4B6XA

Crystal structure of in planta processed avrrps4
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
69
structure length
69
Chain Sequence
b'GAGAALRQEIEDKQLMVNNLTDELQDAIDEANPAEIANTSQQLRHARADLADLQRRFAVLRNEDRRINQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AVIRULENCE PROTEIN
molecule tags Toxin
source organism Pseudomonas syringae pv. pisi
publication title Distinct Regions of the Pseudomonas Syringae Coiled-Coil Effector Avrrps4 are Required for Activation of Immunity.
pubmed doi rcsb
total genus 29
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4b6xA00
2C5KT 1ZKEA 3MXZA 2MBGA 3CKDA 2CA5A 4CQIA 2IC9A 2X9XA 4B6XA 2X9YA 2K48A 2G0UA 4FI5A 3S4UA 2KWHA 1IJ5A 4EYYR 2XTLA 4L0RA 3FXEB 4DNDA 2IC6A 3N5LA 3QUJA 1LVFA 1Z0PA 2C5IT 1IJ6A 3QK6A 2KWIB 3P7IA 4J2CA 2C5JA 1H7CA 1QSDA 1LRZA 3TKLB 3CVRA 2X9WA 3L3PA 3FXDB
chains in the Genus database with same CATH superfamily
4LF6T 4WNKA 3N2OA 5L4HA 2JMKA 1HNWT 3VKGA 3F57A 4ISSA 4HWFA 1MMGA 2BVLA 4UR9A 4ANJA 4O4LE 1WYBA 2W61A 2E2AA 5HXSA 4AQFC 4DR5T 4LMKA 4DR2T 5IUXA 3ESLA 2CHOA 1YQ3A 2Z6EA 3PE0A 5AQIB 3ZC1A 4JI0T 2OV9A 4IDQA 4O2BE 4LMLA 3T8OA 4WBNE 2LSIA 2ZMAA 4QXHB 5ABFB 3PUSA 2JPFA 5HEUA 4YLHA 3QNUA 2RPAA 4NUVA 3CPZA 2LHNA 2BKNA 4EB6E 2E8IA 1IJ6A 4UELA 3AAIA 3P7IA 1MMAA 3ZKRA 4PJMA 2CCQA 3BQKA 4YY3T 4HFHA 2ZM8A 3RRCA 3VR8A 2D0UA 3EDUA 2ZM0A 2HH7A 3L3PA 3P4WA 3CK6A 4YTMA 5LYJE 1AJ3A 5HWYA 3RGLA 2I6HA 1HG5A 3RHWA 4HN9A 1E7PA 2CM0A 4HE8A 1HX8A 2GK9A 3BQLA 4M1PA 4QX8B 3H3AA 2CWOA 2VL0A 4UIGA 4EZ4A 4CXXA 5DQWA 4YSYA 3CQXC 3R84B 2OA5A 1D0ZA 1YKEB 5KX5E 3DP7A 3KVBA 4CN1A 4ZI3D 3UU6A 3VU7H 3N9LA 4OX9T 5JRCB 2LSKA 4EYYR 3Q5EA 5LNKA 2OLTA 3MACA 4JI5T 2DNXA 1HR0T 2H7VC 1OEDB 2LM9A 4CI2B 3ZYLA 1US7B 4ZS2A 5JR9A 3FBZA 2MPKA 4ZS3A 5JDQA 1KNPA 2E9XC 2C5IT 2W66A 2V7KA 2VKJA 2Y6XA 4EIWA 2WZHA 2JQHA 4HKAA 3OYXA 4K0UA 3RYFE 2L3LA 3UU3A 3I1AA 3TLSA 3AEAA 3W15B 2EHOD 2P9BA 3G06A 3ZLIA 3N2GE 2DWKA 4COFA 1W0AA 2IDOB 4YTPA 5AFUL 4DV2T 4AKLA 2MBGA 5HCJA 4E7SA 4NXNT 3RQWA 4QWNB 2LEHA 4HFIA 4PNIA 3PUVF 4ZXLA 3F2EA 5L3CB 3NRXA 2A2FX 5LMNT 2UU9T 3AEDA 5DJQC 5JH7E 1OEDC 2G0UA 3S4UA 3UUNA 2DWGA 2LE8A 3IA3A 4GK0E 5LB7B 4H9RC 4P0AA 3ANWA 2D5UA 2WB5A 4A97A 3LK2B 1BR1A 2VWAA 1S94A 3AAAB 5F8PA 5GONE 3RYCE 3UFGA 2ACXA 2QGSA 2BG9A 3N5LA 3NKZA 3PUYF 2E9XD 2NWBA 2W2UA 2YU1A 4TWDA 2BKPA 3UQ7A 4JYAT 3SFEA 3VKHA 4KHPT 3HKBE 4TV8E 2HPJA 2BBJA 3U78A 3ZMZB 4JI4T 4H63V 2XASB 2X68A 2WDVA 1YW0A 2X66A 4IDNA 3UUMA 2I0MA 4YHHT 3Q9DA 5J1GA 3EAMA 1BR4A 4IE7A 4WW0A 4KBMB 5HEHA 1XDPA 2MYSA 2WSSV 2AXDS 2H89A 2WM9A 1HTJF 2FJDA 2LSGA 1KNZA 4HFBA 4HGAA 1KFYA 1MNDA 1HNXT 4LF5T 4KHZF 3ETUA 4JI1T 2KNDA 4WBOA 2KLQA 2PJQA 3C4XA 4FJOA 4GYSA 4ILUA 4TN7B 3FZLB 5AQKB 4QH4A 2K9AA 4U2ZA 3RIUA 4DR4T 2PG8A 5JDMA 3AE5A 3F31A 5J2UE 1ZEEA 1OWAA 2NOXA 2BVMA 1NWMX 1SHZC 4CI3B 4GYRA 2PTFA 3N9QA 3QC9A 2BDEA 3HKDE 3IEEA 2D0TA 3PJAA 4X64T 3QK6A 3AA0B 4J2CA 3OKQA 2MAWA 2JQQA 2ODVA 2WU2A 5L47A 3AVRA 4X65T 2PBIA 2LKHA 2H7OA 3AE2A 1CHUA 2A72A 2XQ6A 1GQEA 4GK5E 5FXWA 3LJCA 4C91A 1IBLT 2WAUA 1ZKEA 4L9IA 3PURA 3HA4A 3ZMTB 3SFDA 1J1JA 4IREA 5HXCA 4HFVA 5FVKA 4ZEYA 1DU2A 1R8IA 2D2SA 3C50A 3NBXX 2RA1A 2LSYA 2XZEA 4IL9A 4DR7T 4OHFA 3ZN0B 3M65A 1U4QA 2JRKA 3JC6C 1U5PA 4YTNA 3L39A 3TLUA 5KDMC 4YT0A 3VR9A 1B7TA 1FIOA 1HFAA 2V26A 2WDRA 5LBQB 4AKIA 1NAFA 4O8SA 2XAQB 4QXCB 2LM2A 4DVDA 3ZC0A 2X51A 2XQAA 3KV5A 5JVDE 4JV5T 4UF0B 2KWIB 4UXNB 2IIUA 3C4WA 1SE7A 2BS4A 4PK6A 3GN5B 4HWIB 4U3CA 5EK4A 2CMRA 3RF1A 3ZMUB 2BG9B 5JDNA 3O9XA 4IL4A 1QLBA 1N36T 4K0KT 2UXXB 2VK9A 2CE7A 1JNRA 4PFOA 4ZZBA 1UX5A 3ZMVB 5CFBA 2HN1A 4DUYT 2K3WA 2AE9A 5LJMA 2CLYB 5FL0A 5KXJA 2XAFB 2D9DA 3N9OA 1UK5A 4A98A 4CQIA 3U3IA 5M4YA 1WYCA 3IF8B 1KEYA 4TWFA 2F4VT 5ADXL 4AQFA 3O1HA 4F6RC 1M62A 2B1EA 4U72A 4MLKA 4LF4T 2V6XA 3LDQB 5FL1A 3N9MA 2BS3A 2N2NA 2XQ4A 4X1IE 5AQQB 2V1DB 3I0OA 5LXTE 1X9BA 2UUBT 5LG4A 2FJAA 2YKSA 2WS3A 3ONJA 4NPPA 4IGUA 2BS2A 4U2YA 3RYIE 2WP9A 3CVRA 4TUYE 1O3XA 2Y8DA 4TX5A 3ZSTA 2X67A 1QUUA 5FXXA 1XZYA 3MXZA 3AE3A 1MIWA 5AQPB 1T8BA 5LG3A 2VURA 2J1DG 2LOPA 3BK9A 4PW8A 4DR3T 2YEVC 1W0BA 3ETVA 2QRXA 2BBHA 2HPLA 2J4GA 2WWUA 1WCRA 2X9HA 4TZ4C 4AKRB 2XY8B 3C4ZA 3Q5WA 4FI5A 4CI1B 4JUYA 5JDGA 2XPKA 3OVUA 3RKGA 3NVOA 4HTEA 3P50A 1HNZT 3PJAJ 3EDVA 4MBQA 4AI6A 4KP3C 1E1HB 2LOSA 2YN6A 3QB5K 2DHRA 3PUGA 4HEAA 5IHYA 2IW5B 1HCIA 1FMWA 2IMLA 2WU5A 3ZEFB 3AE7A 2WDQA 4GKJT 2YK0A 3AE9A 4DR6T 2XQ5A 2ZM2A 4H9PC 4O4HE 3RIAA 4Z90A 3TLTA 4ZI7E 1LRZA 3EUHA 3HKCE 1UURA 5C8YE 1WR0A 3L09A 5HEOA 1HS7A 2JQKA 2CBIA 4P09A 4IIJE 3RRWA 2H88A 5CJ5A 3WAKA 4WZXA 1YQ4A 4O2AE 2UXDT 2XSAA 2E9XB 5AQVB 5JR9C 2CA5A 5L3GB 2CRBA 3H3MA 2XAJB 4G2AA 4CN6A 3D0TA 2YDSA 4DV0T 4UVBB 5AQNB 1VOMA 2Y48B 4EEDA 1BR2A 2WBLA 3DJBA 4ZI2D 3EHZA 2H3RA 3ONLC 3ZN1B 5EK2A 3WAJA 3VRBA 3RIFA 4BAYB 2W4XA 3P8CD 5DABA 2BZBA 2KMFA 3KDSE 3QUJA 4G63A 1D1CA 4QHOA 4JI3T 3I9WA 4YJ2E 4ERRA 3N2KE 3RH3A 3LK3B 4IDPA 5LCYA 5F3JA 1WR6A 3AEBA 4PFPA 5CA0E 3JC6D 3ZYMA 1H7CA 2BG9C 4DR1T 2WZIA 2XM1A 5AQUB 5FKYA 3FBLA 2FUPA 3AEGA 4IHJE 2ZM6T 2E5VA 3E0ZA 2XM2A 2KXPB 3AEEA 5FVLA 2WMNA 5AQGB 2V6YA 3SWHA 5ABHA 2PFVA 5LP6E 5AQSB 3OTOT 3LBXB 4CXWA 3CMLA 2IC9A 5JDLA 4AKHA 5JQGE 1N33T 4O4JE 1LKXA 4YJ3E 2ODUA 4JEUB 4U31A 4E7ZA 5A1LA 4XBFB 4AXPA 5ETWA 4UV8B 1KK7A 4GOUA 3PDYA 4AKGA 3SRZA 5AQMB 5F5WA 4A56A 4A5XA 4TNVA 2ES0A 3AA1B 2R6GF 4JI8T 4EEBA 2WMOA 2NR4A 4PK5A 2IUBA 3AE4A 2NW7A 1LVKA 1QSDA 3KINB 4I50E 1S35A 4OK0A 3T1HT 3ZT5A 3O4XE 4LFCT 3MA9A 4QXBB 3B5MA 5AQHB 3VRAA 4EOZB 5AQRB 2CPTA 4X5TA 5FY7A 5HEGA 4PK4A 4IDOA 4B3TT 5E0OA 3UFEA 2LJLA 3AA6B 4UVAB 5LOVE 3X1DA 1XMOT 5CGMA 2V7IA 4BA9A 2FJEA 5HYAA 2J47A 4JI6T 3FZMB 3P4QA 1WRDA 3E08A 3A5XA 3CWZB 3N9NA 2XQYA 3QB5A 4PAGA 4PJNA 5CB4E 2VKDA 2YOEA 3AE6A 4UF0A 3CX6B 5EZYE 5LBMA 4DV1T 5JDFA 2XTLA 4QH5A 2EHOA 2WWVA 1KNRA 2W0GA 4EXTA 3IBPA 4Z91A 3A7MA 3ZJ1A 3I9YA 4ISTA 3V5UA 3UUXB 2ACZA 3PUXF 2DI4A 1Z8UA 4H9NC 2N9DA 1T72A 3CX7B 3PUQA 5L3EB 3TLWA 1BR0A 3TLVA 3GMIA 1MIYA 2W63A 1IAPA 2MTQA 3VHLA 2ZLYA 3UT5E 2WQYA 2YDRA 3GN5A 2N1GA 3Q5DA 1JNZA 1UUSA 5AQTB 5FY1A 3NZQA 4U7YA 2NW9A 3RQUA 3Q2MA 3FB2A 3JAEA 3P4RA 4X66T 2CEAA 3OJAA 4JBWF 5FMNA 3FHNA 5FP3A 5AQFB 4ILBA 2VKOA 4X62T 1Y64B 3NZPA 4N78D 3P4PA 4DBRA 1FMVA 2V7JA 5FYMA 4AISA 3LFMA 3PUZF 3RI5A 3RKOA 2WCAA 3K3OA 3AB3B 3UU4A 2VL8A 5FNVE 5AQOB 1FJGT 1T98A 1XDOA 4DV6T 3EI0A 3AECA 3AEFA 2W62A 3OPCA 5FXZA 3MJXA 1NENA 4NXMT 4H9QC 5ABFA 5LA6E 3MK7C 1L0VA 1Z0PA 3AXJA 3ZT6A 5IWAT 1D1BA 1OXZA 3RLFF 4UEMA 5LHIB 2YDQA 4U7IA 5LGTB 5LMUT 3L8RA 2M6IA 1X79A 5LGNB 4LF7T 5HXEA 2V8SV 2XUEA 4JI2T 4UVCB 3RIUC 3FXDB 2SPCA 2YU2A 3NRYA 1HG2A 4GIWA 3RPUA 5L2LA 5JDHA 4JI7T 2JMHA 4U33A 4WYVA 4F8HA 2KT9A 4H9SE 2QVAA 3ZMSB 3Q5XA 1XWMA 1YXRA 3ZYKA 2BG9E 4MHCA 4ZZCA 3QOFA 2FBWA 2I59A 4KI0F 4OYKA 4AQYT 2BKOA 2M67A 3UU8A 5LGUB 3K3NA 3KV9A 2VVNA 3A8YC 1UCUA 3T1YT 4AQGA 5CA1E 2IC6A 4X20E 3E22E 4I55E 4B3MT 2CXDA 4ZI3C 1N34T 3B13A 2CLYC 3GWHA 4X1YE 3UTKA 2XQ8A 3MZKB 3PTRB 5H6RB 2V6YB 2JQ9A 4KMCA 3RYHE 3UU5A 3WI3A 3KV4A 2KINB 4IDZA 5C2TA 3HI2A 2MOZA 2V7MA 3ZSSA 4IE4A 3CQCB 3ZJ2A 5J2TE 2X9WA 2L9QA 2X0HA 3JADA 2V5DA 5AQJB 3OBVE 2VB6A 3LK42 2K5BB 1G8XA 3HKEE 2V7LA 2QA7A 5DQVA 3ZPOA 3AA7B 5FY0A 4DMVA 4YSXA 2LRKA 2WY2A 2XAGB 3IHRA 4P0BA 3PV0F 4EV6A 4I43B 2XSBA 3FZHB 4DV4T 4YHJA 1IZNB 5AQLB 4PJJA 2IAKA 1M7KA 2X9YA 2K48A 2YINA 3OYZA 1EZ3A 4B6XA 2CXFA 4CN4A 4B3RT 1SUMB 4DV5T 2LRLA 4LFAT 1J5WA 3ABVA 4L0RA 3KVAA 4O4IE 2HHHT 1FEWA 2KZ7B 3PUAA 1IBMT 3JAFA 3R6NA 5JR9B 3SS1A 4AIUA 1OEDA 2W67A 3B57A 5ABGA 2C0SA 3JCFA 1KF6A 4LMJA 4MALA 4MFRA 2DLRA 1UX4A 2XAHB 2E9XA 2Q9QB 3UUBA 5C3JA 5L3DB 3AXJB 5L4EA 5JRCA 2UXCT 3ZCJA 4DMWA 4EGWA 4NUUA 4OFZA 3AE1A 3TKLB 2QYWA 1YD8G 5HWXA 3AVSA 4ZHQE 4HFDA 2LKGA 3O1IA 1XNQT 3CX8B 2Q9QD 5EK3A 2E5LT 2C5KT 2VKHA 4HFEA 1T7SA 4JLEA 3ZT7A 3C98B 4QX7B 3CKDA 2RP4A 4YSZA 5BR8T 2L8KA 3AE8A 3GA8A 3ZCIA 4UV9B 2X9XA 4P1NA 3SOLA 3HR0A 2JJ9A 3HL6A 4TWHA 1VCSA 5LHGB 1IJ5A 1G73A 2NTYA 4LF9T 2CHNA 1D1AA 1WFDA 3FXEB 4IT4A 4OYJA 3EABA 4X1KE 4EZHA 1I6ZA 2DL1A 3DTOA 4XZCA 4Z8XA 3K1SA 4ZI2C 3CQGB 5LJNA 1LVFA 4C90A 1MIVA 2NP9A 4QKNA 1YKHB 1MMDA 3PU8A 4DUZT 2CBJA 5J0ZA 4DV3T 2C5JA 3LSVA 4U74A 5KMGP 2XQ9A 2XHEB 3RC3A 2UUAT 3LG7A 4HFCA 2LHRA 4IE0A 4HWCA 4L5GA 3RX6A 4DIDB 4HWDA 2NTXA 4LF8T 1J5ET 2NW8A 2EHOB 2IHR1 4CZZB 3H37A 5ABEA 4H9OC 2JIWA 1NEKA 5JREA 2KSRA 4GKKT 5HXRA 5L3BB 4PJLA 4ILCA 5IYZE 1XMQT 1XNRT 2A3DA 5HCMA 1ZHCA 2VVSA 3EVYA 2HN2A 5TAOA 1W09A 3PUWF 3MKDA 4BJNA 1N32T 2Q9QA 3O1JA 3PU3A 4EAHA 3NWIA 3P4SA 2X0YA 3N9PA 5JTGA 4BJMA 2FJBA 1ZOYA 3I0QA 3KBUA 1VCTA 4TNWA 5HXHA 4EYUA 2EHOC 2LT3A 1CUNA 5FXVA 3C64A 1OEDE 2J62A 3KFWX 3M3ZB 4LFBT 3K8PC 2UXBT 3UULA 1D0XA 2DCFA 4KX6A 3UQ4A 4DBQA 3J9X1 2XQ7A 3FZFB 4Q25A 3KBTA 1D0YA 5H6QB 4JEHB 3C51A 4HWHA 4TV9E 1W9RA 3RC8A 4QH1A 4YFSA 1V9DA 3K3QC 3LBXA 4ADZA 1Y01A 4IE6A 3FZKB 2KWHA 4YXDA 3ANWB 3CIRA 5HAXA 2LSJA 2W00A 2A9UA 3KV6A 5L3FB 1HF8A 4DNDA 2B76A 1MMNA 4IE5A 1VRBA 4ILAA 4DO0A 4H63H 3AAEB 4NIQA 3ONXA 1I94T 3V5SA 1IBKT 1E2AA 1ZV4X 1ZP0A 4KUMB 2CXLA 2XJ7A 4ASKA 5BMVE 2M6BA 1HX1B 2V5CA 4XAXB 1WLXA 4ZOLE 3J7Yq 4B3ST 4DV7T 5HEJA 1SA0E 4V1Av 2VQFT 2VQET 4I4TE 5LHHB 4CXYA 2XQ3A 2X0LB 2VASA 2K24A 2CWYA 2UXNB 4I0UA 2LLYA 2Q9QC 2UUCT 1UGOA 1MNEA 3BQIA
chains in the Genus database with same CATH topology
4WNKA 3N2OA 2JMKA 3VKGA 3F57A 4ISSA 1MMGA 2BVLA 4ANJA 4O4LE 1WYBA 2W61A 5HXSA 4AQFC 3ESLA 2Z6EA 3PE0A 3ZC1A 4O2BE 4WBNE 3T8OA 2LSIA 2ZMAA 4QXHB 3PUSA 2JPFA 4YLHA 4NUVA 3CPZA 2LHNA 4EB6E 2E8IA 1IJ6A 4UELA 3AAIA 3P7IA 1MMAA 4PJMA 2CCQA 3BQKA 2ZM8A 3RRCA 2D0UA 3EDUA 2ZM0A 2HH7A 3L3PA 5LYJE 1AJ3A 5HWYA 1HG5A 4HN9A 2CM0A 4HE8A 4M1PA 1HX8A 2GK9A 3BQLA 4QX8B 4UIGA 3H3AA 2CWOA 4EZ4A 4CXXA 5DQWA 3CQXC 3R84B 2OA5A 1D0ZA 1YKEB 5KX5E 3DP7A 3KVBA 4ZI3D 5JRCB 3VU7H 3N9LA 2LSKA 4EYYR 5LNKA 3MACA 2DNXA 2H7VC 2LM9A 4CI2B 3ZYLA 1US7B 4ZS2A 5JR9A 3FBZA 4ZS3A 2E9XC 2C5IT 4EIWA 2V7KA 2VKJA 2Y6XA 4HKAA 3OYXA 4K0UA 3RYFE 2L3LA 3I1AA 3W15B 2EHOD 2P9BA 3ZLIA 3N2GE 2DWKA 5AFUL 4AKLA 2MBGA 4E7SA 4QWNB 2LEHA 4PNIA 3F2EA 5L3CB 3NRXA 2A2FX 5DJQC 5JH7E 2G0UA 3S4UA 3UUNA 2DWGA 2LE8A 4GK0E 4P0AA 4H9RC 3ANWA 2D5UA 3LK2B 1BR1A 2VWAA 1S94A 3AAAB 5F8PA 5GONE 3RYCE 2ACXA 2QGSA 3N5LA 2E9XD 2NWBA 2YU1A 3VKHA 3HKBE 4TV8E 2HPJA 3U78A 3ZMZB 4H63V 2XASB 2X68A 2X66A 1YW0A 3UUMA 3Q9DA 5J1GA 1BR4A 4IE7A 4WW0A 4KBMB 2MYSA 2WSSV 2WM9A 1HTJF 2LSGA 1KNZA 4HGAA 1MNDA 3ETUA 2KNDA 4WBOA 2KLQA 2PJQA 3C4XA 4FJOA 4GYSA 4ILUA 4TN7B 2K9AA 2PG8A 5JDMA 3F31A 5J2UE 1ZEEA 1OWAA 2NOXA 2BVMA 1NWMX 1SHZC 4CI3B 4GYRA 3N9QA 3QC9A 2BDEA 3HKDE 3IEEA 2D0TA 3QK6A 3AA0B 4J2CA 3OKQA 2JQQA 2ODVA 3AVRA 2PBIA 2H7OA 2A72A 4GK5E 5FXWA 3LJCA 4C91A 2WAUA 1ZKEA 4L9IA 3PURA 3HA4A 3ZMTB 5HXCA 4HFVA 2D2SA 3C50A 3NBXX 2RA1A 2LSYA 4OHFA 3ZN0B 3M65A 1U4QA 2JRKA 3JC6C 1U5PA 5KDMC 1FIOA 1B7TA 1HFAA 2V26A 5LBQB 4AKIA 1NAFA 4O8SA 2XAQB 4QXCB 4DVDA 3ZC0A 2X51A 5JVDE 3KV5A 4UF0B 2KWIB 4UXNB 3C4WA 4PK6A 3GN5B 5EK4A 3O9XA 2CMRA 3ZMUB 5JDNA 2UXXB 2VK9A 2CE7A 4PFOA 1UX5A 3ZMVB 5LJMA 2CLYB 2XAFB 3N9OA 4CQIA 3U3IA 5M4YA 1WYCA 3IF8B 5ADXL 4AQFA 3O1HA 4F6RC 4U72A 2B1EA 4MLKA 3N9MA 2N2NA 4X1IE 2V1DB 3I0OA 5LXTE 5LG4A 4IGUA 3RYIE 3CVRA 4TUYE 1O3XA 2Y8DA 4TX5A 2X67A 1QUUA 5FXXA 3MXZA 1MIWA 2J1DG 2LOPA 3BK9A 4PW8A 2YEVC 3ETVA 2WWUA 2HPLA 4AKRB 2X9HA 4TZ4C 3C4ZA 3Q5WA 4FI5A 4CI1B 4JUYA 5JDGA 4HTEA 3EDVA 4MBQA 4AI6A 4KP3C 1E1HB 2LOSA 2IW5B 2DHRA 3PUGA 4HEAA 5IHYA 3ZEFB 1HCIA 1FMWA 2YK0A 2ZM2A 4H9PC 4O4HE 4ZI7E 1LRZA 3EUHA 3HKCE 5C8YE 3L09A 1HS7A 4P09A 4IIJE 3RRWA 3WAKA 4O2AE 2E9XB 5JR9C 2CA5A 4G2AA 2XAJB 3D0TA 4UVBB 1VOMA 2Y48B 1BR2A 2WBLA 3DJBA 2H3RA 5EK2A 3WAJA 4BAYB 3P8CD 5DABA 2BZBA 2KMFA 3KDSE 3QUJA 4G63A 1D1CA 4QHOA 3I9WA 4YJ2E 4ERRA 3N2KE 3RH3A 3LK3B 5LCYA 5F3JA 1WR6A 4PFPA 5CA0E 3JC6D 3ZYMA 1H7CA 3FBLA 4IHJE 3E0ZA 2KXPB 2WMNA 3SWHA 2PFVA 5LP6E 3LBXB 3CMLA 2IC9A 5JDLA 4AKHA 5JQGE 4O4JE 1LKXA 4YJ3E 2ODUA 4JEUB 4E7ZA 5A1LA 4XBFB 4AXPA 5ETWA 4UV8B 1KK7A 4GOUA 3PDYA 4AKGA 3SRZA 4A56A 2ES0A 3AA1B 2WMOA 4PK5A 2NW7A 1LVKA 1QSDA 3KINB 4I50E 1S35A 4OK0A 3O4XE 3MA9A 4QXBB 4EOZB 5FY7A 4PK4A 5E0OA 3UFEA 2LJLA 3AA6B 4UVAB 5LOVE 2V7IA 4BA9A 5HYAA 3E08A 1WRDA 3A5XA 3CWZB 3N9NA 2XQYA 4PAGA 4PJNA 4DO0A 5CB4E 2VKDA 4UF0A 5EZYE 3CX6B 5LBMA 5JDFA 2XTLA 2EHOA 2W0GA 4EXTA 3IBPA 3ZJ1A 3I9YA 4ISTA 3V5UA 3UUXB 2DI4A 4H9NC 2N9DA 3CX7B 3PUQA 5L3EB 1BR0A 3GMIA 1MIYA 2W63A 1IAPA 2MTQA 3VHLA 2ZLYA 3UT5E 3GN5A 2N1GA 2NW9A 5FY1A 3NZQA 3Q2MA 3FB2A 2CEAA 3OJAA 5FMNA 3FHNA 5FP3A 2VKOA 1Y64B 3NZPA 4N78D 4DBRA 1FMVA 2V7JA 5FYMA 3LFMA 3RKOA 3K3OA 3AB3B 2VL8A 5FNVE 1T98A 2W62A 5FXZA 3MJXA 4H9QC 5LA6E 3MK7C 1Z0PA 1D1BA 1OXZA 4UEMA 5LHIB 5LGTB 1X79A 5LGNB 5HXEA 5JDQA 2XUEA 5L3GB 4UVCB 3FXDB 2SPCA 2YU2A 3NRYA 1HG2A 4GIWA 3RPUA 5L2LA 5JDHA 2JMHA 2KT9A 4H9SE 3ZMSB 3Q5XA 3ZYKA 4MHCA 2I59A 4OYKA 2M67A 5LGUB 3K3NA 3KV9A 1UCUA 4AQGA 5CA1E 2IC6A 4X20E 3E22E 4I55E 2CXDA 4ZI3C 3B13A 2CLYC 3GWHA 4X1YE 3UTKA 3MZKB 5H6RB 3PTRB 3ZN1B 4KMCA 3RYHE 4ZI2D 3WI3A 3KV4A 2KINB 4IDZA 5J2TE 3HI2A 2MOZA 2V7MA 4IE4A 3CQCB 3ZJ2A 2X9WA 2L9QA 3OBVE 2VB6A 3LK42 2K5BB 1G8XA 3HKEE 2V7LA 2QA7A 5DQVA 3ZPOA 3AA7B 5FY0A 4DMVA 2XAGB 3IHRA 4P0BA 4I43B 4YHJA 1IZNB 4PJJA 2IAKA 2YINA 2X9YA 2K48A 4B6XA 3OYZA 1EZ3A 2CXFA 4L0RA 4O4IE 3KVAA 1FEWA 2KZ7B 3PUAA 3R6NA 5JR9B 3SS1A 3B57A 2C0SA 4MALA 4MFRA 5L3DB 2DLRA 1UX4A 2XAHB 2E9XA 2Q9QB 5JRCA 3ZCJA 4DMWA 5HWXA 4NUUA 4OFZA 3TKLB 1YD8G 3AVSA 4ZHQE 3O1IA 3CX8B 2Q9QD 5EK3A 2C5KT 2VKHA 4JLEA 3C98B 4QX7B 3CKDA 2RP4A 2L8KA 3GA8A 3ZCIA 4UV9B 2X9XA 3SOLA 3HR0A 2JJ9A 3HL6A 5LHGB 1IJ5A 1G73A 2NTYA 1D1AA 3FXEB 4EZHA 4OYJA 4X1KE 3DTOA 4XZCA 4Z8XA 4ZI2C 3CQGB 5LJNA 1LVFA 4C90A 1MIVA 2NP9A 4QKNA 1YKHB 1MMDA 3PU8A 2C5JA 5KMGP 4U74A 3RC3A 2XHEB 3LG7A 2LHRA 4IE0A 4L5GA 3RX6A 2NTXA 2NW8A 2EHOB 4CZZB 3H37A 4H9OC 5JREA 5HXRA 5L3BB 4PJLA 5IYZE 2A3DA 1ZHCA 3EVYA 5TAOA 3MKDA 4BJNA 2Q9QA 3O1JA 3PU3A 4EAHA 3N9PA 4BJMA 3I0QA 3KBUA 5HXHA 4EYUA 2EHOC 2LT3A 1CUNA 5FXVA 3C64A 3KFWX 3K8PC 3UULA 1D0XA 2DCFA 4DBQA 3J9X1 3KBTA 1D0YA 5H6QB 4JEHB 3C51A 3RC8A 4TV9E 4YFSA 1V9DA 3K3QC 3LBXA 4ADZA 4IE6A 2KWHA 3ANWB 5HAXA 2LSJA 2W00A 3KV6A 5L3FB 1HF8A 4DNDA 1MMNA 4IE5A 1VRBA 4H63H 3AAEB 3ONXA 3V5SA 1ZV4X 4ASKA 4KUMB 2CXLA 5BMVE 4XAXB 1WLXA 4ZOLE 3J7Yq 1SA0E 4V1Av 4I4TE 5LHHB 4CXYA 2X0LB 2VASA 2K24A 2CWYA 2UXNB 4CXWA 2Q9QC 1MNEA 3BQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5K T;  1ZKE A;  3MXZ A;  2MBG A;  3CKD A;  2CA5 A;  4CQI A;  2IC9 A;  2X9X A;  4B6X A;  2X9Y A;  2K48 A;  2G0U A;  4FI5 A;  3S4U A;  2KWH A;  1IJ5 A;  4EYY R;  2XTL A;  4L0R A;  3FXE B;  4DND A;  2IC6 A;  3N5L A;  3QUJ A;  1LVF A;  1Z0P A;  2C5I T;  1IJ6 A;  3QK6 A;  2KWI B;  3P7I A;  4J2C A;  2C5J A;  1H7C A;  1QSD A;  1LRZ A;  3TKL B;  3CVR A;  2X9W A;  3L3P A;  3FXD B; 
#chains in the Genus database with same CATH topology
 4LF6 T;  4WNK A;  3N2O A;  5L4H A;  2JMK A;  1HNW T;  3VKG A;  3F57 A;  4ISS A;  4HWF A;  1MMG A;  2BVL A;  4UR9 A;  4ANJ A;  4O4L E;  1WYB A;  2W61 A;  2E2A A;  5HXS A;  4AQF C;  4DR5 T;  4LMK A;  4DR2 T;  5IUX A;  3ESL A;  2CHO A;  1YQ3 A;  2Z6E A;  3PE0 A;  5AQI B;  3ZC1 A;  4JI0 T;  2OV9 A;  4IDQ A;  4O2B E;  4LML A;  3T8O A;  4WBN E;  2LSI A;  2ZMA A;  4QXH B;  5ABF B;  3PUS A;  2JPF A;  5HEU A;  4YLH A;  3QNU A;  2RPA A;  4NUV A;  3CPZ A;  2LHN A;  2BKN A;  4EB6 E;  2E8I A;  1IJ6 A;  4UEL A;  3AAI A;  3P7I A;  1MMA A;  3ZKR A;  4PJM A;  2CCQ A;  3BQK A;  4YY3 T;  4HFH A;  2ZM8 A;  3RRC A;  3VR8 A;  2D0U A;  3EDU A;  2ZM0 A;  2HH7 A;  3L3P A;  3P4W A;  3CK6 A;  4YTM A;  5LYJ E;  1AJ3 A;  5HWY A;  3RGL A;  2I6H A;  1HG5 A;  3RHW A;  4HN9 A;  1E7P A;  2CM0 A;  4HE8 A;  1HX8 A;  2GK9 A;  3BQL A;  4M1P A;  4QX8 B;  3H3A A;  2CWO A;  2VL0 A;  4UIG A;  4EZ4 A;  4CXX A;  5DQW A;  4YSY A;  3CQX C;  3R84 B;  2OA5 A;  1D0Z A;  1YKE B;  5KX5 E;  3DP7 A;  3KVB A;  4CN1 A;  4ZI3 D;  3UU6 A;  3VU7 H;  3N9L A;  4OX9 T;  5JRC B;  2LSK A;  4EYY R;  3Q5E A;  5LNK A;  2OLT A;  3MAC A;  4JI5 T;  2DNX A;  1HR0 T;  2H7V C;  1OED B;  2LM9 A;  4CI2 B;  3ZYL A;  1US7 B;  4ZS2 A;  5JR9 A;  3FBZ A;  2MPK A;  4ZS3 A;  5JDQ A;  1KNP A;  2E9X C;  2C5I T;  2W66 A;  2V7K A;  2VKJ A;  2Y6X A;  4EIW A;  2WZH A;  2JQH A;  4HKA A;  3OYX A;  4K0U A;  3RYF E;  2L3L A;  3UU3 A;  3I1A A;  3TLS A;  3AEA A;  3W15 B;  2EHO D;  2P9B A;  3G06 A;  3ZLI A;  3N2G E;  2DWK A;  4COF A;  1W0A A;  2IDO B;  4YTP A;  5AFU L;  4DV2 T;  4AKL A;  2MBG A;  5HCJ A;  4E7S A;  4NXN T;  3RQW A;  4QWN B;  2LEH A;  4HFI A;  4PNI A;  3PUV F;  4ZXL A;  3F2E A;  5L3C B;  3NRX A;  2A2F X;  5LMN T;  2UU9 T;  3AED A;  5DJQ C;  5JH7 E;  1OED C;  2G0U A;  3S4U A;  3UUN A;  2DWG A;  2LE8 A;  3IA3 A;  4GK0 E;  5LB7 B;  4H9R C;  4P0A A;  3ANW A;  2D5U A;  2WB5 A;  4A97 A;  3LK2 B;  1BR1 A;  2VWA A;  1S94 A;  3AAA B;  5F8P A;  5GON E;  3RYC E;  3UFG A;  2ACX A;  2QGS A;  2BG9 A;  3N5L A;  3NKZ A;  3PUY F;  2E9X D;  2NWB A;  2W2U A;  2YU1 A;  4TWD A;  2BKP A;  3UQ7 A;  4JYA T;  3SFE A;  3VKH A;  4KHP T;  3HKB E;  4TV8 E;  2HPJ A;  2BBJ A;  3U78 A;  3ZMZ B;  4JI4 T;  4H63 V;  2XAS B;  2X68 A;  2WDV A;  1YW0 A;  2X66 A;  4IDN A;  3UUM A;  2I0M A;  4YHH T;  3Q9D A;  5J1G A;  3EAM A;  1BR4 A;  4IE7 A;  4WW0 A;  4KBM B;  5HEH A;  1XDP A;  2MYS A;  2WSS V;  2AXD S;  2H89 A;  2WM9 A;  1HTJ F;  2FJD A;  2LSG A;  1KNZ A;  4HFB A;  4HGA A;  1KFY A;  1MND A;  1HNX T;  4LF5 T;  4KHZ F;  3ETU A;  4JI1 T;  2KND A;  4WBO A;  2KLQ A;  2PJQ A;  3C4X A;  4FJO A;  4GYS A;  4ILU A;  4TN7 B;  3FZL B;  5AQK B;  4QH4 A;  2K9A A;  4U2Z A;  3RIU A;  4DR4 T;  2PG8 A;  5JDM A;  3AE5 A;  3F31 A;  5J2U E;  1ZEE A;  1OWA A;  2NOX A;  2BVM A;  1NWM X;  1SHZ C;  4CI3 B;  4GYR A;  2PTF A;  3N9Q A;  3QC9 A;  2BDE A;  3HKD E;  3IEE A;  2D0T A;  3PJA A;  4X64 T;  3QK6 A;  3AA0 B;  4J2C A;  3OKQ A;  2MAW A;  2JQQ A;  2ODV A;  2WU2 A;  5L47 A;  3AVR A;  4X65 T;  2PBI A;  2LKH A;  2H7O A;  3AE2 A;  1CHU A;  2A72 A;  2XQ6 A;  1GQE A;  4GK5 E;  5FXW A;  3LJC A;  4C91 A;  1IBL T;  2WAU A;  1ZKE A;  4L9I A;  3PUR A;  3HA4 A;  3ZMT B;  3SFD A;  1J1J A;  4IRE A;  5HXC A;  4HFV A;  5FVK A;  4ZEY A;  1DU2 A;  1R8I A;  2D2S A;  3C50 A;  3NBX X;  2RA1 A;  2LSY A;  2XZE A;  4IL9 A;  4DR7 T;  4OHF A;  3ZN0 B;  3M65 A;  1U4Q A;  2JRK A;  3JC6 C;  1U5P A;  4YTN A;  3L39 A;  3TLU A;  5KDM C;  4YT0 A;  3VR9 A;  1B7T A;  1FIO A;  1HFA A;  2V26 A;  2WDR A;  5LBQ B;  4AKI A;  1NAF A;  4O8S A;  2XAQ B;  4QXC B;  2LM2 A;  4DVD A;  3ZC0 A;  2X51 A;  2XQA A;  3KV5 A;  5JVD E;  4JV5 T;  4UF0 B;  2KWI B;  4UXN B;  2IIU A;  3C4W A;  1SE7 A;  2BS4 A;  4PK6 A;  3GN5 B;  4HWI B;  4U3C A;  5EK4 A;  2CMR A;  3RF1 A;  3ZMU B;  2BG9 B;  5JDN A;  3O9X A;  4IL4 A;  1QLB A;  1N36 T;  4K0K T;  2UXX B;  2VK9 A;  2CE7 A;  1JNR A;  4PFO A;  4ZZB A;  1UX5 A;  3ZMV B;  5CFB A;  2HN1 A;  4DUY T;  2K3W A;  2AE9 A;  5LJM A;  2CLY B;  5FL0 A;  5KXJ A;  2XAF B;  2D9D A;  3N9O A;  1UK5 A;  4A98 A;  4CQI A;  3U3I A;  5M4Y A;  1WYC A;  3IF8 B;  1KEY A;  4TWF A;  2F4V T;  5ADX L;  4AQF A;  3O1H A;  4F6R C;  1M62 A;  2B1E A;  4U72 A;  4MLK A;  4LF4 T;  2V6X A;  3LDQ B;  5FL1 A;  3N9M A;  2BS3 A;  2N2N A;  2XQ4 A;  4X1I E;  5AQQ B;  2V1D B;  3I0O A;  5LXT E;  1X9B A;  2UUB T;  5LG4 A;  2FJA A;  2YKS A;  2WS3 A;  3ONJ A;  4NPP A;  4IGU A;  2BS2 A;  4U2Y A;  3RYI E;  2WP9 A;  3CVR A;  4TUY E;  1O3X A;  2Y8D A;  4TX5 A;  3ZST A;  2X67 A;  1QUU A;  5FXX A;  1XZY A;  3MXZ A;  3AE3 A;  1MIW A;  5AQP B;  1T8B A;  5LG3 A;  2VUR A;  2J1D G;  2LOP A;  3BK9 A;  4PW8 A;  4DR3 T;  2YEV C;  1W0B A;  3ETV A;  2QRX A;  2BBH A;  2HPL A;  2J4G A;  2WWU A;  1WCR A;  2X9H A;  4TZ4 C;  4AKR B;  2XY8 B;  3C4Z A;  3Q5W A;  4FI5 A;  4CI1 B;  4JUY A;  5JDG A;  2XPK A;  3OVU A;  3RKG A;  3NVO A;  4HTE A;  3P50 A;  1HNZ T;  3PJA J;  3EDV A;  4MBQ A;  4AI6 A;  4KP3 C;  1E1H B;  2LOS A;  2YN6 A;  3QB5 K;  2DHR A;  3PUG A;  4HEA A;  5IHY A;  2IW5 B;  1HCI A;  1FMW A;  2IML A;  2WU5 A;  3ZEF B;  3AE7 A;  2WDQ A;  4GKJ T;  2YK0 A;  3AE9 A;  4DR6 T;  2XQ5 A;  2ZM2 A;  4H9P C;  4O4H E;  3RIA A;  4Z90 A;  3TLT A;  4ZI7 E;  1LRZ A;  3EUH A;  3HKC E;  1UUR A;  5C8Y E;  1WR0 A;  3L09 A;  5HEO A;  1HS7 A;  2JQK A;  2CBI A;  4P09 A;  4IIJ E;  3RRW A;  2H88 A;  5CJ5 A;  3WAK A;  4WZX A;  1YQ4 A;  4O2A E;  2UXD T;  2XSA A;  2E9X B;  5AQV B;  5JR9 C;  2CA5 A;  5L3G B;  2CRB A;  3H3M A;  2XAJ B;  4G2A A;  4CN6 A;  3D0T A;  2YDS A;  4DV0 T;  4UVB B;  5AQN B;  1VOM A;  2Y48 B;  4EED A;  1BR2 A;  2WBL A;  3DJB A;  4ZI2 D;  3EHZ A;  2H3R A;  3ONL C;  3ZN1 B;  5EK2 A;  3WAJ A;  3VRB A;  3RIF A;  4BAY B;  2W4X A;  3P8C D;  5DAB A;  2BZB A;  2KMF A;  3KDS E;  3QUJ A;  4G63 A;  1D1C A;  4QHO A;  4JI3 T;  3I9W A;  4YJ2 E;  4ERR A;  3N2K E;  3RH3 A;  3LK3 B;  4IDP A;  5LCY A;  5F3J A;  1WR6 A;  3AEB A;  4PFP A;  5CA0 E;  3JC6 D;  3ZYM A;  1H7C A;  2BG9 C;  4DR1 T;  2WZI A;  2XM1 A;  5AQU B;  5FKY A;  3FBL A;  2FUP A;  3AEG A;  4IHJ E;  2ZM6 T;  2E5V A;  3E0Z A;  2XM2 A;  2KXP B;  3AEE A;  5FVL A;  2WMN A;  5AQG B;  2V6Y A;  3SWH A;  5ABH A;  2PFV A;  5LP6 E;  5AQS B;  3OTO T;  3LBX B;  4CXW A;  3CML A;  2IC9 A;  5JDL A;  4AKH A;  5JQG E;  1N33 T;  4O4J E;  1LKX A;  4YJ3 E;  2ODU A;  4JEU B;  4U31 A;  4E7Z A;  5A1L A;  4XBF B;  4AXP A;  5ETW A;  4UV8 B;  1KK7 A;  4GOU A;  3PDY A;  4AKG A;  3SRZ A;  5AQM B;  5F5W A;  4A56 A;  4A5X A;  4TNV A;  2ES0 A;  3AA1 B;  2R6G F;  4JI8 T;  4EEB A;  2WMO A;  2NR4 A;  4PK5 A;  2IUB A;  3AE4 A;  2NW7 A;  1LVK A;  1QSD A;  3KIN B;  4I50 E;  1S35 A;  4OK0 A;  3T1H T;  3ZT5 A;  3O4X E;  4LFC T;  3MA9 A;  4QXB B;  3B5M A;  5AQH B;  3VRA A;  4EOZ B;  5AQR B;  2CPT A;  4X5T A;  5FY7 A;  5HEG A;  4PK4 A;  4IDO A;  4B3T T;  5E0O A;  3UFE A;  2LJL A;  3AA6 B;  4UVA B;  5LOV E;  3X1D A;  1XMO T;  5CGM A;  2V7I A;  4BA9 A;  2FJE A;  5HYA A;  2J47 A;  4JI6 T;  3FZM B;  3P4Q A;  1WRD A;  3E08 A;  3A5X A;  3CWZ B;  3N9N A;  2XQY A;  3QB5 A;  4PAG A;  4PJN A;  5CB4 E;  2VKD A;  2YOE A;  3AE6 A;  4UF0 A;  3CX6 B;  5EZY E;  5LBM A;  4DV1 T;  5JDF A;  2XTL A;  4QH5 A;  2EHO A;  2WWV A;  1KNR A;  2W0G A;  4EXT A;  3IBP A;  4Z91 A;  3A7M A;  3ZJ1 A;  3I9Y A;  4IST A;  3V5U A;  3UUX B;  2ACZ A;  3PUX F;  2DI4 A;  1Z8U A;  4H9N C;  2N9D A;  1T72 A;  3CX7 B;  3PUQ A;  5L3E B;  3TLW A;  1BR0 A;  3TLV A;  3GMI A;  1MIY A;  2W63 A;  1IAP A;  2MTQ A;  3VHL A;  2ZLY A;  3UT5 E;  2WQY A;  2YDR A;  3GN5 A;  2N1G A;  3Q5D A;  1JNZ A;  1UUS A;  5AQT B;  5FY1 A;  3NZQ A;  4U7Y A;  2NW9 A;  3RQU A;  3Q2M A;  3FB2 A;  3JAE A;  3P4R A;  4X66 T;  2CEA A;  3OJA A;  4JBW F;  5FMN A;  3FHN A;  5FP3 A;  5AQF B;  4ILB A;  2VKO A;  4X62 T;  1Y64 B;  3NZP A;  4N78 D;  3P4P A;  4DBR A;  1FMV A;  2V7J A;  5FYM A;  4AIS A;  3LFM A;  3PUZ F;  3RI5 A;  3RKO A;  2WCA A;  3K3O A;  3AB3 B;  3UU4 A;  2VL8 A;  5FNV E;  5AQO B;  1FJG T;  1T98 A;  1XDO A;  4DV6 T;  3EI0 A;  3AEC A;  3AEF A;  2W62 A;  3OPC A;  5FXZ A;  3MJX A;  1NEN A;  4NXM T;  4H9Q C;  5ABF A;  5LA6 E;  3MK7 C;  1L0V A;  1Z0P A;  3AXJ A;  3ZT6 A;  5IWA T;  1D1B A;  1OXZ A;  3RLF F;  4UEM A;  5LHI B;  2YDQ A;  4U7I A;  5LGT B;  5LMU T;  3L8R A;  2M6I A;  1X79 A;  5LGN B;  4LF7 T;  5HXE A;  2V8S V;  2XUE A;  4JI2 T;  4UVC B;  3RIU C;  3FXD B;  2SPC A;  2YU2 A;  3NRY A;  1HG2 A;  4GIW A;  3RPU A;  5L2L A;  5JDH A;  4JI7 T;  2JMH A;  4U33 A;  4WYV A;  4F8H A;  2KT9 A;  4H9S E;  2QVA A;  3ZMS B;  3Q5X A;  1XWM A;  1YXR A;  3ZYK A;  2BG9 E;  4MHC A;  4ZZC A;  3QOF A;  2FBW A;  2I59 A;  4KI0 F;  4OYK A;  4AQY T;  2BKO A;  2M67 A;  3UU8 A;  5LGU B;  3K3N A;  3KV9 A;  2VVN A;  3A8Y C;  1UCU A;  3T1Y T;  4AQG A;  5CA1 E;  2IC6 A;  4X20 E;  3E22 E;  4I55 E;  4B3M T;  2CXD A;  4ZI3 C;  1N34 T;  3B13 A;  2CLY C;  3GWH A;  4X1Y E;  3UTK A;  2XQ8 A;  3MZK B;  3PTR B;  5H6R B;  2V6Y B;  2JQ9 A;  4KMC A;  3RYH E;  3UU5 A;  3WI3 A;  3KV4 A;  2KIN B;  4IDZ A;  5C2T A;  3HI2 A;  2MOZ A;  2V7M A;  3ZSS A;  4IE4 A;  3CQC B;  3ZJ2 A;  5J2T E;  2X9W A;  2L9Q A;  2X0H A;  3JAD A;  2V5D A;  5AQJ B;  3OBV E;  2VB6 A;  3LK4 2;  2K5B B;  1G8X A;  3HKE E;  2V7L A;  2QA7 A;  5DQV A;  3ZPO A;  3AA7 B;  5FY0 A;  4DMV A;  4YSX A;  2LRK A;  2WY2 A;  2XAG B;  3IHR A;  4P0B A;  3PV0 F;  4EV6 A;  4I43 B;  2XSB A;  3FZH B;  4DV4 T;  4YHJ A;  1IZN B;  5AQL B;  4PJJ A;  2IAK A;  1M7K A;  2X9Y A;  2K48 A;  2YIN A;  3OYZ A;  1EZ3 A;  4B6X A;  2CXF A;  4CN4 A;  4B3R T;  1SUM B;  4DV5 T;  2LRL A;  4LFA T;  1J5W A;  3ABV A;  4L0R A;  3KVA A;  4O4I E;  2HHH T;  1FEW A;  2KZ7 B;  3PUA A;  1IBM T;  3JAF A;  3R6N A;  5JR9 B;  3SS1 A;  4AIU A;  1OED A;  2W67 A;  3B57 A;  5ABG A;  2C0S A;  3JCF A;  1KF6 A;  4LMJ A;  4MAL A;  4MFR A;  2DLR A;  1UX4 A;  2XAH B;  2E9X A;  2Q9Q B;  3UUB A;  5C3J A;  5L3D B;  3AXJ B;  5L4E A;  5JRC A;  2UXC T;  3ZCJ A;  4DMW A;  4EGW A;  4NUU A;  4OFZ A;  3AE1 A;  3TKL B;  2QYW A;  1YD8 G;  5HWX A;  3AVS A;  4ZHQ E;  4HFD A;  2LKG A;  3O1I A;  1XNQ T;  3CX8 B;  2Q9Q D;  5EK3 A;  2E5L T;  2C5K T;  2VKH A;  4HFE A;  1T7S A;  4JLE A;  3ZT7 A;  3C98 B;  4QX7 B;  3CKD A;  2RP4 A;  4YSZ A;  5BR8 T;  2L8K A;  3AE8 A;  3GA8 A;  3ZCI A;  4UV9 B;  2X9X A;  4P1N A;  3SOL A;  3HR0 A;  2JJ9 A;  3HL6 A;  4TWH A;  1VCS A;  5LHG B;  1IJ5 A;  1G73 A;  2NTY A;  4LF9 T;  2CHN A;  1D1A A;  1WFD A;  3FXE B;  4IT4 A;  4OYJ A;  3EAB A;  4X1K E;  4EZH A;  1I6Z A;  2DL1 A;  3DTO A;  4XZC A;  4Z8X A;  3K1S A;  4ZI2 C;  3CQG B;  5LJN A;  1LVF A;  4C90 A;  1MIV A;  2NP9 A;  4QKN A;  1YKH B;  1MMD A;  3PU8 A;  4DUZ T;  2CBJ A;  5J0Z A;  4DV3 T;  2C5J A;  3LSV A;  4U74 A;  5KMG P;  2XQ9 A;  2XHE B;  3RC3 A;  2UUA T;  3LG7 A;  4HFC A;  2LHR A;  4IE0 A;  4HWC A;  4L5G A;  3RX6 A;  4DID B;  4HWD A;  2NTX A;  4LF8 T;  1J5E T;  2NW8 A;  2EHO B;  2IHR 1;  4CZZ B;  3H37 A;  5ABE A;  4H9O C;  2JIW A;  1NEK A;  5JRE A;  2KSR A;  4GKK T;  5HXR A;  5L3B B;  4PJL A;  4ILC A;  5IYZ E;  1XMQ T;  1XNR T;  2A3D A;  5HCM A;  1ZHC A;  2VVS A;  3EVY A;  2HN2 A;  5TAO A;  1W09 A;  3PUW F;  3MKD A;  4BJN A;  1N32 T;  2Q9Q A;  3O1J A;  3PU3 A;  4EAH A;  3NWI A;  3P4S A;  2X0Y A;  3N9P A;  5JTG A;  4BJM A;  2FJB A;  1ZOY A;  3I0Q A;  3KBU A;  1VCT A;  4TNW A;  5HXH A;  4EYU A;  2EHO C;  2LT3 A;  1CUN A;  5FXV A;  3C64 A;  1OED E;  2J62 A;  3KFW X;  3M3Z B;  4LFB T;  3K8P C;  2UXB T;  3UUL A;  1D0X A;  2DCF A;  4KX6 A;  3UQ4 A;  4DBQ A;  3J9X 1;  2XQ7 A;  3FZF B;  4Q25 A;  3KBT A;  1D0Y A;  5H6Q B;  4JEH B;  3C51 A;  4HWH A;  4TV9 E;  1W9R A;  3RC8 A;  4QH1 A;  4YFS A;  1V9D A;  3K3Q C;  3LBX A;  4ADZ A;  1Y01 A;  4IE6 A;  3FZK B;  2KWH A;  4YXD A;  3ANW B;  3CIR A;  5HAX A;  2LSJ A;  2W00 A;  2A9U A;  3KV6 A;  5L3F B;  1HF8 A;  4DND A;  2B76 A;  1MMN A;  4IE5 A;  1VRB A;  4ILA A;  4DO0 A;  4H63 H;  3AAE B;  4NIQ A;  3ONX A;  1I94 T;  3V5S A;  1IBK T;  1E2A A;  1ZV4 X;  1ZP0 A;  4KUM B;  2CXL A;  2XJ7 A;  4ASK A;  5BMV E;  2M6B A;  1HX1 B;  2V5C A;  4XAX B;  1WLX A;  4ZOL E;  3J7Y q;  4B3S T;  4DV7 T;  5HEJ A;  1SA0 E;  4V1A v;  2VQF T;  2VQE T;  4I4T E;  5LHH B;  4CXY A;  2XQ3 A;  2X0L B;  2VAS A;  2K24 A;  2CWY A;  2UXN B;  4I0U A;  2LLY A;  2Q9Q C;  2UUC T;  1UGO A;  1MNE A;  3BQI A; 
#chains in the Genus database with same CATH homology
 4WNK A;  3N2O A;  2JMK A;  3VKG A;  3F57 A;  4ISS A;  1MMG A;  2BVL A;  4ANJ A;  4O4L E;  1WYB A;  2W61 A;  5HXS A;  4AQF C;  3ESL A;  2Z6E A;  3PE0 A;  3ZC1 A;  4O2B E;  4WBN E;  3T8O A;  2LSI A;  2ZMA A;  4QXH B;  3PUS A;  2JPF A;  4YLH A;  4NUV A;  3CPZ A;  2LHN A;  4EB6 E;  2E8I A;  1IJ6 A;  4UEL A;  3AAI A;  3P7I A;  1MMA A;  4PJM A;  2CCQ A;  3BQK A;  2ZM8 A;  3RRC A;  2D0U A;  3EDU A;  2ZM0 A;  2HH7 A;  3L3P A;  5LYJ E;  1AJ3 A;  5HWY A;  1HG5 A;  4HN9 A;  2CM0 A;  4HE8 A;  4M1P A;  1HX8 A;  2GK9 A;  3BQL A;  4QX8 B;  4UIG A;  3H3A A;  2CWO A;  4EZ4 A;  4CXX A;  5DQW A;  3CQX C;  3R84 B;  2OA5 A;  1D0Z A;  1YKE B;  5KX5 E;  3DP7 A;  3KVB A;  4ZI3 D;  5JRC B;  3VU7 H;  3N9L A;  2LSK A;  4EYY R;  5LNK A;  3MAC A;  2DNX A;  2H7V C;  2LM9 A;  4CI2 B;  3ZYL A;  1US7 B;  4ZS2 A;  5JR9 A;  3FBZ A;  4ZS3 A;  2E9X C;  2C5I T;  4EIW A;  2V7K A;  2VKJ A;  2Y6X A;  4HKA A;  3OYX A;  4K0U A;  3RYF E;  2L3L A;  3I1A A;  3W15 B;  2EHO D;  2P9B A;  3ZLI A;  3N2G E;  2DWK A;  5AFU L;  4AKL A;  2MBG A;  4E7S A;  4QWN B;  2LEH A;  4PNI A;  3F2E A;  5L3C B;  3NRX A;  2A2F X;  5DJQ C;  5JH7 E;  2G0U A;  3S4U A;  3UUN A;  2DWG A;  2LE8 A;  4GK0 E;  4P0A A;  4H9R C;  3ANW A;  2D5U A;  3LK2 B;  1BR1 A;  2VWA A;  1S94 A;  3AAA B;  5F8P A;  5GON E;  3RYC E;  2ACX A;  2QGS A;  3N5L A;  2E9X D;  2NWB A;  2YU1 A;  3VKH A;  3HKB E;  4TV8 E;  2HPJ A;  3U78 A;  3ZMZ B;  4H63 V;  2XAS B;  2X68 A;  2X66 A;  1YW0 A;  3UUM A;  3Q9D A;  5J1G A;  1BR4 A;  4IE7 A;  4WW0 A;  4KBM B;  2MYS A;  2WSS V;  2WM9 A;  1HTJ F;  2LSG A;  1KNZ A;  4HGA A;  1MND A;  3ETU A;  2KND A;  4WBO A;  2KLQ A;  2PJQ A;  3C4X A;  4FJO A;  4GYS A;  4ILU A;  4TN7 B;  2K9A A;  2PG8 A;  5JDM A;  3F31 A;  5J2U E;  1ZEE A;  1OWA A;  2NOX A;  2BVM A;  1NWM X;  1SHZ C;  4CI3 B;  4GYR A;  3N9Q A;  3QC9 A;  2BDE A;  3HKD E;  3IEE A;  2D0T A;  3QK6 A;  3AA0 B;  4J2C A;  3OKQ A;  2JQQ A;  2ODV A;  3AVR A;  2PBI A;  2H7O A;  2A72 A;  4GK5 E;  5FXW A;  3LJC A;  4C91 A;  2WAU A;  1ZKE A;  4L9I A;  3PUR A;  3HA4 A;  3ZMT B;  5HXC A;  4HFV A;  2D2S A;  3C50 A;  3NBX X;  2RA1 A;  2LSY A;  4OHF A;  3ZN0 B;  3M65 A;  1U4Q A;  2JRK A;  3JC6 C;  1U5P A;  5KDM C;  1FIO A;  1B7T A;  1HFA A;  2V26 A;  5LBQ B;  4AKI A;  1NAF A;  4O8S A;  2XAQ B;  4QXC B;  4DVD A;  3ZC0 A;  2X51 A;  5JVD E;  3KV5 A;  4UF0 B;  2KWI B;  4UXN B;  3C4W A;  4PK6 A;  3GN5 B;  5EK4 A;  3O9X A;  2CMR A;  3ZMU B;  5JDN A;  2UXX B;  2VK9 A;  2CE7 A;  4PFO A;  1UX5 A;  3ZMV B;  5LJM A;  2CLY B;  2XAF B;  3N9O A;  4CQI A;  3U3I A;  5M4Y A;  1WYC A;  3IF8 B;  5ADX L;  4AQF A;  3O1H A;  4F6R C;  4U72 A;  2B1E A;  4MLK A;  3N9M A;  2N2N A;  4X1I E;  2V1D B;  3I0O A;  5LXT E;  5LG4 A;  4IGU A;  3RYI E;  3CVR A;  4TUY E;  1O3X A;  2Y8D A;  4TX5 A;  2X67 A;  1QUU A;  5FXX A;  3MXZ A;  1MIW A;  2J1D G;  2LOP A;  3BK9 A;  4PW8 A;  2YEV C;  3ETV A;  2WWU A;  2HPL A;  4AKR B;  2X9H A;  4TZ4 C;  3C4Z A;  3Q5W A;  4FI5 A;  4CI1 B;  4JUY A;  5JDG A;  4HTE A;  3EDV A;  4MBQ A;  4AI6 A;  4KP3 C;  1E1H B;  2LOS A;  2IW5 B;  2DHR A;  3PUG A;  4HEA A;  5IHY A;  3ZEF B;  1HCI A;  1FMW A;  2YK0 A;  2ZM2 A;  4H9P C;  4O4H E;  4ZI7 E;  1LRZ A;  3EUH A;  3HKC E;  5C8Y E;  3L09 A;  1HS7 A;  4P09 A;  4IIJ E;  3RRW A;  3WAK A;  4O2A E;  2E9X B;  5JR9 C;  2CA5 A;  4G2A A;  2XAJ B;  3D0T A;  4UVB B;  1VOM A;  2Y48 B;  1BR2 A;  2WBL A;  3DJB A;  2H3R A;  5EK2 A;  3WAJ A;  4BAY B;  3P8C D;  5DAB A;  2BZB A;  2KMF A;  3KDS E;  3QUJ A;  4G63 A;  1D1C A;  4QHO A;  3I9W A;  4YJ2 E;  4ERR A;  3N2K E;  3RH3 A;  3LK3 B;  5LCY A;  5F3J A;  1WR6 A;  4PFP A;  5CA0 E;  3JC6 D;  3ZYM A;  1H7C A;  3FBL A;  4IHJ E;  3E0Z A;  2KXP B;  2WMN A;  3SWH A;  2PFV A;  5LP6 E;  3LBX B;  3CML A;  2IC9 A;  5JDL A;  4AKH A;  5JQG E;  4O4J E;  1LKX A;  4YJ3 E;  2ODU A;  4JEU B;  4E7Z A;  5A1L A;  4XBF B;  4AXP A;  5ETW A;  4UV8 B;  1KK7 A;  4GOU A;  3PDY A;  4AKG A;  3SRZ A;  4A56 A;  2ES0 A;  3AA1 B;  2WMO A;  4PK5 A;  2NW7 A;  1LVK A;  1QSD A;  3KIN B;  4I50 E;  1S35 A;  4OK0 A;  3O4X E;  3MA9 A;  4QXB B;  4EOZ B;  5FY7 A;  4PK4 A;  5E0O A;  3UFE A;  2LJL A;  3AA6 B;  4UVA B;  5LOV E;  2V7I A;  4BA9 A;  5HYA A;  3E08 A;  1WRD A;  3A5X A;  3CWZ B;  3N9N A;  2XQY A;  4PAG A;  4PJN A;  4DO0 A;  5CB4 E;  2VKD A;  4UF0 A;  5EZY E;  3CX6 B;  5LBM A;  5JDF A;  2XTL A;  2EHO A;  2W0G A;  4EXT A;  3IBP A;  3ZJ1 A;  3I9Y A;  4IST A;  3V5U A;  3UUX B;  2DI4 A;  4H9N C;  2N9D A;  3CX7 B;  3PUQ A;  5L3E B;  1BR0 A;  3GMI A;  1MIY A;  2W63 A;  1IAP A;  2MTQ A;  3VHL A;  2ZLY A;  3UT5 E;  3GN5 A;  2N1G A;  2NW9 A;  5FY1 A;  3NZQ A;  3Q2M A;  3FB2 A;  2CEA A;  3OJA A;  5FMN A;  3FHN A;  5FP3 A;  2VKO A;  1Y64 B;  3NZP A;  4N78 D;  4DBR A;  1FMV A;  2V7J A;  5FYM A;  3LFM A;  3RKO A;  3K3O A;  3AB3 B;  2VL8 A;  5FNV E;  1T98 A;  2W62 A;  5FXZ A;  3MJX A;  4H9Q C;  5LA6 E;  3MK7 C;  1Z0P A;  1D1B A;  1OXZ A;  4UEM A;  5LHI B;  5LGT B;  1X79 A;  5LGN B;  5HXE A;  5JDQ A;  2XUE A;  5L3G B;  4UVC B;  3FXD B;  2SPC A;  2YU2 A;  3NRY A;  1HG2 A;  4GIW A;  3RPU A;  5L2L A;  5JDH A;  2JMH A;  2KT9 A;  4H9S E;  3ZMS B;  3Q5X A;  3ZYK A;  4MHC A;  2I59 A;  4OYK A;  2M67 A;  5LGU B;  3K3N A;  3KV9 A;  1UCU A;  4AQG A;  5CA1 E;  2IC6 A;  4X20 E;  3E22 E;  4I55 E;  2CXD A;  4ZI3 C;  3B13 A;  2CLY C;  3GWH A;  4X1Y E;  3UTK A;  3MZK B;  5H6R B;  3PTR B;  3ZN1 B;  4KMC A;  3RYH E;  4ZI2 D;  3WI3 A;  3KV4 A;  2KIN B;  4IDZ A;  5J2T E;  3HI2 A;  2MOZ A;  2V7M A;  4IE4 A;  3CQC B;  3ZJ2 A;  2X9W A;  2L9Q A;  3OBV E;  2VB6 A;  3LK4 2;  2K5B B;  1G8X A;  3HKE E;  2V7L A;  2QA7 A;  5DQV A;  3ZPO A;  3AA7 B;  5FY0 A;  4DMV A;  2XAG B;  3IHR A;  4P0B A;  4I43 B;  4YHJ A;  1IZN B;  4PJJ A;  2IAK A;  2YIN A;  2X9Y A;  2K48 A;  4B6X A;  3OYZ A;  1EZ3 A;  2CXF A;  4L0R A;  4O4I E;  3KVA A;  1FEW A;  2KZ7 B;  3PUA A;  3R6N A;  5JR9 B;  3SS1 A;  3B57 A;  2C0S A;  4MAL A;  4MFR A;  5L3D B;  2DLR A;  1UX4 A;  2XAH B;  2E9X A;  2Q9Q B;  5JRC A;  3ZCJ A;  4DMW A;  5HWX A;  4NUU A;  4OFZ A;  3TKL B;  1YD8 G;  3AVS A;  4ZHQ E;  3O1I A;  3CX8 B;  2Q9Q D;  5EK3 A;  2C5K T;  2VKH A;  4JLE A;  3C98 B;  4QX7 B;  3CKD A;  2RP4 A;  2L8K A;  3GA8 A;  3ZCI A;  4UV9 B;  2X9X A;  3SOL A;  3HR0 A;  2JJ9 A;  3HL6 A;  5LHG B;  1IJ5 A;  1G73 A;  2NTY A;  1D1A A;  3FXE B;  4EZH A;  4OYJ A;  4X1K E;  3DTO A;  4XZC A;  4Z8X A;  4ZI2 C;  3CQG B;  5LJN A;  1LVF A;  4C90 A;  1MIV A;  2NP9 A;  4QKN A;  1YKH B;  1MMD A;  3PU8 A;  2C5J A;  5KMG P;  4U74 A;  3RC3 A;  2XHE B;  3LG7 A;  2LHR A;  4IE0 A;  4L5G A;  3RX6 A;  2NTX A;  2NW8 A;  2EHO B;  4CZZ B;  3H37 A;  4H9O C;  5JRE A;  5HXR A;  5L3B B;  4PJL A;  5IYZ E;  2A3D A;  1ZHC A;  3EVY A;  5TAO A;  3MKD A;  4BJN A;  2Q9Q A;  3O1J A;  3PU3 A;  4EAH A;  3N9P A;  4BJM A;  3I0Q A;  3KBU A;  5HXH A;  4EYU A;  2EHO C;  2LT3 A;  1CUN A;  5FXV A;  3C64 A;  3KFW X;  3K8P C;  3UUL A;  1D0X A;  2DCF A;  4DBQ A;  3J9X 1;  3KBT A;  1D0Y A;  5H6Q B;  4JEH B;  3C51 A;  3RC8 A;  4TV9 E;  4YFS A;  1V9D A;  3K3Q C;  3LBX A;  4ADZ A;  4IE6 A;  2KWH A;  3ANW B;  5HAX A;  2LSJ A;  2W00 A;  3KV6 A;  5L3F B;  1HF8 A;  4DND A;  1MMN A;  4IE5 A;  1VRB A;  4H63 H;  3AAE B;  3ONX A;  3V5S A;  1ZV4 X;  4ASK A;  4KUM B;  2CXL A;  5BMV E;  4XAX B;  1WLX A;  4ZOL E;  3J7Y q;  1SA0 E;  4V1A v;  4I4T E;  5LHH B;  4CXY A;  2X0L B;  2VAS A;  2K24 A;  2CWY A;  2UXN B;  4CXW A;  2Q9Q C;  1MNE A;  3BQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...