4B6MA

Trypansoma brucei tubulin binding cofactor b cap-gly domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
80
structure length
80
Chain Sequence
b'TIHVGDRCLCRPGDRLGSVRFVGRVASLKPGYWVGVEFDEPVGKGDGTVKGTRVFQCQPNYGGFLRPDQVEVGDFPPEVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TUBULIN-SPECIFIC CHAPERONE, PUTATIVE
publication title The Architecture of Trypanosoma Brucei Tubulin-Binding Cofactor B and Implications for Function.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Structural protein
total genus 15
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 4b6mA00
2COWA 1WHLA 2CP7A 2COYA 2E3HA 2Z0WA 2E4HA 2HQHA 2COZA 2HL5C 1TOVA 2CP3A 2HKNA 1WHGA 2CP0A 2M02A 1LPLA 1WHHA 3RDVA 2HL3A 1WHKA 2CP2A 2CP5A 1TXQA 2E3IA 2CP6A 1WHMA 2HKQB 1WHJA 3TQ7P 2QK0A 1IXDA 2MPXC 4B6MA 3E2UA
chains in the Genus database with same CATH superfamily
4X9DA 3S3MA 3VS7A 2NUPB 2A0FB 1M2OA 4E7JA 1KHCA 1B3QA 1YWPA 4PJOE 4E7HA 1UFFA 5A0DA 3THKA 2EGAA 2HDAA 2KNBB 3LX7A 3URGA 3MKDA 2H3EB 3OQ5A 1Q7YU 2EIFA 1M27C 4WF2A 1VQPT 4IIMA 1U8RA 7AT1B 1WHLA 1EX4A 1NLOC 3JCMf 4PNOA 1H641 3QJYA 5GAOr 1KQSA 3VS1A 3CCMA 1UB4A 3V7RA 1Q81C 2A37A 1VQMT 1VQKQ 3J81E 1PRLC 3VS0A 1PD0A 4M7DB 3H0FA 4BUGA 2OX7A 4OMFB 1UJ0A 1YI2T 2E4HA 4M77D 3AT1B 5C0MA 1WQ7A 1ZSGA 4FYWB 3REAB 2NYSA 4JLIA 5GAMd 4LD9K 2RJFA 3FJPA 5KYYB 4M78B 1X75C 1LOJA 1M2VB 2F2VA 2LNVA 2MPXC 4M77A 3E2UA 3TCJA 2VWFA 4HCKA 5DLQE 4M7AC 4M4ZA 1CSKA 1WHGA 2AIRB 4EMKC 2QDLA 2WSCE 1K73R 2ECZA 1G3WA 1BI0A 1QWEA 1VQ9Q 2YRVA 3X28B 2AZVA 4C92B 5LJ3e 3MEUA 1R77A 4OGCA 4HXJA 4DBRA 4A53A 2QA4T 3WVEB 4BY6B 2D6FA 2CZ7B 4GLKA 4PL6A 4XTWA 3M58A 2L8DA 2QEXQ 1FMKA 3EGXA 3VUBA 3MHXA 1NLPC 2GFAA 1SSHA 4C8QB 2L89A 5LJ5h 1WX6A 4OMMA 3PMTA 1VQPA 2DVEA 3VS6A 2EGCA 4O5VA 3CCEQ 1KFZA 2XHCA 2L3PA 4BI3A 4UC4A 4JJBA 4N0AA 2KK4A 3L42A 1Z9QA 2DTIA 5GAOq 2QASA 2QTVA 2K7AA 2DYBA 1AZGB 1N9SA 1VQMA 1UGQB 5KH6A 4M7DD 1PKTA 4JLGA 1Y71A 4ELYC 2LMJA 5CKEA 4FU6A 3EHRA 4AMCA 1M8VA 1H3HA 1VQNT 1VIEA 3LGLA 1K73C 1YI2A 2HBPA 2VYTA 4KT0E 4RKUE 2C0IA 3ZL7C 4RCBA 2KXCA 3OW2A 3CD6T 3HSBA 2J06A 2KMTA 4M7DA 3N5BB 4F16A 4M7AE 3VS3A 4M78D 2IG0A 2RJDA 3UATA 1LJOA 1QCNA 4FYVB 1HK9A 2VGMA 4V2SA 2X4WA 3JCMe 2P0QA 2ZGWA 2GGRA 4JRKA 4M78A 2RQUA 4C92D 1UHCA 2PVOB 4JJDA 1YWOA 2YRCA 1YIJT 4R56A 2L3RA 2FVUA 2QA4A 2D0QB 5GMKj 2HSPA 3OB9A 1SF9A 1NJIR 1O9SA 4PJOG 3EG9B 1U1SA 2KXDA 1WJRA 3L2RA 1NM7A 4C8QD 4C92A 2D1XA 2L0AA 1I81A 2ROLA 2GTJA 3P8BB 4IKFA 4RCCA 3SWNC 2V1RA 3I55Q 1RL2A 4LD6A 1OX8A 3NTKA 4FSXA 1GFCA 5DLOA 2YHTA 3X25B 4AFSC 1PCXA 1LPLA 1W4SA 3R6OA 3X24B 2JS2A 2YUOA 3HP9A 1KSWA 2CGHA 1I8FA 1QCFA 1KQ1A 5LJ3h 4J6WA 4M75A 2QQBA 3PT9A 1QVFA 4D8DA 4PJOF 1MMGA 1AD5A 3CC2T 2VV5A 1VQNA 4HA8A 1M8MA 1WJQA 2G3RA 3CD6A 2DXCA 3BW1A 1GL5A 3U23A 3CEYA 3SEMA 2L3QA 1VQ5Q 1NJIC 3G6EQ 2JUFA 3A1PA 5GAMg 2GCXA 1OULA 2KQWA 4OB3B 1FXXA 2BIVA 3QPHA 3F70A 2FPFA 4YTLA 5CO7A 5FRNA 1G2BA 1JRIA 4AFUC 2EJ9A 5HCKA 4GY5A 1IHWA 1YIJA 1XOVA 1WQWA 3CCUQ 3NFCA 2D0NA 3CCJT 4JS4A 4NL2A 2K57A 4IUPA 5KYXB 3QZ9B 2IPOB 2VXEA 1X43A 3P8HA 2K3YA 1MUZA 3C0CA 2QGGA 3EH2A 1K1ZA 2O31A 4N4GA 1YN8A 1D0XA 1RADB 3JCMh 3OSVA 4JRIA 3FEOA 5KE3A 3M0PA 4N4IA 1RABB 1UGVA 2D8JA 1E7OA 4EMKA 3CC2A 2X3XD 1W1FA 3TVTA 1NPRA 2WSFE 1QQJA 4IUQA 5LJ5j 3H0HA 3QG1A 2EYYA 2V26A 2F5TX 3RMQA 3E9GA 4J9EA 5J26A 1YHQQ 5CQYA 2DNUA 5C6SA 4KUIA 1QMCA 1VQLQ 4M7AG 1G83A 4LDVA 4J9GA 1YBYA 5D7UA 1JJ2A 2XI9A 4PLLA 3CMAQ 2CP2A 2YT6A 4B9WA 1VQLT 4LDXA 1JXOA 3JCMV 2MWOA 2HBWA 1QP2A 1VA7A 1HYOA 1Q86U 2V8KA 4DEXA 1K76A 4FL6A 4J9CA 3MP6A 4FIBA 5GANg 3TSWA 1M90C 3TEEA 3OBWA 1VQ6Q 2DXTA 3GNGA 5CVIA 1SPKA 3CCJA 4A54A 2FHDA 5GMKe 4OMNA 2JM9A 2PVDB 2B86A 5LJ5f 3VYGA 1YJWQ 4M7AF 3OBYA 1TTHB 2XDDA 4M77C 4GLMA 1YJWT 2RK1A 2LQ8A 3D7SB 3H0IA 5FLXE 5FU6B 2GQIA 2FG0A 4F7UA 5KYXA 1YJNT 1ZX6A 3L2QA 4QT7A 3M55A 1KC8R 2CZ0B 3M0QA 2DTHA 1V76A 2EGEA 5GAN8 4RTZA 1AWXA 3OMCA 3RR6A 1OYXA 3HRTA 4RMOA 3OYGA 1QKXA 4E2FB 2DFUA 1YFNA 2GTOA 1QVFP 1WXBA 3L2VA 1T0JA 2QTXA 3BDUA 1RAAB 2X3WD 2E65A 2JS0A 2BE9B 3SWNA 3CCSA 3A8GB 1UEBA 3LGFA 4XTYA 5L23A 2RHIA 1X2KA 3QYGB 1WHHA 2XKOC 1QVPA 2HZYA 3JCMX 3H9NA 4QVZA 4HT8A 1ZA1B 1SHFA 2HKQB 3QYHB 3LH5A 3WVDB 4QVDA 3HFOA 1ACMB 2GFUA 2YUPA 1KC8C 3VS2A 4M77E 5HK0A 2DM1A 3ASKA 1RAIB 1WNLA 4ELZC 3AHUA 4M7DC 2ROTA 1YJ9T 2RI5A 2DRKA 1Q82R 1IREB 3HL8A 2PNIA 1RAEB 2KRNA 3I35A 4C0FA 3PVQA 4PK4A 4DEYA 4EIKA 1YJNA 4M78C 2HMAA 4ZTFA 2SEMA 5IHIA 1NBEB 5LJ3f 3CCQQ 2EQUA 1VQ4Q 3CC7Q 1VQOT 3M57A 3I56Q 5I11A 2KY9A 2PUKB 2MMPA 3L2WA 2KT1A 1S72Q 1XQHA 2M16A 1X6OA 3RUXA 4XU1A 2DETA 2DXBA 2OTLT 1X2QA 1OQKA 1Q82U 4JJCA 2ABLA 2EW3A 1YP5A 3FIFA 2FL7A 3V7CA 4C92C 2A28A 3V8KA 2NLUA 2KROA 3E9FA 1AZEA 4PJMA 3QXEB 2QDYB 2K3XA 2LNHB 2M1HA 4BY6C 3VRYA 5LJ5e 4HT9A 3RMSA 3OYIA 2LDMA 2F5KA 1JU5C 1Q7YR 2HL3A 4C8QC 2K3BA 1VQ8T 2I0NA 2CT3A 1EFNA 2MCNA 4X1VA 2CP5A 4MMLA 5HY6A 3JCMJ 2E5QA 2EYWA 2QAZA 1ZSZB 3HRSA 4MDWA 1PNJA 2RH2A 1HSQA 2XD0A 1XJWB 4FCYA 4M7DE 1W2BS 1Q95G 1GXIE 5FRMA 3INZA 2J6KA 1JJ2P 2ED1A 4E7LA 1Y96B 2H3JA 1M3BA 4FSSA 4JUVA 4ZN3A 5GAN6 2X4JA 4QQDA 1D3BA 1YJ9A 1HJDA 4FW2A 4B6MA 1QWFA 1PD1A 1BCMA 2GQVA 3HKSA 3MPUB 3OSSC 4M78E 2NWMA 3EFOA 4ME7A 2BZ8A 2FO0A 2P0KA 3A5ZB 1ZQ1A 2KEAA 2ZZDA 1LVKA 3H8ZA 1WYXA 2VVKA 4RG2A 2QG9B 3M5AA 1Q7YC 3NTIA 1VQKT 1YITQ 5CIUA 2X51A 4Y91A 3S3NA 4C92E 1VQOA 1VQ7Q 2E64A 4BB7A 1KIKA 1S1NA 4ANJA 1QKWA 3FDRA 1MHNA 1N6AA 1OU9A 2OTLA 1B34B 1FWZA 4CRIA 3CXCA 3QIIA 3RNJA 4C8QE 4A4FA 1PWTA 2MF2A 5AT1B 1WHMA 1U1TA 4C5HA 2RHXA 3QUIA 4M75E 4E6RA 2LRQA 1VQ8A 4OB1B 4QW2A 2KE9A 2J7IA 2EQKA 2Y4XA 4KUDK 4FYXB 3X20B 4DOVA 1IB8A 3V8LA 2C06A 2CYZB 2KYMA 1N8RU 4F17A 5KYNA 1VQ9T 1G5VA 4JZ3A 3FRNA 3HTRA 3NHNA 1BKBA 3OYYA 5KYWB 3SHWA 1P92A 2DEQA 2LQNA 2QEXT 4M77G 2FZGB 2NUPA 1TWBA 3X26B 3CQTA 1OX9A 4XTUA 3EG1A 5FW9A 1Y96A 1BI1A 3VJPA 2EQJA 1ZBXA 1PC0A 2XMFA 3CCET 1MV0B 2HSEB 2RMOA 1JBMA 1J3TA 1FMVA 1H92A 2DRMA 2EQMA 2YLBA 4HKEA 3OYEA 4BACA 1VQKA 2CH4A 3FC3A 3L2ZA 1JO8A 1NEGA 2F2WA 2QYZA 2LJ1A 5GAOm 4ATOA 1GRIA 4J8OA 3QDRB 4M77F 4PKCC 1MMDA 1UGPB 3CMEQ 4L59A 5CK9A 1M3AA 2DO3A 2M51A 2JTEA 5GAOl 1SRLA 4XAXB 2VXFA 2R5AA 4PJOD 2W10A 4BD3A 4ZN1A 1KJWA 3DLLA 4XTVA 1K8AU 2DILA 2MAMA 4OF1A 1X27A 5GANd 3JCMW 4D6WA 2LJ0A 2K79A 2G6FX 5KYYA 3M56A 4OP0A 3SFMA 1WPYA 3FJ5A 1M2VA 2JW4A 3OYAA 5IH2A 3C95A 1VQ9A 2DZ9A 2FYKA 1PM3A 4M7DG 4PJLA 2PQWA 3LLRA 2DIQA 3A98A 4A4EA 3JB9D 2QEXA 1QVGA 2VGNA 1LCKA 1ZUYA 2RF0A 3OA6A 1AVZC 2RJEA 3FB9A 1D0ZA 1OZ3A 1KK7A 5GMKm 4DA4A 4J9HA 3IQLA 4XU2A 4M78G 1TUDA 4ZTJA 3I55T 3CCEA 1UTIA 2YSQA 5CAIA 2EPDA 5GJVB 4C8QA 2HD0A 1T3SA 2O4XB 5GMKl 1CKAA 3JCMQ 1LNXA 2JM8A 4M7DF 3UDCA 3CPWS 4A4HA 2X9HA 3A8MB 5CR2A 3OYMA 3TSZA 3G4SQ 2LJ3A 1WDXA 5HK3A 4C92G 1WJSA 4AFZC 1D1AA 1BIAA 2C0OA 5KYUB 3CC4Q 4F7UE 2L3SA 2LQKA 3HFNA 2D8HA 2P4RA 3QZ5B 2CSQA 2I2LA 3CC4T 3CCVQ 4E7SA 3S3OA 2EYXA 1UUEA 4M78F 1ABQA 1UJYA 3A8HB 2RQTA 3OYHA 4C8QG 3RESA 1K9MU 3OS5A 3ZFJA 4P5NA 1VQ5T 2OAWA 3EHQA 4DQ2A 3G6ET 2JOYA 4KH0B 4PJNA 3M0UA 3A8OB 4M75G 4ZGEB 3CXCP 1N27A 2JXBA 2CZ6B 3EAEA 1SG5A 3BY7A 3E19A 2VASA 4FM4B 4C92F 2F69A 3QO3A 5FU6C 3G71Q 2RI2A 3JCMd 1XTDA 5GAN4 4BDYA 5LJ5g 4XTZA 4J7FA 4AT1B 4KGXB 3CCUT 2OTJQ 4C8QF 3DB3A 1WFWA 3EFRA 3GOXA 2GBQA 4M75F 2XK0A 2KI7A 4R0KA 4RTYA 1UGSB 2QQAA 1PSFA 4J9BA 1ZUKA 1WZOA 3EG9A 9ATCB 3I55A 5I21A 3CCLQ 2LX9A 3MJXA 3ULRB 2E5KA 2J6FA 1NG2A 2HQHA 2Y90A 1NEBA 4C0ZA 4PJJA 1KQSS 2M9UA 1G8XA 2IIMA 1ZA2B 3G7ZA 2EKHA 3MP1A 2CSIA 3EG2A 2GF7A 3KBGA 3EGDB 2AKKA 2RHUA 5I22A 1Q86R 2KRMA 4RTTA 3QSUA 5AYFA 2BKDN 5GAMj 2VB6A 1TS9A 1SEMA 1H3ZA 1VIFA 5J3BA 1MMAA 2O4XA 4ESRA 5GAOp 2HL5C 4OMPA 1ZBJA 2ZPBB 3CBOA 3JV3A 1JXMA 3VUZA 1YHQT 1RACB 1TH7A 3PE0A 2AHJB 1VQ5A 1HXDA 2CKKA 2IVWA 5KYUA 3M4GA 1RUWA 3G6EA 3LWIA 2XG8D 2F2XA 3CMAT 3CCRQ 4QQ6A 4MZPA 2JNGA 4BE0A 2O9VA 3RKWA 1WXTA 2H8HA 4DBQA 3LH0A 2P0PA 5IN1A 2M0YA 1M1GA 5IHKA 4FW1A 1VQ6T 2YRDA 3CCUA 3A8LB 5CKFA 3C12A 3VKIA 2ZPIB 3EG3A 1BI2A 2DTOA 1Q86C 4JJNK 5FROA 2E70A 2L2PA 1K0SA 3I5SA 2DIGA 2R57A 2COZA 2NUTB 1D1CA 1FMWA 2E6ZA 2O01E 2ESWA 3C4SA 3UA6A 5LJ3g 4E47A 4L6V5 2ZCFB 1QVGP 3VS4A 1TXQA 1WHJA 1Z9ZA 2HEQA 3G1JA 5A2QE 4CC2A 1DJ7B 4J6YA 1MMNA 2XU8A 4WTOB 1V1CA 4DBHA 4E7KA 1ZSZC 4DOWA 1M1KR 1OV3A 4AG1C 2ZPGB 5J39A 2RPNA 3OW2S 2QK0A 4LUDA 2RK2A 4A4KA 4NS5A 4F7UG 3UA7A 3H6ZA 1VYUA 2ZPEB 1VUBA 5LL6S 1YHQA 5GANj 4LDWA 1B07A 3HHTB 2QQ9A 1VQLA 3ZEHA 1X6GA 3EH1A 2PVGB 3CMAA 3E1SA 2ED0A 8ATCB 1WHKA 2Y4YA 1M1KU 1QCOA 2O88A 2EAYA 4EDUA 3M59A 1KD1U 3OYDA 1M30A 1SKUB 2MI6A 2R5MA 1JB0E 4F7UF 1VQ6A 1JEGA 4HCZA 1NYFA 2DD5A 4PLIA 2VKNA 1I07A 1KG1A 2HCKA 3JCMg 2BTTA 3OS2A 1OU8A 1ZLMA 1D09B 1M1KC 1PHTA 1YJWA 2YWWA 3RERA 3JCMc 2RQVA 3M54A 3PGGA 1N9RA 2CDTA 2JTMA 1IHVA 4HCCA 1M4ZA 4RUGA 2LZ6B 1ABOA 1QW1A 4PJOC 3DLMA 2F1LA 3UPUA 2OJ2A 1OEBA 1IRXA 5GAN2 1V29B 2K5LA 3GLXA 1IGUA 4EMGA 2EQIA 3CCQT 2X4XA 1VQ4T 1TUGB 3CC7T 2AK5A 3I56T 3CCMQ 2DERA 2KVQG 3SB2A 5I2SA 1S72T 3QWYA 1MNEA 1QVFS 3CPWA 5IAYA 5KCHA 2CUDA 3CBMA 4BDZA 2DJZA 4OB2B 2XICA 2EJGA 5GAMe 3M9QA 3RIRA 4FT2A 2LVMA 3JCMP 1PG5B 4HCBA 1ARKA 3JRZA 1TG0A 2MIOA 2KSSA 1OI1A 1Q82C 1M5Q1 3MO8A 2W0ZA 4EPCA 2AT1B 3PTAA 1EZZB 3VYHB 1AOJA 2BZXA 4XU0A 1RLQC 2J05A 2HQEA 2DBMA 4N4HA 4A4GA 3OYCA 1EIFA 4DBFA 1XNIA 1W6XA 4OMOA 2K2MA 4J9DA 1A0NB 2KGTA 1BIBA 4NOYA 3EGXB 2X35A 1MV3A 2JT4A 3VRZA 4CI0C 1I5OB 2JN0A 2LTOA 3VS5A 4OVAA 4RTVA 1GCPA 2DD4A 3BFMA 4J83A 1Q81U 1ZUUA 1UHFA 3HRUA 1VQPQ 3M0SA 1SHGA 2FEIA 2LCLA 3L1AA 3H41A 4MDXA 1OPLA 4BE2A 2QQSA 1YITT 3CCQA 2JZ2A 3JB9H 1VQ4A 1NZ9A 3CC7A 1VQ7T 3I56A 2RD1A 4HVVA 1VQMQ 1OOTA 2KR3A 3J80E 1S72A 1N8RR 4MZMA 1PSEA 2XIDA 2B8AA 3GNFB 4KGZB 3CPFA 2DA9A 4C5EA 1AEYA 1RAHB 1YI2Q 2RNAA 2K2VA 4PJOB 3KXTA 2Z0WA 2KT8A 4FT4A 1UGRB 5KE2A 2PUOB 2JMAA 1MNDA 4OB0B 5EC7A 5LJ5d 5GANe 4PFZA 3GPLA 5A0GA 1FX7A 1JJ2S 2E1HA 2QQRA 4IUUA 1E6HA 2AZSA 4KBMB 3KUFA 2NUZA 2K4YA 3MEAA 4CC4B 4J5YA 1G3YA 2HNIA 1JQQA 1NE8A 1ZSZA 1SSFA 4C0DB 1H8KA 3KFVA 2YLCA 5GAMh 4Y28E 2YUQA 2LP5A 2QA4Q 5CCAA 3OYLA 3OMGA 1N8RC 2EFIA 3RBBB 2FZCB 3OYJA 4MMKA 5IXBA 4XQ3A 1M1FA 2ATCB 2LCSA 4MZTA 3LYIA 1X01A 2HKNA 2LQWA 4CC3A 5FU7C 1K8AR 1WI7A 4PFPA 3UWNA 3PVLA 4M75B 5D6WA 4RTWA 3JB9I 4AFQC 5GJWB 1YITA 2K6DA 1K73U 4ORZA 4F04B 5CKHA 1VQ7A 3TQ7P 2A36A 4GBQA 5GMKi 3M53A 2V8JA 1I0CA 3MEVA 3CMET 4IUVA 4KRTA 3M0RA 4JRQA 1VQNQ 4IUTA 2KBTA 1GCQA 2CZ1B 1R0BG 4XK8E 4JPBW 5FWCA 3I5RA 2XDBA 1AHJB 1BCOA 3CD6Q 1BI3A 1G3TA 4X9CA 1C0MA 3CPWP 2VUBA 3S6WA 1B34A 3DKMA 1CKBA 2RQRA 2SRCA 2DL3A 1D0YA 4QVCA 1G3SA 1WLPB 4PJOA 5D6YA 2FPEA 1U3OA 1Y0MA 4HVWA 2BE7D 5IXFA 4L5GA 1K8AC 1T0HA 1OZ2A 1BYMA 2ZPHB 5FWBA 4OMLA 4E7ZA 2CREA 5LJ3d 1QLYA 1YIJQ 3UF4A 4J9FA 2BUDA 5GAN5 4LXCA 1GFDA 4PFOA 3L2UA 3OY9A 3SD4A 5KYWA 1UG1A 2DL5A 2V8IA 4VUBA 5L8RE 5GANh 2DE0X 4IURA 1K9MR 2ZPFB 2CP6A 1K9AA 4M7AB 4NL3A 1WXUA 4BE1A 2KRSA 4EMKB 1R8OB 2LT4A 4M75D 4LUEA 4JZ4A 2OI3A 2RQWA 1Y57A 4B9XA 4EMHA 3CBPA 3G4ST 1Y7XA 1IO6A 3R6NA 3DB4A 1BK2A 2DVJA 3NPFA 2K5FA 3M4YA 2GNCA 3CMEA 1NJIU 2RA2A 3CC2Q 3QWXX 2K5IA 3VV0A 3CCVT 3JB9G 5FU7B 1WGSA 3OYKA 1YNZA 3HPWA 1KQSP 2FRYA 4RTUA 4TVRA 8AT1B 1T3LA 1C1AA 2EYQA 1TSFA 2DAQA 1RI0A 1I4K1 4X34A 2RM4A 2V1QA 3BDLA 2M0OA 1IXDA 3QDFA 2DPPB 1K9MC 4R55A 3V7SA 3G71T 1AWWA 3PIPA 5GAN3 2RJCA 4LDUA 2EYZA 4E7IA 1I5LA 1OPKA 2R58A 4LDYA 1W2BA 2AKLA 3JB9F 2DL8A 4RTXA 2LX7A 3PFSA 2CUBA 2KDSA 2OTJT 3Q1JA 2HQXA 1K4US 1X69A 4J9IA 3CCJQ 1O75A 4Z02A 4XU3A 3M0TA 4F7UB 5IHNA 1TUCA 4BI8B 1UDLA 2L5QA 3CCLT 1U06A 4ZGDB 4M7AD 3JSCA 1IZ6A 1KHIA 2DLPA 4ZGJB 4LE9A 3FLGA 1HD3A 1R0CB 3RKXA 5GAN7 1VOMA 3ZBDA 3TREA 3G4SA 2PZ1A 2E3HA 3OYBA 4M7AA 2JJ9A 1M90R 2MOXA 2MYSA 4JS5A 3CC4A 4C5GA 1U5SA 2EVRA 2MK5A 2KYBA 4KGVB 4F14A 2M02A 4D8KA 3CXCS 3QHSA 3CCVA 2DK3A 2E41A 3SWNB 3RKYA 2E12A 6AT1B 1RAFB 1MGQA 3CCRT 3CCSQ 4JDSA 3VU3C 1TU0B 1M90U 3PNWC 5ECAA 2X4YA 3CCST 2YXYA 3OW2P 2DYIA 3G71A 4OMQA 4Y92A 3GP8A 5HKCA 2E3IA 2DEUA 2DL7A 3EFSA 1BBZA 2LC4A 5GAMf 1ZHIA 2DMOA 3ME9A 1IGQA 2RN8A 2CT4A 2YUNA 4KULA 2PTKA 5DM7R 2E6NA 2OTJA 3NMZC 4AG2C 1B7TA 4C0GA 3NGPA 4A63B 2FZKB 1YCYA 1RI9A 3BE3A 1AWOA 2VC8A 1AT1B 1Y07A 3OYNA 5D6XA 3CCLA 4HVUA 2JVVA 1X6BA 5A0LA 4BI4A 2P84A 2EWNA 4Z88A 3MP8A 2RI3A 1BU1A 1TOVA 1C6VX 1YJNQ 1VYVA 3EG0A 2A7YA 5GAOn 3J7AF 1FYNA 3GIBA 3PIOA 3GF5A 4JRPA 2DJQA 2D9TA 2DBKA 2JTFA 2WSEE 1PRMC 2LT1A 1KD1R 3QKJA 3LWHA 3EGDA 1I1JA 2COWA 5CQXA 2PU9B 5EG2A 1KQ2A 4J6XA 2OAUA 4ZNXA 1D1BA 3ER0A 1WA7A 1UE9A 3MEWA 1NYGA 2E10A 2A3LA 1M3CA 1QP3A 4Z89A 2DKGA 3RDVA 1E6GA 3O8VA 2XDPA 3JB9J 2DL4A 2RO0A 2FB7A 2DZCA 5M9OA 3CCRA 4N0AC 1RLPC 2EBPA 3C94A 2ENMA 3O5ZA 1UECA 3OS0A 2LCCA 2HAXA 1KC8U 4J7IA 1F1BB 4FYYB 4II1A 2K9GA 2CS7A 2RHYA 1BB9A 1WIEA 5LJ3j 3WXMB 5KCOA 3PMIA 1AWJA 1GCQC 2QGFB 1D3BB 4RG8A 2C0TA 4C5IA 4Z8AA 3JCMb 3T9NA 3EFOB 1QVGS 2FPDA 3V8JA 2DXUA 3UT1A 3JAME 1KD1C 2J6OA 1YJ9Q 1W2BP 3P8DA 2COYA 5GANf 2MWPA 1N5ZA 3META 2EJFA 2DF6A 3NTHA 3MCAB 2O9SA 2NUTA 4CC7A 4LN2A 3REBB 3GBQA 2QI2A 2KAFA 2RB6A 3CCMT 4K11A 3QBYA 3TU4K 1VQOQ 1M9SA 3QJ6A 2DX1A 4QQGA 4QKUA 2FRWA 1GBQA 4OGEA 5CKDA 3OS1A 2OTLQ 3I9QA 2ZAEA 4M77B 2BZYA 4C0DC 2A08A 2WACA 3EGUA 1RAGB 5IT9E 2P4TA 5GMKh 2YDLA 2QXFA 5DY9A 1NPPA 2CP7A 4KH1B 2JMCA 1W70A 2CP3A 4LNPA 1Q81R 4O6JA 2CP0A 1VQ8Q 4WCIA 2EKOA 2O2OA 2CH4W 3SDZA 4XTXA 1PKSA 4Q5WA 1SRMA 1K0XA 1VYTA 5I2MA 2RHZA 3OYFA 3LW5E 5CKBA 4M75C 4IIOA 1YCSB 1GBRA
chains in the Genus database with same CATH topology
2COWA 1WHLA 2CP7A 2COYA 2E3HA 2Z0WA 2E4HA 2HQHA 2COZA 2HL5C 1TOVA 2CP3A 2HKNA 1WHGA 2CP0A 2M02A 1LPLA 1WHHA 3RDVA 2HL3A 1WHKA 2CP2A 2CP5A 1TXQA 2E3IA 2CP6A 1WHMA 2HKQB 1WHJA 3TQ7P 2QK0A 1IXDA 2MPXC 4B6MA 3E2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COW A;  1WHL A;  2CP7 A;  2COY A;  2E3H A;  2Z0W A;  2E4H A;  2HQH A;  2COZ A;  2HL5 C;  1TOV A;  2CP3 A;  2HKN A;  1WHG A;  2CP0 A;  2M02 A;  1LPL A;  1WHH A;  3RDV A;  2HL3 A;  1WHK A;  2CP2 A;  2CP5 A;  1TXQ A;  2E3I A;  2CP6 A;  1WHM A;  2HKQ B;  1WHJ A;  3TQ7 P;  2QK0 A;  1IXD A;  2MPX C;  4B6M A;  3E2U A; 
#chains in the Genus database with same CATH topology
 4X9D A;  3S3M A;  3VS7 A;  2NUP B;  2A0F B;  1M2O A;  4E7J A;  1KHC A;  1B3Q A;  1YWP A;  4PJO E;  4E7H A;  1UFF A;  5A0D A;  3THK A;  2EGA A;  2HDA A;  2KNB B;  3LX7 A;  3URG A;  3MKD A;  2H3E B;  3OQ5 A;  1Q7Y U;  2EIF A;  1M27 C;  4WF2 A;  1VQP T;  4IIM A;  1U8R A;  7AT1 B;  1WHL A;  1EX4 A;  1NLO C;  3JCM f;  4PNO A;  1H64 1;  3QJY A;  5GAO r;  1KQS A;  3VS1 A;  3CCM A;  1UB4 A;  3V7R A;  1Q81 C;  2A37 A;  1VQM T;  1VQK Q;  3J81 E;  1PRL C;  3VS0 A;  1PD0 A;  4M7D B;  3H0F A;  4BUG A;  2OX7 A;  4OMF B;  1UJ0 A;  1YI2 T;  2E4H A;  4M77 D;  3AT1 B;  5C0M A;  1WQ7 A;  1ZSG A;  4FYW B;  3REA B;  2NYS A;  4JLI A;  5GAM d;  4LD9 K;  2RJF A;  3FJP A;  5KYY B;  4M78 B;  1X75 C;  1LOJ A;  1M2V B;  2F2V A;  2LNV A;  2MPX C;  4M77 A;  3E2U A;  3TCJ A;  2VWF A;  4HCK A;  5DLQ E;  4M7A C;  4M4Z A;  1CSK A;  1WHG A;  2AIR B;  4EMK C;  2QDL A;  2WSC E;  1K73 R;  2ECZ A;  1G3W A;  1BI0 A;  1QWE A;  1VQ9 Q;  2YRV A;  3X28 B;  2AZV A;  4C92 B;  5LJ3 e;  3MEU A;  1R77 A;  4OGC A;  4HXJ A;  4DBR A;  4A53 A;  2QA4 T;  3WVE B;  4BY6 B;  2D6F A;  2CZ7 B;  4GLK A;  4PL6 A;  4XTW A;  3M58 A;  2L8D A;  2QEX Q;  1FMK A;  3EGX A;  3VUB A;  3MHX A;  1NLP C;  2GFA A;  1SSH A;  4C8Q B;  2L89 A;  5LJ5 h;  1WX6 A;  4OMM A;  3PMT A;  1VQP A;  2DVE A;  3VS6 A;  2EGC A;  4O5V A;  3CCE Q;  1KFZ A;  2XHC A;  2L3P A;  4BI3 A;  4UC4 A;  4JJB A;  4N0A A;  2KK4 A;  3L42 A;  1Z9Q A;  2DTI A;  5GAO q;  2QAS A;  2QTV A;  2K7A A;  2DYB A;  1AZG B;  1N9S A;  1VQM A;  1UGQ B;  5KH6 A;  4M7D D;  1PKT A;  4JLG A;  1Y71 A;  4ELY C;  2LMJ A;  5CKE A;  4FU6 A;  3EHR A;  4AMC A;  1M8V A;  1H3H A;  1VQN T;  1VIE A;  3LGL A;  1K73 C;  1YI2 A;  2HBP A;  2VYT A;  4KT0 E;  4RKU E;  2C0I A;  3ZL7 C;  4RCB A;  2KXC A;  3OW2 A;  3CD6 T;  3HSB A;  2J06 A;  2KMT A;  4M7D A;  3N5B B;  4F16 A;  4M7A E;  3VS3 A;  4M78 D;  2IG0 A;  2RJD A;  3UAT A;  1LJO A;  1QCN A;  4FYV B;  1HK9 A;  2VGM A;  4V2S A;  2X4W A;  3JCM e;  2P0Q A;  2ZGW A;  2GGR A;  4JRK A;  4M78 A;  2RQU A;  4C92 D;  1UHC A;  2PVO B;  4JJD A;  1YWO A;  2YRC A;  1YIJ T;  4R56 A;  2L3R A;  2FVU A;  2QA4 A;  2D0Q B;  5GMK j;  2HSP A;  3OB9 A;  1SF9 A;  1NJI R;  1O9S A;  4PJO G;  3EG9 B;  1U1S A;  2KXD A;  1WJR A;  3L2R A;  1NM7 A;  4C8Q D;  4C92 A;  2D1X A;  2L0A A;  1I81 A;  2ROL A;  2GTJ A;  3P8B B;  4IKF A;  4RCC A;  3SWN C;  2V1R A;  3I55 Q;  1RL2 A;  4LD6 A;  1OX8 A;  3NTK A;  4FSX A;  1GFC A;  5DLO A;  2YHT A;  3X25 B;  4AFS C;  1PCX A;  1LPL A;  1W4S A;  3R6O A;  3X24 B;  2JS2 A;  2YUO A;  3HP9 A;  1KSW A;  2CGH A;  1I8F A;  1QCF A;  1KQ1 A;  5LJ3 h;  4J6W A;  4M75 A;  2QQB A;  3PT9 A;  1QVF A;  4D8D A;  4PJO F;  1MMG A;  1AD5 A;  3CC2 T;  2VV5 A;  1VQN A;  4HA8 A;  1M8M A;  1WJQ A;  2G3R A;  3CD6 A;  2DXC A;  3BW1 A;  1GL5 A;  3U23 A;  3CEY A;  3SEM A;  2L3Q A;  1VQ5 Q;  1NJI C;  3G6E Q;  2JUF A;  3A1P A;  5GAM g;  2GCX A;  1OUL A;  2KQW A;  4OB3 B;  1FXX A;  2BIV A;  3QPH A;  3F70 A;  2FPF A;  4YTL A;  5CO7 A;  5FRN A;  1G2B A;  1JRI A;  4AFU C;  2EJ9 A;  5HCK A;  4GY5 A;  1IHW A;  1YIJ A;  1XOV A;  1WQW A;  3CCU Q;  3NFC A;  2D0N A;  3CCJ T;  4JS4 A;  4NL2 A;  2K57 A;  4IUP A;  5KYX B;  3QZ9 B;  2IPO B;  2VXE A;  1X43 A;  3P8H A;  2K3Y A;  1MUZ A;  3C0C A;  2QGG A;  3EH2 A;  1K1Z A;  2O31 A;  4N4G A;  1YN8 A;  1D0X A;  1RAD B;  3JCM h;  3OSV A;  4JRI A;  3FEO A;  5KE3 A;  3M0P A;  4N4I A;  1RAB B;  1UGV A;  2D8J A;  1E7O A;  4EMK A;  3CC2 A;  2X3X D;  1W1F A;  3TVT A;  1NPR A;  2WSF E;  1QQJ A;  4IUQ A;  5LJ5 j;  3H0H A;  3QG1 A;  2EYY A;  2V26 A;  2F5T X;  3RMQ A;  3E9G A;  4J9E A;  5J26 A;  1YHQ Q;  5CQY A;  2DNU A;  5C6S A;  4KUI A;  1QMC A;  1VQL Q;  4M7A G;  1G83 A;  4LDV A;  4J9G A;  1YBY A;  5D7U A;  1JJ2 A;  2XI9 A;  4PLL A;  3CMA Q;  2CP2 A;  2YT6 A;  4B9W A;  1VQL T;  4LDX A;  1JXO A;  3JCM V;  2MWO A;  2HBW A;  1QP2 A;  1VA7 A;  1HYO A;  1Q86 U;  2V8K A;  4DEX A;  1K76 A;  4FL6 A;  4J9C A;  3MP6 A;  4FIB A;  5GAN g;  3TSW A;  1M90 C;  3TEE A;  3OBW A;  1VQ6 Q;  2DXT A;  3GNG A;  5CVI A;  1SPK A;  3CCJ A;  4A54 A;  2FHD A;  5GMK e;  4OMN A;  2JM9 A;  2PVD B;  2B86 A;  5LJ5 f;  3VYG A;  1YJW Q;  4M7A F;  3OBY A;  1TTH B;  2XDD A;  4M77 C;  4GLM A;  1YJW T;  2RK1 A;  2LQ8 A;  3D7S B;  3H0I A;  5FLX E;  5FU6 B;  2GQI A;  2FG0 A;  4F7U A;  5KYX A;  1YJN T;  1ZX6 A;  3L2Q A;  4QT7 A;  3M55 A;  1KC8 R;  2CZ0 B;  3M0Q A;  2DTH A;  1V76 A;  2EGE A;  5GAN 8;  4RTZ A;  1AWX A;  3OMC A;  3RR6 A;  1OYX A;  3HRT A;  4RMO A;  3OYG A;  1QKX A;  4E2F B;  2DFU A;  1YFN A;  2GTO A;  1QVF P;  1WXB A;  3L2V A;  1T0J A;  2QTX A;  3BDU A;  1RAA B;  2X3W D;  2E65 A;  2JS0 A;  2BE9 B;  3SWN A;  3CCS A;  3A8G B;  1UEB A;  3LGF A;  4XTY A;  5L23 A;  2RHI A;  1X2K A;  3QYG B;  1WHH A;  2XKO C;  1QVP A;  2HZY A;  3JCM X;  3H9N A;  4QVZ A;  4HT8 A;  1ZA1 B;  1SHF A;  2HKQ B;  3QYH B;  3LH5 A;  3WVD B;  4QVD A;  3HFO A;  1ACM B;  2GFU A;  2YUP A;  1KC8 C;  3VS2 A;  4M77 E;  5HK0 A;  2DM1 A;  3ASK A;  1RAI B;  1WNL A;  4ELZ C;  3AHU A;  4M7D C;  2ROT A;  1YJ9 T;  2RI5 A;  2DRK A;  1Q82 R;  1IRE B;  3HL8 A;  2PNI A;  1RAE B;  2KRN A;  3I35 A;  4C0F A;  3PVQ A;  4PK4 A;  4DEY A;  4EIK A;  1YJN A;  4M78 C;  2HMA A;  4ZTF A;  2SEM A;  5IHI A;  1NBE B;  5LJ3 f;  3CCQ Q;  2EQU A;  1VQ4 Q;  3CC7 Q;  1VQO T;  3M57 A;  3I56 Q;  5I11 A;  2KY9 A;  2PUK B;  2MMP A;  3L2W A;  2KT1 A;  1S72 Q;  1XQH A;  2M16 A;  1X6O A;  3RUX A;  4XU1 A;  2DET A;  2DXB A;  2OTL T;  1X2Q A;  1OQK A;  1Q82 U;  4JJC A;  2ABL A;  2EW3 A;  1YP5 A;  3FIF A;  2FL7 A;  3V7C A;  4C92 C;  2A28 A;  3V8K A;  2NLU A;  2KRO A;  3E9F A;  1AZE A;  4PJM A;  3QXE B;  2QDY B;  2K3X A;  2LNH B;  2M1H A;  4BY6 C;  3VRY A;  5LJ5 e;  4HT9 A;  3RMS A;  3OYI A;  2LDM A;  2F5K A;  1JU5 C;  1Q7Y R;  2HL3 A;  4C8Q C;  2K3B A;  1VQ8 T;  2I0N A;  2CT3 A;  1EFN A;  2MCN A;  4X1V A;  2CP5 A;  4MML A;  5HY6 A;  3JCM J;  2E5Q A;  2EYW A;  2QAZ A;  1ZSZ B;  3HRS A;  4MDW A;  1PNJ A;  2RH2 A;  1HSQ A;  2XD0 A;  1XJW B;  4FCY A;  4M7D E;  1W2B S;  1Q95 G;  1GXI E;  5FRM A;  3INZ A;  2J6K A;  1JJ2 P;  2ED1 A;  4E7L A;  1Y96 B;  2H3J A;  1M3B A;  4FSS A;  4JUV A;  4ZN3 A;  5GAN 6;  2X4J A;  4QQD A;  1D3B A;  1YJ9 A;  1HJD A;  4FW2 A;  4B6M A;  1QWF A;  1PD1 A;  1BCM A;  2GQV A;  3HKS A;  3MPU B;  3OSS C;  4M78 E;  2NWM A;  3EFO A;  4ME7 A;  2BZ8 A;  2FO0 A;  2P0K A;  3A5Z B;  1ZQ1 A;  2KEA A;  2ZZD A;  1LVK A;  3H8Z A;  1WYX A;  2VVK A;  4RG2 A;  2QG9 B;  3M5A A;  1Q7Y C;  3NTI A;  1VQK T;  1YIT Q;  5CIU A;  2X51 A;  4Y91 A;  3S3N A;  4C92 E;  1VQO A;  1VQ7 Q;  2E64 A;  4BB7 A;  1KIK A;  1S1N A;  4ANJ A;  1QKW A;  3FDR A;  1MHN A;  1N6A A;  1OU9 A;  2OTL A;  1B34 B;  1FWZ A;  4CRI A;  3CXC A;  3QII A;  3RNJ A;  4C8Q E;  4A4F A;  1PWT A;  2MF2 A;  5AT1 B;  1WHM A;  1U1T A;  4C5H A;  2RHX A;  3QUI A;  4M75 E;  4E6R A;  2LRQ A;  1VQ8 A;  4OB1 B;  4QW2 A;  2KE9 A;  2J7I A;  2EQK A;  2Y4X A;  4KUD K;  4FYX B;  3X20 B;  4DOV A;  1IB8 A;  3V8L A;  2C06 A;  2CYZ B;  2KYM A;  1N8R U;  4F17 A;  5KYN A;  1VQ9 T;  1G5V A;  4JZ3 A;  3FRN A;  3HTR A;  3NHN A;  1BKB A;  3OYY A;  5KYW B;  3SHW A;  1P92 A;  2DEQ A;  2LQN A;  2QEX T;  4M77 G;  2FZG B;  2NUP A;  1TWB A;  3X26 B;  3CQT A;  1OX9 A;  4XTU A;  3EG1 A;  5FW9 A;  1Y96 A;  1BI1 A;  3VJP A;  2EQJ A;  1ZBX A;  1PC0 A;  2XMF A;  3CCE T;  1MV0 B;  2HSE B;  2RMO A;  1JBM A;  1J3T A;  1FMV A;  1H92 A;  2DRM A;  2EQM A;  2YLB A;  4HKE A;  3OYE A;  4BAC A;  1VQK A;  2CH4 A;  3FC3 A;  3L2Z A;  1JO8 A;  1NEG A;  2F2W A;  2QYZ A;  2LJ1 A;  5GAO m;  4ATO A;  1GRI A;  4J8O A;  3QDR B;  4M77 F;  4PKC C;  1MMD A;  1UGP B;  3CME Q;  4L59 A;  5CK9 A;  1M3A A;  2DO3 A;  2M51 A;  2JTE A;  5GAO l;  1SRL A;  4XAX B;  2VXF A;  2R5A A;  4PJO D;  2W10 A;  4BD3 A;  4ZN1 A;  1KJW A;  3DLL A;  4XTV A;  1K8A U;  2DIL A;  2MAM A;  4OF1 A;  1X27 A;  5GAN d;  3JCM W;  4D6W A;  2LJ0 A;  2K79 A;  2G6F X;  5KYY A;  3M56 A;  4OP0 A;  3SFM A;  1WPY A;  3FJ5 A;  1M2V A;  2JW4 A;  3OYA A;  5IH2 A;  3C95 A;  1VQ9 A;  2DZ9 A;  2FYK A;  1PM3 A;  4M7D G;  4PJL A;  2PQW A;  3LLR A;  2DIQ A;  3A98 A;  4A4E A;  3JB9 D;  2QEX A;  1QVG A;  2VGN A;  1LCK A;  1ZUY A;  2RF0 A;  3OA6 A;  1AVZ C;  2RJE A;  3FB9 A;  1D0Z A;  1OZ3 A;  1KK7 A;  5GMK m;  4DA4 A;  4J9H A;  3IQL A;  4XU2 A;  4M78 G;  1TUD A;  4ZTJ A;  3I55 T;  3CCE A;  1UTI A;  2YSQ A;  5CAI A;  2EPD A;  5GJV B;  4C8Q A;  2HD0 A;  1T3S A;  2O4X B;  5GMK l;  1CKA A;  3JCM Q;  1LNX A;  2JM8 A;  4M7D F;  3UDC A;  3CPW S;  4A4H A;  2X9H A;  3A8M B;  5CR2 A;  3OYM A;  3TSZ A;  3G4S Q;  2LJ3 A;  1WDX A;  5HK3 A;  4C92 G;  1WJS A;  4AFZ C;  1D1A A;  1BIA A;  2C0O A;  5KYU B;  3CC4 Q;  4F7U E;  2L3S A;  2LQK A;  3HFN A;  2D8H A;  2P4R A;  3QZ5 B;  2CSQ A;  2I2L A;  3CC4 T;  3CCV Q;  4E7S A;  3S3O A;  2EYX A;  1UUE A;  4M78 F;  1ABQ A;  1UJY A;  3A8H B;  2RQT A;  3OYH A;  4C8Q G;  3RES A;  1K9M U;  3OS5 A;  3ZFJ A;  4P5N A;  1VQ5 T;  2OAW A;  3EHQ A;  4DQ2 A;  3G6E T;  2JOY A;  4KH0 B;  4PJN A;  3M0U A;  3A8O B;  4M75 G;  4ZGE B;  3CXC P;  1N27 A;  2JXB A;  2CZ6 B;  3EAE A;  1SG5 A;  3BY7 A;  3E19 A;  2VAS A;  4FM4 B;  4C92 F;  2F69 A;  3QO3 A;  5FU6 C;  3G71 Q;  2RI2 A;  3JCM d;  1XTD A;  5GAN 4;  4BDY A;  5LJ5 g;  4XTZ A;  4J7F A;  4AT1 B;  4KGX B;  3CCU T;  2OTJ Q;  4C8Q F;  3DB3 A;  1WFW A;  3EFR A;  3GOX A;  2GBQ A;  4M75 F;  2XK0 A;  2KI7 A;  4R0K A;  4RTY A;  1UGS B;  2QQA A;  1PSF A;  4J9B A;  1ZUK A;  1WZO A;  3EG9 A;  9ATC B;  3I55 A;  5I21 A;  3CCL Q;  2LX9 A;  3MJX A;  3ULR B;  2E5K A;  2J6F A;  1NG2 A;  2HQH A;  2Y90 A;  1NEB A;  4C0Z A;  4PJJ A;  1KQS S;  2M9U A;  1G8X A;  2IIM A;  1ZA2 B;  3G7Z A;  2EKH A;  3MP1 A;  2CSI A;  3EG2 A;  2GF7 A;  3KBG A;  3EGD B;  2AKK A;  2RHU A;  5I22 A;  1Q86 R;  2KRM A;  4RTT A;  3QSU A;  5AYF A;  2BKD N;  5GAM j;  2VB6 A;  1TS9 A;  1SEM A;  1H3Z A;  1VIF A;  5J3B A;  1MMA A;  2O4X A;  4ESR A;  5GAO p;  2HL5 C;  4OMP A;  1ZBJ A;  2ZPB B;  3CBO A;  3JV3 A;  1JXM A;  3VUZ A;  1YHQ T;  1RAC B;  1TH7 A;  3PE0 A;  2AHJ B;  1VQ5 A;  1HXD A;  2CKK A;  2IVW A;  5KYU A;  3M4G A;  1RUW A;  3G6E A;  3LWI A;  2XG8 D;  2F2X A;  3CMA T;  3CCR Q;  4QQ6 A;  4MZP A;  2JNG A;  4BE0 A;  2O9V A;  3RKW A;  1WXT A;  2H8H A;  4DBQ A;  3LH0 A;  2P0P A;  5IN1 A;  2M0Y A;  1M1G A;  5IHK A;  4FW1 A;  1VQ6 T;  2YRD A;  3CCU A;  3A8L B;  5CKF A;  3C12 A;  3VKI A;  2ZPI B;  3EG3 A;  1BI2 A;  2DTO A;  1Q86 C;  4JJN K;  5FRO A;  2E70 A;  2L2P A;  1K0S A;  3I5S A;  2DIG A;  2R57 A;  2COZ A;  2NUT B;  1D1C A;  1FMW A;  2E6Z A;  2O01 E;  2ESW A;  3C4S A;  3UA6 A;  5LJ3 g;  4E47 A;  4L6V 5;  2ZCF B;  1QVG P;  3VS4 A;  1TXQ A;  1WHJ A;  1Z9Z A;  2HEQ A;  3G1J A;  5A2Q E;  4CC2 A;  1DJ7 B;  4J6Y A;  1MMN A;  2XU8 A;  4WTO B;  1V1C A;  4DBH A;  4E7K A;  1ZSZ C;  4DOW A;  1M1K R;  1OV3 A;  4AG1 C;  2ZPG B;  5J39 A;  2RPN A;  3OW2 S;  2QK0 A;  4LUD A;  2RK2 A;  4A4K A;  4NS5 A;  4F7U G;  3UA7 A;  3H6Z A;  1VYU A;  2ZPE B;  1VUB A;  5LL6 S;  1YHQ A;  5GAN j;  4LDW A;  1B07 A;  3HHT B;  2QQ9 A;  1VQL A;  3ZEH A;  1X6G A;  3EH1 A;  2PVG B;  3CMA A;  3E1S A;  2ED0 A;  8ATC B;  1WHK A;  2Y4Y A;  1M1K U;  1QCO A;  2O88 A;  2EAY A;  4EDU A;  3M59 A;  1KD1 U;  3OYD A;  1M30 A;  1SKU B;  2MI6 A;  2R5M A;  1JB0 E;  4F7U F;  1VQ6 A;  1JEG A;  4HCZ A;  1NYF A;  2DD5 A;  4PLI A;  2VKN A;  1I07 A;  1KG1 A;  2HCK A;  3JCM g;  2BTT A;  3OS2 A;  1OU8 A;  1ZLM A;  1D09 B;  1M1K C;  1PHT A;  1YJW A;  2YWW A;  3RER A;  3JCM c;  2RQV A;  3M54 A;  3PGG A;  1N9R A;  2CDT A;  2JTM A;  1IHV A;  4HCC A;  1M4Z A;  4RUG A;  2LZ6 B;  1ABO A;  1QW1 A;  4PJO C;  3DLM A;  2F1L A;  3UPU A;  2OJ2 A;  1OEB A;  1IRX A;  5GAN 2;  1V29 B;  2K5L A;  3GLX A;  1IGU A;  4EMG A;  2EQI A;  3CCQ T;  2X4X A;  1VQ4 T;  1TUG B;  3CC7 T;  2AK5 A;  3I56 T;  3CCM Q;  2DER A;  2KVQ G;  3SB2 A;  5I2S A;  1S72 T;  3QWY A;  1MNE A;  1QVF S;  3CPW A;  5IAY A;  5KCH A;  2CUD A;  3CBM A;  4BDZ A;  2DJZ A;  4OB2 B;  2XIC A;  2EJG A;  5GAM e;  3M9Q A;  3RIR A;  4FT2 A;  2LVM A;  3JCM P;  1PG5 B;  4HCB A;  1ARK A;  3JRZ A;  1TG0 A;  2MIO A;  2KSS A;  1OI1 A;  1Q82 C;  1M5Q 1;  3MO8 A;  2W0Z A;  4EPC A;  2AT1 B;  3PTA A;  1EZZ B;  3VYH B;  1AOJ A;  2BZX A;  4XU0 A;  1RLQ C;  2J05 A;  2HQE A;  2DBM A;  4N4H A;  4A4G A;  3OYC A;  1EIF A;  4DBF A;  1XNI A;  1W6X A;  4OMO A;  2K2M A;  4J9D A;  1A0N B;  2KGT A;  1BIB A;  4NOY A;  3EGX B;  2X35 A;  1MV3 A;  2JT4 A;  3VRZ A;  4CI0 C;  1I5O B;  2JN0 A;  2LTO A;  3VS5 A;  4OVA A;  4RTV A;  1GCP A;  2DD4 A;  3BFM A;  4J83 A;  1Q81 U;  1ZUU A;  1UHF A;  3HRU A;  1VQP Q;  3M0S A;  1SHG A;  2FEI A;  2LCL A;  3L1A A;  3H41 A;  4MDX A;  1OPL A;  4BE2 A;  2QQS A;  1YIT T;  3CCQ A;  2JZ2 A;  3JB9 H;  1VQ4 A;  1NZ9 A;  3CC7 A;  1VQ7 T;  3I56 A;  2RD1 A;  4HVV A;  1VQM Q;  1OOT A;  2KR3 A;  3J80 E;  1S72 A;  1N8R R;  4MZM A;  1PSE A;  2XID A;  2B8A A;  3GNF B;  4KGZ B;  3CPF A;  2DA9 A;  4C5E A;  1AEY A;  1RAH B;  1YI2 Q;  2RNA A;  2K2V A;  4PJO B;  3KXT A;  2Z0W A;  2KT8 A;  4FT4 A;  1UGR B;  5KE2 A;  2PUO B;  2JMA A;  1MND A;  4OB0 B;  5EC7 A;  5LJ5 d;  5GAN e;  4PFZ A;  3GPL A;  5A0G A;  1FX7 A;  1JJ2 S;  2E1H A;  2QQR A;  4IUU A;  1E6H A;  2AZS A;  4KBM B;  3KUF A;  2NUZ A;  2K4Y A;  3MEA A;  4CC4 B;  4J5Y A;  1G3Y A;  2HNI A;  1JQQ A;  1NE8 A;  1ZSZ A;  1SSF A;  4C0D B;  1H8K A;  3KFV A;  2YLC A;  5GAM h;  4Y28 E;  2YUQ A;  2LP5 A;  2QA4 Q;  5CCA A;  3OYL A;  3OMG A;  1N8R C;  2EFI A;  3RBB B;  2FZC B;  3OYJ A;  4MMK A;  5IXB A;  4XQ3 A;  1M1F A;  2ATC B;  2LCS A;  4MZT A;  3LYI A;  1X01 A;  2HKN A;  2LQW A;  4CC3 A;  5FU7 C;  1K8A R;  1WI7 A;  4PFP A;  3UWN A;  3PVL A;  4M75 B;  5D6W A;  4RTW A;  3JB9 I;  4AFQ C;  5GJW B;  1YIT A;  2K6D A;  1K73 U;  4ORZ A;  4F04 B;  5CKH A;  1VQ7 A;  3TQ7 P;  2A36 A;  4GBQ A;  5GMK i;  3M53 A;  2V8J A;  1I0C A;  3MEV A;  3CME T;  4IUV A;  4KRT A;  3M0R A;  4JRQ A;  1VQN Q;  4IUT A;  2KBT A;  1GCQ A;  2CZ1 B;  1R0B G;  4XK8 E;  4JPB W;  5FWC A;  3I5R A;  2XDB A;  1AHJ B;  1BCO A;  3CD6 Q;  1BI3 A;  1G3T A;  4X9C A;  1C0M A;  3CPW P;  2VUB A;  3S6W A;  1B34 A;  3DKM A;  1CKB A;  2RQR A;  2SRC A;  2DL3 A;  1D0Y A;  4QVC A;  1G3S A;  1WLP B;  4PJO A;  5D6Y A;  2FPE A;  1U3O A;  1Y0M A;  4HVW A;  2BE7 D;  5IXF A;  4L5G A;  1K8A C;  1T0H A;  1OZ2 A;  1BYM A;  2ZPH B;  5FWB A;  4OML A;  4E7Z A;  2CRE A;  5LJ3 d;  1QLY A;  1YIJ Q;  3UF4 A;  4J9F A;  2BUD A;  5GAN 5;  4LXC A;  1GFD A;  4PFO A;  3L2U A;  3OY9 A;  3SD4 A;  5KYW A;  1UG1 A;  2DL5 A;  2V8I A;  4VUB A;  5L8R E;  5GAN h;  2DE0 X;  4IUR A;  1K9M R;  2ZPF B;  2CP6 A;  1K9A A;  4M7A B;  4NL3 A;  1WXU A;  4BE1 A;  2KRS A;  4EMK B;  1R8O B;  2LT4 A;  4M75 D;  4LUE A;  4JZ4 A;  2OI3 A;  2RQW A;  1Y57 A;  4B9X A;  4EMH A;  3CBP A;  3G4S T;  1Y7X A;  1IO6 A;  3R6N A;  3DB4 A;  1BK2 A;  2DVJ A;  3NPF A;  2K5F A;  3M4Y A;  2GNC A;  3CME A;  1NJI U;  2RA2 A;  3CC2 Q;  3QWX X;  2K5I A;  3VV0 A;  3CCV T;  3JB9 G;  5FU7 B;  1WGS A;  3OYK A;  1YNZ A;  3HPW A;  1KQS P;  2FRY A;  4RTU A;  4TVR A;  8AT1 B;  1T3L A;  1C1A A;  2EYQ A;  1TSF A;  2DAQ A;  1RI0 A;  1I4K 1;  4X34 A;  2RM4 A;  2V1Q A;  3BDL A;  2M0O A;  1IXD A;  3QDF A;  2DPP B;  1K9M C;  4R55 A;  3V7S A;  3G71 T;  1AWW A;  3PIP A;  5GAN 3;  2RJC A;  4LDU A;  2EYZ A;  4E7I A;  1I5L A;  1OPK A;  2R58 A;  4LDY A;  1W2B A;  2AKL A;  3JB9 F;  2DL8 A;  4RTX A;  2LX7 A;  3PFS A;  2CUB A;  2KDS A;  2OTJ T;  3Q1J A;  2HQX A;  1K4U S;  1X69 A;  4J9I A;  3CCJ Q;  1O75 A;  4Z02 A;  4XU3 A;  3M0T A;  4F7U B;  5IHN A;  1TUC A;  4BI8 B;  1UDL A;  2L5Q A;  3CCL T;  1U06 A;  4ZGD B;  4M7A D;  3JSC A;  1IZ6 A;  1KHI A;  2DLP A;  4ZGJ B;  4LE9 A;  3FLG A;  1HD3 A;  1R0C B;  3RKX A;  5GAN 7;  1VOM A;  3ZBD A;  3TRE A;  3G4S A;  2PZ1 A;  2E3H A;  3OYB A;  4M7A A;  2JJ9 A;  1M90 R;  2MOX A;  2MYS A;  4JS5 A;  3CC4 A;  4C5G A;  1U5S A;  2EVR A;  2MK5 A;  2KYB A;  4KGV B;  4F14 A;  2M02 A;  4D8K A;  3CXC S;  3QHS A;  3CCV A;  2DK3 A;  2E41 A;  3SWN B;  3RKY A;  2E12 A;  6AT1 B;  1RAF B;  1MGQ A;  3CCR T;  3CCS Q;  4JDS A;  3VU3 C;  1TU0 B;  1M90 U;  3PNW C;  5ECA A;  2X4Y A;  3CCS T;  2YXY A;  3OW2 P;  2DYI A;  3G71 A;  4OMQ A;  4Y92 A;  3GP8 A;  5HKC A;  2E3I A;  2DEU A;  2DL7 A;  3EFS A;  1BBZ A;  2LC4 A;  5GAM f;  1ZHI A;  2DMO A;  3ME9 A;  1IGQ A;  2RN8 A;  2CT4 A;  2YUN A;  4KUL A;  2PTK A;  5DM7 R;  2E6N A;  2OTJ A;  3NMZ C;  4AG2 C;  1B7T A;  4C0G A;  3NGP A;  4A63 B;  2FZK B;  1YCY A;  1RI9 A;  3BE3 A;  1AWO A;  2VC8 A;  1AT1 B;  1Y07 A;  3OYN A;  5D6X A;  3CCL A;  4HVU A;  2JVV A;  1X6B A;  5A0L A;  4BI4 A;  2P84 A;  2EWN A;  4Z88 A;  3MP8 A;  2RI3 A;  1BU1 A;  1TOV A;  1C6V X;  1YJN Q;  1VYV A;  3EG0 A;  2A7Y A;  5GAO n;  3J7A F;  1FYN A;  3GIB A;  3PIO A;  3GF5 A;  4JRP A;  2DJQ A;  2D9T A;  2DBK A;  2JTF A;  2WSE E;  1PRM C;  2LT1 A;  1KD1 R;  3QKJ A;  3LWH A;  3EGD A;  1I1J A;  2COW A;  5CQX A;  2PU9 B;  5EG2 A;  1KQ2 A;  4J6X A;  2OAU A;  4ZNX A;  1D1B A;  3ER0 A;  1WA7 A;  1UE9 A;  3MEW A;  1NYG A;  2E10 A;  2A3L A;  1M3C A;  1QP3 A;  4Z89 A;  2DKG A;  3RDV A;  1E6G A;  3O8V A;  2XDP A;  3JB9 J;  2DL4 A;  2RO0 A;  2FB7 A;  2DZC A;  5M9O A;  3CCR A;  4N0A C;  1RLP C;  2EBP A;  3C94 A;  2ENM A;  3O5Z A;  1UEC A;  3OS0 A;  2LCC A;  2HAX A;  1KC8 U;  4J7I A;  1F1B B;  4FYY B;  4II1 A;  2K9G A;  2CS7 A;  2RHY A;  1BB9 A;  1WIE A;  5LJ3 j;  3WXM B;  5KCO A;  3PMI A;  1AWJ A;  1GCQ C;  2QGF B;  1D3B B;  4RG8 A;  2C0T A;  4C5I A;  4Z8A A;  3JCM b;  3T9N A;  3EFO B;  1QVG S;  2FPD A;  3V8J A;  2DXU A;  3UT1 A;  3JAM E;  1KD1 C;  2J6O A;  1YJ9 Q;  1W2B P;  3P8D A;  2COY A;  5GAN f;  2MWP A;  1N5Z A;  3MET A;  2EJF A;  2DF6 A;  3NTH A;  3MCA B;  2O9S A;  2NUT A;  4CC7 A;  4LN2 A;  3REB B;  3GBQ A;  2QI2 A;  2KAF A;  2RB6 A;  3CCM T;  4K11 A;  3QBY A;  3TU4 K;  1VQO Q;  1M9S A;  3QJ6 A;  2DX1 A;  4QQG A;  4QKU A;  2FRW A;  1GBQ A;  4OGE A;  5CKD A;  3OS1 A;  2OTL Q;  3I9Q A;  2ZAE A;  4M77 B;  2BZY A;  4C0D C;  2A08 A;  2WAC A;  3EGU A;  1RAG B;  5IT9 E;  2P4T A;  5GMK h;  2YDL A;  2QXF A;  5DY9 A;  1NPP A;  2CP7 A;  4KH1 B;  2JMC A;  1W70 A;  2CP3 A;  4LNP A;  1Q81 R;  4O6J A;  2CP0 A;  1VQ8 Q;  4WCI A;  2EKO A;  2O2O A;  2CH4 W;  3SDZ A;  4XTX A;  1PKS A;  4Q5W A;  1SRM A;  1K0X A;  1VYT A;  5I2M A;  2RHZ A;  3OYF A;  3LW5 E;  5CKB A;  4M75 C;  4IIO A;  1YCS B;  1GBR A; 
#chains in the Genus database with same CATH homology
 2COW A;  1WHL A;  2CP7 A;  2COY A;  2E3H A;  2Z0W A;  2E4H A;  2HQH A;  2COZ A;  2HL5 C;  1TOV A;  2CP3 A;  2HKN A;  1WHG A;  2CP0 A;  2M02 A;  1LPL A;  1WHH A;  3RDV A;  2HL3 A;  1WHK A;  2CP2 A;  2CP5 A;  1TXQ A;  2E3I A;  2CP6 A;  1WHM A;  2HKQ B;  1WHJ A;  3TQ7 P;  2QK0 A;  1IXD A;  2MPX C;  4B6M A;  3E2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...