4B6CA

Structure of the m. smegmatis gyrb atpase domain in complex with an aminopyrazinamide
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
168
structure length
161
Chain Sequence
STGERGLHHLIWEVVDNAVDEAMAGFATRVDVKIHADGSVEVRDDGRGIPVPTIDVVMTQVGVSVVNALSTRLEATVLRDGYEWFQYYDRSVPGKLKQGGETKETGTTIRFWADPEIFETTDYNFETVARRLQEMAFLNKGLTIELTDERDGKHRVFHYPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA gyrase subunit B,DNA gyrase subunit B,DNA gyrase subunit
publication title Aminopyrazinamides: novel and specific GyrB inhibitors that kill replicating and nonreplicating Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Isomerase
total genus 46
structure length 161
sequence length 168
chains with identical sequence B
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 4b6cA00
2YGAA 4FCQA 2BU2A 3B28A 2E0AA 3JZ3A 1AJ6A 4U7NA 3T0HA 2FYPA 4BAEA 4AWQA 4HYMA 2Q8HA 3C0EA 4QPJA 2QF6A 3PEJA 2XHRA 1AM1A 4L8ZA 2YKIA 3Q5LA 4MP2A 4JQLA 2YKEA 1I58A 1Y8OA 4R1FA 4I3HA 3O2FA 3T0ZA 3KE6A 2Q8GA 5CF0A 2YE3A 3GIEA 1B63A 5D6QA 3ZKDA 1YT1A 4FMTA 2YEBA 5CTUA 4CE1A 4X9LA 1UYLA 2VW5A 3GIGB 2YEJA 2YI6A 2CGFA 4GT8A 2IWUA 4O05A 2HKJA 4MOTA 4K4OA 2BYHA 4BQJA 1US7A 3A0YA 4EM7A 2VWCA 2IWXA 4CWRA 1KZNA 3QTFA 1TC6A 3TZ2A 4URMA 3A0RA 4R3MA 2YJXA 5M4HA 3INXA 4GFNA 2QG0A 3TTZA 4P8OA 2XJGA 4O09A 3TZ5A 2WEQA 4URNA 3A0XA 2BU6A 4CWTA 4BIUA 1UYCA 5F5RA 2ESAA 4W7TA 2JJCA 1EI1A 2CG9A 1KIJA 2YK9A 2ZDYA 3BM9A 2K5BA 3VHDA 3T1KA 2JKIA 4O07A 2BU5A 3R92A 3EKRA 4HY1A 5BOCA 1I59A 3U2KA 3A0WA 1TILA 3OPDA 4FPPA 2CCUA 1YT2A 3R4NA 3ZM7A 4E02A 2WI1A 4ZVIA 4EGIA 1ZWHA 4XIPA 1Y4SA 1Y4UA 4XKKA 5M4KA 1GJVA 4H85A 1TBWA 5CPHA 4GEEA 5D6PA 3IEDA 3U2DA 3PEHA 4Q20A 4UROA 3B24A 4XKOA 3HYYA 3GIGA 4EMVA 4KSHA 4WUDA 4ASAA 4NH9A 2IOQA 3H80A 2XHTA 4I5SA 1S16A 3CRLA 4JASA 4O0BA 4V25A 4CWSA 2YK2A 4B7PA 4MPEA 1ID0A 3G75A 1NHIA 5M4MA 5D7RA 4ASGA 3Q5KA 2HCHA 3TZ0A 4AWOA 2WI2A 4CWQA 1NHJA 4CE3A 1BYQA 1ZW9A 4MPCA 2ZKJA 4E00A 1UYHA 4YKUA 4LWFA 4CWPA 4QPKA 4YKXA 1UY7A 4FCPA 1UY8A 3O6OA 2EXLA 2ZDXA 3T2SA 5IN9A 3FT8A 1YC4A 4JAVA 3VHCA 3GIFA 2YEIA 3H4LA 4XD8A 4JAUA 2YE4A 3Q5JA 3R4OA 1B3QA 2YGEA 1TC0A 4LPBA 1Z5CA 3SL2A 3RLQA 2XHXA 2IWSA 3ZKBA 1YT0A 1H7SA 3K99A 4FCRA 1Y8PA 2XDSA 5FWKA 1YS3A 2IOPA 4GQTA 2CCSA 3G7BA 1UYIA 2O1UA 1R62A 5GGZA 5M4PA 2YI7A 2WI3A 5FNFA 1AH8A 4V26A 4YKQA 4L94A 4O04A 5CTYA 1Z59A 1YC1A 4P7AA 3HZ1A 2YJWA 2WI7A 4XDMA 4URLA 1THNA 2WERA 4XKAA 4MPNA 4EEHA 1YETA 5J71A 1GKZA 4HZ0A 1UYKA 4L91A 3DGEA 4GCZA 4PU9A 1PVGA 4WUBA 1QYEA 4LP0A 2YEFA 5CTWA 2H8MA 1UYGA 1BXDA 4AWPA 4L90A 5D7DA 2FWZA 5F3KA 3HYZA 4KQVA 4B6CA 2BRCA 2XDUA 3EHGA 2XD6A 5BODA 4KSGA 2YEEA 1NHHA 1ZXMA 4U7OA 3MNRP 4MP7A 5J6AA 1U2OA 3HEKA 3HHUA 3VHAA 3R4MA 2YGFA 3B25A 1I5DA 1I5BA 2VCJA 1BKNA 4WUCA 1JM6A 3BMYA 1S14A 1UYEA 3CGZA 3QDDA 2BSMA 1UYDA 1EA6A 3R91A 4DUHA 1YERA 3B26A 4BQGA 4CWFA 2BU7A 3TUHA 2XJXA 1B62A 2Q8FA 1UYMA 3EHHA 1YSZA 3RLRA 3CGYA 2XDKA 1MU5A 2WI4A 2YE7A 3FT5A 2O1VA 2XDLA 1YC3A 4CE2A 4EFTA 3R4PA 3C11A 2WI6A 2UWDA 3FV5A 1YSRA 2WI5A 3OWDA 4BIZA 4EFUA 2BYIA 4XE2A 4YKWA 2YEDA 2YEAA 2XX5A 1H7UA 2XJJA 2XABA 4XTJA 2C2AA 1I5CA 2ZBKB 4KTNA 2YE8A 2FWYA 1YESA 2YEHA 1GKXA 2YKJA 3A0ZA 1Y8NA 3LPSA 2XK2A 3A0TA 4HYPA 3TZ4A 2AKPA 2YKBA 3INWA 4H81A 3OWBA 5IDJA 1L0OA 1OSFA 1TIDA 4NH8A 4CWOA 2YEGA 2YE2A 4AS9A 3CRKA 2XDXA 2CCTA 2BT0A 5CTXA 3OW6A 4YKRA 4E01A 4PRXA 3U67A 2FXSA 4BXIA 3D2RA 1ZXNA 5L3JA 4KFGA 1TH8A 4MB9A 2Q2EB 4NH7A 2GQPA 4YKYA 3RLPA 4YKZA 4EGKA 4XITA 1QY8A 4PRVA 2YE6A 3HZ5A 5D7CA 1BGQA 1I5AA 2WEPA 5M4NA 3K60A 3ZXQA 3EHJA 4GGLA 2H55A 1U0ZA 3VADA 3K97A 1MX0A 2XX4A 1UYFA 5FNDA 5IDMA 4HXWA 4HY6A 4H7QA 4ASBA 4PL9A 4HXZA 1A4HA 1QZRA 3D36A 4XC0A 1Z5AA 2VCIA 3ZXOA 4EGHA 2QG2A 4ZKIA 3CWVA 3K98A 3EHFA 3OMUA 2O1WA 1AH6A 2HG1A 3G7EA 2YECA 4MBCA 4LWHA 2IORA 2Q8IA 4CWNA 1UY9A 4U93A 4XIRA 5C93A 4HZ5A 4YKTA 4ASFA 3WHAA 4XCJA 2BZ5A 4LWGA 2YI0A 4DZYA 4XIQA 4L93A 4LWEA 2QFOA 2YKCA 3O0IA 2PNRA 3EKOA 2BU8A 1AMWA 4R3AA 2YE5A 5FNCA 1UY6A 2XCMA 3LNUA 3RKZA 4KP4A 5M4EA 2YE9A 3NMQA 1Z5BA 2YI5A 3B27A 4LWIA 3WQ9A 2CH4A 4XCLA 2BREA 2BTZA 2GFDA 3D0BA 2XX2A 3T10A
chains in the Genus database with same CATH superfamily
2YGAA 4FCQA 2BU2A 3B28A 2E0AA 3JZ3A 1AJ6A 4U7NA 3T0HA 2FYPA 4BAEA 4AWQA 4HYMA 2Q8HA 3C0EA 4QPJA 2QF6A 3PEJA 2XHRA 1AM1A 4L8ZA 2YKIA 3Q5LA 4MP2A 4JQLA 2YKEA 1I58A 1Y8OA 4R1FA 4I3HA 3O2FA 3T0ZA 3KE6A 2Q8GA 5CF0A 2YE3A 3GIEA 1B63A 5D6QA 3ZKDA 2C1GA 1YT1A 4FMTA 2YEBA 5CTUA 4CE1A 4X9LA 1UYLA 2C1IA 2VW5A 3GIGB 2YEJA 2YI6A 2CGFA 4GT8A 2IWUA 4O05A 2HKJA 4MOTA 4K4OA 2BYHA 4BQJA 1US7A 3A0YA 4EM7A 2VWCA 2IWXA 4CWRA 1KZNA 3QTFA 1TC6A 3TZ2A 4URMA 3A0RA 4R3MA 2YJXA 5M4HA 3INXA 4GFNA 2QG0A 3TTZA 4P8OA 2XJGA 4O09A 3TZ5A 2WEQA 4URNA 3A0XA 2BU6A 4CWTA 4BIUA 1UYCA 5F5RA 2ESAA 4W7TA 2JJCA 1EI1A 2CG9A 1KIJA 2YK9A 2ZDYA 3BM9A 2K5BA 3VHDA 3T1KA 2JKIA 4O07A 2BU5A 3R92A 3EKRA 4HY1A 5BOCA 1I59A 3U2KA 3A0WA 1TILA 3OPDA 4FPPA 2CCUA 1YT2A 3R4NA 3ZM7A 4E02A 2WI1A 4ZVIA 4EGIA 1ZWHA 4XIPA 1Y4SA 1Y4UA 4XKKA 5M4KA 1GJVA 4H85A 1TBWA 5CPHA 4GEEA 5D6PA 3IEDA 3U2DA 3PEHA 4Q20A 4UROA 3B24A 4XKOA 3HYYA 3GIGA 4EMVA 4KSHA 4WUDA 4ASAA 4NH9A 2IOQA 3H80A 2XHTA 4I5SA 1S16A 3CRLA 4JASA 4O0BA 4V25A 4CWSA 2YK2A 4B7PA 4MPEA 1ID0A 3G75A 1NHIA 5M4MA 5D7RA 4ASGA 3Q5KA 2HCHA 3TZ0A 4AWOA 2WI2A 4CWQA 1NHJA 4CE3A 1BYQA 1ZW9A 4MPCA 2ZKJA 4E00A 1UYHA 4YKUA 4LWFA 4CWPA 4QPKA 4YKXA 1UY7A 4FCPA 1UY8A 3O6OA 2EXLA 2ZDXA 3T2SA 5IN9A 3FT8A 1YC4A 4JAVA 3VHCA 3GIFA 2YEIA 3H4LA 4XD8A 4JAUA 2YE4A 3Q5JA 3R4OA 1B3QA 2YGEA 1TC0A 4LPBA 1Z5CA 3SL2A 3RLQA 3S5TA 2XHXA 2IWSA 3ZKBA 1YT0A 1H7SA 3K99A 4FCRA 1Y8PA 2XDSA 5FWKA 1YS3A 2IOPA 4GQTA 2CCSA 3G7BA 1UYIA 2O1UA 1R62A 5GGZA 5M4PA 2YI7A 2WI3A 5FNFA 1AH8A 4V26A 4YKQA 4L94A 4O04A 5CTYA 1Z59A 1YC1A 4P7AA 3HZ1A 1F51A 2YJWA 2WI7A 4XDMA 4URLA 1THNA 2WERA 4XKAA 4MPNA 4EEHA 1YETA 5J71A 1GKZA 4HZ0A 1UYKA 4L91A 3DGEA 4GCZA 4PU9A 1PVGA 4WUBA 1QYEA 4LP0A 2YEFA 5CTWA 2H8MA 1UYGA 1BXDA 4AWPA 4L90A 5D7DA 2FWZA 5F3KA 3HYZA 4KQVA 4B6CA 2BRCA 2XDUA 3EHGA 2XD6A 5BODA 4KSGA 2YEEA 1NHHA 1ZXMA 4U7OA 3MNRP 4MP7A 5J6AA 1U2OA 3HEKA 1IXMA 3HHUA 3VHAA 3R4MA 3CYGA 2YGFA 3B25A 1I5DA 1I5BA 2VCJA 1BKNA 4WUCA 1JM6A 3BMYA 1S14A 1UYEA 3CGZA 3QDDA 2BSMA 1UYDA 2FTKA 1EA6A 3R91A 4DUHA 1YERA 3B26A 4BQGA 4CWFA 2BU7A 3TUHA 2XJXA 1B62A 2Q8FA 1UYMA 3EHHA 1YSZA 3RLRA 3CGYA 2XDKA 1MU5A 2WI4A 2YE7A 3FT5A 2O1VA 2XDLA 1YC3A 4CE2A 4EFTA 3R4PA 3C11A 2WI6A 2UWDA 3FV5A 1YSRA 2WI5A 3OWDA 4BIZA 4EFUA 2BYIA 4XE2A 4YKWA 2YEDA 2YEAA 2XX5A 1H7UA 2XJJA 2XABA 4XTJA 2C2AA 1I5CA 2ZBKB 4KTNA 2YE8A 2FWYA 1YESA 2YEHA 1GKXA 2YKJA 3A0ZA 1Y8NA 3LPSA 2XK2A 3A0TA 4HYPA 3TZ4A 2AKPA 2YKBA 3INWA 4H81A 3OWBA 5IDJA 1L0OA 1OSFA 1TIDA 4NH8A 4CWOA 2YEGA 2YE2A 4AS9A 3CRKA 2XDXA 2CCTA 2BT0A 5CTXA 3OW6A 4YKRA 4E01A 4PRXA 3U67A 2FXSA 4BXIA 3D2RA 1ZXNA 5L3JA 4KFGA 1TH8A 4MB9A 2Q2EB 4NH7A 2GQPA 4YKYA 3RLPA 4YKZA 4EGKA 4XITA 1QY8A 4PRVA 2YE6A 3HZ5A 5D7CA 1BGQA 1I5AA 3LMMA 2WEPA 5M4NA 3K60A 3ZXQA 3EHJA 4GGLA 2H55A 1U0ZA 3VADA 5JENA 3K97A 1MX0A 2XX4A 1UYFA 5FNDA 5IDMA 4HXWA 4HY6A 4H7QA 4ASBA 4PL9A 4HXZA 1A4HA 1QZRA 3D36A 4XC0A 1Z5AA 2VCIA 3ZXOA 4EGHA 2QG2A 4ZKIA 3CWVA 3K98A 3EHFA 3OMUA 2O1WA 1AH6A 2HG1A 3G7EA 2YECA 4MBCA 4LWHA 2IORA 2Q8IA 4CWNA 1UY9A 4U93A 4XIRA 5C93A 4HZ5A 4YKTA 4ASFA 3WHAA 4XCJA 2BZ5A 4LWGA 2YI0A 4DZYA 4XIQA 4L93A 4LWEA 2QFOA 2YKCA 3O0IA 2PNRA 3EKOA 2BU8A 1AMWA 4R3AA 2YE5A 5FNCA 1UY6A 2XCMA 3LNUA 3RKZA 4KP4A 5M4EA 2YE9A 3NMQA 1Z5BA 2YI5A 3B27A 4LWIA 3WQ9A 2HHIA 2CH4A 4XCLA 4E72A 2BREA 2BTZA 2GFDA 3D0BA 2XX2A 3T10A
chains in the Genus database with same CATH topology
2YGAA 4FCQA 2BU2A 3B28A 2E0AA 3JZ3A 1AJ6A 4U7NA 3T0HA 2FYPA 4BAEA 4AWQA 4HYMA 2Q8HA 3C0EA 4QPJA 2QF6A 3PEJA 2XHRA 1AM1A 4L8ZA 2YKIA 3Q5LA 4MP2A 4JQLA 2YKEA 1I58A 1Y8OA 4R1FA 4I3HA 3O2FA 3T0ZA 3KE6A 2Q8GA 5CF0A 2YE3A 3GIEA 1B63A 5D6QA 3ZKDA 1YT1A 4FMTA 2YEBA 5CTUA 4CE1A 4X9LA 1UYLA 2VW5A 3GIGB 2YEJA 2YI6A 2CGFA 4GT8A 2IWUA 4O05A 2HKJA 4MOTA 4K4OA 2BYHA 4BQJA 1US7A 3A0YA 4EM7A 2VWCA 2IWXA 4CWRA 1KZNA 3QTFA 1TC6A 3TZ2A 4URMA 3A0RA 4R3MA 2YJXA 5M4HA 3INXA 4GFNA 2QG0A 3TTZA 4P8OA 2XJGA 4O09A 3TZ5A 2WEQA 4URNA 3A0XA 2BU6A 4CWTA 4BIUA 1UYCA 5F5RA 2ESAA 4W7TA 2JJCA 1EI1A 2CG9A 1KIJA 2YK9A 2ZDYA 3BM9A 2K5BA 3VHDA 3T1KA 2JKIA 4O07A 2BU5A 3R92A 3EKRA 4HY1A 5BOCA 1I59A 3U2KA 3A0WA 1TILA 3OPDA 4FPPA 2CCUA 1YT2A 3R4NA 3ZM7A 4E02A 2WI1A 4ZVIA 4EGIA 1ZWHA 4XIPA 1Y4SA 1Y4UA 4XKKA 5M4KA 1GJVA 4H85A 1TBWA 5CPHA 4GEEA 5D6PA 3IEDA 3U2DA 3PEHA 4Q20A 4UROA 3B24A 4XKOA 3HYYA 3GIGA 4EMVA 4KSHA 4WUDA 4ASAA 4NH9A 2IOQA 3H80A 2XHTA 4I5SA 1S16A 3CRLA 4JASA 4O0BA 4V25A 4CWSA 2YK2A 4B7PA 4MPEA 1ID0A 3G75A 1NHIA 5M4MA 5D7RA 4ASGA 3Q5KA 2HCHA 3TZ0A 4AWOA 2WI2A 4CWQA 1NHJA 4CE3A 1BYQA 1ZW9A 4MPCA 2ZKJA 4E00A 1UYHA 4YKUA 4LWFA 4CWPA 4QPKA 4YKXA 1UY7A 4FCPA 1UY8A 3O6OA 2EXLA 2ZDXA 3T2SA 5IN9A 3FT8A 1YC4A 4JAVA 3VHCA 3GIFA 2YEIA 3H4LA 4XD8A 4JAUA 2YE4A 3Q5JA 3R4OA 1B3QA 2YGEA 1TC0A 4LPBA 1Z5CA 3SL2A 3RLQA 2XHXA 2IWSA 3ZKBA 1YT0A 1H7SA 3K99A 4FCRA 1Y8PA 2XDSA 5FWKA 1YS3A 2IOPA 4GQTA 2CCSA 3G7BA 1UYIA 2O1UA 1R62A 5GGZA 5M4PA 2YI7A 2WI3A 5FNFA 1AH8A 4V26A 4YKQA 4L94A 4O04A 5CTYA 1Z59A 1YC1A 4P7AA 3HZ1A 2YJWA 2WI7A 4XDMA 4URLA 1THNA 2WERA 4XKAA 4MPNA 4EEHA 1YETA 5J71A 1GKZA 4HZ0A 1UYKA 4L91A 3DGEA 4GCZA 4PU9A 1PVGA 4WUBA 1QYEA 4LP0A 2YEFA 5CTWA 2H8MA 1UYGA 1BXDA 4AWPA 4L90A 5D7DA 2FWZA 5F3KA 3HYZA 4KQVA 4B6CA 2BRCA 2XDUA 3EHGA 2XD6A 5BODA 4KSGA 2YEEA 1NHHA 1ZXMA 4U7OA 3MNRP 4MP7A 5J6AA 1U2OA 3HEKA 3HHUA 3VHAA 3R4MA 2YGFA 3B25A 1I5DA 1I5BA 2VCJA 1BKNA 4WUCA 1JM6A 3BMYA 1S14A 1UYEA 3CGZA 3QDDA 2BSMA 1UYDA 1EA6A 3R91A 4DUHA 1YERA 3B26A 4BQGA 4CWFA 2BU7A 3TUHA 2XJXA 1B62A 2Q8FA 1UYMA 3EHHA 1YSZA 3RLRA 3CGYA 2XDKA 1MU5A 2WI4A 2YE7A 3FT5A 2O1VA 2XDLA 1YC3A 4CE2A 4EFTA 3R4PA 3C11A 2WI6A 2UWDA 3FV5A 1YSRA 2WI5A 3OWDA 4BIZA 4EFUA 2BYIA 4XE2A 4YKWA 2YEDA 2YEAA 2XX5A 1H7UA 2XJJA 2XABA 4XTJA 2C2AA 1I5CA 2ZBKB 4KTNA 2YE8A 2FWYA 1YESA 2YEHA 1GKXA 2YKJA 3A0ZA 1Y8NA 3LPSA 2XK2A 3A0TA 4HYPA 3TZ4A 2AKPA 2YKBA 3INWA 4H81A 3OWBA 5IDJA 1L0OA 1OSFA 1TIDA 4NH8A 4CWOA 2YEGA 2YE2A 4AS9A 3CRKA 2XDXA 2CCTA 2BT0A 5CTXA 3OW6A 4YKRA 4E01A 4PRXA 3U67A 2FXSA 4BXIA 3D2RA 1ZXNA 5L3JA 4KFGA 1TH8A 4MB9A 2Q2EB 4NH7A 2GQPA 4YKYA 3RLPA 4YKZA 4EGKA 4XITA 1QY8A 4PRVA 2YE6A 3HZ5A 5D7CA 1BGQA 1I5AA 2WEPA 5M4NA 3K60A 3ZXQA 3EHJA 4GGLA 2H55A 1U0ZA 3VADA 3K97A 1MX0A 2XX4A 1UYFA 5FNDA 5IDMA 4HXWA 4HY6A 4H7QA 4ASBA 4PL9A 4HXZA 1A4HA 1QZRA 3D36A 4XC0A 1Z5AA 2VCIA 3ZXOA 4EGHA 2QG2A 4ZKIA 3CWVA 3K98A 3EHFA 3OMUA 2O1WA 1AH6A 2HG1A 3G7EA 2YECA 4MBCA 4LWHA 2IORA 2Q8IA 4CWNA 1UY9A 4U93A 4XIRA 5C93A 4HZ5A 4YKTA 4ASFA 3WHAA 4XCJA 2BZ5A 4LWGA 2YI0A 4DZYA 4XIQA 4L93A 4LWEA 2QFOA 2YKCA 3O0IA 2PNRA 3EKOA 2BU8A 1AMWA 4R3AA 2YE5A 5FNCA 1UY6A 2XCMA 3LNUA 3RKZA 4KP4A 5M4EA 2YE9A 3NMQA 1Z5BA 2YI5A 3B27A 4LWIA 3WQ9A 2CH4A 4XCLA 2BREA 2BTZA 2GFDA 3D0BA 2XX2A 3T10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YGA A;  4FCQ A;  2BU2 A;  3B28 A;  2E0A A;  3JZ3 A;  1AJ6 A;  4U7N A;  3T0H A;  2FYP A;  4BAE A;  4AWQ A;  4HYM A;  2Q8H A;  3C0E A;  4QPJ A;  2QF6 A;  3PEJ A;  2XHR A;  1AM1 A;  4L8Z A;  2YKI A;  3Q5L A;  4MP2 A;  4JQL A;  2YKE A;  1I58 A;  1Y8O A;  4R1F A;  4I3H A;  3O2F A;  3T0Z A;  3KE6 A;  2Q8G A;  5CF0 A;  2YE3 A;  3GIE A;  1B63 A;  5D6Q A;  3ZKD A;  1YT1 A;  4FMT A;  2YEB A;  5CTU A;  4CE1 A;  4X9L A;  1UYL A;  2VW5 A;  3GIG B;  2YEJ A;  2YI6 A;  2CGF A;  4GT8 A;  2IWU A;  4O05 A;  2HKJ A;  4MOT A;  4K4O A;  2BYH A;  4BQJ A;  1US7 A;  3A0Y A;  4EM7 A;  2VWC A;  2IWX A;  4CWR A;  1KZN A;  3QTF A;  1TC6 A;  3TZ2 A;  4URM A;  3A0R A;  4R3M A;  2YJX A;  5M4H A;  3INX A;  4GFN A;  2QG0 A;  3TTZ A;  4P8O A;  2XJG A;  4O09 A;  3TZ5 A;  2WEQ A;  4URN A;  3A0X A;  2BU6 A;  4CWT A;  4BIU A;  1UYC A;  5F5R A;  2ESA A;  4W7T A;  2JJC A;  1EI1 A;  2CG9 A;  1KIJ A;  2YK9 A;  2ZDY A;  3BM9 A;  2K5B A;  3VHD A;  3T1K A;  2JKI A;  4O07 A;  2BU5 A;  3R92 A;  3EKR A;  4HY1 A;  5BOC A;  1I59 A;  3U2K A;  3A0W A;  1TIL A;  3OPD A;  4FPP A;  2CCU A;  1YT2 A;  3R4N A;  3ZM7 A;  4E02 A;  2WI1 A;  4ZVI A;  4EGI A;  1ZWH A;  4XIP A;  1Y4S A;  1Y4U A;  4XKK A;  5M4K A;  1GJV A;  4H85 A;  1TBW A;  5CPH A;  4GEE A;  5D6P A;  3IED A;  3U2D A;  3PEH A;  4Q20 A;  4URO A;  3B24 A;  4XKO A;  3HYY A;  3GIG A;  4EMV A;  4KSH A;  4WUD A;  4ASA A;  4NH9 A;  2IOQ A;  3H80 A;  2XHT A;  4I5S A;  1S16 A;  3CRL A;  4JAS A;  4O0B A;  4V25 A;  4CWS A;  2YK2 A;  4B7P A;  4MPE A;  1ID0 A;  3G75 A;  1NHI A;  5M4M A;  5D7R A;  4ASG A;  3Q5K A;  2HCH A;  3TZ0 A;  4AWO A;  2WI2 A;  4CWQ A;  1NHJ A;  4CE3 A;  1BYQ A;  1ZW9 A;  4MPC A;  2ZKJ A;  4E00 A;  1UYH A;  4YKU A;  4LWF A;  4CWP A;  4QPK A;  4YKX A;  1UY7 A;  4FCP A;  1UY8 A;  3O6O A;  2EXL A;  2ZDX A;  3T2S A;  5IN9 A;  3FT8 A;  1YC4 A;  4JAV A;  3VHC A;  3GIF A;  2YEI A;  3H4L A;  4XD8 A;  4JAU A;  2YE4 A;  3Q5J A;  3R4O A;  1B3Q A;  2YGE A;  1TC0 A;  4LPB A;  1Z5C A;  3SL2 A;  3RLQ A;  2XHX A;  2IWS A;  3ZKB A;  1YT0 A;  1H7S A;  3K99 A;  4FCR A;  1Y8P A;  2XDS A;  5FWK A;  1YS3 A;  2IOP A;  4GQT A;  2CCS A;  3G7B A;  1UYI A;  2O1U A;  1R62 A;  5GGZ A;  5M4P A;  2YI7 A;  2WI3 A;  5FNF A;  1AH8 A;  4V26 A;  4YKQ A;  4L94 A;  4O04 A;  5CTY A;  1Z59 A;  1YC1 A;  4P7A A;  3HZ1 A;  2YJW A;  2WI7 A;  4XDM A;  4URL A;  1THN A;  2WER A;  4XKA A;  4MPN A;  4EEH A;  1YET A;  5J71 A;  1GKZ A;  4HZ0 A;  1UYK A;  4L91 A;  3DGE A;  4GCZ A;  4PU9 A;  1PVG A;  4WUB A;  1QYE A;  4LP0 A;  2YEF A;  5CTW A;  2H8M A;  1UYG A;  1BXD A;  4AWP A;  4L90 A;  5D7D A;  2FWZ A;  5F3K A;  3HYZ A;  4KQV A;  4B6C A;  2BRC A;  2XDU A;  3EHG A;  2XD6 A;  5BOD A;  4KSG A;  2YEE A;  1NHH A;  1ZXM A;  4U7O A;  3MNR P;  4MP7 A;  5J6A A;  1U2O A;  3HEK A;  3HHU A;  3VHA A;  3R4M A;  2YGF A;  3B25 A;  1I5D A;  1I5B A;  2VCJ A;  1BKN A;  4WUC A;  1JM6 A;  3BMY A;  1S14 A;  1UYE A;  3CGZ A;  3QDD A;  2BSM A;  1UYD A;  1EA6 A;  3R91 A;  4DUH A;  1YER A;  3B26 A;  4BQG A;  4CWF A;  2BU7 A;  3TUH A;  2XJX A;  1B62 A;  2Q8F A;  1UYM A;  3EHH A;  1YSZ A;  3RLR A;  3CGY A;  2XDK A;  1MU5 A;  2WI4 A;  2YE7 A;  3FT5 A;  2O1V A;  2XDL A;  1YC3 A;  4CE2 A;  4EFT A;  3R4P A;  3C11 A;  2WI6 A;  2UWD A;  3FV5 A;  1YSR A;  2WI5 A;  3OWD A;  4BIZ A;  4EFU A;  2BYI A;  4XE2 A;  4YKW A;  2YED A;  2YEA A;  2XX5 A;  1H7U A;  2XJJ A;  2XAB A;  4XTJ A;  2C2A A;  1I5C A;  2ZBK B;  4KTN A;  2YE8 A;  2FWY A;  1YES A;  2YEH A;  1GKX A;  2YKJ A;  3A0Z A;  1Y8N A;  3LPS A;  2XK2 A;  3A0T A;  4HYP A;  3TZ4 A;  2AKP A;  2YKB A;  3INW A;  4H81 A;  3OWB A;  5IDJ A;  1L0O A;  1OSF A;  1TID A;  4NH8 A;  4CWO A;  2YEG A;  2YE2 A;  4AS9 A;  3CRK A;  2XDX A;  2CCT A;  2BT0 A;  5CTX A;  3OW6 A;  4YKR A;  4E01 A;  4PRX A;  3U67 A;  2FXS A;  4BXI A;  3D2R A;  1ZXN A;  5L3J A;  4KFG A;  1TH8 A;  4MB9 A;  2Q2E B;  4NH7 A;  2GQP A;  4YKY A;  3RLP A;  4YKZ A;  4EGK A;  4XIT A;  1QY8 A;  4PRV A;  2YE6 A;  3HZ5 A;  5D7C A;  1BGQ A;  1I5A A;  2WEP A;  5M4N A;  3K60 A;  3ZXQ A;  3EHJ A;  4GGL A;  2H55 A;  1U0Z A;  3VAD A;  3K97 A;  1MX0 A;  2XX4 A;  1UYF A;  5FND A;  5IDM A;  4HXW A;  4HY6 A;  4H7Q A;  4ASB A;  4PL9 A;  4HXZ A;  1A4H A;  1QZR A;  3D36 A;  4XC0 A;  1Z5A A;  2VCI A;  3ZXO A;  4EGH A;  2QG2 A;  4ZKI A;  3CWV A;  3K98 A;  3EHF A;  3OMU A;  2O1W A;  1AH6 A;  2HG1 A;  3G7E A;  2YEC A;  4MBC A;  4LWH A;  2IOR A;  2Q8I A;  4CWN A;  1UY9 A;  4U93 A;  4XIR A;  5C93 A;  4HZ5 A;  4YKT A;  4ASF A;  3WHA A;  4XCJ A;  2BZ5 A;  4LWG A;  2YI0 A;  4DZY A;  4XIQ A;  4L93 A;  4LWE A;  2QFO A;  2YKC A;  3O0I A;  2PNR A;  3EKO A;  2BU8 A;  1AMW A;  4R3A A;  2YE5 A;  5FNC A;  1UY6 A;  2XCM A;  3LNU A;  3RKZ A;  4KP4 A;  5M4E A;  2YE9 A;  3NMQ A;  1Z5B A;  2YI5 A;  3B27 A;  4LWI A;  3WQ9 A;  2CH4 A;  4XCL A;  2BRE A;  2BTZ A;  2GFD A;  3D0B A;  2XX2 A;  3T10 A; 
#chains in the Genus database with same CATH topology
 2YGA A;  4FCQ A;  2BU2 A;  3B28 A;  2E0A A;  3JZ3 A;  1AJ6 A;  4U7N A;  3T0H A;  2FYP A;  4BAE A;  4AWQ A;  4HYM A;  2Q8H A;  3C0E A;  4QPJ A;  2QF6 A;  3PEJ A;  2XHR A;  1AM1 A;  4L8Z A;  2YKI A;  3Q5L A;  4MP2 A;  4JQL A;  2YKE A;  1I58 A;  1Y8O A;  4R1F A;  4I3H A;  3O2F A;  3T0Z A;  3KE6 A;  2Q8G A;  5CF0 A;  2YE3 A;  3GIE A;  1B63 A;  5D6Q A;  3ZKD A;  2C1G A;  1YT1 A;  4FMT A;  2YEB A;  5CTU A;  4CE1 A;  4X9L A;  1UYL A;  2C1I A;  2VW5 A;  3GIG B;  2YEJ A;  2YI6 A;  2CGF A;  4GT8 A;  2IWU A;  4O05 A;  2HKJ A;  4MOT A;  4K4O A;  2BYH A;  4BQJ A;  1US7 A;  3A0Y A;  4EM7 A;  2VWC A;  2IWX A;  4CWR A;  1KZN A;  3QTF A;  1TC6 A;  3TZ2 A;  4URM A;  3A0R A;  4R3M A;  2YJX A;  5M4H A;  3INX A;  4GFN A;  2QG0 A;  3TTZ A;  4P8O A;  2XJG A;  4O09 A;  3TZ5 A;  2WEQ A;  4URN A;  3A0X A;  2BU6 A;  4CWT A;  4BIU A;  1UYC A;  5F5R A;  2ESA A;  4W7T A;  2JJC A;  1EI1 A;  2CG9 A;  1KIJ A;  2YK9 A;  2ZDY A;  3BM9 A;  2K5B A;  3VHD A;  3T1K A;  2JKI A;  4O07 A;  2BU5 A;  3R92 A;  3EKR A;  4HY1 A;  5BOC A;  1I59 A;  3U2K A;  3A0W A;  1TIL A;  3OPD A;  4FPP A;  2CCU A;  1YT2 A;  3R4N A;  3ZM7 A;  4E02 A;  2WI1 A;  4ZVI A;  4EGI A;  1ZWH A;  4XIP A;  1Y4S A;  1Y4U A;  4XKK A;  5M4K A;  1GJV A;  4H85 A;  1TBW A;  5CPH A;  4GEE A;  5D6P A;  3IED A;  3U2D A;  3PEH A;  4Q20 A;  4URO A;  3B24 A;  4XKO A;  3HYY A;  3GIG A;  4EMV A;  4KSH A;  4WUD A;  4ASA A;  4NH9 A;  2IOQ A;  3H80 A;  2XHT A;  4I5S A;  1S16 A;  3CRL A;  4JAS A;  4O0B A;  4V25 A;  4CWS A;  2YK2 A;  4B7P A;  4MPE A;  1ID0 A;  3G75 A;  1NHI A;  5M4M A;  5D7R A;  4ASG A;  3Q5K A;  2HCH A;  3TZ0 A;  4AWO A;  2WI2 A;  4CWQ A;  1NHJ A;  4CE3 A;  1BYQ A;  1ZW9 A;  4MPC A;  2ZKJ A;  4E00 A;  1UYH A;  4YKU A;  4LWF A;  4CWP A;  4QPK A;  4YKX A;  1UY7 A;  4FCP A;  1UY8 A;  3O6O A;  2EXL A;  2ZDX A;  3T2S A;  5IN9 A;  3FT8 A;  1YC4 A;  4JAV A;  3VHC A;  3GIF A;  2YEI A;  3H4L A;  4XD8 A;  4JAU A;  2YE4 A;  3Q5J A;  3R4O A;  1B3Q A;  2YGE A;  1TC0 A;  4LPB A;  1Z5C A;  3SL2 A;  3RLQ A;  3S5T A;  2XHX A;  2IWS A;  3ZKB A;  1YT0 A;  1H7S A;  3K99 A;  4FCR A;  1Y8P A;  2XDS A;  5FWK A;  1YS3 A;  2IOP A;  4GQT A;  2CCS A;  3G7B A;  1UYI A;  2O1U A;  1R62 A;  5GGZ A;  5M4P A;  2YI7 A;  2WI3 A;  5FNF A;  1AH8 A;  4V26 A;  4YKQ A;  4L94 A;  4O04 A;  5CTY A;  1Z59 A;  1YC1 A;  4P7A A;  3HZ1 A;  1F51 A;  2YJW A;  2WI7 A;  4XDM A;  4URL A;  1THN A;  2WER A;  4XKA A;  4MPN A;  4EEH A;  1YET A;  5J71 A;  1GKZ A;  4HZ0 A;  1UYK A;  4L91 A;  3DGE A;  4GCZ A;  4PU9 A;  1PVG A;  4WUB A;  1QYE A;  4LP0 A;  2YEF A;  5CTW A;  2H8M A;  1UYG A;  1BXD A;  4AWP A;  4L90 A;  5D7D A;  2FWZ A;  5F3K A;  3HYZ A;  4KQV A;  4B6C A;  2BRC A;  2XDU A;  3EHG A;  2XD6 A;  5BOD A;  4KSG A;  2YEE A;  1NHH A;  1ZXM A;  4U7O A;  3MNR P;  4MP7 A;  5J6A A;  1U2O A;  3HEK A;  1IXM A;  3HHU A;  3VHA A;  3R4M A;  3CYG A;  2YGF A;  3B25 A;  1I5D A;  1I5B A;  2VCJ A;  1BKN A;  4WUC A;  1JM6 A;  3BMY A;  1S14 A;  1UYE A;  3CGZ A;  3QDD A;  2BSM A;  1UYD A;  2FTK A;  1EA6 A;  3R91 A;  4DUH A;  1YER A;  3B26 A;  4BQG A;  4CWF A;  2BU7 A;  3TUH A;  2XJX A;  1B62 A;  2Q8F A;  1UYM A;  3EHH A;  1YSZ A;  3RLR A;  3CGY A;  2XDK A;  1MU5 A;  2WI4 A;  2YE7 A;  3FT5 A;  2O1V A;  2XDL A;  1YC3 A;  4CE2 A;  4EFT A;  3R4P A;  3C11 A;  2WI6 A;  2UWD A;  3FV5 A;  1YSR A;  2WI5 A;  3OWD A;  4BIZ A;  4EFU A;  2BYI A;  4XE2 A;  4YKW A;  2YED A;  2YEA A;  2XX5 A;  1H7U A;  2XJJ A;  2XAB A;  4XTJ A;  2C2A A;  1I5C A;  2ZBK B;  4KTN A;  2YE8 A;  2FWY A;  1YES A;  2YEH A;  1GKX A;  2YKJ A;  3A0Z A;  1Y8N A;  3LPS A;  2XK2 A;  3A0T A;  4HYP A;  3TZ4 A;  2AKP A;  2YKB A;  3INW A;  4H81 A;  3OWB A;  5IDJ A;  1L0O A;  1OSF A;  1TID A;  4NH8 A;  4CWO A;  2YEG A;  2YE2 A;  4AS9 A;  3CRK A;  2XDX A;  2CCT A;  2BT0 A;  5CTX A;  3OW6 A;  4YKR A;  4E01 A;  4PRX A;  3U67 A;  2FXS A;  4BXI A;  3D2R A;  1ZXN A;  5L3J A;  4KFG A;  1TH8 A;  4MB9 A;  2Q2E B;  4NH7 A;  2GQP A;  4YKY A;  3RLP A;  4YKZ A;  4EGK A;  4XIT A;  1QY8 A;  4PRV A;  2YE6 A;  3HZ5 A;  5D7C A;  1BGQ A;  1I5A A;  3LMM A;  2WEP A;  5M4N A;  3K60 A;  3ZXQ A;  3EHJ A;  4GGL A;  2H55 A;  1U0Z A;  3VAD A;  5JEN A;  3K97 A;  1MX0 A;  2XX4 A;  1UYF A;  5FND A;  5IDM A;  4HXW A;  4HY6 A;  4H7Q A;  4ASB A;  4PL9 A;  4HXZ A;  1A4H A;  1QZR A;  3D36 A;  4XC0 A;  1Z5A A;  2VCI A;  3ZXO A;  4EGH A;  2QG2 A;  4ZKI A;  3CWV A;  3K98 A;  3EHF A;  3OMU A;  2O1W A;  1AH6 A;  2HG1 A;  3G7E A;  2YEC A;  4MBC A;  4LWH A;  2IOR A;  2Q8I A;  4CWN A;  1UY9 A;  4U93 A;  4XIR A;  5C93 A;  4HZ5 A;  4YKT A;  4ASF A;  3WHA A;  4XCJ A;  2BZ5 A;  4LWG A;  2YI0 A;  4DZY A;  4XIQ A;  4L93 A;  4LWE A;  2QFO A;  2YKC A;  3O0I A;  2PNR A;  3EKO A;  2BU8 A;  1AMW A;  4R3A A;  2YE5 A;  5FNC A;  1UY6 A;  2XCM A;  3LNU A;  3RKZ A;  4KP4 A;  5M4E A;  2YE9 A;  3NMQ A;  1Z5B A;  2YI5 A;  3B27 A;  4LWI A;  3WQ9 A;  2HHI A;  2CH4 A;  4XCL A;  4E72 A;  2BRE A;  2BTZ A;  2GFD A;  3D0B A;  2XX2 A;  3T10 A; 
#chains in the Genus database with same CATH homology
 2YGA A;  4FCQ A;  2BU2 A;  3B28 A;  2E0A A;  3JZ3 A;  1AJ6 A;  4U7N A;  3T0H A;  2FYP A;  4BAE A;  4AWQ A;  4HYM A;  2Q8H A;  3C0E A;  4QPJ A;  2QF6 A;  3PEJ A;  2XHR A;  1AM1 A;  4L8Z A;  2YKI A;  3Q5L A;  4MP2 A;  4JQL A;  2YKE A;  1I58 A;  1Y8O A;  4R1F A;  4I3H A;  3O2F A;  3T0Z A;  3KE6 A;  2Q8G A;  5CF0 A;  2YE3 A;  3GIE A;  1B63 A;  5D6Q A;  3ZKD A;  1YT1 A;  4FMT A;  2YEB A;  5CTU A;  4CE1 A;  4X9L A;  1UYL A;  2VW5 A;  3GIG B;  2YEJ A;  2YI6 A;  2CGF A;  4GT8 A;  2IWU A;  4O05 A;  2HKJ A;  4MOT A;  4K4O A;  2BYH A;  4BQJ A;  1US7 A;  3A0Y A;  4EM7 A;  2VWC A;  2IWX A;  4CWR A;  1KZN A;  3QTF A;  1TC6 A;  3TZ2 A;  4URM A;  3A0R A;  4R3M A;  2YJX A;  5M4H A;  3INX A;  4GFN A;  2QG0 A;  3TTZ A;  4P8O A;  2XJG A;  4O09 A;  3TZ5 A;  2WEQ A;  4URN A;  3A0X A;  2BU6 A;  4CWT A;  4BIU A;  1UYC A;  5F5R A;  2ESA A;  4W7T A;  2JJC A;  1EI1 A;  2CG9 A;  1KIJ A;  2YK9 A;  2ZDY A;  3BM9 A;  2K5B A;  3VHD A;  3T1K A;  2JKI A;  4O07 A;  2BU5 A;  3R92 A;  3EKR A;  4HY1 A;  5BOC A;  1I59 A;  3U2K A;  3A0W A;  1TIL A;  3OPD A;  4FPP A;  2CCU A;  1YT2 A;  3R4N A;  3ZM7 A;  4E02 A;  2WI1 A;  4ZVI A;  4EGI A;  1ZWH A;  4XIP A;  1Y4S A;  1Y4U A;  4XKK A;  5M4K A;  1GJV A;  4H85 A;  1TBW A;  5CPH A;  4GEE A;  5D6P A;  3IED A;  3U2D A;  3PEH A;  4Q20 A;  4URO A;  3B24 A;  4XKO A;  3HYY A;  3GIG A;  4EMV A;  4KSH A;  4WUD A;  4ASA A;  4NH9 A;  2IOQ A;  3H80 A;  2XHT A;  4I5S A;  1S16 A;  3CRL A;  4JAS A;  4O0B A;  4V25 A;  4CWS A;  2YK2 A;  4B7P A;  4MPE A;  1ID0 A;  3G75 A;  1NHI A;  5M4M A;  5D7R A;  4ASG A;  3Q5K A;  2HCH A;  3TZ0 A;  4AWO A;  2WI2 A;  4CWQ A;  1NHJ A;  4CE3 A;  1BYQ A;  1ZW9 A;  4MPC A;  2ZKJ A;  4E00 A;  1UYH A;  4YKU A;  4LWF A;  4CWP A;  4QPK A;  4YKX A;  1UY7 A;  4FCP A;  1UY8 A;  3O6O A;  2EXL A;  2ZDX A;  3T2S A;  5IN9 A;  3FT8 A;  1YC4 A;  4JAV A;  3VHC A;  3GIF A;  2YEI A;  3H4L A;  4XD8 A;  4JAU A;  2YE4 A;  3Q5J A;  3R4O A;  1B3Q A;  2YGE A;  1TC0 A;  4LPB A;  1Z5C A;  3SL2 A;  3RLQ A;  2XHX A;  2IWS A;  3ZKB A;  1YT0 A;  1H7S A;  3K99 A;  4FCR A;  1Y8P A;  2XDS A;  5FWK A;  1YS3 A;  2IOP A;  4GQT A;  2CCS A;  3G7B A;  1UYI A;  2O1U A;  1R62 A;  5GGZ A;  5M4P A;  2YI7 A;  2WI3 A;  5FNF A;  1AH8 A;  4V26 A;  4YKQ A;  4L94 A;  4O04 A;  5CTY A;  1Z59 A;  1YC1 A;  4P7A A;  3HZ1 A;  2YJW A;  2WI7 A;  4XDM A;  4URL A;  1THN A;  2WER A;  4XKA A;  4MPN A;  4EEH A;  1YET A;  5J71 A;  1GKZ A;  4HZ0 A;  1UYK A;  4L91 A;  3DGE A;  4GCZ A;  4PU9 A;  1PVG A;  4WUB A;  1QYE A;  4LP0 A;  2YEF A;  5CTW A;  2H8M A;  1UYG A;  1BXD A;  4AWP A;  4L90 A;  5D7D A;  2FWZ A;  5F3K A;  3HYZ A;  4KQV A;  4B6C A;  2BRC A;  2XDU A;  3EHG A;  2XD6 A;  5BOD A;  4KSG A;  2YEE A;  1NHH A;  1ZXM A;  4U7O A;  3MNR P;  4MP7 A;  5J6A A;  1U2O A;  3HEK A;  3HHU A;  3VHA A;  3R4M A;  2YGF A;  3B25 A;  1I5D A;  1I5B A;  2VCJ A;  1BKN A;  4WUC A;  1JM6 A;  3BMY A;  1S14 A;  1UYE A;  3CGZ A;  3QDD A;  2BSM A;  1UYD A;  1EA6 A;  3R91 A;  4DUH A;  1YER A;  3B26 A;  4BQG A;  4CWF A;  2BU7 A;  3TUH A;  2XJX A;  1B62 A;  2Q8F A;  1UYM A;  3EHH A;  1YSZ A;  3RLR A;  3CGY A;  2XDK A;  1MU5 A;  2WI4 A;  2YE7 A;  3FT5 A;  2O1V A;  2XDL A;  1YC3 A;  4CE2 A;  4EFT A;  3R4P A;  3C11 A;  2WI6 A;  2UWD A;  3FV5 A;  1YSR A;  2WI5 A;  3OWD A;  4BIZ A;  4EFU A;  2BYI A;  4XE2 A;  4YKW A;  2YED A;  2YEA A;  2XX5 A;  1H7U A;  2XJJ A;  2XAB A;  4XTJ A;  2C2A A;  1I5C A;  2ZBK B;  4KTN A;  2YE8 A;  2FWY A;  1YES A;  2YEH A;  1GKX A;  2YKJ A;  3A0Z A;  1Y8N A;  3LPS A;  2XK2 A;  3A0T A;  4HYP A;  3TZ4 A;  2AKP A;  2YKB A;  3INW A;  4H81 A;  3OWB A;  5IDJ A;  1L0O A;  1OSF A;  1TID A;  4NH8 A;  4CWO A;  2YEG A;  2YE2 A;  4AS9 A;  3CRK A;  2XDX A;  2CCT A;  2BT0 A;  5CTX A;  3OW6 A;  4YKR A;  4E01 A;  4PRX A;  3U67 A;  2FXS A;  4BXI A;  3D2R A;  1ZXN A;  5L3J A;  4KFG A;  1TH8 A;  4MB9 A;  2Q2E B;  4NH7 A;  2GQP A;  4YKY A;  3RLP A;  4YKZ A;  4EGK A;  4XIT A;  1QY8 A;  4PRV A;  2YE6 A;  3HZ5 A;  5D7C A;  1BGQ A;  1I5A A;  2WEP A;  5M4N A;  3K60 A;  3ZXQ A;  3EHJ A;  4GGL A;  2H55 A;  1U0Z A;  3VAD A;  3K97 A;  1MX0 A;  2XX4 A;  1UYF A;  5FND A;  5IDM A;  4HXW A;  4HY6 A;  4H7Q A;  4ASB A;  4PL9 A;  4HXZ A;  1A4H A;  1QZR A;  3D36 A;  4XC0 A;  1Z5A A;  2VCI A;  3ZXO A;  4EGH A;  2QG2 A;  4ZKI A;  3CWV A;  3K98 A;  3EHF A;  3OMU A;  2O1W A;  1AH6 A;  2HG1 A;  3G7E A;  2YEC A;  4MBC A;  4LWH A;  2IOR A;  2Q8I A;  4CWN A;  1UY9 A;  4U93 A;  4XIR A;  5C93 A;  4HZ5 A;  4YKT A;  4ASF A;  3WHA A;  4XCJ A;  2BZ5 A;  4LWG A;  2YI0 A;  4DZY A;  4XIQ A;  4L93 A;  4LWE A;  2QFO A;  2YKC A;  3O0I A;  2PNR A;  3EKO A;  2BU8 A;  1AMW A;  4R3A A;  2YE5 A;  5FNC A;  1UY6 A;  2XCM A;  3LNU A;  3RKZ A;  4KP4 A;  5M4E A;  2YE9 A;  3NMQ A;  1Z5B A;  2YI5 A;  3B27 A;  4LWI A;  3WQ9 A;  2CH4 A;  4XCL A;  2BRE A;  2BTZ A;  2GFD A;  3D0B A;  2XX2 A;  3T10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...