WW2C 2V17H 2W9DH 5BOPA 5TPWH 4N5EC 2DW5A 3NJFA 2BH0A 4YFLF 4AY0A 3SJVE 3GRWL 3IJSB 1Y0LB 2DWEB 4FMVA 2VLKA 1MFMA 4U0QB 3LKSB 4JO4H 4EXKA 2ZJSL 3MRBB 3SQOL 1AG6A 2FLBT 4RX4A 1X5HA 5LLIC 2VL5A 5IIEB 4BV1A 4YPJA 2R2BB 5A2JH 5E08L 2YPLA 4HJGB 1QSFB 2YJQA 5D2NA 1N19A 2XRAL 3L9EA 1BZ9B 3DTUB 4PW4A 3ZKNC 4FLSA 2ERJC 4FQ1L 4OZGB 2ORBH 4HGWB 3UO1H 1Z5LB 2OMBA 4XODA 2DQHL 1CR9L 2JB6B 3S36X 4H0IA 3WIAA 1OV8A 1MRDL 2P9RA 4BCXA 4PM1A 1QMUA 2GUOA 3QP3A 4PRNB 3S0PA 2BM3A 1I1FA 1LE5B 1PFOA 1RMFH 3QJTB 2QQLH 3ECBB 1W9XA 1ZE3C 3FJTA 3H2WA 3HE7A 1TQUA 4N86A 4XCEA 5FOBB 3UTSD 2R4RL 5D1ZD 3ZHFA 1K6QL 5F1KC 2HMIC 4Z7AA 1SN5A 1LP9F 5DMKB 2ADJB 3NZUA 4G5ZL 3QEUB 5EIQA 2OXGB 4OBRA 4HGKC 1RP8A 1RERA 3QH3A 3HPJB 3PWLB 4ILDA 1TYRA 5F7BA 1WZMA 4GIPD 3QNZA 3QORA 4NPYA 3BGFB 3I3EA 1OPGL 4O51A 4XWOD 3CXFA 1DL7H 3B6SA 1U8HB 3M45A 3WTYA 4CSPA 3ZUCA 4HQQH 3QUXC 3SB3A 1JDAA 1P7QD 4PFEA 4LLMB 1NFDA 4TNWK 4TUKL 2KPWA 2BSRA 1CYXA 4G1MA 3V52H 1UUSA 1Q0XH 2NCMA 4HOMA 4HF5L 1NGQL 2W07A 4WHTA 2RBLA 4MDRA 2M1KA 2AV7B 3SKMB 2KC0A 4HFUH 4LSPL 1F02I 4NDMA 3CH1B 3D9AH 4ZTEA 3TZVA 4KKNA 1E0OB 5A1AA 3D4CA 3HHSA 3O3AB 3PIQA 5ESQA 5I66B 1ASQA 1A7OH 4KV5E 1T2JA 5KVFH 5L8KB 3RUGF 3H4FA 4PJAF 4UCFA 2GK2A 1OHQA 2ROYA 4DF9A 3ZE1F 1RLBA 1KTLA 4NN6C 4NZTL 3L1OL 1LM8V 5FYJH 1GHFH 3WKPA 3LH2H 4NUPA 4PJGA 1BV8A 2HUHA 4NYLA 4U6VL 4UZUA 3MLZL 2EDOA 4JRYD 1CVRA 1E6JH 4D3CH 5FGCE 1KZYA 4NO2A 1P9MA 2N1KA 5TFSH 3RVUD 1YEEH 2OMZA 1M6UA 1PZUB 4Z77A 5TH2B 3GIVB 4DGWC 3HLKA 2NSMA 3ZW3A 1M57B 3JTTB 4TN9A 1E4WH 3CH8A 3D85B 5B1AB 4KNTA 1UACL 3SJVD 4DCQB 4GXUN 2FHFA 1RUPL 4BSJA 5C0JA 1NSNL 4Z18A 4QHKI 3LV3A 3LZNA 1F41A 1E7UA 3PDOA 3JV5A 3IKKA 2QPDB 1GZPA 1OTSD 4P48A 3BQVA 3PGFL 3O41B 1K8IB 3E2HB 3SDCC 2VUKA 3FL7A 1X44A 3E9TA 1PLAA 1P7QA 2P49B 4HUCA 1NCWL 2I5YL 3QJZA 5DJYA 4ZMPA 4FULA 3SD2A 5GISL 4UNVA 2JQAA 2ARJQ 3BO8B 4IRZH 4BELD 3TPKA 3B43A 4LVHC 4JW3A 2X28A 3NH7H 2Y1VA 5BRQA 2O5ZL 1X9RA 2WD0A 1S78D 2W0LA 4ZFOL 1P4BL 5I9QC 4XX1E 1R5IB 1MRCL 3FH5A 4QTHB 4P5KB 2J1KA 3EHBC 4UT6A 4EN3C 1WBXA 4Y5YA 4JG0L 2E9JA 3H7BB 1YZZA 2K1MA 4ZUVA 2QSVA 4F7CB 1HXYA 5GS0H 5E1QA 5EU6B 1MFDL 1G7JB 4LASH 4XCCH 1TOXA 1T1WA 4MRBA 2KT6A 4X4KA 2ZKHH 2FWOB 3GF8A 4PMFA 1XV8A 1ZHBB 4JRYA 2XZZA 4ZOBA 3DTXA 2K6YA 3KPOA 4F7MA 1M05A 4PJXF 2GJ6D 5CSZA 3WLWD 2OP4H 3V10A 3VD3A 1PQZB 2Z31C 2YXWA 1JHTB 2FO1A 4KKRA 2VDNH 4QHMA 1K8DB 4M8RA 4EO5A 4C4KT 4YDIL 5H37G 3FQYA 2AKRA 3SJVA 1X7QA 3IFPB 3RIFK 1XSOA 3QR2A 1SQ2N 3NFNB 1XF3A 5IVZA 3AB0B 1E50A 1KGCE 4KK9D 3ZO0A 3ETSA 4N2DA 1JPSH 2AI0L 1CFQB 4L8SB 4O2EB 3S48A 5KVDE 4PWKA 4NNYA 3H54A 2VZSA 5CKGA 3WFBL 3FB8A 2IWGA 4AGOA 3MLPA 3L95A 3IJ8A 5AZ2H 1QI3A 4X6DE 3SCMB 3B9VA 1AJ7H 4APXA 3FOLA 2J5LC 4Z7OF 4IGBD 2IFFL 4KI5C 3FC8A 3K0WA 2ODHA 3PGDB 5J13C 1U3ZA 3DA0A 4Z3IA 3VG0H 4F7PA 1M1XB 3C60C 5KJ7E 1DEDA 2N1TE 2ROXA 1D5MA 3BCFA 4PLKC 3VWKB 4ZPTA 4DGYH 4FABH 3T0DA 4M7KL 3QEQA 3ES6A 2WBJA 1IGMH 4NQCB 3E6FB 5J1AB 1C5BL 4MKMA 4GMTH 3OAYK 5ILTH 2XU9A 3F58L 4JFPB 3VD1A 4EI0A 2GFBB 3CMOH 5G4NA 1J86A 4ODBD 1Q1JH 3KGRA 4PRIA 1OP9A 1BZ7B 3MLUH 1MJUH 3KW8A 4B7LA 4P9ML 2GJZA 4HH9A 2P3YA 2Y07H 1EO7A 2PW1A 3EO0B 4PRHB 4R26H 5F2FA 4C57C 5JDJA 3D05A 3K2MC 5J5EA 5ERWA 3WFDH 1HL8A 3ME0B 4XN4A 2ENJA 1JZHA 2D73A 5DQ9A 3WNPA 1T4KA 1F11B 3UZEA 3RFZB 1FLRH 4AQEA 4XO4A 3MGOA 5KG9B 1GTNA 4IOIA 4JZNA 3V5KB 3C5ZD 1A8ZA 2NY4C 3ELQA 2DBLL 1Y6NR 3LZQA 5FO7A 1G0XA 5EOCL 4MMZA 2HJKB 3G5ZA 4LVOB 1IAII 1SEQH 5DJCB 2OKMA 2DQDH 2HKHL 2EEBA 4JZJC 4MAUH 4GQZA 1GAFL 5BQ7B 5DVPA 1Q9KA 2VW4A 5HYQA 4OCLC 4PB0L 2EIBA 3TFBA 1DQQB 1KJ2B 3WS6A 2ESVB 2DWYA 1L9MA 3LS4L 3JWNC 1ND0B 4IGBA 4D9LL 1BEXA 4J3OH 1HYSD 4AW7A 4FS0A 1TTGA 5D55A 3BQUB 3MODH 2X87A 1RKRA 1XIWB 4MB5A 2Y0SA 1PSKL 4NUJB 4XHJD 1FO0H 4CJ0A 1BLNA 2A3TA 4K8RD 2ARJB 2AJZB 3C8KA 1DDHA 2WWMC 4J4PA 5FUCC 1HEZA 2QKIA 1JPTL 2WXKA 4EOWH 2JKSA 1HTYA 1YEIH 4AQ1A 3LRGA 1CBVL 4ETYA 5CBEB 3WTVA 1A7RL 2W81C 1LE9B 2W0FA 3GLZA 1VFMA 4KK6C 4PJHB 2X2UA 2Y22A 3CN4A 4KK5D 1PYWB 3VFSA 4FNLL 1ZLWH 5FM5O 1ONQA 4KY1H 1XF2A 5FK9A 4NLHA 2E46A 1V7MH 1JWUB 1Q72L 2IPKA 1H15A 5I17A 5A3ID 3CNKA 4MSWB 1IU1A 5E6IC 1ROCA 4BHUA 3ECUA 1KGCD 2KBGA 2DMCA 3C5JA 4FX5A 3WGVB 2GCYB 1T2XA 3D7PA 4KXCA 5HY9B 5AB2A 3IDGB 3LZLA 1FN4A 4HX1B 2J8HA 1OY3B 2KZWA 4PJEE 4J2XA 3VFVA 4LT7A 3OQ3B 4TMPA 5GZOC 2ZONA 5DRNA 2EINB 3SYQA 4BKLB 5JZ7D 1UADC 1P1ZA 4FNPA 5ETUA 3GBMH 2X89D 4K3DH 3TN0D 1J0ZA 1RZJH 1KCLA 2EKSA 5AQ0A 6FABL 4LGPB 3NA9L 4X9HA 1TITA 3VFNA 1ZANH 5HGBA 5KOMC 2MPAL 3KLSA 4Z95H 4GG6F 2MKLC 4GEIA 1XR8A 5IJDC 1G7IA 4PRBB 2G3NA 1QBLH 2E74C 1RV6X 2V33A 3SQBB 3AG3B 3U0TA 3C8DA 4LEXL 4P5TB 1T7WA 4KRPD 2VMEA 1JWMA 4P46C 1PLGH 4ZYKA 4HGMA 3LIUA 4ZPVA 5JNYB 1E7VA 2A5UA 2PKDA 3IFOB 2FJSA 5CZXC 3UZQB 4P4KC 1PBYA 4AG4L 3CSGA 2DQGH 4GY4A 2X4QA 3MRMA 3VD2A 1J5OH 2BOCB 4YHNA 5C08B 3BE1L 5DC4B 1T0MA 1KPVA 1MHHB 3H0TA 1BQLL 3P77B 5JHLH 3IAPA 5F89B 2HX7A 2A9MH 4K7FA 4Q56A 3DRQB 1M7IA 5DRXB 3UGEA 2J8UB 1F3DJ 2KZ1B 4HXBL 2CD0A 4G1MB 5T5NF 1P5UC 5AG9A 2PTVA 1D5XB 3AM8C 3NQIA 4MB1A 4WUUB 3G5XA 2ZUQB 3CFMA 1XF5A 3KL5A 3NCMA 1KBPA 3ABKB 4Y88A 5HI4C 2XETA 4X6DA 5T1DH 2YPKB 1MJ7L 1NLBH 3V0WH 5A2BA 2NNAA 1JNNH 2HSIA 4WGVB 2AJVH 2K70A 1PTZA 3PQYD 4N2BA 2PYFA 4EVNA 1CURA 1S9XB 4NBYB 2A74C 1D5RA 3Q5YA 2CBQA 5JW5A 2ADYA 3L9YA 1MFCH 1Q9LB 4KDWA 1WS7A 1ZIBA 3MA9L 1AGBB 3L5JA 4LEOB 4P57A 3WDIA 2ZSWA 1DVFC 4NYLB 4KQ0A 3F64A 4IOFC 3LRMA 1UYWL 2J88L 2A99A 5EZPA 3SPHA 1R5WA 5I6OA 2QEJA 1FCGA 5J1SC 3UTSB 3FTVA 1VFAA 5D1ZB 1LO2H 3ROLA 4LRNH 4QRSB 3BH9A 2OMZB 1MCIA 4MXWH 2VXSL 4Z77B 2C3WA 4PRPA 3MV9E 1CFNB 1RZ7H 2NZ9C 1IFGA 5JLZA 5F44A 2NY0D 3MOAL 2CKBH 4GRWB 2K7PA 4WW1A 5IEKB 3UP6A 1JF5A 1XEUA 3WHXB 1X5YA 3L2NA 3UGUA 1FA4A 2PR4L 3QZWA 2E7DA 4O2CB 2X1PA 4NM8H 3V6FA 4OD1L 4U1SA 4OCXL 4X7EC 2OJZL 4HC1A 1RZIA 1KFAH 1SXAA 4DVRH 1GOGA 3U0WH 2WSPA 4HJTA 2AV1B 4WK2B 3TH2T 1OW0A 4RSVA 3VGFA 4QXTA 3NVQA 4LQFL 5IBTH 1D7FA 4W93A 5EORH 5L8LB 4G7QB 5J57B 1E4XH 1NGXA 5DWUH 5CFAA 4S1SL 1RUAL 4GT0A 1D9KC 3I50L 1E9OA 3TOPA 2AQNA 1OGTA 3N1GC 4QYOA 1T66C 3FT2A 2QQNL 3DGGA 4RAHA 3MKGA 1A8JH 1CICA 1FZKB 2DS4A 3FCSA 4BDVA 2FJGA 4OV6F 3V95A 5DRZA 3RWHB 3AWGA 3SE9L 1JZIA 1OCZB 5T1MB 4AYID 1A4KA 3MNVB 3MRDA 3PP4H 3QBTB 4JQIA 5AW7B 4Y5YB 1SY6A 4ZXBC 4FFZH 2PWGA 4DN3L 3BH8A 5D1QC 5FYLL 3UAJD 2HZHA 1PG7W 3SYPA 2E0PA 2PABA 3O6FA 4OLUL 4RGMC 2DQFB 4YX2L 2BVUA 2XVGA 3BWAB 4IRSD 3NPZB 3RU8H 4AMXA 3EOAB 2DL9A 3VXTB 3PHAA 3ARRA 3Q3GA 5IW6B 4OUUB 2GJJA 3GI9L 3IETA 4JFEA 3DJTA 3I02A 4LZKA 4F7MB 1MIEH 4TNEA 2CQVA 5CSZB 2NYYC 3MUGB 2YMXH 1A5FH 3N41B 3CC5B 2W9LA 5KSAC 3O9WC 2GW5A 3GHBL 3GMRB 2R0KL 1YMMB 4ZUSB 3RL1A 1UTDA 4YSQA 2DQIL 2NQCA 4FQLL 5KAQF 1XMEB 3ZRSA 2HRPL 4KXZH 5DLMH 3BPCA 1XMWA 5DK2A 1MSPA 1IEBB 1RIHH 4WU7B 3MU3A 1FNAA 2X70B 3AXLA 2VT0A 4POZC 1H3VA 1PD6A 3F3HA 3HKFA 3V4VL 2X4PB 3KEDA 2ZNXA 3HFML 5G4MA 1A22B 4AQ8A 1A4CA 2JK5A 2QPEB 4NKDB 5LG6A 3QQ3A 4PJEA 3FB8B 3L1GA 1RK1A 3L95B 3L5WA 4S1RH 4Y89A 4PH8A 3BN9C 4K23L 2XV6B 5FYKE 5GRJL 3IRCA 2CALA 1GC1H 3LTVA 1EUTA 1G5AA 4MB3A 3VXOA 1SXSA 4GKZB 2EEDA 1XGYH 4HUNB 1W80A 3PWUB 1C16B 1V7NL 3IEAA 1D5MB 3DHMA 3GNMH 4N6RB 2CR6A 5JYMA 2WZ0A 3EJPA 1LEGB 1RZKH 3NSDA 2LVCA 4KKBC 2PCFA 1GPOH 3DX4A 3MLVL 3PABA 3EJCA 3FTYA 3F00A 4G6ML 2AFNA 2ZCZA 5AOZA 1OO2A 3MV9D 3L2MA 3SEPA 5E1HB 2AS5M 2C4FU 2XV3A 1WT5C 4D0BA 1MCPH 2NXYD 2FQGA 3BKYH 4FC3E 4IRSA 3ILDA 5H2BB 4AJ0A 4HH9B 2ZYIA 4DK3A 4KAQH 3MLWH 2MEJB 2A77L 3LYRA 1Q9WB 1X9UA 1MFEH 1GGIH 4HJ1A 1AD0A 2GJ6B 2OI9C 4YZFE 3OHXC 3O3EB 1GVIA 5ICZB 4K94L 2Y7LA 4PS3A 4W9GC 5EO0B 1JGUL 2Q5BA 2D31B 1C1EH 1U3JA 1XF4A 1DJWA 2PETA 1A1NB 3EYOB 3SPJA 2K4AA 4XZUB 4Q9RH 1UKTA 3VFPA 3C09B 2FCBA 4PPTA 3ZIYA 2CUIA 3FSOA 1S8DA 2I9LB 3G7TA 1UC6A 3UP1A 4M6NH 2O61A 5F3HB 5BZWB 5TE4H 4LNRB 5MEOB 2BP0A 1BWWA 2CO7A 2VDKH 2YRPA 4O02L 4MS8D 3QJOA 2BP5M 3EYQC 5D5ME 3RX5A 1CQKA 3I2CH 3CTTA 2X4RB 4I3SL 1OAUH 4LP8A 2X3AA 3GGWA 1ETZA 3BDBA 4GYBA 2EKJA 3ATAA 3DI2B 1CIDA 2FL5B 2VSKB 1AQ8A 4UQIM 5C0ND 5IW1A 3HB3C 1HDMB 2MCPL 4MA3A 4PAZA 2WXHA 3FFDB 5HDWA 4QDGA 1B0GB 3IF1B 2NY1B 3CHPA 3HC4H 2HTKD 4AMWA 2Y06L 2AERT 2O4EA 3U7YH 3Q8BA 4WCYL 2V0AA 1G7HB 2QELA 3GPEA 1LDPH 1I9EA 3Q43A 4ZFFA 5AAPA 2WAQA 4AQ1B 5CO1A 5HBBA 2ICWJ 1J9QA 5HYSA 2MSPA 3NG5A 1T1YA 5J56B 1YJDL 2AXGB 2XG5A 2ZKMX 3ASNB 4P2RE 1JGLL 1TQBB 1JXKA 2A9NH 4HWBH 3UGXA 4ENED 5AOJA 4DUXA 4QHUA 5E2WH 1B3IA 5C9KA 1J88A 5TK4A 1HXKA 4H0LC 1XF2B 5JPNB 4NZFA 3I9AA 1H15B 5BJTA 1OOAA 1NCJA 2APFA 3PV7A 4C8XA 3KMDA 4JKNA 5ICXA 5D4HA 1YEDB 4XBMA 1BEYH 1E28A 3C5JB 4U1GC 3RWCB 4RIRB 4B60A 2NLJB 3GTNA 1NDMB 5CHNB 4HLZH 3V5HB 1DUZB 4AEHH 5I1HL 2HP4A 2VWEC 4P59L 4M56A 1SJMA 1FJ1A 3UTOA 3IU4L 4JG5A 4KVPA 5I74B 4L3EE 5DEJA 3X12B 3C5ZB 4FFVD 5FYKD 4PUBL 1WFJA 3P0YL 4X7SL 5ABDE 4JREB 4X4YB 2GSMB 3V5DB 3NJHA 5AOIA 1J1XH 2P8LA 3C8HA 3KBEA 3LKRB 2I07A 2D7OA 3H42H 1FP5A 3BGMB 5HGBB 2WKLA 1QLEL 4HWBA 2OR9L 3WN5C 2JELL 4PV8A 4JGMA 1G7IB 4MQTB 3SZ6A 1YJDC 1CS6A 4X0KA 3IDIB 3MTXA 5F88B 3IN0A 1NBZB 5H94A 4K7PL 1DQIA 3BRDA 3ABMB 1ZGLB 5F0PB 5FDYA 4AV5A 1A6VH 2VABA 3FU6A 4S2SA 3QARA 4GQPH 3TFKD 3QIUA 3DWTA 3GB7B 4LESA 3RE0A 4F93B 3GZKA 5I1EL 3FO1B 3VFOA 3X3FL 1BG1A 4PD4K 4M5YH 1RK7A 2OCJA 3P9WB 3TU6A 2R27A 1WCQA 4OQTH 3W9EA 3BAWA 3QRGL 3GXNA 4K5MA 1CUOA 4OIBA 3VA6A 4FKEA 2AQQA 1SFHA 1SYSA 1CQYA 4W68A 1T0MB 2R56L 5F7WC 2A6DB 5TTRA 3HVNA 4CVXB 1GIGH 2J1WA 4KROC 3RQ3A 3WFEH 3MUHL 4EN2A 1BX2A 5LBVA 3WI9A 2WQ8A 4LPCA 5D7KE 3S4SG 3GJFH 5C71A 3FOMB 3AROA 5HI5C 2FLRT 1U8IA 4XMXA 3WD5H 2BZCA 4NT6B 1EAQA 5JQHC 3IGLA 1NCBH 2FB4H 4P2CG 4AM0A 1GCFA 1XF5B 1PD1A 1RZFL 4R7NA 1LEIA 1O6SA 4GFXA 4G3YL 1NIDA 4J3XA 2V7HB 1RZQA 2VDRH 4LSVL 2GIXA 5ECGA 1ZWIA 2UUDH 3AUVA 1NC2D 3KE0A 5I8CA 2X7LA 3LRSA 2H32B 2I69A 3HAEA 3TN0B 5IB3A 2PYFB 1J8HA 2AGJH 3KYMA 1ZGLP 1UM4H 1L7TH 3I75A 2FE0A 2CJUH 1JOIA 3VVWA 4JM2F 3W1ZA 4F91B 2ZSWB 1E43A 2KZBA 3TS8A 3FFOA 1UZ6E 4WUKL 4GI9A 1L9NA 2Q87A 5TQ2H 1IGJA 3S96B 1VFAB 2FBJL 1HQ4B 3KWWA 4N4YB 3TO4D 4KRPB 1UM6H 2C9AA 3AABA 5EU4B 1K9TA 1T5WB 4UOJA 1LK2A 2BNRE 3QUYC 2WK2A 4HYTB 2E59A 2QPSA 1N4XL 4P2YA 5CEXA 3L1FA 3EH5B 4G6AD 3QZWB 1FYTD 3L81A 3TESA 4XCNA 4FJYA 1RXLA 3TPUB 2CDEA 4ZUWB 3HNTL 3OB0H 4DTGL 1RZIB 3MBWB 3Q5OA 1N9PA 2JH2A 2J71A 4M8QA 3GQFA 4OU3A 2NY7H 4K55A 3FULA 5EIIA 1VEPA 3GPSA 4PREB 1R3KB 4L3ED 5D7LE 5TD4A 2KDYA 1NGXB 5K9OB 1S7SA 4I0PD 4KO6A 4N8VB 4U3CA 4NN5B 4U4IA 2X09A 2YHGA 4QYOB 5LCVH 5EC2A 1IM9A 2XZAH 3CFIC 4XO8A 5D5MA 2X4OA 1OXYA 1ZLEA 5MERA 4Z76A 1K4DB 3OKMA 3R18A 2VLJE 3TT1H 3UTPE 2Z34A 1NCNA 4Q58C 4QY8B 3KBPA 4ZFGH 4N8UA 4OT1L 4D8OA 3EJRA 3AC0A 2K9UA 1QX1A 1KWGA 2DEXX 3GKWL 2L7UA 4NAJA 4WI9A 3IE9A 1KGJA 5DQJB 2HLAA 2IOMA 1JCKA 3MRKA 3PQYB 1BDYA 2QVKA 2ZXQA 3F5WA 3F7QA 3B9KC 2G9HA 4JQXC 1TQSA 2XV0A 5IHHA 3Q8FA 2SEBA 1AYRA 4MCZA 3A4FA 2NY2C 1AZUA 5F7EL 1ORQB 1RUML 1U6AL 4AIOA 3L5XL 2W92A 4OUOA 1FRGH 1P6FA 4NCC1 1GGTA 2YPVH 5F1SA 2DJUA 4ZMXA 4FQQB 3VXSE 1B2WL 3TO4A 1CYGA 4RH4A 5LGHL 4TVPH 1KB5A 1P5VA 1J12A 4P2RA 3CDYA 5ENWB 3SY0B 2LW3A 4WWKD 1IILE 4E9LA 4EXPX 4KKPA 5D7KD 2AXWA 1XBDA 2A0LD 4NQXB 3EYUL 3FAXA 2WM0A 4FQHB 3FN0H 3ULVL 3L4TA 1HE8A 3ZYOA 2AK4A 3T0EE 2NYZA 1AKJD 5AVSB 3GHEL 12E8L 4YHML 1N12A 2AJSL 3BSHA 2JK5B 3CXDH 4L3EA 4CBZA 1OSPL 3GIZL 4J3OG 2XN0A 4TSBH 4L0YA 3LS5H 2XJKA 1CG9B 2NOYA 2JNZA 3QWRD 5IUCA 1FC2D 4EDWL 2VW7A 5J3HD 4PJ8D 5DTFA 1N5YL 3QZLA 3ENEA 1CGVA 1S7RB 5H35A 1QAWA 1KIPA 3U6XS 3RPIA 4MGXA 3VSUA 1P84K 1LNUB 1EGJL 1W91A 3FUKA 4QLRA 4TLUA 4WI8A 3HBPA 3TEWA 1ZGLM 2YUWA 3HLAA 1ACYL 5JXAH 1R17A 5JTWA 2EYSA 4QF1B 4XNZB 1ZTMA 2BCKB 4AM0Q 5ID0A 3TH4T 3ULVC 1UWGH 3TT3L 3SGJC 2XX1A 2FX7H 6PAZA 2V9RA 2WXQA 1NM9A 3CVDA 4BZ1L 5CD5D 3J7HA 1AD0B 1HX0A 4RFOH 4G72B 5I8KL 1RZGA 4MXQD 2VUOA 4NQTA 3CFCL 3DXAB 1UD4A 5C0CB 5INDA 5GGRA 5IGXH 3ARGC 1N2RB 1TO5A 3THMH 4B7IA 2B77A 1YN6B 1J9TA 2XWJA 3VFPB 3CCHB 5F7MC 2HAZA 4O58L 1T89C 4XBEH 4YFLI 4KO7A 4DEPC 3BKML 4H1LB 3I84A 4YXKL 3J07A 3WFHB 4TULL 3OLEA 4FYSA 3DUSA 4KQ4H 2BP0B 3MCKB 5HHNA 4IJ3B 5IOPA 1JERA 2WO3B 3KLQA 2VLJD 3UTPD 1WLHA 2NQ3A 4P5MB 4L1SA 4QUOA 4HAFA 4BFNA 4N6QA 1G7LA 4NCC2 2BPBA 3QG7L 1LO4L 2HVJB 1J0IA 2WPGA 4RGOH 1IFRA 4PJ8A 5I0YA 1G9MH 4OGZA 4CGTA 4GH7B 1YNLH 4I9XA 3W3BA 3K3QA 4D7BA 4Z3GA 5FO8B 5ALCH 3PHQA 2ZCKH 3VFUB 4JFWA 4W70A 1UZ8B 3E8VA 3H9SE 2XX0A 4O2FA 3V7AE 4XNUH 1B0RA 3VXSD 3TJHC 4WSKA 4ZFFB 4M62L 4LCIH 3OD3A 3ARSA 4HKXB 1LO5A 3BJ91 3OZ9L 4X8CA 3STLA 1AR1C 1INEH 2AXJA 2BNRA 3AS3A 3L3DA 2IGFL 3MN8A 3MV9B 5JIDA 3GI8L 1KT2A 1MCRA 3C2AL 3DVNB 2NXYB 1BJ1J 4TNVF 3EOYG 2QL1A 5B38G 1C12A 2HFEB 4J39A 5DD6A 1H8SA 4ICWA 4HIJA 3ORJA 4P23C 3ZDZF 1ZT4B 4XWGH 4ZUUA 5BJTB 3OKDA 1EA9C 2G2RA 5E4OA 1LP9B 2XTLA 1U8QA 1BPLB 3EFFB 4BGDA 4MVBD 3T0ED 2L7EA 3DMMD 4ZAKA 2MCMA 3CFJA 4H2AA 2H9GB 4XO3A 4OLZH 5FCUL 1UJ3A 3TA3A 5D7LA 5F6HI 4QTIL 5T3XH 3MV7E 2YD0A 2Y6TE 1KIUB 1XFPA 3TIEB 4YQXL 4U33A 2XWZA 5I1DB 4Q52A 2FNBA 4NAMA 1UCTA 4L8CA 4BQCA 4OZIE 4PJDA 4Y0GA 4AL8L 4N9GA 1BFVL 3FONA 4HHGA 2VNCA 1OOWA 2Y7MA 3UTTE 5IMLA 1P7KB 3GSNL 2MHAA 4PV8B 4YHIB 5MEQB 5GRYA 4BSVA 2ZP9A 4AQOA 3PAYA 1I31A 1PJWA 1E5BA 4GEJA 5FF6A 1Q9OA 2WXRA 5AKRA 4LLQB 3SGKC 4L37B 5CJBA 5AOKA 4GQQA 3SE3A 3EADA 1YNKL 3QXDA 3VFOB 3RUGB 5KYUA 2OYMA 1RSYA 3EGDA 3O6KL 4GAGH 5IFHH 2H3XC 1HCZA 2DMBA 3GD1C 2Z64C 3B2UD 3DPDA 3ZE1B 3RIKA 3NCFB 1NCTA 1EJFA 1UJTA 5EBMA 1A6AA 1QA9B 1SYSB 1KXVA 2O30A 5IV2A 1OCWL 1IC7H 2XTSA 4XNYH 5PAZA 4K3EL 2DKSA 4E9RA 4M61A 1P4UA 5FUOH 4ESKA 3RIAK 4G9FE 2EDDA 4B3EA 3L3IA 1IAIH 5E00A 1W72H 4AL8C 2PWFA 3HJ0A 4ZS6C 1F45A 5IHUL 4ODTH 3VFMA 5IQ7H 2YQGA 3DMMA 1MHPL 1ZIAA 2IPTH 3QDGB 3A67L 4N2HA 2KLRA 4NNXB 4RMBA 2OQJA 1O6SB 2WBKA 3HZVA 5JIIA 2WKGA 5EWIL 3WKNA 2DIEA 1AXTH 1QD0A 4RAUA 4XMVA 5I8CB 1MFUA 3HG1E 2PMZA 7CGTA 3IJ9A 3L16A 3HAEB 2H1PH 1FE8L 2OMUA 1GMEA 1ORSA 2FIRT 1TMCB 3I75B 3ILPA 5EZOL 3ZPDA 2R9HC 2WGNB 4MJ4A 1PG7L 1MJ8L 1YN7A 2PWEA 3ET9F 4ECNA 3HI1B 4JFQA 3H9SD 1IKFL 1DSFL 2XZQH 1F58H 3DO4A 2Y36H 4TQ8A 4YBLB 2WKOA 3MJ7A 2QFPA 4D0DA 3BZEA 3RWIB 3S37H 1BCIA 1FGVH 4NLAA 4HJUA 4QXGH 3OMIB 5GSVA 5KANG 3D30A 1QFWL 1JAEA 3O8XC 3W0WE 4DKFL 1KLGA 4GP4B 3INUH 1VKXA 1CMOA 1I7ZA 3FHAA 2YD9A 4W4OC 4WJ5A 2BC4B 4DZ8B 1S9KC 3ABLB 4PGZA 3OKKA 2C4XA 4QRUB 5E5MA 3EUUA 1DLHB 1QSEE 2O5XH 4UT9H 2WINA 3DX0A 5GGUA 1UOKA 3ECWA 4XCNB 3WXVL 5JW3H 1OZUA 3EOBB 4ODXA 2DEWX 4H8UA 4AJYV 4QRRA 2AF2A 2PPFA 3FQWB 2QSTA 3Q0HA 4E42A 1YECL 3JV6A 1XB8A 2EDMA 3EJQA 4U6XA 4WFHE 3QR0A 1KTDA 3CPLB 1JMZA 5AW5B 2FX9L 1DJGA 1UWXH 2VRAA 2R39A 1NCUA 3MV7D 1U8CA 1S7SB 1PMYA 4JMNA 3UJTH 1JBJA 5T5FH 4NN7C 8FABB 1HZKA 1WYJA 3FUIA 3IDMA 2BVEA 2DI8A 3WDHA 5EC2B 2EYTA 4JM0A 2P47B 2X4OB 4W6XB 3I74A 2LLNA 3K6OA 3UTTD 3BZFB 3N6YA 2K0RA 5DVNA 4UT9A 1DSWA 5FXCH 2CBPA 1VGEL 1NC2B 1BJMA 4F8LA 4C4KO 4X8JA 1A7PL 5KBNC 4AIXA 2QADD 3AW5A 1MQKL 2WY3B 1E42A 4N1CA 1WIPA 3DURB 5A2LH 1LK3H 2J25A 3TIDB 2CRYA 2C9PA 3PP3K 1SDAB 1WWAX 3W82A 3ULUF 3TF4A 1E67A 5AL0A 4ZW5A 1E5UI 4Z7OB 1QYGH 2GKIA 4YDKL 2Q7AA 3EFOA 2H6OA 2OA9A 3KPLB 3S36H 4AK2A 4IKIA 3MZTA 5I82A 1A1MA 2OXHA 4ONFH 4U6YB 3T08A 4L4VB 5DHYB 3QJFA 3ZYIA 3FHQA 5HPOA 3FPXA 3O3UN 2C9QA 3BLKA 1B3JA 1Z9SB 4Y5XA 2GI0A 3MX0A 1KPUA 1RJZA 2F1AA 2Q6WA 2VJXA 3ZTDC 4AZ8B 3S88L 3FFCB 2P8PB 4G9FD 4WFED 3BMVA 3L3KA 1OM3L 2EDXA 4I77L 3ASWA 3JV4A 1I8MA 1FYTB 4JFYA 4ELDA 4HS8H 3ATFA 4I7ZC 2R8SL 3F83A 1R4XA 2Q7NA 1V3MA 3PJLA 1J0YA 2P8MB 3PPEA 2OYLA 4NQQA 4KMTH 5I73C 1XGUB 3GK8L 4RZCA 1G7QB 4LNVA 3KPNB 3REWB 2ZUYA 3S5LG 5KVGE 5LAXA 4I0PB 5KYWA 3HG1D 3MCG1 4HUVA 1JFHA 4K71B 3HMXA 5DTFB 2CO3A 4OZIA 1CLOL 3D0AA 1U3HB 4YSPA 2G9KA 1TVBA 1WAEA 3UTTA 3KGSA 4GRWH 1GGBH 3MRQB 2GSIA 1JZDC 3D0LA 4OGYH 3SSGA 1SGKA 1E2WA 2GITB 2K4WA 1NOFA 4OCNC 3LNIA 4OM0L 4LB8A 4HJSA 3DHPA 1I1YB 5D1XE 2PP9A 3DROB 3O3DA 3G5VB 4BK5C 2EYSB 3S5YA 4HUWB 1IE4A 1QSED 3IPFA 5JHDA 2AJXH 2B3IA 4RFNB 5I5JA 5GPRA 2NPLX 4NHCH 4NNPL 3OJMB 4WHCA 1OGPA 3VXNB 1IAKA 2V4LA 4ZTPH 3UPRB 1RZGB 3A5VA 3HS0C 5HVHB 4LKXA 1FL3A 2RCSL 3VWJA 1ZTXL 4WWKB 5DC0A 4KZCA 3BX7C 3TCTA 1BYOA 4JRXE 2WW8A 4QXUL 2XPZA 3BPOC 4P8QA 1FNLA 4E5XG 2EDLA 2XICA 1DQJA 3MR9A 3RWEA 2AQ2A 3QZOA 3I6GA 5I1LB 4PGEB 2RFXA 1FNEA 1AKJB 1JZJA 2DQJH 3A6CH 1AGCA 5IOPB 1NMAH 2B15A 4GKNB 5E9DE 2R1WB 1A47A 4J2QA 5ESVA 4AOFA 1GKOA 1KCBA 1HXMA 2MFNA 2HX8A 3RILA 3P4MB 4MAYA 3E8UL 5DSCA 4BXVA 4CADA 2R0ZL 4EZMA 4NZRL 4R4BB 4DW2L 2E7BA 1A3RH 1WG3A 1C7TA 2IGLA 3FQRB 2F5AH 5I16B 3QAZB 5F9JA 2E7HA 3H6AA 5DURB 3NZ8A 4Q6YA 4W1TA 5GS1C 1HILA 2Y2TA 1B0RB 2V5MA 5J6SA 3HKZA 5IMMA 4OIIL 4HZ1A 3W0WA 1KZQA 1LO5B 5JPMC 2EC9T 3CAFA 2BWDA 1G5GA 2F7RA 1OLZA 5FB8A 2AK1H 4HMEA 1H0DB 4GG6B 2R7EB 5KSBE 1CDBA 5GZNC 2JJSC 4DZBA 1FL6B 5DD6B 4WI0A 5EBLA 4DPAX 4N0FA 2EH8H 4UBDD 4XVOA 2Q2LA 2IG2L 5GJSH 4YHKL 3FQ4A 1HOEA 3NFSL 5I19H 3KPMB 1IC4H 1IBHA 3MLXH 2N3JA 4TQPA 3CSTA 4KRNA 4UMSA 32C2A 1AHWA 2GHWB 3LHPL 3O4LE 1ZS8B 5DK0A 5JXEC 3D5OF 4G9DA 4UB0H 1U91A 3ZU8A 4KGJA 4UM9A 5KBPA 2MNWA 2L4OA 4HUUA 1PW3A 1NCCL 1AZRA 1X9QA 2H2PD 4U3HA 4XCYA 4L8CB 1SUJA 2WBWB 2FZ3B 2AQ1A 4R0LC 4WO4A 5GS3A 3FONB 1MCKA 4PCTA 4U1IB 2AITA 2VLJB 1N5AA 4XN9A 2VDLL 2YQBA 1J9RA 1OF2B 2Q10A 3ARDA 1CD1B 1SHSA 4BSVB 2F2HA 4I0CC 3MPCA 4FD0A 5D1XD 4P49A 4Z7QE 2W9DL 5TPWL 4GRMB 4OJCA 1V05A 3O45A 2A73B 1XSKA 3D1MC 4JPIA 3NK3A 3JV0A 2P1YA 1PX3A 1ZVHA 3BXNB 3LRKA 4JO4L 5GS2D 4XNQA 5H4YA 3VXSB 2WAHA 4R5XA 4KJQC 3L7FA 4U1HA 1IGCH 5F3FA 2N7SA 2NY5H 3LNGA 3RDTD 1TTRA 1ODAA 4YHYC 2CR3A 4N0YH 2APWA 1BP3B 1PIFA 4JRXD 5FV2A 2GABA 2ORBL 3UO1L 5D2NC 1IIKA 3BP6A 1IB5A 2XXMB 4MLIA 3O3BB 1WC7A 3T0EB 2EXWC 4DO4A 3Q6FA 2AQSA 1R34A 2JV6A 4ODUB 1RMFL 1E8ZA 2QQLL 2YD3A 1WZLA 4B9KC 1LTXA 2WLNA 3EJTA 5E9DD 5CIPA 4IKLA 4JAMB 5KS9F 1DQTA 3PUCA 3MC0A 4U6TA 3STZB 3TBTA 4ZO9A 2VDPB 4PJFF 5DZJA 2HJLA 1KOAA 1DBMH 2IVFC 4YSOA 3SO5A 3ZTCC 2PPCA 3F05A 3ILPB 4NKIL 4K0OA 3SDAC 1XB3A 4PBDA 5GRVL 1DJYA 1QBAA 1YN7B 1DQMH 4BA8A 4MNGB 1FBIL 4FFWC 4EI5A 1UD8A 1J1PH 3ECQA 3H4HA 3MKKA 3T6XA 3MJ7B 3BZEB 3EYFA 1DL7L 5GJTH 3KAAA 5D1XA 3U79A 2HXAA 2UZXA 4M5SA 1SJHA 2WOBA 5KBKA 3X3GH 5EEYA 3UPAA 1FWXA 4N5ED 2K6ZA 4I2XB 2ZAGA 3KLAB 4HQQL 4U6HB 2HWZH 1TZIB 4FLRA 3OB8A 3EUDA 4UOQA 3V52L 3OKKB 3UXFA 5E5MB 2DMGA 3JTSB 3MRFB 2BOBA 1Q0XL 4XVJH 3NZSA 3ZLQC 5GGQH 3FMGL 3L3JA 2ZX7A 5GGUB 1T83A 3P40A 5D2LF 3WEXA 4RDQG 2W0KA 3CV5A 3SDXE 3MLRH 3T09A 4ODXB 5I24A 2NCEA 2F0CA 1A7NL 3D9AL 4F37K 3R0MA 5LDSA 5LGJA 3RDTA 3O4LD 3N42F 4E42B 3JV6B 1CE6B 3ZKND 2BDNH 3U7WH 2Q7YA 4JRXA 2E8ZA 4KITB 1KTDB 4O5LL 3BN3B 1A7OL 2J12B 5KVFL 1CGXA 3R4RA 3VU1A 5C9JB 1MCOH 1OE2A 2BJMH 3G5YB 1JN6B 1EV2E 2H7WA 2YAHA 4I5BB 4NO0B 4EVNB 1O0VA 1RURH 1TU2A 2WTRB 3B83A 5FYJL 2HX9A 1GHFL 1UD3A 3AREA 2VGLM 4A38A 5AOMA 3D18A 3TJPA 1E6JL 4D3CL 2A6IA 4NERA 1I8KA 2KQNA 1QR4A 1C5DB 5E9DA 3NJXA 5EB9A 2EICA 5IQ9B 1YEEL 3FSVA 2N59A 4WEUD 4U05A 5LBSA 4F1SA 3T6VA 2ICEA 1P9MC 3K5RA 1SJXA 3K2UH 1A9VA 2WHVA 3OKEA 1I7RA 4APQC 1E4WL 5C7XH 5K9JH 2BINA 1WRFA 4LCCB 3H9SB 1JI1A 3L5IA 1VF5C 2V3FA 4JS7A 2V2XA 3CDGA 3HZMB 3NRQA 2OXHB 3ZE2F 4AYEC 3ARFB 4H26B 4WW2A 1NGYB 1TVDA 4D0CA 3QUXD 4FEMA 4JN2B 5E5RB 5KSBA 3MX0B 4AYDC 2G4GA 2Q6WB 1FFPA 1QLFB 3ROOA 1CGWA 2J43A 1YQ2A 3D3VE 2VISA 3NH7L 5AAMC 3VDCA 3WY4A 1OB1B 3FN9A 2H32H 4DOHB 2Z8RA 15C8H 1MLBA 4CUCA 5FECA 3O4LA 5JHMA 4JVWA 4X9GA 3SKUD 4BH7A 3CBJB 4ODWB 1ET7A 3IJHB 3QQ4A 4FQCH 3NGBB 4GQ9H 4PN6A 4KI5E 4XAWH 3MV7B 5CM1A 1AXSB 1FH5H 3FCGA 5GS0L 1T20A 2A38A 3U46A 3FUFA 2XI9A 4LASL 4XCCL 5L0QC 1LWHA 5HHPB 2H0PA 1WCBB 2ZKHL 3EO1A 3G6JF 4LF3B 4N1EA 4YAQB 1HHJB 2BNUA 3BUBA 1C7SA 5TDNB 3GSQA 5I75C 2AP2A 3X1BA 1VA9A 3UTTB 2IMNA 2UZYA 5FKAB 1KELL 2Z91B 3MJ9A 4ELMF 4DEWA 3CVHA 5JOFA 2OP4L 3MMEB 3N9GH 2QLYA 2ZNWA 3QYCA 4L8BA 2F68X 4QHLA 2DB8A 2QADB 3D2UD 4F7EB 2VDNL 3M07A 5AW3B 1ZT1A 4U1KB 4YC2C 1DUYA 4PV9B 5ACMA 1JZGA 1OT1A 4NS0A 2RD0A 4BJLA 2QQKH 4HIIA 4ZMWA 2GT9B 3WCYA 2D03H 5KJRH 2WWKT 2QDWA 4D2NA 1U30A 2FT8A 3LZPA 3PL6C 4YWGH 4FE9A 5EN2B 5SWZA 1Q4NX 4E9TA 1JPSL 2I27N 3EDKA 1EFXD 2NZIA 3ZKXB 1D5ZA 1BZOA 4ZOEA 1EHAA 1BPVA 1SQMA 4G1EB 3SDCD 1MW2A 2W91A 2XLLA 3BP7A 1HSAA 3QUXA 5ITFB 2YS4A 3OWEA 5C6TH 5KWYC 4V1DE 5GS0C 1XL4A 1AJ7L 3KYOA 4FQIH 5FM8A 4G9FB 3NJVA 2Z1KA 1S46A 1HHHB 3VG0L 1IUZA 4IM8A 3I6GB 4BYHA 1XO8A 2RFXB 4P07A 4C56E 1FNEB 4OLEA 1T21A 4DGYL 4FABL 2D3NA 2R2EA 4EN3D 3EHBD 3WUZA 1IGML 3JWNE 4U7KA 4N3UA 2EYRB 4GMTL 3LKOA 5ILTL 4HKZA 2WBJC 3M8OH 1BOGB 2H45A 3HG1B 5BVJA 4EDXA 5J06A 2CHDA 3CMOL 3PDDA 1Q1JL 5FW6A 2BRRH 3MLUL 1MJUL 4YBQC 3VGBA 4PR5A 5F71A 2KKQA 2EVFA 1YUKB 2IDTA 5D93C 2Y07L 3VRIB 2JXMA 4R26L 3P4OB 5JMOC 1W6LA 3QUHA 3TV8A 2OAAA 2CZNA 4QR7A 3U9UB 1AMXA 5FUCE 1U21A 4CMHC 3NZ8B 3WFDL 3ZVVA 1HILB 4OZFA 3RPKA 2Z31D 3HEIB 3IJYB 2BVOB 2H3NB 2Z9TA 3VGAB 5EBWB 1FLRL 3WIFA 1HSBA 4I4WA 1DJXA 5FKPA 2BNQE 2PYEB 1NBQA 5KOVC 4XCFH 1QSEB 4YBHA 2KPNA 4HFWB 3D3VD 1D6EA 1SEQL 3EJJX 4LQ1A 4HU2A 1BA9A 1WEJH 2DQDL 4N0FB 1S7WA 1EFXA 1Z66A 5T8IA 3SDXA 1JD9A 3NOIA 3OAZH 5IG7A 2ED8A 4MMZC 3BP5A 4IU2B 5KVMC 1JPFB 3SDCA 1O7VA 2MIZA 4DKEH 4TOYH 1XVSA 5CF3A 1JVOA 2WYHA 4FFTA 1UH2A 1WWWX 2X6CA 3EIFA 3U36B 3MDJA 5B3JF 3D25A 5J1TC 2FQEA 4KI5D 4PU2A 1IQDA 4MNHA 4WENB 5D7SH 2BWQA 3ZX1A 5KSVB 3OJDB 2XTJC 3H2QA 1H3UA 4YK4C 5ALBL 3WOVA 2FJFB 1EJ8A 3MODL 3C60D 4XCYB 1WGOA 1DP0A 2ZD0A 1CXHA 3T2QA 2X42A 1FO0L 1TVHB 4PLKD 4E0RB 1UURA 3US0A 5I6XC 5C97A 2K9FB 3SE4C 3AZUA 2Y6SC 1HQRA 3RY6C 2XQYG 3IN2A 1ZHKA 4UQ9A 3V0VA 4EOWL 1ET5A 1YEIL 4ZFZA 3X1EA 6PCYA 5ANME 1I7UB 5C2UB 3S3CB 2VR3A 3QR1A 2YA2A 2ZAIA 1QTSA 4U0RC 4GI8A 3AQDA 2QKIC 3K71A 5TGBA 5B39A 4LSTH 4YIQB 3PWVB 3S3JA 3DO7B 2Q1EA 2Y2WA 4KY1L 3P9LA 3SDYH 1V7ML 4AUYA 2I24N 4PIRF 4QRPB 3EJZC 1F3JA 5LDUA 1N64H 4OD2A 3RVWC 1Z5HA 1N59A 1DBKH 2MOGA 3APNA 1DJZA 1NWOA 1TJIH 2VXQH 4H1LH 1M6OB 2AXFA 4G8GB 5F7UA 1RHHB 4AYFA 3PFUA 5HJ3A 5C0DA 3FW6A 1JYXA 2CHWA 2BK8A 3KDMB 4R7LA 4J3OC 4V1DD 1EZLA 2LE9A 3TONA 2NY4D 3FYEB 4PS8A 5J0BA 1A14L 1D7BA 4Y4FC 1GS6X 1L9PA 3CQFA 3GBML 4K3DL 3BMWA 1P4LB 1CYWA 1RZJL 3VYNA 3BP6B 2Z4QA 3BT2H 1WC7B 3APCA 4OBSA 4LL9A 4C56D 1ZANL 3Q6FB 5B1JA 2ZF8A 3ZR5A 4Z95L 4OFVA 5B1KA 5I26A 1INDL 3BWSA 1QBLL 2VR5A 1ZK5A 3NCYP 1R3LA 3LDBB 1UXSA 4BEIA 4FXKA 4YO0B 3E1F1 1JYVA 2R0WH 3TBTB 2VXQA 1PLGL 1RFDH 5E95B 2EDBA 2R2HB 4MWFA 4JHWH 2DYPD 2E3VA 3NABH 3U30C 4HOZA 4FLQA 1KYFA 4AENA 1S4IA 3C5SB 2YBGA 5B7EA 1XX9C 3IDYB 4OI7A 4ZMNA 2ED9A 1J5OL 2ITFA 3QB7C 4WJKB 4WGKA 3OKLA 5F7LB 5DMJB 3U1PA 1BFSA 3W38A 5JHLL 4KK6D 3F7LA 4R7XA 2OZNA 1CLZH 2Y7SA 4NIYE 1ZDSA 1DEEB 2A9ML 3HFFA 5I8OH 2OTPA 1RZJC 4OQ1A 2BNQD 1XL6A 4R5TA 4W4NA 4OFDA 4AXWA 4QRFA 5E6ID 2GK0A 4WWOA 1GZHC 4L1LA 3QK0A 2WC7A 1KCKA 4KO5A 2WLIA 4H8VA 4XB7A 2P5EB 4K5PA 3T9WA 3MLYH 5IB4A 4UTBH 3UMTA 3ZGIA 1XZ0B 3CGTA 3RY4A 2GAZA 1KBVA 4BQ9A 5LGJB 4V1DA 3RDTB 5GZOD 5D96B 2FR4B 1NFIB 5J9PA 4YE4H 5T1DL 4I0KA 3HZYA 1NLBL 4P2QD 2CH8A 3V0WL 2CHZA 2AJVL 3DJSA 4UQAA 1BVKB 1O9WA 5A6IA 2VAJA 2YSSA 1HI6A 1G6RH 1MFCL 1DJSA 1PJ9A 3WE1A 4IBQA 5AVVB 3VXRB 1INQB 1QO3A 2CUHA 1EXHA 1UB5A 2DKMA 4BFIA 1WDAA 3WSQH 4NHUB 3VI4F 3DGCR 3EH3B 5DEGA 5E9DB 1VERA 2OM5A 3LCYA 5D1QE 1LO2L 3GSVA 5A16A 4LRNL 4E9VA 2YAMA 4JFVA 3N43F 1L9QA 4AH2A 3MLTB 5K9JL 4MXWL 3LB6C 3Q2CA 4P46D 1H6UA 1VDGA 1DVXA 3UROR 4UTBA 1RZ7L 5CZXD 2P42B 1I85A 1QATA 4UNIA 5DJDA 4P4KD 2CKBL 3U9PH 3GS0A 4EAEA 2OZ4H 3RNQA 4HKJA 1WIUA 2O93L 4BFJA 2O26U 4NM8L 4YDLB 2AZUA 4TLKA 1UHVA 2V6HA 1SN2A 1OTTC 2XNAA 1KYOK 2KI6A 1KFAL 4DVRL 3CDGB 3U0WL 4ZSOE 3DPBA 4OJYA 5JHBA 4BK8A 4AKPA 4PJ9C 5IBTL 3IGAA 5I1IH 5E6UB 1KTBA 3EH2A 2D2CC 2K3HA 5EORL 5KSBB 2PWDA 1E4XL 1A6UH 3N0PB 4P5RA 2ITCB 5DWUL 5E1AB 3U1SH 1FFPB 1OW0C 2COVD 1T5XB 5CJXC 4EI6A 2ENSA 4R97C 4EZKA 1FHNA 4PJAA 1MJJB 1J48A 3ZL2A 3BYYA 4OIAA 1EVTC 1NBVH 1LMIA 1U92A 5FYKU 5HI4D 4KK8C 5CEZH 1KWKA 4CILA 1MLBB 5FYLE 1DE4A 3O4LB 4X6CF 2IDUA 2N7BA 2B2XH 3BAKA 1CLCA 2WQXA 2OZ4A 4BH7B 2OTUB 3U2SA 1KEML 4FFZL 3UL4A 2YGPA 5D2LE 2ZOTA 3FPYA 3QC5X 5HHXH 1PKQE 1S3RA 1TENA 1WTGT 4E41A 1IE5A 2UZPA 3HUJF 5I8EB 3TBCA 5IWLC 3DRTA 5DUBA 1URIA 5EA0H 1DVFD 3RU8L 5DJXA 1GYAA 1C8QA 3HNSH 4IOFD 1DBAH 1AGDA 3QHFH 3HW7A 4WKZB 1R5VA 2YKLH 4CL7A 1MIEL 1G7PA 2O1AA 1B88A 4KGLA 5ANMA 2YMXL 1A5FL 1E2ZA 4X6FB 5I1KH 4P46A 4LLWA 4PLJC 3P1VA 1EEZA 3VXPB 4P4KA 4EIGB 3LIZH 2IH9A 2OLDA 2XACC 4HIIB 4HT1H 5DLML 3KVDD 1W0WA 5ECJE 1NIBA 3G08A 1AGFB 2IAAC 3K6NA 1Y6KR 4LOEA 3FT0A 5D7IE 2FEEI 5CJOH 2R69H 5G5DA 4OLYH 5D71H 4JDZB 5IHBA 4MJIE 1S5HB 5PCYA 4S1RL 3TCXA 3KYOB 3FB7A 4NRYA 1S7XB 1P5UA 2AJYH 2BVPA 3NN8B 1D9KD 4XOAA 1NM4A 3AM8A 3DYOA 1OQXA 3IPEA 3FUEA 4GQRA 4Y2OA 1T66D 1S7TA 2BMKB 5DJ6A 3Q48A 3U0PA 4F2MB 1F4WH 1XGYL 2HLFD 5T33H 2AQPA 3NIDF 1RSFA 2CK0H 2OMTA 1SEBB 3GNML 3OR7B 4NWUH 1F8TH 1OL0A 5E8OA 2B9BA 2BOLA 2R2EB 4ZXBD 3V0HA 1C08B 2C8NA 4E9YA 3ZDZB 1RZKL 1D5IH 5D1QD 1CE1L 3UOAB 3UTZB 1GPOL 1JPGA 1TMQA 1ZVSA 3DX7A 3VX0A 3RNKA 2A74A 4NN6B 5I0VA 1KTRL 4PP1C 2R1XB 3FQ1A 1MCPL 3QNYA 3TYGH 1QFUH 1CDHA 2HG5B 1DVFA 3FH7A 4JANA 4JN1H 4PJ5E 5DD5H 1JRHI 2A9AA 3W39A 3AS1A 1IM3A 4KAQL 1HK6A 3MLWL 3GBEA 3GUTB 2PN5A 3KWVA 4X42A 1MFEL 1GGIL 1H19A 1YDPA 4FEIA 1S5IL 2NYYD 2EDYA 2QHRH 4KUCF 5EZLA 5HD8C 4LARH 3O9WD 4B0MB 1NKGA 5D7JA 3G6JE 4K3GA 2ZIDA 1C1EL 3D2UB 1I9RH 5CLWA 1NEZB 1TFPA 3HCVB 2ZXEB 1GC1C 5CLTA 4YFEA 1TNNA 3MXVH 4L4JA 1ZDQA 3VSVA 4Q9RL 3SKJH 1HOCA 3RKPA 4ELME 3NJMA 3KCPA 4Y9BA 1W16A 4Y9EA 1YRKA 4GMSH 1PVHA 4BQ8A 5SX5K 4POZD 4HZLA 4RMWA 3T6QC 3NESA 2HT4C 1DVYA 4JLRA 1TJHL 4M6NL 1A21A 1KYUA 5TE4L 3C6LC 3EDFA 4AGMA 4D94A 2J57A 1CN4A 4HHAB 2VDKL 4CN6A 3QIWC 2EO9A 2DYRB 3BP5B 1RZKC 4OM1L 1TKWB 2VWEE 3I2CL 5FYLD 2V9UA 4CVZB 2F54E 1OAUL 3KJ4C 4XPHH 1K2DA 3BN9D 1E9PA 2ALAA 4I8DA 4OFYD 5DC9B 3TC9A 5L88L 2OSLA 5MEPB 5F8RC 3F7YA 1D9KA 4ZUTA 1I3VA 1IQDB 1RCYA 5F1IA 2YAPA 4LVHB 1Q0EA 5BRPA 4PY7A 3BPNC 2DQ6A 3POHA 2GTWA 2O5YH 4M93C 3GLEA 4YDZA 3OJ2C 3O4OC 4Z5RB 2QZQA 3LN4A 2XG4B 3MRLB 1KULA 3HC4L 5I9QB 3T4AC 4EN3B 3EHBB 5F93C 1AMYA 4ZXBA 2F74A 1TEGA 2XKUA 3U7YL 1CGTA 2VXTH 5D1QA 4NENA 1LDPL 5AW0B 4KKBD 2WB1A 1YY8B 4BWTA 3HRZB 2WQRA 3LJ3A 3L3GB 5EG6C 4UU9A 3JYBA 5AKSA 3LAFA 2A9NL 4A55A 3K71B 4HWBL 1DVZA 3MZGB 1CBJA 5DD3H 2IGTA 4FXGB 5E2WL 3T2LA 4KDVA 2W65A 5M7QA 1I7TA 4L9LA 4DERA 2IANE 43CAB 5HHOB 2XXCB 4FQ2H 4HPOH 3JUZA 5CUSH 4F58H 4OD2B 4JDTL 1BEYL 2DQUL 1N59B 2GHZA 2VM4A 2AMGA 3BHBB 5DGQA 4ZSOA 2Z31B 3UJIL 2ICWI 3O9WA 4Z1PA 5KSAA 1QR1A 2ZOWA 5CZVH 4AEHL 1T04A 4MJID 5DFVD 5HJ3B 1I9IH 2XXGA 3MBEC 1KCSH 4HIHA 4MMYB 4LAQL 4RDQF 1JV2B 1E27B 4AI7A 4X99B 4NQEE 5L88H 4JGJA 3CZLA 4J8RA 3FUHA 2ICWB 1WSST 4ZFOB 3COOA 3D3VB 3FT9A 1I9JL 4UIMB 3IMWA 1N10A 5I6PA 3HJEA 2RTTA 5E9NA 1SLVA 3EYQD 4UINH 3H42L 1MELA 2FTAA 5I1GH 3ABGA 1GSMA 1HCFX 4OFYA 1WVZA 4HWNA 1AS6A 4GBXA 1Y1DA 1M7UA 2R15A 5D70H 1T1ZB 4NO5A 2G0KA 3A3YB 3QJRB 4HHWA 3BT0A 5J13B 4NOBA 2JKRM 1LO3H 1NCHA 3FQXB 3C60B 4YNYA 2OJ1A 1A6VL 4U3XA 1E3FA 4PJ5D 4OAWB 4NQDE 3SIKA 1KFGA 4XAKE 2K78A 3TM6A 4ZOAA 5HGDA 4LBEA 1O75A 4M5YL 4Z9KB 4S11A 3TV3H 4I13B 4HPYH 3QIUC 4OQTL 4YOKA 1EANA 3MRNB 3E38A 4FQJH 3MRHA 3QULA 4L18A 4RNRA 4JPWH 1GIGL 1W2KT 3IWVA 1H5BB 3WFEL 1TJGH 5LBGA 2OW7A 4QNPE 5HPMA 4FRWA 3DX8A 3V4VA 4I18B 4H7VA 2UWEF 3HG4A 4OLXH 3B5TA 3QFDB 5AW4B 3WD5L 2DM4A 5D7IA 3OHXA 5LN4A 2Z0BA 4W9LC 5CP7A 2WLIB 1NCBL 3ZL4H 3CZFA 2FB4L 4MRCA 3D4YA 4OV5A 4XP9L 5E8EB 5K9QG 1ACXA 4MJIA 4TUOB 1NL0L 2F54D 2MOQA 2UX6A 4MD0B 4OB5H 1AD9B 3U4BH 4LBAA 5FHBH 2VDRL 3VSQA 4CN4A 1Z9NA 3FB6B 3WHE1 2GIYA 1HH6A 3R19A 2O6PA 4JG1H 3C6SB 2APBA 4X80H 2AGJL 2ZWSA 1KGUA 4JZJB 4GW1B 1L7TL 4A67A 1UD6A 4C56B 2CJUL 2YUZA 3HVDA 5EH1A 5EPMB 5DYFA 1DO6A 4U1LA 1YMHB 4HIQA 2FYYA 3T1FA 1KXTB 4HCRH 1B4JH 1MH5A 3FAWA 3K7UA 3NSJA 4UOW0 3QZWG 4MZIA 1UATA 4Y16C 4PRAB 5TQ2L 4IIQC 4YDVA 4IDJH 2PCYA 4MNQA 3T2NH 3U4KA 1UM6L 3BVDB 2CIKA 1WS8A 5J6GA 3ZYJA 5T3ZH 2DYPB 4F15B 1Q94A 4PJ5A 1J1OH 1GS7A 3GC3A 1EBAA 1FV1A 2YO3A 5DJDB 1X5AA 1HZHH 4F20A 3HNVH 2P5WB 3RNQB 2IAND 3R06B 3CU7A 2GC7C 1MUJA 4TUJB 1TQVA 3TGXA 4JJ5A 4N8VG 3H9HB 4LHJB 2G30A 2OS7A 1HNGA 2IBGA 3DUUA 5C09A 4WO0A 4KROD 2VE6B 4QRAA 2NY7L 3P2DA 4QGTA 1PNDA 2ADGA 3WFCH 4NQSA 4NUGH 2UXTA 3OKNB 4JZOA 4NQED 2BNQB 1LILA 5HI5D 4IBSA 3CDCA 5AD0B 5E6IB 4ERSH 3WNOA 2IV8A 5ID1A 3KBHE 3NSCA 4EI6B 2VC2H 1KB5L 3S3DB 1F90H 4YHZH 4BD4A 2AANA 4KHTH 4W9JC 4HK3J 5EUOF 5C0FB 1GYVA 4PJ7F 5FWRA 4DP9X 2XN9B 3CSFA 5CMAA 1IQWH 1XCQA 3TT1L 4ZFGL 2BZ7A 4AK1A 4NO3B 1DYZA 1ZLVH 5HDBF 1KCRL 4MCYA 5DUMH 4P2QB 5GQBA 1JZ3A 4IS6A 4X8XA 3FF8A 2OYPA 4LIQH 2B4CH 2HFTA 4RLDA 4LCYA 1W15A 4L3CB 5CJ5A 4QCIA 3AVEA 4NQDD 4ADIA 4XAKD 1KB9J 4UQ2A 5DUBB 1X7TA 4OZHF 2X9ZA 4XZ4A 1FRGL 3WN5A 2FSEA 4RFEA 3FU9A 3STBA 3X14B 1AGDB 2IAMC 2YPVL 4ONHB 1DQLH 2DTMH 3ESUF 2VQ1B 1DANT 5F1NA 1KBBA 2VDMB 1HH9A 2ARWA 4TVPL 2JKLA 2XVKA 5LNEA 1WBZB 4V11A 4G6FD 3QUGA 1DJHA 2NY6B 2YWZA 1S9VA 4PJBF 5GGSY 1WBYB 1KNOB 3RHWK 3AQYA 3QEGH 4P4KB 3ULVE 4JFZH 3BKCH 2D9QB 4G6JH 1NMCC 3WUWA 3FN0L 4M6MH 1FG9C 2BS9A 4MA8H 1RU9H 5EEUA 2B1AH 3GSUB 2HVBA 3LH8A 4ZDHA 3EOTH 3MGTB 35C8H 5IK3B 5L7XH 1QEWA 1UT9A 3GKZA 1KGYE 3CXDL 4NQEA 3BWUF 3BGFC 4AQAB 4A7UA 4AIZB 2FJHB 2LLLA 4NRYB 3LS5L 4TSBL 1AYOA 2E86A 2OMXB 2UVEA 3QDJE 4XPBH 4PWJA 3MXWH 4A7SA 3S98A 2DQMA 1QI5A