4B6XA

Crystal structure of in planta processed avrrps4
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
69
structure length
69
Chain Sequence
GAGAALRQEIEDKQLMVNNLTDELQDAIDEANPAEIANTSQQLRHARADLADLQRRFAVLRNEDRRINQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AVIRULENCE PROTEIN
publication title Distinct Regions of the Pseudomonas Syringae Coiled-Coil Effector Avrrps4 are Required for Activation of Immunity.
pubmed doi rcsb
source organism Pseudomonas syringae pv. pisi
molecule tags Toxin
total genus 29
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4b6xA00
2K48A 2C5JA 3QK6A 3QUJA 3S4UA 3MXZA 3FXEB 1LRZA 1IJ6A 2G0UA 2XTLA 4L0RA 1ZKEA 3CKDA 1QSDA 3P7IA 4B6XA 1LVFA 2X9XA 1H7CA 2C5KT 1IJ5A 2X9YA 3TKLB 4EYYR 2IC6A 3L3PA 2MBGA 4DNDA 2KWIB 3N5LA 4J2CA 2CA5A 2X9WA 4CQIA 3FXDB 3CVRA 4FI5A 2KWHA 1Z0PA 2C5IT 2IC9A
chains in the Genus database with same CATH superfamily
5JVDE 5EK4A 4NIQA 1ZHCA 4QXCB 5AFUL 2LHRA 1N33T 4YT0A 4HWCA 4ZZCA 3LFMA 2R6GF 2JQKA 1KEYA 4FI5A 4IL9A 3RPUA 1OXZA 3E0ZA 3H37A 1HR0T 2DWKA 5ABEA 4UV8B 5L3BB 1VCTA 5ABFA 2LRKA 5LGTB 2WMOA 4Q25A 3JC6D 2V6YA 1YW0A 1MIYA 3TLSA 2EHOD 4QXBB 2BG9A 1YKEB 5DQVA 5LHHB 5EZYE 4P0BA 4PK5A 3O9XA 3MJXA 4IL4A 5KX5E 2BZBA 4H63V 5AQIB 1HNZT 4UIGA 4YY3T 3Q9DA 4O4IE 4LF8T 1LVKA 2X0YA 5C2TA 2X51A 3N2KE 4LMKA 4U31A 4LF9T 3S4UA 3AA0B 5FYMA 2V7MA 2XPKA 3AE1A 2VURA 5L3DB 3RX6A 3AE5A 3HKDE 3C51A 2WDQA 2LSGA 2J62A 3RC3A 3N5LA 4QX8B 3V5SA 2XAFB 4CXXA 4FJOA 4OK0A 4HE8A 2KMFA 5LMUT 4JI5T 4K0UA 5FNVE 1OEDB 3FZMB 2UXDT 5FY7A 3I1AA 4YTPA 4CN6A 4PAGA 2X67A 3I9YA 3ONXA 3PE0A 4NPPA 1CUNA 4Z90A 4U2YA 1HX1B 1LKXA 2YN6A 3CQXC 3AAAB 3KFWX 4X1KE 4BAYB 5H6RB 2ACZA 4HFEA 4TNVA 1B7TA 2M67A 2KT9A 5FVKA 1JNRA 4AQGA 3VKHA 3AE8A 4TZ4C 4IIJE 3C98B 3EVYA 2CMRA 2V7LA 2CM0A 1AJ3A 2XQ5A 1E7PA 3UUMA 3AEEA 2DLRA 3AAIA 3CIRA 4IDOA 4G2AA 5AQKB 4JEHB 4DNDA 2N2NA 1U4QA 1M7KA 4JI8T 2CLYB 5JR9C 3LK42 2CPTA 1BR4A 5F8PA 2XZEA 3FHNA 3UQ4A 2XQAA 3Q2MA 2W66A 1YD8G 4UEMA 1KFYA 3ZN0B 3HKBE 1EZ3A 3L09A 3U3IA 5FY1A 2W61A 4AKHA 2E9XD 4HFVA 2VVNA 2A9UA 3JC6C 3ZC1A 3QC9A 2K5BB 5AQJB 5A1LA 2AXDS 2EHOC 3O1JA 2WZIA 3B57A 1GQEA 4LF6T 4QKNA 2D9DA 3LBXB 3ESLA 3H3AA 2NOXA 4ILAA 2DCFA 2CWOA 4OFZA 2V7IA 3LG7A 4PJJA 2BS2A 3LDQB 5JR9A 5HXEA 3RF1A 4DV0T 5AQGB 3E22E 1WRDA 3C64A 3FB2A 4YLHA 3P4RA 2WU2A 1MIVA 3ZMVB 4WBOA 5L3GB 2XM1A 3SWHA 2CRBA 1T8BA 2XM2A 2XAHB 2IW5B 3RYCE 1WYBA 2XQYA 3OVUA 2XQ9A 3RIAA 2EHOA 2LOSA 3TLUA 1NWMX 5LHGB 4TWDA 5HEOA 1S94A 4H9RC 5AQMB 1QUUA 4AIUA 3ZCJA 5L4EA 4LMLA 4P1NA 3EDVA 2YDRA 4UVBB 2XAGB 2D5UA 4IREA 2ACXA 2Y48B 3QK6A 2QYWA 4UF0A 3L39A 2VASA 4ADZA 4PJNA 2NWBA 4JBWF 3FBZA 2DI4A 5CA0E 4OHFA 2IIUA 3AE2A 3OYXA 4AQFC 3CX8B 3QOFA 1O3XA 4U7IA 1NEKA 3VU7H 5HEHA 4UELA 5FMNA 5JREA 3D0TA 4ZS3A 2W4XA 5JDHA 1W0BA 4P0AA 3P4WA 2NW7A 3ETVA 2JPFA 4O2BE 3QUJA 5BR8T 1LRZA 4ZI2D 2E9XC 4YHJA 3ZMUB 2XJ7A 3F2EA 4ILCA 5CGMA 4HFCA 3UU6A 2BVMA 3CQCB 4CN4A 4X62T 2RPAA 5L47A 1Z8UA 4YJ3E 4GKKT 3RQWA 4ZXLA 3FZFB 4EYUA 5IHYA 4TV9E 4X20E 5JDQA 4AQFA 3AB3B 3K1SA 4TWHA 5LYJE 4DV1T 2L8KA 3HKEE 2HHHT 2ZM6T 3ONLC 4HFHA 3WAKA 2WCAA 4O8SA 2LLYA 1MMAA 2CCQA 3O4XE 4JI6T 3UT5E 3UUXB 1YKHB 1MMDA 3VR9A 2P9BA 3KV4A 3RRWA 2LE8A 2E9XA 2CBJA 1N34T 4IE4A 2D0TA 2W62A 3SRZA 3T1HT 4H63H 1UK5A 4EZHA 1E2AA 2VQFT 4JLEA 5HXHA 5LA6E 3KVAA 3O1IA 3NWIA 4ZOLE 3AE9A 2CWYA 1MMGA 2BS3A 3LK3B 4HEAA 4YHHT 2V6YB 2IHR1 1WLXA 2YDQA 2BG9B 1NENA 2YKSA 4HN9A 4JI3T 3SOLA 1J5WA 2BBJA 4YTMA 1XMOT 2KWIB 2JIWA 3ZYKA 3R6NA 4OYKA 4AKLA 1NAFA 4AKIA 3ZCIA 3KVBA 4AKRB 3AA1B 4XAXB 2IMLA 4NUUA 3RHWA 2UXNB 3ONJA 2LRLA 4TWFA 4DIDB 2WAUA 3K3NA 3SFDA 2YU1A 5JH7E 3QB5K 3FXDB 2C5IT 3NBXX 2IDOB 5CA1E 2Q9QD 2LHNA 5LBMA 4E7ZA 4DUZT 1JNZA 2B76A 2NW8A 2UU9T 4ZI2C 3FZHB 3RYIE 2LSKA 4HTEA 5ABGA 4ZS2A 1I6ZA 5J2UE 4KP3C 5JDGA 4WZXA 3J7Yq 5EK2A 3QNUA 2E2AA 3B13A 1D0ZA 3C4WA 2KSRA 5AQOB 2NP9A 3DTOA 4BJNA 5KMGP 2XSBA 3VRAA 4OYJA 4H9PC 3ETUA 1KNRA 3EUHA 2CHOA 2W0GA 2J1DG 2KXPB 1VCSA 4LF4T 5CB4E 5F3JA 2ZM8A 1FIOA 1SUMB 5GONE 1KK7A 2QGSA 2WWUA 2UXXB 4UV9B 3JAFA 4GYRA 5JTGA 5AQVB 2JQHA 5JRCA 2I59A 1X79A 4HGAA 3RIFA 3MA9A 4F6RC 4IHJE 2X9XA 2FUPA 2QVAA 2XQ8A 4I50E 3WI3A 1US7B 3L3PA 1G73A 2YDSA 5FL0A 2I6HA 3CVRA 2WZHA 5JDLA 4LFAT 3RH3A 4I0UA 2W00A 4X5TA 4WYVA 3O1HA 2KLQA 4U72A 2NW9A 4DV4T 2LT3A 1KNZA 2V5CA 4X66T 3UFEA 4CI3B 5FXWA 4DUYT 2CBIA 2BS4A 3RYFE 4LF5T 2VVSA 3X1DA 4DBQA 3AEGA 3SS1A 4EGWA 3ZPOA 1W09A 3K3OA 3K8PC 5HEUA 5HAXA 3UFGA 5C3JA 2J47A 4YFSA 1YQ4A 2Q9QC 3AE6A 2K3WA 3GN5B 1IAPA 2H89A 4F8HA 4ZEYA 3MKDA 4C91A 4IDQA 3P7IA 4Z91A 3VRBA 2C5KT 3CQGB 5IYZE 2WS3A 5ADXL 1MNDA 3JADA 3ZMSB 2H7OA 2HH7A 1ZP0A 5CJ5A 2XSAA 3IA3A 4PFPA 5LNKA 4UVCB 4EIWA 2SPCA 3BQKA 4AI6A 4EXTA 2MTQA 4IE5A 4HKAA 2OV9A 4J2CA 4IT4A 3WAJA 4EB6E 4CZZB 3ZT6A 3EHZA 2Q9QA 4EAHA 2YOEA 3EDUA 3UU8A 3A5XA 4IDPA 1HF8A 5LGUB 4ISSA 2F4VT 1HNXT 5TAOA 3VKGA 4CN1A 4DR4T 2HPLA 5LOVE 4X1IE 3RKOA 1YXRA 2WP9A 5AQQB 4AISA 5FP3A 2KNDA 1DU2A 3MACA 2VL0A 4KI0F 4EZ4A 3C4ZA 3ANWB 2E5LT 3N9PA 2V6XA 2BDEA 3AA7B 4DV2T 5FVLA 2FJDA 4NUVA 1OEDA 4U2ZA 4XZCA 2L9QA 2ES0A 1UUSA 2WMNA 2B1EA 2BKOA 2CLYC 3AAEB 2NR4A 2NTXA 4LFBT 4JEUB 5LG4A 4PFOA 3I0OA 4L9IA 2VK9A 4X64T 4TV8E 4H9OC 4V1Av 4L5GA 3RLFF 4NXMT 5J1GA 1HX8A 1CHUA 3ZLIA 4EEBA 1VOMA 3N9OA 4HFBA 2X68A 2UUCT 4YSZA 3AE3A 2DHRA 2ZLYA 2BVLA 3KINB 1KF6A 1L0VA 1UGOA 2XY8B 4O4JE 4PK6A 5IUXA 2E9XB 5HWYA 1Y64B 4G63A 2CXDA 4U7YA 2H3RA 4JYAT 4QXHB 2WDRA 2VB6A 3PUSA 2IUBA 2OA5A 3GMIA 4BJMA 4EV6A 3HA4A 1D1CA 2XTLA 1UX5A 3IF8B 3M3ZB 2VKHA 1ZOYA 1MIWA 5LG3A 2WB5A 1IZNB 2KZ7B 2CXLA 2V7KA 3MXZA 3FZKB 4QH1A 1UURA 3PUQA 2ZM2A 3LBXA 3TKLB 2PJQA 3ZN1B 4YSYA 3G06A 4JI1T 3N9QA 1FMWA 1T7SA 3CK6A 5FKYA 5HEGA 4DBRA 5BMVE 1QLBA 2UUAT 3AE4A 3PV0F 2FJAA 3MK7C 2M6BA 4K0KT 1T72A 3ZJ2A 4B6XA 3ZT7A 2LM9A 2L3LA 4N78D 4YTNA 2GK9A 3AEBA 5FXZA 3BQIA 4IE0A 3CX6B 3LSVA 3N2OA 4YXDA 2X9WA 2BBHA 3ZC0A 3NZPA 4JI7T 3AEAA 1SHZC 3FBLA 3RIUC 1D1AA 2CEAA 4QWNB 3OBVE 2LSJA 2MYSA 5DABA 3UQ7A 5ABFB 3KV9A 4M1PA 4U3CA 4PJLA 4WNKA 3SFEA 2FBWA 2M6IA 3UULA 2VQET 3VR8A 1KNPA 5AQUB 4IGUA 2WY2A 2HPJA 3AEFA 5C8YE 2X66A 4ISTA 1T98A 3N9NA 2CA5A 5LGNB 4Z8XA 2IC9A 3PDYA 3Q5XA 5LP6E 1J5ET 3AE7A 3EABA 3PJAJ 5LHIB 1IJ6A 5JRCB 1BR1A 4I43B 2ODUA 5ABHA 2JJ9A 2ZMAA 3RIUA 4A56A 3KBUA 1I94T 3TLVA 2Y8DA 4ZI3D 5JDFA 5AQHB 2X9HA 2X0LB 3PURA 5JDNA 2AE9A 3ZMTB 2D2SA 4TUYE 1U5PA 4MHCA 2QA7A 4IE6A 2LJLA 5FXVA 2C0SA 3UU4A 3PUYF 3PTRB 3AECA 4DV7T 4DV5T 3JCFA 5LJMA 4E7SA 5HYAA 3NRYA 2XQ4A 3N9LA 2WQYA 1QSDA 2D0UA 3A7MA 1YQ3A 4KUMB 3HR0A 3RC8A 3GA8A 3IHRA 4ASKA 4DVDA 3CPZA 4ZZBA 2WWVA 3ABVA 3NKZA 3P4SA 1FJGT 5L2LA 4GYSA 4BA9A 2LSIA 1ZV4X 1Y01A 2XUEA 3CX7B 1HS7A 2G0UA 2WU5A 2Z6EA 2WM9A 1IBLT 3N9MA 1X9BA 4H9NC 1XNRT 4B3RT 2CHNA 4OX9T 3PUAA 4HWDA 4YJ2E 2E5VA 4JUYA 3ZYLA 5CFBA 2RA1A 3PU3A 3H3MA 2HN1A 2HN2A 1WFDA 3W15B 5JDMA 2V7JA 4CI2B 5IWAT 2UUBT 5HWXA 2N1GA 3IEEA 5L3EB 2JMKA 4AKGA 3HL6A 2K24A 4UR9A 2A2FX 3AVRA 4P09A 2WDVA 3Q5DA 3KV5A 4X65T 2V26A 3Q5EA 2Q9QB 3LK2B 1D0YA 2CXFA 3KDSE 2YEVC 1IBMT 2MOZA 1VRBA 3UTKA 4IDZA 5L3FB 5HCJA 3BK9A 2XQ3A 3HKCE 3NRXA 1V9DA 5HXRA 4I55E 3F31A 1WR0A 2JQQA 4GK0E 2FJEA 2DWGA 2XQ7A 1XDPA 2WSSV 5JR9B 5AQLB 1D0XA 5AQNB 4IE7A 3AXJA 1BR0A 4ZI3C 3P4QA 1LVFA 3FZLB 3RRCA 4A98A 2IC6A 2QRXA 4ERRA 4GKJT 3MZKB 1UX4A 1OEDE 2A3DA 2JQ9A 1M62A 2XAQB 3P4PA 4ILBA 2A72A 2K48A 3P8CD 2EHOB 3UU3A 4L0RA 3V5UA 2ZM0A 2VKDA 3IBPA 2RP4A 4EEDA 4YSXA 4DMVA 3PUZF 3PUGA 4HWIB 4HFIA 2BKPA 4PJMA 2LM2A 3AEDA 5KDMC 4UF0B 2LOPA 2ODVA 1OEDC 4ANJA 3P50A 3ZJ1A 2DL1A 2XQ6A 1UCUA 4ILUA 4MFRA 3E08A 3ZYMA 3UU5A 3JAEA 4GK5E 4LFCT 4DR3T 4B3TT 1HNWT 2K9AA 2PTFA 1MMNA 4H9QC 3OJAA 3C50A 4DR2T 5LCYA 2DNXA 4B3ST 2VKJA 4UVAB 5LXTE 2I0MA 4QX7B 5LB7B 1G8XA 1S35A 2LSYA 3PUVF 3I9WA 3ZSSA 2UXBT 1Z0PA 1XNQT 2LKHA 3ZMZB 5HCMA 3KV6A 2VWAA 4QHOA 2UXCT 3TLTA 4IDNA 2J4GA 4A97A 5LMNT 3U78A 4HFDA 3UUBA 3AA6B 4I4TE 5E0OA 5ETWA 2C5JA 5LBQB 1ZKEA 3BQLA 4MALA 3GN5A 1SE7A 4X1YE 2IAKA 2MBGA 2KINB 4PW8A 3OTOT 1WCRA 2XASB 3DP7A 1W0AA 5AQRB 4DR5T 1HG2A 1OWAA 3UUNA 3VHLA 4KHZF 2X9YA 2X0HA 4NXNT 3RI5A 4KX6A 3F57A 2Y6XA 3B5MA 2LKGA 2PG8A 1XWMA 4CQIA 3KBTA 2MAWA 4TN7B 4U33A 2WBLA 2V1DB 3NZQA 1XZYA 3CWZB 4UXNB 4LMJA 2XHEB 5J2TE 4CI1B 1FEWA 2E8IA 3PJAA 2YINA 3QB5A 3GWHA 3CMLA 4JI0T 2LEHA 4XBFB 1ZEEA 4PK4A 4ZI7E 1HTJF 3RKGA 3OPCA 4JI2T 3Q5WA 5FL1A 4GOUA 4DR6T 5FXXA 3PUWF 3RQUA 5DJQC 1R8IA 3RYHE 2JRKA 2VKOA 3ANWA 3PUXF 5F5WA 5JQGE 1D1BA 1E1HB 4B3MT 3DJBA 3C4XA 4ZHQE 4WBNE 5AQTB 2JMHA 4H9SE 4HWHA 3ZEFB 1HFAA 5HEJA 3CKDA 2W63A 1IJ5A 5H6QB 3ZKRA 1HG5A 3A8YC 1FMVA 1XDOA 5HXCA 1IBKT 3T8OA 1MNEA 3EI0A 4GIWA 3FXEB 4DV6T 4EYYR 3ZT5A 3M65A 4EOZB 4AQYT 1W9RA 5KXJA 2W67A 4C90A 5DQWA 3NVOA 5AQSB 1N32T 4TNWA 4AXPA 3J9X1 3PU8A 1SA0E 1J1JA 5L4HA 3ZSTA 4JI4T 2FJBA 4O2AE 5HXSA 3L8RA 1XMQT 4HWFA 1HCIA 2KWHA 3R84B 4PNIA 3RGLA 2W2UA 4QH4A 4WW0A 4O4HE 4A5XA 3OKQA 2BG9E 5FY0A 4DMWA 1WR6A 5LJNA 3N2GE 4DR7T 4MBQA 2YK0A 5EK3A 4LF7T 5J0ZA 4TX5A 3K3QC 2V5DA 2PFVA 3T1YT 3LJCA 1N36T 4JV5T 2BKNA 1H7CA 4DR1T 5AQFB 2N9DA 2YU2A 4KBMB 2MPKA 2XAJB 4DO0A 4U74A 3AVSA 4QH5A 3HI2A 5AQPB 2NTYA 4O4LE 1WYCA 4MLKA 3I0QA 3AXJB 2VL8A 2CE7A 2H88A 2OLTA 3EAMA 4CXWA 2BG9C 2PBIA 3TLWA 4CXYA 5L3CB 2V8SV 5M4YA 4COFA 3OYZA 4KHPT 2H7VC 4KMCA 4DV3T 1BR2A
chains in the Genus database with same CATH topology
2K48A 3P8CD 5JVDE 2EHOB 5EK4A 3WAKA 4L0RA 4O8SA 5J1GA 1HX8A 1ZHCA 4QXCB 5AFUL 1MMAA 2CCQA 3V5UA 2ZM0A 3ZLIA 2LHRA 2VKDA 3IBPA 3O4XE 2RP4A 1VOMA 3UT5E 3UUXB 1YKHB 3N9OA 1MMDA 2X68A 2P9BA 3KV4A 3RRWA 2LE8A 2E9XA 3LFMA 2DHRA 2ZLYA 4DMVA 2BVLA 4IE4A 3PUGA 3KINB 4FI5A 3RPUA 4O4JE 1OXZA 3E0ZA 3H37A 2D0TA 2DWKA 4PK6A 2E9XB 4PJMA 5HWYA 2W62A 3SRZA 1Y64B 4G63A 4H63H 2CXDA 4UV8B 2H3RA 5KDMC 5L3BB 4QXHB 4EZHA 4JLEA 5HXHA 4UF0B 2VB6A 5LGTB 3PUSA 2WMOA 5LA6E 2LOPA 2ODVA 3KVAA 3JC6D 3O1IA 4ZOLE 4ANJA 2CWYA 3ZJ1A 1YW0A 1MIYA 1MMGA 2OA5A 2EHOD 3LK3B 4QXBB 1UCUA 4HEAA 1YKEB 5DQVA 3GMIA 4BJMA 5EZYE 5LHHB 4P0BA 1WLXA 4PK5A 3HA4A 3O9XA 4ILUA 3MJXA 1D1CA 2XTLA 4MFRA 1UX5A 3IF8B 2BZBA 5KX5E 3E08A 4H63V 3ZYMA 4UIGA 4GK5E 3Q9DA 4HN9A 2VKHA 4O4IE 3SOLA 2K9AA 1MIWA 1LVKA 2KWIB 3ZYKA 2X51A 1MMNA 3N2KE 4H9QC 3OJAA 3R6NA 3C50A 5LCYA 1IZNB 2DNXA 4OYKA 2VKJA 4AKLA 1NAFA 2KZ7B 2CXLA 2V7KA 3S4UA 3MXZA 3AA0B 5FYMA 4UVAB 5LXTE 4AKIA 2V7MA 3PUQA 3ZCIA 5L3DB 4QX7B 3RX6A 2ZM2A 3KVBA 4AKRB 3LBXA 3AA1B 4XAXB 1G8XA 1S35A 3TKLB 3HKDE 4NUUA 3C51A 2LSYA 2LSGA 2UXNB 3RC3A 2PJQA 3N5LA 4QX8B 3V5SA 2WAUA 2XAFB 3K3NA 3ZN1B 3I9WA 2YU1A 5JH7E 3FXDB 4CXXA 1Z0PA 2C5IT 3NBXX 4FJOA 4HE8A 4OK0A 3N9QA 5CA1E 2Q9QD 2KMFA 3ZMZB 1FMWA 2LHNA 3KV6A 5LBMA 2VWAA 4E7ZA 4K0UA 5FNVE 4DBRA 2NW8A 4QHOA 5BMVE 5FY7A 3I1AA 4ZI2C 4PAGA 2X67A 3I9YA 3MK7C 3RYIE 3U78A 3ONXA 2LSKA 3PE0A 3AA6B 4HTEA 4I4TE 1CUNA 5E0OA 4ZS2A 5ETWA 2C5JA 5LBQB 5J2UE 4KP3C 1LKXA 5JDGA 3CQXC 1ZKEA 3AAAB 3KFWX 4X1KE 4BAYB 3BQLA 5H6RB 3ZJ2A 4B6XA 4MALA 1B7TA 2LM9A 2L3LA 2M67A 3GN5A 4N78D 5EK2A 3J7Yq 4X1YE 2KT9A 2GK9A 2IAKA 5FXZA 3BQIA 2MBGA 4IE0A 2KINB 3CX6B 4AQGA 3VKHA 3B13A 3N2OA 4PW8A 2X9WA 4TZ4C 1D0ZA 3C4WA 3ZC0A 4IIJE 3C98B 2XASB 3EVYA 3NZPA 2CMRA 2NP9A 2V7LA 3DP7A 3DTOA 1SHZC 1HG2A 3FBLA 1D1AA 1OWAA 2CM0A 4BJNA 5KMGP 1AJ3A 3UUNA 3UUMA 2CEAA 4OYJA 3VHLA 2DLRA 3AAIA 4H9PC 2X9YA 3ETUA 4QWNB 3OBVE 2LSJA 3F57A 4G2AA 3EUHA 2MYSA 5DABA 4JEHB 2Y6XA 4DNDA 2PG8A 2W0GA 2N2NA 2J1DG 4CQIA 3KBTA 1U4QA 2KXPB 3KV9A 4TN7B 4M1PA 2WBLA 2V1DB 4PJLA 2CLYB 3NZQA 4WNKA 5JR9C 3CWZB 3LK42 5CB4E 5F3JA 2ZM8A 4UXNB 1FIOA 1BR4A 5F8PA 5GONE 1KK7A 2QGSA 2XHEB 3UULA 5J2TE 2WWUA 3FHNA 4CI1B 1FEWA 2E8IA 2UXXB 4IGUA 4UV9B 2YINA 3Q2MA 4GYRA 2HPJA 3GWHA 5C8YE 3CMLA 1YD8G 2LEHA 2X66A 4UEMA 4ISTA 4XBFB 3ZN0B 1T98A 3N9NA 3HKBE 2CA5A 1EZ3A 1ZEEA 4PK4A 5LGNB 3L09A 3U3IA 5JRCA 5FY1A 2W61A 4Z8XA 4ZI7E 4AKHA 2IC9A 2E9XD 2I59A 1X79A 3PDYA 4HFVA 1HTJF 3JC6C 3Q5XA 4HGAA 5LP6E 3ZC1A 5LHIB 1IJ6A 2K5BB 3QC9A 3MA9A 4F6RC 5A1LA 5JRCB 1BR1A 2EHOC 4IHJE 3O1JA 4I43B 2X9XA 3B57A 3Q5WA 2ODUA 4GOUA 4QKNA 2JJ9A 2ZMAA 4I50E 5FXXA 3WI3A 3KBUA 4A56A 1US7B 3L3PA 1G73A 3LBXB 2Y8DA 3ESLA 4ZI3D 5DJQC 5JDFA 3CVRA 3H3AA 5JDLA 2X9HA 2X0LB 3RH3A 3RYHE 2JRKA 2NOXA 2W00A 2VKOA 2DCFA 3ANWA 3PURA 5JDNA 3ZMTB 5JQGE 1D1BA 2D2SA 4TUYE 2CWOA 1E1HB 4OFZA 2V7IA 3O1HA 1U5PA 3DJBA 2KLQA 3LG7A 4PJJA 4U72A 2NW9A 4MHCA 3C4XA 2LT3A 1KNZA 5JR9A 2QA7A 3UFEA 4ZHQE 4IE6A 5HXEA 4CI3B 5FXWA 4WBNE 2LJLA 5FXVA 3E22E 1WRDA 2C0SA 3C64A 3FB2A 3RYFE 3PTRB 4YLHA 2JMHA 1MIVA 3ZMVB 4WBOA 4DBQA 4H9SE 5LJMA 5L3GB 3ZEFB 3SS1A 4E7SA 5HYAA 3ZPOA 1HFAA 3NRYA 3K3OA 3SWHA 3N9LA 3CKDA 3K8PC 5HAXA 2XAHB 1QSDA 2D0UA 1WYBA 2W63A 2IW5B 3RYCE 4KUMB 1IJ5A 2XQYA 5H6QB 4YFSA 3HR0A 3RC8A 2Q9QC 3GA8A 3IHRA 4ASKA 4DVDA 2EHOA 2LOSA 3CPZA 1HG5A 1FMVA 1NWMX 5HXCA 3GN5B 1IAPA 5L2LA 5LHGB 1S94A 3T8OA 4H9RC 1QUUA 1MNEA 4GYSA 4BA9A 2LSIA 1ZV4X 3MKDA 2XUEA 3CX7B 1HS7A 4GIWA 3ZCJA 3FXEB 4C91A 2G0UA 3P7IA 3EDVA 2C5KT 2Z6EA 2WM9A 3CQGB 5IYZE 4UVBB 5ADXL 3N9MA 4H9NC 4EYYR 1MNDA 2XAGB 2D5UA 3ZMSB 2H7OA 3PUAA 3M65A 2ACXA 2HH7A 4YJ2E 3ZYLA 4JUYA 4EOZB 2RA1A 3PU3A 2Y48B 3W15B 4C90A 5JDMA 2V7JA 3QK6A 5DQWA 4CI2B 4PFPA 4UF0A 5LNKA 5HWXA 2N1GA 4UVCB 2VASA 3IEEA 3J9X1 4ADZA 4PJNA 4AXPA 2JMKA 4EIWA 2NWBA 5L3EB 3PU8A 4AKGA 2SPCA 1SA0E 3HL6A 2K24A 3FBZA 3BQKA 4AI6A 4EXTA 2DI4A 2MTQA 4IE5A 2A2FX 3AVRA 4HKAA 4O2AE 5HXSA 5CA0E 4P09A 4J2CA 3WAJA 4OHFA 1HCIA 4EB6E 4CZZB 2KWHA 2Q9QA 3R84B 4EAHA 4PNIA 3EDUA 3OYXA 3A5XA 1HF8A 3CX8B 4AQFC 4ISSA 3KV5A 5LGUB 2V26A 1O3XA 4WW0A 2Q9QB 5TAOA 3VKGA 3VU7H 4O4HE 3LK2B 1D0YA 4UELA 5FMNA 3OKQA 2CXFA 5FY0A 4DMWA 3KDSE 1WR6A 2HPLA 2YEVC 3D0TA 5JREA 4ZS3A 5LOVE 5LJNA 4X1IE 3N2GE 2MOZA 5JDHA 1VRBA 4MBQA 2YK0A 5EK3A 3RKOA 4P0AA 3UTKA 2NW7A 4IDZA 3ETVA 4TX5A 3K3QC 2JPFA 4O2BE 5L3FB 3QUJA 5FP3A 2KNDA 2PFVA 1LRZA 3BK9A 3HKCE 4ZI2D 3LJCA 3MACA 3NRXA 1V9DA 5HXRA 1H7CA 4EZ4A 2E9XC 4YHJA 3C4ZA 4I55E 3F31A 3ZMUB 3F2EA 3ANWB 2JQQA 2N9DA 4GK0E 2BVMA 2YU2A 3CQCB 3N9PA 4KBMB 2BDEA 2DWGA 3AA7B 2XAJB 2WSSV 4YJ3E 4DO0A 5JR9B 4U74A 3AVSA 4NUVA 1D0XA 4XZCA 4IE7A 2L9QA 2ES0A 3HI2A 2WMNA 1BR0A 2NTYA 4O4LE 1WYCA 2B1EA 4ZI3C 4EYUA 2CLYC 5IHYA 4MLKA 1LVFA 3I0QA 3AAEB 4TV9E 4X20E 2VL8A 2CE7A 3RRCA 5JDQA 2NTXA 4CXWA 4AQFA 2PBIA 4JEUB 3AB3B 2IC6A 5LG4A 4PFOA 3I0OA 4ERRA 4CXYA 4L9IA 5L3CB 5LYJE 2VK9A 3MZKB 1UX4A 4TV8E 5M4YA 2A3DA 2L8KA 3HKEE 4H9OC 3OYZA 2XAQB 2H7VC 4KMCA 4V1Av 2A72A 4L5GA 1BR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K48 A;  2C5J A;  3QK6 A;  3QUJ A;  3S4U A;  3MXZ A;  3FXE B;  1LRZ A;  1IJ6 A;  2G0U A;  2XTL A;  4L0R A;  1ZKE A;  3CKD A;  1QSD A;  3P7I A;  4B6X A;  1LVF A;  2X9X A;  1H7C A;  2C5K T;  1IJ5 A;  2X9Y A;  3TKL B;  4EYY R;  2IC6 A;  3L3P A;  2MBG A;  4DND A;  2KWI B;  3N5L A;  4J2C A;  2CA5 A;  2X9W A;  4CQI A;  3FXD B;  3CVR A;  4FI5 A;  2KWH A;  1Z0P A;  2C5I T;  2IC9 A; 
#chains in the Genus database with same CATH topology
 5JVD E;  5EK4 A;  4NIQ A;  1ZHC A;  4QXC B;  5AFU L;  2LHR A;  1N33 T;  4YT0 A;  4HWC A;  4ZZC A;  3LFM A;  2R6G F;  2JQK A;  1KEY A;  4FI5 A;  4IL9 A;  3RPU A;  1OXZ A;  3E0Z A;  3H37 A;  1HR0 T;  2DWK A;  5ABE A;  4UV8 B;  5L3B B;  1VCT A;  5ABF A;  2LRK A;  5LGT B;  2WMO A;  4Q25 A;  3JC6 D;  2V6Y A;  1YW0 A;  1MIY A;  3TLS A;  2EHO D;  4QXB B;  2BG9 A;  1YKE B;  5DQV A;  5LHH B;  5EZY E;  4P0B A;  4PK5 A;  3O9X A;  3MJX A;  4IL4 A;  5KX5 E;  2BZB A;  4H63 V;  5AQI B;  1HNZ T;  4UIG A;  4YY3 T;  3Q9D A;  4O4I E;  4LF8 T;  1LVK A;  2X0Y A;  5C2T A;  2X51 A;  3N2K E;  4LMK A;  4U31 A;  4LF9 T;  3S4U A;  3AA0 B;  5FYM A;  2V7M A;  2XPK A;  3AE1 A;  2VUR A;  5L3D B;  3RX6 A;  3AE5 A;  3HKD E;  3C51 A;  2WDQ A;  2LSG A;  2J62 A;  3RC3 A;  3N5L A;  4QX8 B;  3V5S A;  2XAF B;  4CXX A;  4FJO A;  4OK0 A;  4HE8 A;  2KMF A;  5LMU T;  4JI5 T;  4K0U A;  5FNV E;  1OED B;  3FZM B;  2UXD T;  5FY7 A;  3I1A A;  4YTP A;  4CN6 A;  4PAG A;  2X67 A;  3I9Y A;  3ONX A;  3PE0 A;  4NPP A;  1CUN A;  4Z90 A;  4U2Y A;  1HX1 B;  1LKX A;  2YN6 A;  3CQX C;  3AAA B;  3KFW X;  4X1K E;  4BAY B;  5H6R B;  2ACZ A;  4HFE A;  4TNV A;  1B7T A;  2M67 A;  2KT9 A;  5FVK A;  1JNR A;  4AQG A;  3VKH A;  3AE8 A;  4TZ4 C;  4IIJ E;  3C98 B;  3EVY A;  2CMR A;  2V7L A;  2CM0 A;  1AJ3 A;  2XQ5 A;  1E7P A;  3UUM A;  3AEE A;  2DLR A;  3AAI A;  3CIR A;  4IDO A;  4G2A A;  5AQK B;  4JEH B;  4DND A;  2N2N A;  1U4Q A;  1M7K A;  4JI8 T;  2CLY B;  5JR9 C;  3LK4 2;  2CPT A;  1BR4 A;  5F8P A;  2XZE A;  3FHN A;  3UQ4 A;  2XQA A;  3Q2M A;  2W66 A;  1YD8 G;  4UEM A;  1KFY A;  3ZN0 B;  3HKB E;  1EZ3 A;  3L09 A;  3U3I A;  5FY1 A;  2W61 A;  4AKH A;  2E9X D;  4HFV A;  2VVN A;  2A9U A;  3JC6 C;  3ZC1 A;  3QC9 A;  2K5B B;  5AQJ B;  5A1L A;  2AXD S;  2EHO C;  3O1J A;  2WZI A;  3B57 A;  1GQE A;  4LF6 T;  4QKN A;  2D9D A;  3LBX B;  3ESL A;  3H3A A;  2NOX A;  4ILA A;  2DCF A;  2CWO A;  4OFZ A;  2V7I A;  3LG7 A;  4PJJ A;  2BS2 A;  3LDQ B;  5JR9 A;  5HXE A;  3RF1 A;  4DV0 T;  5AQG B;  3E22 E;  1WRD A;  3C64 A;  3FB2 A;  4YLH A;  3P4R A;  2WU2 A;  1MIV A;  3ZMV B;  4WBO A;  5L3G B;  2XM1 A;  3SWH A;  2CRB A;  1T8B A;  2XM2 A;  2XAH B;  2IW5 B;  3RYC E;  1WYB A;  2XQY A;  3OVU A;  2XQ9 A;  3RIA A;  2EHO A;  2LOS A;  3TLU A;  1NWM X;  5LHG B;  4TWD A;  5HEO A;  1S94 A;  4H9R C;  5AQM B;  1QUU A;  4AIU A;  3ZCJ A;  5L4E A;  4LML A;  4P1N A;  3EDV A;  2YDR A;  4UVB B;  2XAG B;  2D5U A;  4IRE A;  2ACX A;  2Y48 B;  3QK6 A;  2QYW A;  4UF0 A;  3L39 A;  2VAS A;  4ADZ A;  4PJN A;  2NWB A;  4JBW F;  3FBZ A;  2DI4 A;  5CA0 E;  4OHF A;  2IIU A;  3AE2 A;  3OYX A;  4AQF C;  3CX8 B;  3QOF A;  1O3X A;  4U7I A;  1NEK A;  3VU7 H;  5HEH A;  4UEL A;  5FMN A;  5JRE A;  3D0T A;  4ZS3 A;  2W4X A;  5JDH A;  1W0B A;  4P0A A;  3P4W A;  2NW7 A;  3ETV A;  2JPF A;  4O2B E;  3QUJ A;  5BR8 T;  1LRZ A;  4ZI2 D;  2E9X C;  4YHJ A;  3ZMU B;  2XJ7 A;  3F2E A;  4ILC A;  5CGM A;  4HFC A;  3UU6 A;  2BVM A;  3CQC B;  4CN4 A;  4X62 T;  2RPA A;  5L47 A;  1Z8U A;  4YJ3 E;  4GKK T;  3RQW A;  4ZXL A;  3FZF B;  4EYU A;  5IHY A;  4TV9 E;  4X20 E;  5JDQ A;  4AQF A;  3AB3 B;  3K1S A;  4TWH A;  5LYJ E;  4DV1 T;  2L8K A;  3HKE E;  2HHH T;  2ZM6 T;  3ONL C;  4HFH A;  3WAK A;  2WCA A;  4O8S A;  2LLY A;  1MMA A;  2CCQ A;  3O4X E;  4JI6 T;  3UT5 E;  3UUX B;  1YKH B;  1MMD A;  3VR9 A;  2P9B A;  3KV4 A;  3RRW A;  2LE8 A;  2E9X A;  2CBJ A;  1N34 T;  4IE4 A;  2D0T A;  2W62 A;  3SRZ A;  3T1H T;  4H63 H;  1UK5 A;  4EZH A;  1E2A A;  2VQF T;  4JLE A;  5HXH A;  5LA6 E;  3KVA A;  3O1I A;  3NWI A;  4ZOL E;  3AE9 A;  2CWY A;  1MMG A;  2BS3 A;  3LK3 B;  4HEA A;  4YHH T;  2V6Y B;  2IHR 1;  1WLX A;  2YDQ A;  2BG9 B;  1NEN A;  2YKS A;  4HN9 A;  4JI3 T;  3SOL A;  1J5W A;  2BBJ A;  4YTM A;  1XMO T;  2KWI B;  2JIW A;  3ZYK A;  3R6N A;  4OYK A;  4AKL A;  1NAF A;  4AKI A;  3ZCI A;  3KVB A;  4AKR B;  3AA1 B;  4XAX B;  2IML A;  4NUU A;  3RHW A;  2UXN B;  3ONJ A;  2LRL A;  4TWF A;  4DID B;  2WAU A;  3K3N A;  3SFD A;  2YU1 A;  5JH7 E;  3QB5 K;  3FXD B;  2C5I T;  3NBX X;  2IDO B;  5CA1 E;  2Q9Q D;  2LHN A;  5LBM A;  4E7Z A;  4DUZ T;  1JNZ A;  2B76 A;  2NW8 A;  2UU9 T;  4ZI2 C;  3FZH B;  3RYI E;  2LSK A;  4HTE A;  5ABG A;  4ZS2 A;  1I6Z A;  5J2U E;  4KP3 C;  5JDG A;  4WZX A;  3J7Y q;  5EK2 A;  3QNU A;  2E2A A;  3B13 A;  1D0Z A;  3C4W A;  2KSR A;  5AQO B;  2NP9 A;  3DTO A;  4BJN A;  5KMG P;  2XSB A;  3VRA A;  4OYJ A;  4H9P C;  3ETU A;  1KNR A;  3EUH A;  2CHO A;  2W0G A;  2J1D G;  2KXP B;  1VCS A;  4LF4 T;  5CB4 E;  5F3J A;  2ZM8 A;  1FIO A;  1SUM B;  5GON E;  1KK7 A;  2QGS A;  2WWU A;  2UXX B;  4UV9 B;  3JAF A;  4GYR A;  5JTG A;  5AQV B;  2JQH A;  5JRC A;  2I59 A;  1X79 A;  4HGA A;  3RIF A;  3MA9 A;  4F6R C;  4IHJ E;  2X9X A;  2FUP A;  2QVA A;  2XQ8 A;  4I50 E;  3WI3 A;  1US7 B;  3L3P A;  1G73 A;  2YDS A;  5FL0 A;  2I6H A;  3CVR A;  2WZH A;  5JDL A;  4LFA T;  3RH3 A;  4I0U A;  2W00 A;  4X5T A;  4WYV A;  3O1H A;  2KLQ A;  4U72 A;  2NW9 A;  4DV4 T;  2LT3 A;  1KNZ A;  2V5C A;  4X66 T;  3UFE A;  4CI3 B;  5FXW A;  4DUY T;  2CBI A;  2BS4 A;  3RYF E;  4LF5 T;  2VVS A;  3X1D A;  4DBQ A;  3AEG A;  3SS1 A;  4EGW A;  3ZPO A;  1W09 A;  3K3O A;  3K8P C;  5HEU A;  5HAX A;  3UFG A;  5C3J A;  2J47 A;  4YFS A;  1YQ4 A;  2Q9Q C;  3AE6 A;  2K3W A;  3GN5 B;  1IAP A;  2H89 A;  4F8H A;  4ZEY A;  3MKD A;  4C91 A;  4IDQ A;  3P7I A;  4Z91 A;  3VRB A;  2C5K T;  3CQG B;  5IYZ E;  2WS3 A;  5ADX L;  1MND A;  3JAD A;  3ZMS B;  2H7O A;  2HH7 A;  1ZP0 A;  5CJ5 A;  2XSA A;  3IA3 A;  4PFP A;  5LNK A;  4UVC B;  4EIW A;  2SPC A;  3BQK A;  4AI6 A;  4EXT A;  2MTQ A;  4IE5 A;  4HKA A;  2OV9 A;  4J2C A;  4IT4 A;  3WAJ A;  4EB6 E;  4CZZ B;  3ZT6 A;  3EHZ A;  2Q9Q A;  4EAH A;  2YOE A;  3EDU A;  3UU8 A;  3A5X A;  4IDP A;  1HF8 A;  5LGU B;  4ISS A;  2F4V T;  1HNX T;  5TAO A;  3VKG A;  4CN1 A;  4DR4 T;  2HPL A;  5LOV E;  4X1I E;  3RKO A;  1YXR A;  2WP9 A;  5AQQ B;  4AIS A;  5FP3 A;  2KND A;  1DU2 A;  3MAC A;  2VL0 A;  4KI0 F;  4EZ4 A;  3C4Z A;  3ANW B;  2E5L T;  3N9P A;  2V6X A;  2BDE A;  3AA7 B;  4DV2 T;  5FVL A;  2FJD A;  4NUV A;  1OED A;  4U2Z A;  4XZC A;  2L9Q A;  2ES0 A;  1UUS A;  2WMN A;  2B1E A;  2BKO A;  2CLY C;  3AAE B;  2NR4 A;  2NTX A;  4LFB T;  4JEU B;  5LG4 A;  4PFO A;  3I0O A;  4L9I A;  2VK9 A;  4X64 T;  4TV8 E;  4H9O C;  4V1A v;  4L5G A;  3RLF F;  4NXM T;  5J1G A;  1HX8 A;  1CHU A;  3ZLI A;  4EEB A;  1VOM A;  3N9O A;  4HFB A;  2X68 A;  2UUC T;  4YSZ A;  3AE3 A;  2DHR A;  2ZLY A;  2BVL A;  3KIN B;  1KF6 A;  1L0V A;  1UGO A;  2XY8 B;  4O4J E;  4PK6 A;  5IUX A;  2E9X B;  5HWY A;  1Y64 B;  4G63 A;  2CXD A;  4U7Y A;  2H3R A;  4JYA T;  4QXH B;  2WDR A;  2VB6 A;  3PUS A;  2IUB A;  2OA5 A;  3GMI A;  4BJM A;  4EV6 A;  3HA4 A;  1D1C A;  2XTL A;  1UX5 A;  3IF8 B;  3M3Z B;  2VKH A;  1ZOY A;  1MIW A;  5LG3 A;  2WB5 A;  1IZN B;  2KZ7 B;  2CXL A;  2V7K A;  3MXZ A;  3FZK B;  4QH1 A;  1UUR A;  3PUQ A;  2ZM2 A;  3LBX A;  3TKL B;  2PJQ A;  3ZN1 B;  4YSY A;  3G06 A;  4JI1 T;  3N9Q A;  1FMW A;  1T7S A;  3CK6 A;  5FKY A;  5HEG A;  4DBR A;  5BMV E;  1QLB A;  2UUA T;  3AE4 A;  3PV0 F;  2FJA A;  3MK7 C;  2M6B A;  4K0K T;  1T72 A;  3ZJ2 A;  4B6X A;  3ZT7 A;  2LM9 A;  2L3L A;  4N78 D;  4YTN A;  2GK9 A;  3AEB A;  5FXZ A;  3BQI A;  4IE0 A;  3CX6 B;  3LSV A;  3N2O A;  4YXD A;  2X9W A;  2BBH A;  3ZC0 A;  3NZP A;  4JI7 T;  3AEA A;  1SHZ C;  3FBL A;  3RIU C;  1D1A A;  2CEA A;  4QWN B;  3OBV E;  2LSJ A;  2MYS A;  5DAB A;  3UQ7 A;  5ABF B;  3KV9 A;  4M1P A;  4U3C A;  4PJL A;  4WNK A;  3SFE A;  2FBW A;  2M6I A;  3UUL A;  2VQE T;  3VR8 A;  1KNP A;  5AQU B;  4IGU A;  2WY2 A;  2HPJ A;  3AEF A;  5C8Y E;  2X66 A;  4IST A;  1T98 A;  3N9N A;  2CA5 A;  5LGN B;  4Z8X A;  2IC9 A;  3PDY A;  3Q5X A;  5LP6 E;  1J5E T;  3AE7 A;  3EAB A;  3PJA J;  5LHI B;  1IJ6 A;  5JRC B;  1BR1 A;  4I43 B;  2ODU A;  5ABH A;  2JJ9 A;  2ZMA A;  3RIU A;  4A56 A;  3KBU A;  1I94 T;  3TLV A;  2Y8D A;  4ZI3 D;  5JDF A;  5AQH B;  2X9H A;  2X0L B;  3PUR A;  5JDN A;  2AE9 A;  3ZMT B;  2D2S A;  4TUY E;  1U5P A;  4MHC A;  2QA7 A;  4IE6 A;  2LJL A;  5FXV A;  2C0S A;  3UU4 A;  3PUY F;  3PTR B;  3AEC A;  4DV7 T;  4DV5 T;  3JCF A;  5LJM A;  4E7S A;  5HYA A;  3NRY A;  2XQ4 A;  3N9L A;  2WQY A;  1QSD A;  2D0U A;  3A7M A;  1YQ3 A;  4KUM B;  3HR0 A;  3RC8 A;  3GA8 A;  3IHR A;  4ASK A;  4DVD A;  3CPZ A;  4ZZB A;  2WWV A;  3ABV A;  3NKZ A;  3P4S A;  1FJG T;  5L2L A;  4GYS A;  4BA9 A;  2LSI A;  1ZV4 X;  1Y01 A;  2XUE A;  3CX7 B;  1HS7 A;  2G0U A;  2WU5 A;  2Z6E A;  2WM9 A;  1IBL T;  3N9M A;  1X9B A;  4H9N C;  1XNR T;  4B3R T;  2CHN A;  4OX9 T;  3PUA A;  4HWD A;  4YJ2 E;  2E5V A;  4JUY A;  3ZYL A;  5CFB A;  2RA1 A;  3PU3 A;  3H3M A;  2HN1 A;  2HN2 A;  1WFD A;  3W15 B;  5JDM A;  2V7J A;  4CI2 B;  5IWA T;  2UUB T;  5HWX A;  2N1G A;  3IEE A;  5L3E B;  2JMK A;  4AKG A;  3HL6 A;  2K24 A;  4UR9 A;  2A2F X;  3AVR A;  4P09 A;  2WDV A;  3Q5D A;  3KV5 A;  4X65 T;  2V26 A;  3Q5E A;  2Q9Q B;  3LK2 B;  1D0Y A;  2CXF A;  3KDS E;  2YEV C;  1IBM T;  2MOZ A;  1VRB A;  3UTK A;  4IDZ A;  5L3F B;  5HCJ A;  3BK9 A;  2XQ3 A;  3HKC E;  3NRX A;  1V9D A;  5HXR A;  4I55 E;  3F31 A;  1WR0 A;  2JQQ A;  4GK0 E;  2FJE A;  2DWG A;  2XQ7 A;  1XDP A;  2WSS V;  5JR9 B;  5AQL B;  1D0X A;  5AQN B;  4IE7 A;  3AXJ A;  1BR0 A;  4ZI3 C;  3P4Q A;  1LVF A;  3FZL B;  3RRC A;  4A98 A;  2IC6 A;  2QRX A;  4ERR A;  4GKJ T;  3MZK B;  1UX4 A;  1OED E;  2A3D A;  2JQ9 A;  1M62 A;  2XAQ B;  3P4P A;  4ILB A;  2A72 A;  2K48 A;  3P8C D;  2EHO B;  3UU3 A;  4L0R A;  3V5U A;  2ZM0 A;  2VKD A;  3IBP A;  2RP4 A;  4EED A;  4YSX A;  4DMV A;  3PUZ F;  3PUG A;  4HWI B;  4HFI A;  2BKP A;  4PJM A;  2LM2 A;  3AED A;  5KDM C;  4UF0 B;  2LOP A;  2ODV A;  1OED C;  4ANJ A;  3P50 A;  3ZJ1 A;  2DL1 A;  2XQ6 A;  1UCU A;  4ILU A;  4MFR A;  3E08 A;  3ZYM A;  3UU5 A;  3JAE A;  4GK5 E;  4LFC T;  4DR3 T;  4B3T T;  1HNW T;  2K9A A;  2PTF A;  1MMN A;  4H9Q C;  3OJA A;  3C50 A;  4DR2 T;  5LCY A;  2DNX A;  4B3S T;  2VKJ A;  4UVA B;  5LXT E;  2I0M A;  4QX7 B;  5LB7 B;  1G8X A;  1S35 A;  2LSY A;  3PUV F;  3I9W A;  3ZSS A;  2UXB T;  1Z0P A;  1XNQ T;  2LKH A;  3ZMZ B;  5HCM A;  3KV6 A;  2VWA A;  4QHO A;  2UXC T;  3TLT A;  4IDN A;  2J4G A;  4A97 A;  5LMN T;  3U78 A;  4HFD A;  3UUB A;  3AA6 B;  4I4T E;  5E0O A;  5ETW A;  2C5J A;  5LBQ B;  1ZKE A;  3BQL A;  4MAL A;  3GN5 A;  1SE7 A;  4X1Y E;  2IAK A;  2MBG A;  2KIN B;  4PW8 A;  3OTO T;  1WCR A;  2XAS B;  3DP7 A;  1W0A A;  5AQR B;  4DR5 T;  1HG2 A;  1OWA A;  3UUN A;  3VHL A;  4KHZ F;  2X9Y A;  2X0H A;  4NXN T;  3RI5 A;  4KX6 A;  3F57 A;  2Y6X A;  3B5M A;  2LKG A;  2PG8 A;  1XWM A;  4CQI A;  3KBT A;  2MAW A;  4TN7 B;  4U33 A;  2WBL A;  2V1D B;  3NZQ A;  1XZY A;  3CWZ B;  4UXN B;  4LMJ A;  2XHE B;  5J2T E;  4CI1 B;  1FEW A;  2E8I A;  3PJA A;  2YIN A;  3QB5 A;  3GWH A;  3CML A;  4JI0 T;  2LEH A;  4XBF B;  1ZEE A;  4PK4 A;  4ZI7 E;  1HTJ F;  3RKG A;  3OPC A;  4JI2 T;  3Q5W A;  5FL1 A;  4GOU A;  4DR6 T;  5FXX A;  3PUW F;  3RQU A;  5DJQ C;  1R8I A;  3RYH E;  2JRK A;  2VKO A;  3ANW A;  3PUX F;  5F5W A;  5JQG E;  1D1B A;  1E1H B;  4B3M T;  3DJB A;  3C4X A;  4ZHQ E;  4WBN E;  5AQT B;  2JMH A;  4H9S E;  4HWH A;  3ZEF B;  1HFA A;  5HEJ A;  3CKD A;  2W63 A;  1IJ5 A;  5H6Q B;  3ZKR A;  1HG5 A;  3A8Y C;  1FMV A;  1XDO A;  5HXC A;  1IBK T;  3T8O A;  1MNE A;  3EI0 A;  4GIW A;  3FXE B;  4DV6 T;  4EYY R;  3ZT5 A;  3M65 A;  4EOZ B;  4AQY T;  1W9R A;  5KXJ A;  2W67 A;  4C90 A;  5DQW A;  3NVO A;  5AQS B;  1N32 T;  4TNW A;  4AXP A;  3J9X 1;  3PU8 A;  1SA0 E;  1J1J A;  5L4H A;  3ZST A;  4JI4 T;  2FJB A;  4O2A E;  5HXS A;  3L8R A;  1XMQ T;  4HWF A;  1HCI A;  2KWH A;  3R84 B;  4PNI A;  3RGL A;  2W2U A;  4QH4 A;  4WW0 A;  4O4H E;  4A5X A;  3OKQ A;  2BG9 E;  5FY0 A;  4DMW A;  1WR6 A;  5LJN A;  3N2G E;  4DR7 T;  4MBQ A;  2YK0 A;  5EK3 A;  4LF7 T;  5J0Z A;  4TX5 A;  3K3Q C;  2V5D A;  2PFV A;  3T1Y T;  3LJC A;  1N36 T;  4JV5 T;  2BKN A;  1H7C A;  4DR1 T;  5AQF B;  2N9D A;  2YU2 A;  4KBM B;  2MPK A;  2XAJ B;  4DO0 A;  4U74 A;  3AVS A;  4QH5 A;  3HI2 A;  5AQP B;  2NTY A;  4O4L E;  1WYC A;  4MLK A;  3I0Q A;  3AXJ B;  2VL8 A;  2CE7 A;  2H88 A;  2OLT A;  3EAM A;  4CXW A;  2BG9 C;  2PBI A;  3TLW A;  4CXY A;  5L3C B;  2V8S V;  5M4Y A;  4COF A;  3OYZ A;  4KHP T;  2H7V C;  4KMC A;  4DV3 T;  1BR2 A; 
#chains in the Genus database with same CATH homology
 2K48 A;  3P8C D;  5JVD E;  2EHO B;  5EK4 A;  3WAK A;  4L0R A;  4O8S A;  5J1G A;  1HX8 A;  1ZHC A;  4QXC B;  5AFU L;  1MMA A;  2CCQ A;  3V5U A;  2ZM0 A;  3ZLI A;  2LHR A;  2VKD A;  3IBP A;  3O4X E;  2RP4 A;  1VOM A;  3UT5 E;  3UUX B;  1YKH B;  3N9O A;  1MMD A;  2X68 A;  2P9B A;  3KV4 A;  3RRW A;  2LE8 A;  2E9X A;  3LFM A;  2DHR A;  2ZLY A;  4DMV A;  2BVL A;  4IE4 A;  3PUG A;  3KIN B;  4FI5 A;  3RPU A;  4O4J E;  1OXZ A;  3E0Z A;  3H37 A;  2D0T A;  2DWK A;  4PK6 A;  2E9X B;  4PJM A;  5HWY A;  2W62 A;  3SRZ A;  1Y64 B;  4G63 A;  4H63 H;  2CXD A;  4UV8 B;  2H3R A;  5KDM C;  5L3B B;  4QXH B;  4EZH A;  4JLE A;  5HXH A;  4UF0 B;  2VB6 A;  5LGT B;  3PUS A;  2WMO A;  5LA6 E;  2LOP A;  2ODV A;  3KVA A;  3JC6 D;  3O1I A;  4ZOL E;  4ANJ A;  2CWY A;  3ZJ1 A;  1YW0 A;  1MIY A;  1MMG A;  2OA5 A;  2EHO D;  3LK3 B;  4QXB B;  1UCU A;  4HEA A;  1YKE B;  5DQV A;  3GMI A;  4BJM A;  5EZY E;  5LHH B;  4P0B A;  1WLX A;  4PK5 A;  3HA4 A;  3O9X A;  4ILU A;  3MJX A;  1D1C A;  2XTL A;  4MFR A;  1UX5 A;  3IF8 B;  2BZB A;  5KX5 E;  3E08 A;  4H63 V;  3ZYM A;  4UIG A;  4GK5 E;  3Q9D A;  4HN9 A;  2VKH A;  4O4I E;  3SOL A;  2K9A A;  1MIW A;  1LVK A;  2KWI B;  3ZYK A;  2X51 A;  1MMN A;  3N2K E;  4H9Q C;  3OJA A;  3R6N A;  3C50 A;  5LCY A;  1IZN B;  2DNX A;  4OYK A;  2VKJ A;  4AKL A;  1NAF A;  2KZ7 B;  2CXL A;  2V7K A;  3S4U A;  3MXZ A;  3AA0 B;  5FYM A;  4UVA B;  5LXT E;  4AKI A;  2V7M A;  3PUQ A;  3ZCI A;  5L3D B;  4QX7 B;  3RX6 A;  2ZM2 A;  3KVB A;  4AKR B;  3LBX A;  3AA1 B;  4XAX B;  1G8X A;  1S35 A;  3TKL B;  3HKD E;  4NUU A;  3C51 A;  2LSY A;  2LSG A;  2UXN B;  3RC3 A;  2PJQ A;  3N5L A;  4QX8 B;  3V5S A;  2WAU A;  2XAF B;  3K3N A;  3ZN1 B;  3I9W A;  2YU1 A;  5JH7 E;  3FXD B;  4CXX A;  1Z0P A;  2C5I T;  3NBX X;  4FJO A;  4HE8 A;  4OK0 A;  3N9Q A;  5CA1 E;  2Q9Q D;  2KMF A;  3ZMZ B;  1FMW A;  2LHN A;  3KV6 A;  5LBM A;  2VWA A;  4E7Z A;  4K0U A;  5FNV E;  4DBR A;  2NW8 A;  4QHO A;  5BMV E;  5FY7 A;  3I1A A;  4ZI2 C;  4PAG A;  2X67 A;  3I9Y A;  3MK7 C;  3RYI E;  3U78 A;  3ONX A;  2LSK A;  3PE0 A;  3AA6 B;  4HTE A;  4I4T E;  1CUN A;  5E0O A;  4ZS2 A;  5ETW A;  2C5J A;  5LBQ B;  5J2U E;  4KP3 C;  1LKX A;  5JDG A;  3CQX C;  1ZKE A;  3AAA B;  3KFW X;  4X1K E;  4BAY B;  3BQL A;  5H6R B;  3ZJ2 A;  4B6X A;  4MAL A;  1B7T A;  2LM9 A;  2L3L A;  2M67 A;  3GN5 A;  4N78 D;  5EK2 A;  3J7Y q;  4X1Y E;  2KT9 A;  2GK9 A;  2IAK A;  5FXZ A;  3BQI A;  2MBG A;  4IE0 A;  2KIN B;  3CX6 B;  4AQG A;  3VKH A;  3B13 A;  3N2O A;  4PW8 A;  2X9W A;  4TZ4 C;  1D0Z A;  3C4W A;  3ZC0 A;  4IIJ E;  3C98 B;  2XAS B;  3EVY A;  3NZP A;  2CMR A;  2NP9 A;  2V7L A;  3DP7 A;  3DTO A;  1SHZ C;  1HG2 A;  3FBL A;  1D1A A;  1OWA A;  2CM0 A;  4BJN A;  5KMG P;  1AJ3 A;  3UUN A;  3UUM A;  2CEA A;  4OYJ A;  3VHL A;  2DLR A;  3AAI A;  4H9P C;  2X9Y A;  3ETU A;  4QWN B;  3OBV E;  2LSJ A;  3F57 A;  4G2A A;  3EUH A;  2MYS A;  5DAB A;  4JEH B;  2Y6X A;  4DND A;  2PG8 A;  2W0G A;  2N2N A;  2J1D G;  4CQI A;  3KBT A;  1U4Q A;  2KXP B;  3KV9 A;  4TN7 B;  4M1P A;  2WBL A;  2V1D B;  4PJL A;  2CLY B;  3NZQ A;  4WNK A;  5JR9 C;  3CWZ B;  3LK4 2;  5CB4 E;  5F3J A;  2ZM8 A;  4UXN B;  1FIO A;  1BR4 A;  5F8P A;  5GON E;  1KK7 A;  2QGS A;  2XHE B;  3UUL A;  5J2T E;  2WWU A;  3FHN A;  4CI1 B;  1FEW A;  2E8I A;  2UXX B;  4IGU A;  4UV9 B;  2YIN A;  3Q2M A;  4GYR A;  2HPJ A;  3GWH A;  5C8Y E;  3CML A;  1YD8 G;  2LEH A;  2X66 A;  4UEM A;  4IST A;  4XBF B;  3ZN0 B;  1T98 A;  3N9N A;  3HKB E;  2CA5 A;  1EZ3 A;  1ZEE A;  4PK4 A;  5LGN B;  3L09 A;  3U3I A;  5JRC A;  5FY1 A;  2W61 A;  4Z8X A;  4ZI7 E;  4AKH A;  2IC9 A;  2E9X D;  2I59 A;  1X79 A;  3PDY A;  4HFV A;  1HTJ F;  3JC6 C;  3Q5X A;  4HGA A;  5LP6 E;  3ZC1 A;  5LHI B;  1IJ6 A;  2K5B B;  3QC9 A;  3MA9 A;  4F6R C;  5A1L A;  5JRC B;  1BR1 A;  2EHO C;  4IHJ E;  3O1J A;  4I43 B;  2X9X A;  3B57 A;  3Q5W A;  2ODU A;  4GOU A;  4QKN A;  2JJ9 A;  2ZMA A;  4I50 E;  5FXX A;  3WI3 A;  3KBU A;  4A56 A;  1US7 B;  3L3P A;  1G73 A;  3LBX B;  2Y8D A;  3ESL A;  4ZI3 D;  5DJQ C;  5JDF A;  3CVR A;  3H3A A;  5JDL A;  2X9H A;  2X0L B;  3RH3 A;  3RYH E;  2JRK A;  2NOX A;  2W00 A;  2VKO A;  2DCF A;  3ANW A;  3PUR A;  5JDN A;  3ZMT B;  5JQG E;  1D1B A;  2D2S A;  4TUY E;  2CWO A;  1E1H B;  4OFZ A;  2V7I A;  3O1H A;  1U5P A;  3DJB A;  2KLQ A;  3LG7 A;  4PJJ A;  4U72 A;  2NW9 A;  4MHC A;  3C4X A;  2LT3 A;  1KNZ A;  5JR9 A;  2QA7 A;  3UFE A;  4ZHQ E;  4IE6 A;  5HXE A;  4CI3 B;  5FXW A;  4WBN E;  2LJL A;  5FXV A;  3E22 E;  1WRD A;  2C0S A;  3C64 A;  3FB2 A;  3RYF E;  3PTR B;  4YLH A;  2JMH A;  1MIV A;  3ZMV B;  4WBO A;  4DBQ A;  4H9S E;  5LJM A;  5L3G B;  3ZEF B;  3SS1 A;  4E7S A;  5HYA A;  3ZPO A;  1HFA A;  3NRY A;  3K3O A;  3SWH A;  3N9L A;  3CKD A;  3K8P C;  5HAX A;  2XAH B;  1QSD A;  2D0U A;  1WYB A;  2W63 A;  2IW5 B;  3RYC E;  4KUM B;  1IJ5 A;  2XQY A;  5H6Q B;  4YFS A;  3HR0 A;  3RC8 A;  2Q9Q C;  3GA8 A;  3IHR A;  4ASK A;  4DVD A;  2EHO A;  2LOS A;  3CPZ A;  1HG5 A;  1FMV A;  1NWM X;  5HXC A;  3GN5 B;  1IAP A;  5L2L A;  5LHG B;  1S94 A;  3T8O A;  4H9R C;  1QUU A;  1MNE A;  4GYS A;  4BA9 A;  2LSI A;  1ZV4 X;  3MKD A;  2XUE A;  3CX7 B;  1HS7 A;  4GIW A;  3ZCJ A;  3FXE B;  4C91 A;  2G0U A;  3P7I A;  3EDV A;  2C5K T;  2Z6E A;  2WM9 A;  3CQG B;  5IYZ E;  4UVB B;  5ADX L;  3N9M A;  4H9N C;  4EYY R;  1MND A;  2XAG B;  2D5U A;  3ZMS B;  2H7O A;  3PUA A;  3M65 A;  2ACX A;  2HH7 A;  4YJ2 E;  3ZYL A;  4JUY A;  4EOZ B;  2RA1 A;  3PU3 A;  2Y48 B;  3W15 B;  4C90 A;  5JDM A;  2V7J A;  3QK6 A;  5DQW A;  4CI2 B;  4PFP A;  4UF0 A;  5LNK A;  5HWX A;  2N1G A;  4UVC B;  2VAS A;  3IEE A;  3J9X 1;  4ADZ A;  4PJN A;  4AXP A;  2JMK A;  4EIW A;  2NWB A;  5L3E B;  3PU8 A;  4AKG A;  2SPC A;  1SA0 E;  3HL6 A;  2K24 A;  3FBZ A;  3BQK A;  4AI6 A;  4EXT A;  2DI4 A;  2MTQ A;  4IE5 A;  2A2F X;  3AVR A;  4HKA A;  4O2A E;  5HXS A;  5CA0 E;  4P09 A;  4J2C A;  3WAJ A;  4OHF A;  1HCI A;  4EB6 E;  4CZZ B;  2KWH A;  2Q9Q A;  3R84 B;  4EAH A;  4PNI A;  3EDU A;  3OYX A;  3A5X A;  1HF8 A;  3CX8 B;  4AQF C;  4ISS A;  3KV5 A;  5LGU B;  2V26 A;  1O3X A;  4WW0 A;  2Q9Q B;  5TAO A;  3VKG A;  3VU7 H;  4O4H E;  3LK2 B;  1D0Y A;  4UEL A;  5FMN A;  3OKQ A;  2CXF A;  5FY0 A;  4DMW A;  3KDS E;  1WR6 A;  2HPL A;  2YEV C;  3D0T A;  5JRE A;  4ZS3 A;  5LOV E;  5LJN A;  4X1I E;  3N2G E;  2MOZ A;  5JDH A;  1VRB A;  4MBQ A;  2YK0 A;  5EK3 A;  3RKO A;  4P0A A;  3UTK A;  2NW7 A;  4IDZ A;  3ETV A;  4TX5 A;  3K3Q C;  2JPF A;  4O2B E;  5L3F B;  3QUJ A;  5FP3 A;  2KND A;  2PFV A;  1LRZ A;  3BK9 A;  3HKC E;  4ZI2 D;  3LJC A;  3MAC A;  3NRX A;  1V9D A;  5HXR A;  1H7C A;  4EZ4 A;  2E9X C;  4YHJ A;  3C4Z A;  4I55 E;  3F31 A;  3ZMU B;  3F2E A;  3ANW B;  2JQQ A;  2N9D A;  4GK0 E;  2BVM A;  2YU2 A;  3CQC B;  3N9P A;  4KBM B;  2BDE A;  2DWG A;  3AA7 B;  2XAJ B;  2WSS V;  4YJ3 E;  4DO0 A;  5JR9 B;  4U74 A;  3AVS A;  4NUV A;  1D0X A;  4XZC A;  4IE7 A;  2L9Q A;  2ES0 A;  3HI2 A;  2WMN A;  1BR0 A;  2NTY A;  4O4L E;  1WYC A;  2B1E A;  4ZI3 C;  4EYU A;  2CLY C;  5IHY A;  4MLK A;  1LVF A;  3I0Q A;  3AAE B;  4TV9 E;  4X20 E;  2VL8 A;  2CE7 A;  3RRC A;  5JDQ A;  2NTX A;  4CXW A;  4AQF A;  2PBI A;  4JEU B;  3AB3 B;  2IC6 A;  5LG4 A;  4PFO A;  3I0O A;  4ERR A;  4CXY A;  4L9I A;  5L3C B;  5LYJ E;  2VK9 A;  3MZK B;  1UX4 A;  4TV8 E;  5M4Y A;  2A3D A;  2L8K A;  3HKE E;  4H9O C;  3OYZ A;  2XAQ B;  2H7V C;  4KMC A;  4V1A v;  2A72 A;  4L5G A;  1BR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...